5HM0A

Crystal structure of the first bromodomain of human brd4 bound to benzoisoxazoloazepine 3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a Benzoisoxazoloazepine Inhibitor (CPI-0610) of the Bromodomain and Extra-Terminal (BET) Family as a Candidate for Human Clinical Trials.
pubmed doi rcsb
molecule keywords Bromodomain-containing protein 4
molecule tags Transcription
source organism Homo sapiens
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5hm0A01
5EU1A 5A81A 2KTBB 4YBMA 4Z6HA 4NR9A 2F6JA 5HRVA 4BW2A 5D0CA 5I80A 3U5OA 3O34A 5DX4A 4LDFA 5FE4A 4ZW1A 4F3IA 4Z1QA 4MR6A 5L8UA 4O75A 4QZSA 5IIDA 5EICA 5I40A 3UVYA 4CURA 3P5OA 4ZQLA 5ENCA 5I88A 2WP2A 5E74A 5L97A 5CUEA 5CGPA 5FE0A 4YYDA 5CUBA 5DFBA 4TU4A 2N9GA 4LC2A 3UVXA 5II1A 5CFWA 5EPRA 4MEPA 3DAIA 3MB4A 5I7XA 5D3JA 5BT4A 5ENBA 5CQ5A 4O72A 5DW1A 4CFKA 5D26A 4QYDA 3MULA 4C66A 4UIYA 5CQ4A 4UIXA 4HXOA 4NR4A 5D24A 3U5JA 2R10A 3LJWA 5ENGA 4CL9A 3U5NA 1JM4B 3S91A 4LZRA 4QUUA 4KCXA 5EPBA 5C4QA 5A5SA 5HQ6A 3IU5A 4QC3A 1X0JA 4UYHA 5G4SA 3AQAA 4HBXA 5KTWA 5D3RA 5D7XA 4MEQA 4LZSA 3TLPA 4PS5A 4YBTA 5HQ7A 2RNXA 3LQIA 5E9KA 4PCIA 5DY7A 4AKNA 5D3LA 4OGJA 2DVRA 4N4IA 5BT5A 4O7CA 2WP1A 5DFDA 2YQDA 4IR4A 5HFRA 4YK0A 4QSRA 5HEMA 5IGMA 4TZ8A 5FFYA 4XUAA 4O74A 5DLXA 4Z93A 4XY8A 4QEWA 5CTLA 4A9NA 4O76A 5DYCA 5EWWA 3O36A 5ENEA 5E9MA 4ALGA 5F61A 4YY4A 4YYMA 5H1VA 2R0YA 4CLBA 4QSTA 4CUSA 4QSVA 3LXJA 4TYLA 4J1PA 5H1TA 3G0LA 3UV2A 5LVQA 5A83A 4YH4A 4N4HA 5CUDA 2E3KA 5JWMA 5KTUA 4A9OA 4OGIA 4QB3A 4HBYA 5CRMA 3I3JA 4QSPA 5CUAA 5FG5A 5ENIA 4IR6A 4NRAA 5CQ6A 2DKWA 1WUMA 5E73A 4A9HA 4XYAA 5EWHA 5E3GA 3P1DA 4BHWA 5FH8A 2DATA 4RVRA 4LZ2A 5CRZA 4YYHA 5IGKA 4LYSA 5EA1A 5E9LA 5CQAA 3MQMA 5AD3A 5L98A 4DONA 3UVDA 2DVSA 3O33A 3UV5A 2YELA 5IG6A 5A5NA 4MENA 4HXNA 4NYXA 4XY9A 5C87A 2RNYA 5IGNA 4LYIA 4TQNA 5E7DA 5CUCA 4TZ2A 2E7NA 5LKUA 1JSPB 3LQHA 4N3WA 4IOOA 5EISA 3UV4A 5II2A 4WHUA 5D25A 5FE2A 5HRXA 4Y03A 5CPEA 5E9YA 4BJXA 5JI8A 3P1CA 2RI7A 3SVHA 5BT3A 5ENJA 5F62A 5FFWA 3U5KA 2D82A 5F2PA 5H85A 3P1FA 4LYWA 4E96A 4UIWA 2R0VA 1EQFA 4CUUA 5F36A 5A82A 5D3TA 4QSUA 4WIVA 4A9MA 4CUTA 5C85A 4NRBA 5DKDA 2RFJA 5CQ7A 4YYJA 5COIA 5HM0A 3G0JA 3HMHA 2YW5A 5DYXA 5D3SA 3SVFA 5EVAA 4HXLA 5F1HA 4ALHA 5A5OA 5FFVA 4YH3A 5EK9A 5CQ8A 5C8GA 3MUKA 2OO1A 5CY9A 5D3HA 5DBMA 5FE8A 3UW9A 4QR3A 2GRCA 4WHWA 4YYIA 3JVKA 4QSXA 4BW1A 2MJVB 5F63A 2E7OA 4GPJA 5A5QA 4NR6A 4QEVA 4YAXA 4YYKA 4YYGA 5A7CA 4QSWA 4OUFA 2YYNA 4A9JA 4Z6IA 5L96A 2RS9B 4IORA 4UIVA 2OUOA 5F3AA 5FB0A 4A9IA 5FE1A 4J3IA 5J0DA 5LKTA 4UYGA 2NXBA 4PY6A 3NXBA 4NUCA 4YBSA 4IR3A 4CUQA 2I7KA 5KU3A 4J0RA 3U5PA 4TU6A 4NYWA 5FG4A 2I8NA 4Q0NA 4QEUA 4UYEA 4KV4A 5I83A 5LKZA 4QC1A 4IR5A 4O7FA 4PKLA 5AMFA 4NQNA 5AMEA 5FBXA 5C7NA 4PCEA 3K2JA 4NQMA 5EPSA 5I7YA 5ETDA 3UVWA 3QZVA 1E6IA 5HELA 4MEOA 3Q2EA 4C67A 3S92A 2D9EA 4O71A 4MR5A 3ONIA 4O70A 1N72A 3O37A 4FLPA 4PTBA 5EI4A 4CUPA 3JVLA 4UYFB 3JVJA 4NR5A 3U5LA 5HLSA 4BW4A 4CFLA 5CUGA 5CP5A 5A5PA 5DFCA 2DWWA 2F6NA 4HXMA 5FH6A 4UITA 4NYVA 4Z1SA 5HQ5A 5ENFA 2FSAA 4N4FA 4X2IA 5DKCA 1F68A 5D3NA 4A9LA 4TT6A 5KTXA 3JVMA 5DYUA 5KHMA 4J0SA 4ZC9A 5F1LA 4NRCA 2YDWA 5TB6A 4MR3A 5LUUA 4A9KA 4QSSA 4QR4A 5A5RA 4Q0OA 3O35A 5HENA 4NXJA 5ETBA 5I1QA 5FE5A 4QSQA 3HMFA 5KO4A 2YEMA 5FDZA 5HRWA 2L84A 4NUEA 4NR7A 3HMEA 5F5ZA 4YY6A 5EWDA 4HBWA 4QBMA 5FE3A 4YADA 5IGLA 4O77A 4NS5A 5A85A 4UIUA 4O78A 4YYNA 5ACYA 4NR8A 5FE7A 5LKXA 4HXPA 5AD2A 3ZYUA 5IBNA 4YABA 5LVRA 3RCWA 4HXSA 4HXKA 5FB1A 5EM3A 5FE9A 2OSSA 3MB3A 5CQ3A 2RO1A 5E3DA 5LJ0A 4LR6A 4UIZA 5E0RA 5LJ1A 5TCMA 2L5EA 4TTEA 3DWYA 4HXRA 5HJCA 5EGUA 3IU6A 5EWVA 4QYLA 4MR4A 5L99A 1WUGA 2RNWA 4O7AA 4TS8A 4O7BA 5D3PA 5G4RA 5FH7A 4TT2A 2LSPB 3MXFA 5DW2A 4NUDA 5EQ1A 3GG3A 4HBVA 4KV1A 4QR5A 5E9IA 2R0SA 4LRGA 3QZSA 3QZTA 5CQTA 2G4AA 5ENHA 5DKHA 5LJ2A 4IOQA 5CU8A 4YATA 3SVGA 3AADA 5I89A 4QNSA 2L85A 4UYFA 5CS8A 2YEKA 2DVVA 5FE6A 4A9FA 5CZGA 3D7CA 3P1EA 5EV9A 1ZS5A 4UYDA 5HFQA 5F60A 5EWCA 4TT4A 2DVQA 4XUBA 4O7EA 5C89A 5DYAA 4QY4A 5L8TA 3U5MA 4A9EA 3LQJA 5K29A 4BW3A 4QUTA 5EP7A 5HCLA 5FG6A 4N4GA 3Q2FA 5E9VA 5F25A 5H1UA 2H60A 5I29A 3FKMX 5DLZA 4YC9A 5I86A
chains in the Genus database with same CATH superfamily
5EU1A 5A81A 2KTBB 4YBMA 4Z6HA 4NR9A 2F6JA 5HRVA 4BW2A 5D0CA 5I80A 3U5OA 3O34A 5DX4A 4LDFA 5FE4A 4ZW1A 4F3IA 4Z1QA 4MR6A 5L8UA 4O75A 4QZSA 5IIDA 5EICA 5I40A 3UVYA 4CURA 3P5OA 4ZQLA 5ENCA 5I88A 2WP2A 5E74A 5L97A 5CUEA 5CGPA 5FE0A 4YYDA 5CUBA 5DFBA 4TU4A 2N9GA 4LC2A 3UVXA 5II1A 5CFWA 5EPRA 4MEPA 3DAIA 3MB4A 5I7XA 5D3JA 5BT4A 5ENBA 5CQ5A 4O72A 5DW1A 4CFKA 5D26A 4QYDA 3MULA 4C66A 4UIYA 5CQ4A 4UIXA 4HXOA 4NR4A 5D24A 3U5JA 2R10A 3LJWA 5ENGA 4CL9A 3U5NA 1JM4B 3S91A 4LZRA 4QUUA 4KCXA 5EPBA 5C4QA 5A5SA 5HQ6A 3IU5A 4QC3A 1X0JA 4UYHA 5G4SA 3ERRA 3AQAA 4HBXA 5KTWA 5D3RA 5D7XA 4MEQA 4LZSA 3TLPA 4PS5A 4YBTA 5HQ7A 2RNXA 3LQIA 5E9KA 4PCIA 5DY7A 4AKNA 5D3LA 4OGJA 2DVRA 4N4IA 5BT5A 4O7CA 2WP1A 5DFDA 2YQDA 4IR4A 5HFRA 4YK0A 4QSRA 5HEMA 5IGMA 4TZ8A 5FFYA 4XUAA 4O74A 5DLXA 4Z93A 4XY8A 4QEWA 5CTLA 4A9NA 4O76A 5DYCA 5EWWA 3O36A 5ENEA 5E9MA 4ALGA 5F61A 4YY4A 4YYMA 5H1VA 2R0YA 4CLBA 4QSTA 4CUSA 4QSVA 3LXJA 4TYLA 4J1PA 5H1TA 3G0LA 3UV2A 5LVQA 5A83A 4YH4A 4N4HA 5CUDA 2E3KA 5JWMA 5KTUA 4A9OA 4OGIA 4QB3A 4HBYA 5CRMA 3I3JA 4QSPA 5CUAA 5FG5A 5ENIA 4IR6A 4NRAA 5CQ6A 2DKWA 1WUMA 5E73A 4A9HA 4XYAA 5EWHA 5E3GA 3P1DA 4BHWA 5FH8A 2DATA 4RVRA 4LZ2A 5CRZA 4YYHA 5IGKA 4LYSA 5EA1A 5E9LA 5CQAA 3MQMA 5AD3A 5L98A 4DONA 3UVDA 2DVSA 3O33A 3UV5A 2YELA 5IG6A 5A5NA 4MENA 4HXNA 4NYXA 4XY9A 5C87A 2RNYA 5IGNA 4LYIA 4TQNA 5E7DA 5CUCA 4AKGA 4TZ2A 2E7NA 5LKUA 1JSPB 3LQHA 4N3WA 4IOOA 5EISA 3UV4A 5II2A 4WHUA 5D25A 5FE2A 5HRXA 4Y03A 5CPEA 5E9YA 4BJXA 5JI8A 3P1CA 2RI7A 3SVHA 5BT3A 5ENJA 5F62A 5FFWA 3U5KA 2D82A 5F2PA 5H85A 3P1FA 4LYWA 4E96A 4UIWA 4AKHA 2R0VA 1EQFA 4CUUA 5F36A 5A82A 5D3TA 4QSUA 4WIVA 4A9MA 4CUTA 5C85A 4NRBA 5DKDA 2RFJA 5CQ7A 4YYJA 5COIA 5HM0A 3G0JA 3HMHA 2YW5A 5DYXA 5D3SA 3SVFA 5EVAA 4HXLA 5F1HA 4ALHA 5A5OA 5FFVA 4YH3A 5EK9A 5CQ8A 5C8GA 3MUKA 2OO1A 5CY9A 5D3HA 5DBMA 5FE8A 3UW9A 4QR3A 2GRCA 4WHWA 4YYIA 3JVKA 4QSXA 4BW1A 2MJVB 5F63A 2E7OA 4GPJA 5A5QA 4NR6A 4QEVA 4YAXA 4YYKA 4YYGA 5A7CA 4QSWA 4OUFA 2YYNA 4A9JA 4Z6IA 5L96A 2RS9B 4IORA 4UIVA 2OUOA 5F3AA 5FB0A 4A9IA 5FE1A 4J3IA 5J0DA 5LKTA 4UYGA 2NXBA 4PY6A 3NXBA 4NUCA 4YBSA 4IR3A 4CUQA 2EJNA 2I7KA 5KU3A 4J0RA 3U5PA 4TU6A 4NYWA 5FG4A 2I8NA 4Q0NA 4QEUA 4UYEA 4KV4A 5I83A 5LKZA 4QC1A 4IR5A 4O7FA 1PUOA 4PKLA 5AMFA 4NQNA 5AMEA 5FBXA 5C7NA 4PCEA 3K2JA 4NQMA 5EPSA 5I7YA 5ETDA 3UVWA 3QZVA 1E6IA 5HELA 4MEOA 3Q2EA 4C67A 3S92A 2D9EA 4O71A 4MR5A 3ONIA 4O70A 1N72A 3O37A 4FLPA 4PTBA 5EI4A 3VKGA 4CUPA 3JVLA 4UYFB 3JVJA 4NR5A 3U5LA 5HLSA 4BW4A 4CFLA 5CUGA 4AKIA 5CP5A 5A5PA 5DFCA 2DWWA 2F6NA 4HXMA 5FH6A 4UITA 4NYVA 4Z1SA 5HQ5A 5ENFA 2FSAA 4N4FA 4X2IA 5DKCA 1F68A 5D3NA 4A9LA 4TT6A 5KTXA 1ZKRA 3JVMA 5DYUA 5KHMA 4J0SA 4ZC9A 5F1LA 4NRCA 2YDWA 5TB6A 4MR3A 5LUUA 4A9KA 4QSSA 4QR4A 3VKHA 5A5RA 4Q0OA 3O35A 3D1BA 5HENA 4NXJA 5ETBA 5I1QA 5FE5A 4QSQA 3HMFA 5KO4A 2YEMA 5FDZA 5HRWA 2L84A 4NUEA 4NR7A 3HMEA 5F5ZA 4YY6A 5EWDA 4HBWA 4QBMA 5FE3A 4YADA 5IGLA 4O77A 4NS5A 5A85A 4UIUA 4O78A 4YYNA 5ACYA 4NR8A 5FE7A 5LKXA 4HXPA 5AD2A 3ZYUA 5IBNA 4YABA 5LVRA 3RCWA 4HXSA 4HXKA 5FB1A 5EM3A 5FE9A 2OSSA 3MB3A 5CQ3A 2RO1A 5E3DA 5LJ0A 4LR6A 4UIZA 5E0RA 5LJ1A 5TCMA 2L5EA 4TTEA 3DWYA 4HXRA 5HJCA 5EGUA 3IU6A 5EWVA 4QYLA 4MR4A 5L99A 1WUGA 2RNWA 4O7AA 4TS8A 4O7BA 5D3PA 5G4RA 5FH7A 4TT2A 2LSPB 3MXFA 5DW2A 4AI6A 4NUDA 5EQ1A 3GG3A 4HBVA 4KV1A 4QR5A 5E9IA 2R0SA 4LRGA 3QZSA 3QZTA 5CQTA 2G4AA 5ENHA 5DKHA 5LJ2A 4IOQA 5CU8A 4YATA 3SVGA 3AADA 5I89A 4QNSA 2L85A 4UYFA 5CS8A 2YEKA 2DVVA 5FE6A 4A9FA 5CZGA 3D1DA 3D7CA 3P1EA 5EV9A 1ZS5A 4UYDA 5HFQA 5F60A 5EWCA 4TT4A 2DVQA 4XUBA 4O7EA 5C89A 5DYAA 4QY4A 5L8TA 3U5MA 4A9EA 3LQJA 5K29A 4BW3A 4QUTA 5EP7A 5HCLA 5FG6A 4N4GA 3Q2FA 5E9VA 5F25A 5H1UA 2H60A 5I29A 3FKMX 5DLZA 4YC9A 5I86A
chains in the Genus database with same CATH topology
5EU1A 5A81A 2KTBB 4YBMA 4Z6HA 4NR9A 2F6JA 5HRVA 4BW2A 5D0CA 5I80A 3U5OA 3O34A 5DX4A 4LDFA 5FE4A 4ZW1A 4F3IA 4Z1QA 4MR6A 5L8UA 4O75A 4QZSA 5IIDA 5EICA 5I40A 3UVYA 4CURA 3P5OA 4ZQLA 5ENCA 5I88A 2WP2A 5E74A 5L97A 5CUEA 5CGPA 5FE0A 4YYDA 5CUBA 5DFBA 4TU4A 2N9GA 4LC2A 3UVXA 5II1A 5CFWA 5EPRA 4MEPA 3DAIA 3MB4A 5I7XA 5D3JA 5BT4A 5ENBA 5CQ5A 4O72A 5DW1A 4CFKA 5D26A 4QYDA 3MULA 4C66A 4UIYA 5CQ4A 4UIXA 4HXOA 4NR4A 5D24A 3U5JA 2R10A 3LJWA 5ENGA 4CL9A 3U5NA 1JM4B 3S91A 4LZRA 4QUUA 4KCXA 5EPBA 5C4QA 5A5SA 5HQ6A 3IU5A 4QC3A 1X0JA 4UYHA 5G4SA 3AQAA 4HBXA 5KTWA 5D3RA 5D7XA 4MEQA 4LZSA 3TLPA 4PS5A 4YBTA 5HQ7A 2RNXA 3LQIA 5E9KA 4PCIA 5DY7A 4AKNA 5D3LA 4OGJA 2DVRA 4N4IA 5BT5A 4O7CA 2WP1A 5DFDA 2YQDA 4IR4A 5HFRA 4YK0A 4QSRA 5HEMA 5IGMA 4TZ8A 5FFYA 4XUAA 4O74A 5DLXA 4Z93A 4XY8A 4QEWA 5CTLA 4A9NA 4O76A 5DYCA 5EWWA 3O36A 5ENEA 5E9MA 4ALGA 5F61A 4YY4A 4YYMA 5H1VA 2R0YA 4CLBA 4QSTA 4CUSA 4QSVA 3LXJA 4TYLA 4J1PA 5H1TA 3G0LA 3UV2A 5LVQA 5A83A 4YH4A 4N4HA 5CUDA 2E3KA 5JWMA 5KTUA 4A9OA 4OGIA 4QB3A 4HBYA 5CRMA 3I3JA 4QSPA 5CUAA 5FG5A 5ENIA 4IR6A 4NRAA 5CQ6A 2DKWA 1WUMA 5E73A 4A9HA 4XYAA 5EWHA 5E3GA 3P1DA 4BHWA 5FH8A 2DATA 4RVRA 4LZ2A 5CRZA 4YYHA 5IGKA 4LYSA 5EA1A 5E9LA 5CQAA 3MQMA 5AD3A 5L98A 4DONA 3UVDA 2DVSA 3O33A 3UV5A 2YELA 5IG6A 5A5NA 4MENA 4HXNA 4NYXA 4XY9A 5C87A 2RNYA 5IGNA 4LYIA 4TQNA 5E7DA 5CUCA 4TZ2A 2E7NA 5LKUA 1JSPB 3LQHA 4N3WA 4IOOA 5EISA 3UV4A 5II2A 4WHUA 5D25A 5FE2A 5HRXA 4Y03A 5CPEA 5E9YA 4BJXA 5JI8A 3P1CA 2RI7A 3SVHA 5BT3A 5ENJA 5F62A 5FFWA 3U5KA 2D82A 5F2PA 5H85A 3P1FA 4LYWA 4E96A 4UIWA 2R0VA 1EQFA 4CUUA 5F36A 5A82A 5D3TA 4QSUA 4WIVA 4A9MA 4CUTA 5C85A 4NRBA 5DKDA 2RFJA 5CQ7A 4YYJA 5COIA 5HM0A 3G0JA 3HMHA 2YW5A 5DYXA 5D3SA 3SVFA 5EVAA 4HXLA 5F1HA 4ALHA 5A5OA 5FFVA 4YH3A 5EK9A 5CQ8A 5C8GA 3MUKA 2OO1A 5CY9A 5D3HA 5DBMA 5FE8A 3UW9A 4QR3A 2GRCA 4WHWA 4YYIA 3JVKA 4QSXA 4BW1A 2MJVB 5F63A 2E7OA 4GPJA 5A5QA 4NR6A 4QEVA 4YAXA 4YYKA 4YYGA 5A7CA 4QSWA 4OUFA 2YYNA 4A9JA 4Z6IA 5L96A 2RS9B 4IORA 4UIVA 2OUOA 5F3AA 5FB0A 4A9IA 5FE1A 4J3IA 5J0DA 5LKTA 4UYGA 2NXBA 4PY6A 3NXBA 4NUCA 4YBSA 4IR3A 4CUQA 2I7KA 5KU3A 4J0RA 3U5PA 4TU6A 4NYWA 5FG4A 2I8NA 4Q0NA 4QEUA 4UYEA 4KV4A 5I83A 5LKZA 4QC1A 4IR5A 4O7FA 4PKLA 5AMFA 4NQNA 5AMEA 5FBXA 5C7NA 4PCEA 3K2JA 4NQMA 5EPSA 5I7YA 5ETDA 3UVWA 3QZVA 1E6IA 5HELA 4MEOA 3Q2EA 4C67A 3S92A 2D9EA 4O71A 4MR5A 3ONIA 4O70A 1N72A 3O37A 4FLPA 4PTBA 5EI4A 4CUPA 3JVLA 4UYFB 3JVJA 4NR5A 3U5LA 5HLSA 4BW4A 4CFLA 5CUGA 5CP5A 5A5PA 5DFCA 2DWWA 2F6NA 4HXMA 5FH6A 4UITA 4NYVA 4Z1SA 5HQ5A 5ENFA 2FSAA 4N4FA 4X2IA 5DKCA 1F68A 5D3NA 4A9LA 4TT6A 5KTXA 3JVMA 5DYUA 5KHMA 4J0SA 4ZC9A 5F1LA 4NRCA 2YDWA 5TB6A 4MR3A 5LUUA 4A9KA 4QSSA 4QR4A 5A5RA 4Q0OA 3O35A 5HENA 4NXJA 5ETBA 5I1QA 5FE5A 4QSQA 3HMFA 5KO4A 2YEMA 5FDZA 5HRWA 2L84A 4NUEA 4NR7A 3HMEA 5F5ZA 4YY6A 5EWDA 4HBWA 4QBMA 5FE3A 4YADA 5IGLA 4O77A 4NS5A 5A85A 4UIUA 4O78A 4YYNA 5ACYA 4NR8A 5FE7A 5LKXA 4HXPA 5AD2A 3ZYUA 5IBNA 4YABA 5LVRA 3RCWA 4HXSA 4HXKA 5FB1A 5EM3A 5FE9A 2OSSA 3MB3A 5CQ3A 2RO1A 5E3DA 5LJ0A 4LR6A 4UIZA 5E0RA 5LJ1A 5TCMA 2L5EA 4TTEA 3DWYA 4HXRA 5HJCA 5EGUA 3IU6A 5EWVA 4QYLA 4MR4A 5L99A 1WUGA 2RNWA 4O7AA 4TS8A 4O7BA 5D3PA 5G4RA 5FH7A 4TT2A 2LSPB 3MXFA 5DW2A 4NUDA 5EQ1A 3GG3A 4HBVA 4KV1A 4QR5A 5E9IA 2R0SA 4LRGA 3QZSA 3QZTA 5CQTA 2G4AA 5ENHA 5DKHA 5LJ2A 4IOQA 5CU8A 4YATA 3SVGA 3AADA 5I89A 4QNSA 2L85A 4UYFA 5CS8A 2YEKA 2DVVA 5FE6A 4A9FA 5CZGA 3D7CA 3P1EA 5EV9A 1ZS5A 4UYDA 5HFQA 5F60A 5EWCA 4TT4A 2DVQA 4XUBA 4O7EA 5C89A 5DYAA 4QY4A 5L8TA 3U5MA 4A9EA 3LQJA 5K29A 4BW3A 4QUTA 5EP7A 5HCLA 5FG6A 4N4GA 3Q2FA 5E9VA 5F25A 5H1UA 2H60A 5I29A 3FKMX 5DLZA 4YC9A 5I86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EU1 A;  5A81 A;  2KTB B;  4YBM A;  4Z6H A;  4NR9 A;  2F6J A;  5HRV A;  4BW2 A;  5D0C A;  5I80 A;  3U5O A;  3O34 A;  5DX4 A;  4LDF A;  5FE4 A;  4ZW1 A;  4F3I A;  4Z1Q A;  4MR6 A;  5L8U A;  4O75 A;  4QZS A;  5IID A;  5EIC A;  5I40 A;  3UVY A;  4CUR A;  3P5O A;  4ZQL A;  5ENC A;  5I88 A;  2WP2 A;  5E74 A;  5L97 A;  5CUE A;  5CGP A;  5FE0 A;  4YYD A;  5CUB A;  5DFB A;  4TU4 A;  2N9G A;  4LC2 A;  3UVX A;  5II1 A;  5CFW A;  5EPR A;  4MEP A;  3DAI A;  3MB4 A;  5I7X A;  5D3J A;  5BT4 A;  5ENB A;  5CQ5 A;  4O72 A;  5DW1 A;  4CFK A;  5D26 A;  4QYD A;  3MUL A;  4C66 A;  4UIY A;  5CQ4 A;  4UIX A;  4HXO A;  4NR4 A;  5D24 A;  3U5J A;  2R10 A;  3LJW A;  5ENG A;  4CL9 A;  3U5N A;  1JM4 B;  3S91 A;  4LZR A;  4QUU A;  4KCX A;  5EPB A;  5C4Q A;  5A5S A;  5HQ6 A;  3IU5 A;  4QC3 A;  1X0J A;  4UYH A;  5G4S A;  3AQA A;  4HBX A;  5KTW A;  5D3R A;  5D7X A;  4MEQ A;  4LZS A;  3TLP A;  4PS5 A;  4YBT A;  5HQ7 A;  2RNX A;  3LQI A;  5E9K A;  4PCI A;  5DY7 A;  4AKN A;  5D3L A;  4OGJ A;  2DVR A;  4N4I A;  5BT5 A;  4O7C A;  2WP1 A;  5DFD A;  2YQD A;  4IR4 A;  5HFR A;  4YK0 A;  4QSR A;  5HEM A;  5IGM A;  4TZ8 A;  5FFY A;  4XUA A;  4O74 A;  5DLX A;  4Z93 A;  4XY8 A;  4QEW A;  5CTL A;  4A9N A;  4O76 A;  5DYC A;  5EWW A;  3O36 A;  5ENE A;  5E9M A;  4ALG A;  5F61 A;  4YY4 A;  4YYM A;  5H1V A;  2R0Y A;  4CLB A;  4QST A;  4CUS A;  4QSV A;  3LXJ A;  4TYL A;  4J1P A;  5H1T A;  3G0L A;  3UV2 A;  5LVQ A;  5A83 A;  4YH4 A;  4N4H A;  5CUD A;  2E3K A;  5JWM A;  5KTU A;  4A9O A;  4OGI A;  4QB3 A;  4HBY A;  5CRM A;  3I3J A;  4QSP A;  5CUA A;  5FG5 A;  5ENI A;  4IR6 A;  4NRA A;  5CQ6 A;  2DKW A;  1WUM A;  5E73 A;  4A9H A;  4XYA A;  5EWH A;  5E3G A;  3P1D A;  4BHW A;  5FH8 A;  2DAT A;  4RVR A;  4LZ2 A;  5CRZ A;  4YYH A;  5IGK A;  4LYS A;  5EA1 A;  5E9L A;  5CQA A;  3MQM A;  5AD3 A;  5L98 A;  4DON A;  3UVD A;  2DVS A;  3O33 A;  3UV5 A;  2YEL A;  5IG6 A;  5A5N A;  4MEN A;  4HXN A;  4NYX A;  4XY9 A;  5C87 A;  2RNY A;  5IGN A;  4LYI A;  4TQN A;  5E7D A;  5CUC A;  4TZ2 A;  2E7N A;  5LKU A;  1JSP B;  3LQH A;  4N3W A;  4IOO A;  5EIS A;  3UV4 A;  5II2 A;  4WHU A;  5D25 A;  5FE2 A;  5HRX A;  4Y03 A;  5CPE A;  5E9Y A;  4BJX A;  5JI8 A;  3P1C A;  2RI7 A;  3SVH A;  5BT3 A;  5ENJ A;  5F62 A;  5FFW A;  3U5K A;  2D82 A;  5F2P A;  5H85 A;  3P1F A;  4LYW A;  4E96 A;  4UIW A;  2R0V A;  1EQF A;  4CUU A;  5F36 A;  5A82 A;  5D3T A;  4QSU A;  4WIV A;  4A9M A;  4CUT A;  5C85 A;  4NRB A;  5DKD A;  2RFJ A;  5CQ7 A;  4YYJ A;  5COI A;  5HM0 A;  3G0J A;  3HMH A;  2YW5 A;  5DYX A;  5D3S A;  3SVF A;  5EVA A;  4HXL A;  5F1H A;  4ALH A;  5A5O A;  5FFV A;  4YH3 A;  5EK9 A;  5CQ8 A;  5C8G A;  3MUK A;  2OO1 A;  5CY9 A;  5D3H A;  5DBM A;  5FE8 A;  3UW9 A;  4QR3 A;  2GRC A;  4WHW A;  4YYI A;  3JVK A;  4QSX A;  4BW1 A;  2MJV B;  5F63 A;  2E7O A;  4GPJ A;  5A5Q A;  4NR6 A;  4QEV A;  4YAX A;  4YYK A;  4YYG A;  5A7C A;  4QSW A;  4OUF A;  2YYN A;  4A9J A;  4Z6I A;  5L96 A;  2RS9 B;  4IOR A;  4UIV A;  2OUO A;  5F3A A;  5FB0 A;  4A9I A;  5FE1 A;  4J3I A;  5J0D A;  5LKT A;  4UYG A;  2NXB A;  4PY6 A;  3NXB A;  4NUC A;  4YBS A;  4IR3 A;  4CUQ A;  2I7K A;  5KU3 A;  4J0R A;  3U5P A;  4TU6 A;  4NYW A;  5FG4 A;  2I8N A;  4Q0N A;  4QEU A;  4UYE A;  4KV4 A;  5I83 A;  5LKZ A;  4QC1 A;  4IR5 A;  4O7F A;  4PKL A;  5AMF A;  4NQN A;  5AME A;  5FBX A;  5C7N A;  4PCE A;  3K2J A;  4NQM A;  5EPS A;  5I7Y A;  5ETD A;  3UVW A;  3QZV A;  1E6I A;  5HEL A;  4MEO A;  3Q2E A;  4C67 A;  3S92 A;  2D9E A;  4O71 A;  4MR5 A;  3ONI A;  4O70 A;  1N72 A;  3O37 A;  4FLP A;  4PTB A;  5EI4 A;  4CUP A;  3JVL A;  4UYF B;  3JVJ A;  4NR5 A;  3U5L A;  5HLS A;  4BW4 A;  4CFL A;  5CUG A;  5CP5 A;  5A5P A;  5DFC A;  2DWW A;  2F6N A;  4HXM A;  5FH6 A;  4UIT A;  4NYV A;  4Z1S A;  5HQ5 A;  5ENF A;  2FSA A;  4N4F A;  4X2I A;  5DKC A;  1F68 A;  5D3N A;  4A9L A;  4TT6 A;  5KTX A;  3JVM A;  5DYU A;  5KHM A;  4J0S A;  4ZC9 A;  5F1L A;  4NRC A;  2YDW A;  5TB6 A;  4MR3 A;  5LUU A;  4A9K A;  4QSS A;  4QR4 A;  5A5R A;  4Q0O A;  3O35 A;  5HEN A;  4NXJ A;  5ETB A;  5I1Q A;  5FE5 A;  4QSQ A;  3HMF A;  5KO4 A;  2YEM A;  5FDZ A;  5HRW A;  2L84 A;  4NUE A;  4NR7 A;  3HME A;  5F5Z A;  4YY6 A;  5EWD A;  4HBW A;  4QBM A;  5FE3 A;  4YAD A;  5IGL A;  4O77 A;  4NS5 A;  5A85 A;  4UIU A;  4O78 A;  4YYN A;  5ACY A;  4NR8 A;  5FE7 A;  5LKX A;  4HXP A;  5AD2 A;  3ZYU A;  5IBN A;  4YAB A;  5LVR A;  3RCW A;  4HXS A;  4HXK A;  5FB1 A;  5EM3 A;  5FE9 A;  2OSS A;  3MB3 A;  5CQ3 A;  2RO1 A;  5E3D A;  5LJ0 A;  4LR6 A;  4UIZ A;  5E0R A;  5LJ1 A;  5TCM A;  2L5E A;  4TTE A;  3DWY A;  4HXR A;  5HJC A;  5EGU A;  3IU6 A;  5EWV A;  4QYL A;  4MR4 A;  5L99 A;  1WUG A;  2RNW A;  4O7A A;  4TS8 A;  4O7B A;  5D3P A;  5G4R A;  5FH7 A;  4TT2 A;  2LSP B;  3MXF A;  5DW2 A;  4NUD A;  5EQ1 A;  3GG3 A;  4HBV A;  4KV1 A;  4QR5 A;  5E9I A;  2R0S A;  4LRG A;  3QZS A;  3QZT A;  5CQT A;  2G4A A;  5ENH A;  5DKH A;  5LJ2 A;  4IOQ A;  5CU8 A;  4YAT A;  3SVG A;  3AAD A;  5I89 A;  4QNS A;  2L85 A;  4UYF A;  5CS8 A;  2YEK A;  2DVV A;  5FE6 A;  4A9F A;  5CZG A;  3D7C A;  3P1E A;  5EV9 A;  1ZS5 A;  4UYD A;  5HFQ A;  5F60 A;  5EWC A;  4TT4 A;  2DVQ A;  4XUB A;  4O7E A;  5C89 A;  5DYA A;  4QY4 A;  5L8T A;  3U5M A;  4A9E A;  3LQJ A;  5K29 A;  4BW3 A;  4QUT A;  5EP7 A;  5HCL A;  5FG6 A;  4N4G A;  3Q2F A;  5E9V A;  5F25 A;  5H1U A;  2H60 A;  5I29 A;  3FKM X;  5DLZ A;  4YC9 A;  5I86 A; 
#chains in the Genus database with same CATH topology
 5EU1 A;  5A81 A;  2KTB B;  4YBM A;  4Z6H A;  4NR9 A;  2F6J A;  5HRV A;  4BW2 A;  5D0C A;  5I80 A;  3U5O A;  3O34 A;  5DX4 A;  4LDF A;  5FE4 A;  4ZW1 A;  4F3I A;  4Z1Q A;  4MR6 A;  5L8U A;  4O75 A;  4QZS A;  5IID A;  5EIC A;  5I40 A;  3UVY A;  4CUR A;  3P5O A;  4ZQL A;  5ENC A;  5I88 A;  2WP2 A;  5E74 A;  5L97 A;  5CUE A;  5CGP A;  5FE0 A;  4YYD A;  5CUB A;  5DFB A;  4TU4 A;  2N9G A;  4LC2 A;  3UVX A;  5II1 A;  5CFW A;  5EPR A;  4MEP A;  3DAI A;  3MB4 A;  5I7X A;  5D3J A;  5BT4 A;  5ENB A;  5CQ5 A;  4O72 A;  5DW1 A;  4CFK A;  5D26 A;  4QYD A;  3MUL A;  4C66 A;  4UIY A;  5CQ4 A;  4UIX A;  4HXO A;  4NR4 A;  5D24 A;  3U5J A;  2R10 A;  3LJW A;  5ENG A;  4CL9 A;  3U5N A;  1JM4 B;  3S91 A;  4LZR A;  4QUU A;  4KCX A;  5EPB A;  5C4Q A;  5A5S A;  5HQ6 A;  3IU5 A;  4QC3 A;  1X0J A;  4UYH A;  5G4S A;  3ERR A;  3AQA A;  4HBX A;  5KTW A;  5D3R A;  5D7X A;  4MEQ A;  4LZS A;  3TLP A;  4PS5 A;  4YBT A;  5HQ7 A;  2RNX A;  3LQI A;  5E9K A;  4PCI A;  5DY7 A;  4AKN A;  5D3L A;  4OGJ A;  2DVR A;  4N4I A;  5BT5 A;  4O7C A;  2WP1 A;  5DFD A;  2YQD A;  4IR4 A;  5HFR A;  4YK0 A;  4QSR A;  5HEM A;  5IGM A;  4TZ8 A;  5FFY A;  4XUA A;  4O74 A;  5DLX A;  4Z93 A;  4XY8 A;  4QEW A;  5CTL A;  4A9N A;  4O76 A;  5DYC A;  5EWW A;  3O36 A;  5ENE A;  5E9M A;  4ALG A;  5F61 A;  4YY4 A;  4YYM A;  5H1V A;  2R0Y A;  4CLB A;  4QST A;  4CUS A;  4QSV A;  3LXJ A;  4TYL A;  4J1P A;  5H1T A;  3G0L A;  3UV2 A;  5LVQ A;  5A83 A;  4YH4 A;  4N4H A;  5CUD A;  2E3K A;  5JWM A;  5KTU A;  4A9O A;  4OGI A;  4QB3 A;  4HBY A;  5CRM A;  3I3J A;  4QSP A;  5CUA A;  5FG5 A;  5ENI A;  4IR6 A;  4NRA A;  5CQ6 A;  2DKW A;  1WUM A;  5E73 A;  4A9H A;  4XYA A;  5EWH A;  5E3G A;  3P1D A;  4BHW A;  5FH8 A;  2DAT A;  4RVR A;  4LZ2 A;  5CRZ A;  4YYH A;  5IGK A;  4LYS A;  5EA1 A;  5E9L A;  5CQA A;  3MQM A;  5AD3 A;  5L98 A;  4DON A;  3UVD A;  2DVS A;  3O33 A;  3UV5 A;  2YEL A;  5IG6 A;  5A5N A;  4MEN A;  4HXN A;  4NYX A;  4XY9 A;  5C87 A;  2RNY A;  5IGN A;  4LYI A;  4TQN A;  5E7D A;  5CUC A;  4AKG A;  4TZ2 A;  2E7N A;  5LKU A;  1JSP B;  3LQH A;  4N3W A;  4IOO A;  5EIS A;  3UV4 A;  5II2 A;  4WHU A;  5D25 A;  5FE2 A;  5HRX A;  4Y03 A;  5CPE A;  5E9Y A;  4BJX A;  5JI8 A;  3P1C A;  2RI7 A;  3SVH A;  5BT3 A;  5ENJ A;  5F62 A;  5FFW A;  3U5K A;  2D82 A;  5F2P A;  5H85 A;  3P1F A;  4LYW A;  4E96 A;  4UIW A;  4AKH A;  2R0V A;  1EQF A;  4CUU A;  5F36 A;  5A82 A;  5D3T A;  4QSU A;  4WIV A;  4A9M A;  4CUT A;  5C85 A;  4NRB A;  5DKD A;  2RFJ A;  5CQ7 A;  4YYJ A;  5COI A;  5HM0 A;  3G0J A;  3HMH A;  2YW5 A;  5DYX A;  5D3S A;  3SVF A;  5EVA A;  4HXL A;  5F1H A;  4ALH A;  5A5O A;  5FFV A;  4YH3 A;  5EK9 A;  5CQ8 A;  5C8G A;  3MUK A;  2OO1 A;  5CY9 A;  5D3H A;  5DBM A;  5FE8 A;  3UW9 A;  4QR3 A;  2GRC A;  4WHW A;  4YYI A;  3JVK A;  4QSX A;  4BW1 A;  2MJV B;  5F63 A;  2E7O A;  4GPJ A;  5A5Q A;  4NR6 A;  4QEV A;  4YAX A;  4YYK A;  4YYG A;  5A7C A;  4QSW A;  4OUF A;  2YYN A;  4A9J A;  4Z6I A;  5L96 A;  2RS9 B;  4IOR A;  4UIV A;  2OUO A;  5F3A A;  5FB0 A;  4A9I A;  5FE1 A;  4J3I A;  5J0D A;  5LKT A;  4UYG A;  2NXB A;  4PY6 A;  3NXB A;  4NUC A;  4YBS A;  4IR3 A;  4CUQ A;  2EJN A;  2I7K A;  5KU3 A;  4J0R A;  3U5P A;  4TU6 A;  4NYW A;  5FG4 A;  2I8N A;  4Q0N A;  4QEU A;  4UYE A;  4KV4 A;  5I83 A;  5LKZ A;  4QC1 A;  4IR5 A;  4O7F A;  1PUO A;  4PKL A;  5AMF A;  4NQN A;  5AME A;  5FBX A;  5C7N A;  4PCE A;  3K2J A;  4NQM A;  5EPS A;  5I7Y A;  5ETD A;  3UVW A;  3QZV A;  1E6I A;  5HEL A;  4MEO A;  3Q2E A;  4C67 A;  3S92 A;  2D9E A;  4O71 A;  4MR5 A;  3ONI A;  4O70 A;  1N72 A;  3O37 A;  4FLP A;  4PTB A;  5EI4 A;  3VKG A;  4CUP A;  3JVL A;  4UYF B;  3JVJ A;  4NR5 A;  3U5L A;  5HLS A;  4BW4 A;  4CFL A;  5CUG A;  4AKI A;  5CP5 A;  5A5P A;  5DFC A;  2DWW A;  2F6N A;  4HXM A;  5FH6 A;  4UIT A;  4NYV A;  4Z1S A;  5HQ5 A;  5ENF A;  2FSA A;  4N4F A;  4X2I A;  5DKC A;  1F68 A;  5D3N A;  4A9L A;  4TT6 A;  5KTX A;  1ZKR A;  3JVM A;  5DYU A;  5KHM A;  4J0S A;  4ZC9 A;  5F1L A;  4NRC A;  2YDW A;  5TB6 A;  4MR3 A;  5LUU A;  4A9K A;  4QSS A;  4QR4 A;  3VKH A;  5A5R A;  4Q0O A;  3O35 A;  3D1B A;  5HEN A;  4NXJ A;  5ETB A;  5I1Q A;  5FE5 A;  4QSQ A;  3HMF A;  5KO4 A;  2YEM A;  5FDZ A;  5HRW A;  2L84 A;  4NUE A;  4NR7 A;  3HME A;  5F5Z A;  4YY6 A;  5EWD A;  4HBW A;  4QBM A;  5FE3 A;  4YAD A;  5IGL A;  4O77 A;  4NS5 A;  5A85 A;  4UIU A;  4O78 A;  4YYN A;  5ACY A;  4NR8 A;  5FE7 A;  5LKX A;  4HXP A;  5AD2 A;  3ZYU A;  5IBN A;  4YAB A;  5LVR A;  3RCW A;  4HXS A;  4HXK A;  5FB1 A;  5EM3 A;  5FE9 A;  2OSS A;  3MB3 A;  5CQ3 A;  2RO1 A;  5E3D A;  5LJ0 A;  4LR6 A;  4UIZ A;  5E0R A;  5LJ1 A;  5TCM A;  2L5E A;  4TTE A;  3DWY A;  4HXR A;  5HJC A;  5EGU A;  3IU6 A;  5EWV A;  4QYL A;  4MR4 A;  5L99 A;  1WUG A;  2RNW A;  4O7A A;  4TS8 A;  4O7B A;  5D3P A;  5G4R A;  5FH7 A;  4TT2 A;  2LSP B;  3MXF A;  5DW2 A;  4AI6 A;  4NUD A;  5EQ1 A;  3GG3 A;  4HBV A;  4KV1 A;  4QR5 A;  5E9I A;  2R0S A;  4LRG A;  3QZS A;  3QZT A;  5CQT A;  2G4A A;  5ENH A;  5DKH A;  5LJ2 A;  4IOQ A;  5CU8 A;  4YAT A;  3SVG A;  3AAD A;  5I89 A;  4QNS A;  2L85 A;  4UYF A;  5CS8 A;  2YEK A;  2DVV A;  5FE6 A;  4A9F A;  5CZG A;  3D1D A;  3D7C A;  3P1E A;  5EV9 A;  1ZS5 A;  4UYD A;  5HFQ A;  5F60 A;  5EWC A;  4TT4 A;  2DVQ A;  4XUB A;  4O7E A;  5C89 A;  5DYA A;  4QY4 A;  5L8T A;  3U5M A;  4A9E A;  3LQJ A;  5K29 A;  4BW3 A;  4QUT A;  5EP7 A;  5HCL A;  5FG6 A;  4N4G A;  3Q2F A;  5E9V A;  5F25 A;  5H1U A;  2H60 A;  5I29 A;  3FKM X;  5DLZ A;  4YC9 A;  5I86 A; 
#chains in the Genus database with same CATH homology
 5EU1 A;  5A81 A;  2KTB B;  4YBM A;  4Z6H A;  4NR9 A;  2F6J A;  5HRV A;  4BW2 A;  5D0C A;  5I80 A;  3U5O A;  3O34 A;  5DX4 A;  4LDF A;  5FE4 A;  4ZW1 A;  4F3I A;  4Z1Q A;  4MR6 A;  5L8U A;  4O75 A;  4QZS A;  5IID A;  5EIC A;  5I40 A;  3UVY A;  4CUR A;  3P5O A;  4ZQL A;  5ENC A;  5I88 A;  2WP2 A;  5E74 A;  5L97 A;  5CUE A;  5CGP A;  5FE0 A;  4YYD A;  5CUB A;  5DFB A;  4TU4 A;  2N9G A;  4LC2 A;  3UVX A;  5II1 A;  5CFW A;  5EPR A;  4MEP A;  3DAI A;  3MB4 A;  5I7X A;  5D3J A;  5BT4 A;  5ENB A;  5CQ5 A;  4O72 A;  5DW1 A;  4CFK A;  5D26 A;  4QYD A;  3MUL A;  4C66 A;  4UIY A;  5CQ4 A;  4UIX A;  4HXO A;  4NR4 A;  5D24 A;  3U5J A;  2R10 A;  3LJW A;  5ENG A;  4CL9 A;  3U5N A;  1JM4 B;  3S91 A;  4LZR A;  4QUU A;  4KCX A;  5EPB A;  5C4Q A;  5A5S A;  5HQ6 A;  3IU5 A;  4QC3 A;  1X0J A;  4UYH A;  5G4S A;  3AQA A;  4HBX A;  5KTW A;  5D3R A;  5D7X A;  4MEQ A;  4LZS A;  3TLP A;  4PS5 A;  4YBT A;  5HQ7 A;  2RNX A;  3LQI A;  5E9K A;  4PCI A;  5DY7 A;  4AKN A;  5D3L A;  4OGJ A;  2DVR A;  4N4I A;  5BT5 A;  4O7C A;  2WP1 A;  5DFD A;  2YQD A;  4IR4 A;  5HFR A;  4YK0 A;  4QSR A;  5HEM A;  5IGM A;  4TZ8 A;  5FFY A;  4XUA A;  4O74 A;  5DLX A;  4Z93 A;  4XY8 A;  4QEW A;  5CTL A;  4A9N A;  4O76 A;  5DYC A;  5EWW A;  3O36 A;  5ENE A;  5E9M A;  4ALG A;  5F61 A;  4YY4 A;  4YYM A;  5H1V A;  2R0Y A;  4CLB A;  4QST A;  4CUS A;  4QSV A;  3LXJ A;  4TYL A;  4J1P A;  5H1T A;  3G0L A;  3UV2 A;  5LVQ A;  5A83 A;  4YH4 A;  4N4H A;  5CUD A;  2E3K A;  5JWM A;  5KTU A;  4A9O A;  4OGI A;  4QB3 A;  4HBY A;  5CRM A;  3I3J A;  4QSP A;  5CUA A;  5FG5 A;  5ENI A;  4IR6 A;  4NRA A;  5CQ6 A;  2DKW A;  1WUM A;  5E73 A;  4A9H A;  4XYA A;  5EWH A;  5E3G A;  3P1D A;  4BHW A;  5FH8 A;  2DAT A;  4RVR A;  4LZ2 A;  5CRZ A;  4YYH A;  5IGK A;  4LYS A;  5EA1 A;  5E9L A;  5CQA A;  3MQM A;  5AD3 A;  5L98 A;  4DON A;  3UVD A;  2DVS A;  3O33 A;  3UV5 A;  2YEL A;  5IG6 A;  5A5N A;  4MEN A;  4HXN A;  4NYX A;  4XY9 A;  5C87 A;  2RNY A;  5IGN A;  4LYI A;  4TQN A;  5E7D A;  5CUC A;  4TZ2 A;  2E7N A;  5LKU A;  1JSP B;  3LQH A;  4N3W A;  4IOO A;  5EIS A;  3UV4 A;  5II2 A;  4WHU A;  5D25 A;  5FE2 A;  5HRX A;  4Y03 A;  5CPE A;  5E9Y A;  4BJX A;  5JI8 A;  3P1C A;  2RI7 A;  3SVH A;  5BT3 A;  5ENJ A;  5F62 A;  5FFW A;  3U5K A;  2D82 A;  5F2P A;  5H85 A;  3P1F A;  4LYW A;  4E96 A;  4UIW A;  2R0V A;  1EQF A;  4CUU A;  5F36 A;  5A82 A;  5D3T A;  4QSU A;  4WIV A;  4A9M A;  4CUT A;  5C85 A;  4NRB A;  5DKD A;  2RFJ A;  5CQ7 A;  4YYJ A;  5COI A;  5HM0 A;  3G0J A;  3HMH A;  2YW5 A;  5DYX A;  5D3S A;  3SVF A;  5EVA A;  4HXL A;  5F1H A;  4ALH A;  5A5O A;  5FFV A;  4YH3 A;  5EK9 A;  5CQ8 A;  5C8G A;  3MUK A;  2OO1 A;  5CY9 A;  5D3H A;  5DBM A;  5FE8 A;  3UW9 A;  4QR3 A;  2GRC A;  4WHW A;  4YYI A;  3JVK A;  4QSX A;  4BW1 A;  2MJV B;  5F63 A;  2E7O A;  4GPJ A;  5A5Q A;  4NR6 A;  4QEV A;  4YAX A;  4YYK A;  4YYG A;  5A7C A;  4QSW A;  4OUF A;  2YYN A;  4A9J A;  4Z6I A;  5L96 A;  2RS9 B;  4IOR A;  4UIV A;  2OUO A;  5F3A A;  5FB0 A;  4A9I A;  5FE1 A;  4J3I A;  5J0D A;  5LKT A;  4UYG A;  2NXB A;  4PY6 A;  3NXB A;  4NUC A;  4YBS A;  4IR3 A;  4CUQ A;  2I7K A;  5KU3 A;  4J0R A;  3U5P A;  4TU6 A;  4NYW A;  5FG4 A;  2I8N A;  4Q0N A;  4QEU A;  4UYE A;  4KV4 A;  5I83 A;  5LKZ A;  4QC1 A;  4IR5 A;  4O7F A;  4PKL A;  5AMF A;  4NQN A;  5AME A;  5FBX A;  5C7N A;  4PCE A;  3K2J A;  4NQM A;  5EPS A;  5I7Y A;  5ETD A;  3UVW A;  3QZV A;  1E6I A;  5HEL A;  4MEO A;  3Q2E A;  4C67 A;  3S92 A;  2D9E A;  4O71 A;  4MR5 A;  3ONI A;  4O70 A;  1N72 A;  3O37 A;  4FLP A;  4PTB A;  5EI4 A;  4CUP A;  3JVL A;  4UYF B;  3JVJ A;  4NR5 A;  3U5L A;  5HLS A;  4BW4 A;  4CFL A;  5CUG A;  5CP5 A;  5A5P A;  5DFC A;  2DWW A;  2F6N A;  4HXM A;  5FH6 A;  4UIT A;  4NYV A;  4Z1S A;  5HQ5 A;  5ENF A;  2FSA A;  4N4F A;  4X2I A;  5DKC A;  1F68 A;  5D3N A;  4A9L A;  4TT6 A;  5KTX A;  3JVM A;  5DYU A;  5KHM A;  4J0S A;  4ZC9 A;  5F1L A;  4NRC A;  2YDW A;  5TB6 A;  4MR3 A;  5LUU A;  4A9K A;  4QSS A;  4QR4 A;  5A5R A;  4Q0O A;  3O35 A;  5HEN A;  4NXJ A;  5ETB A;  5I1Q A;  5FE5 A;  4QSQ A;  3HMF A;  5KO4 A;  2YEM A;  5FDZ A;  5HRW A;  2L84 A;  4NUE A;  4NR7 A;  3HME A;  5F5Z A;  4YY6 A;  5EWD A;  4HBW A;  4QBM A;  5FE3 A;  4YAD A;  5IGL A;  4O77 A;  4NS5 A;  5A85 A;  4UIU A;  4O78 A;  4YYN A;  5ACY A;  4NR8 A;  5FE7 A;  5LKX A;  4HXP A;  5AD2 A;  3ZYU A;  5IBN A;  4YAB A;  5LVR A;  3RCW A;  4HXS A;  4HXK A;  5FB1 A;  5EM3 A;  5FE9 A;  2OSS A;  3MB3 A;  5CQ3 A;  2RO1 A;  5E3D A;  5LJ0 A;  4LR6 A;  4UIZ A;  5E0R A;  5LJ1 A;  5TCM A;  2L5E A;  4TTE A;  3DWY A;  4HXR A;  5HJC A;  5EGU A;  3IU6 A;  5EWV A;  4QYL A;  4MR4 A;  5L99 A;  1WUG A;  2RNW A;  4O7A A;  4TS8 A;  4O7B A;  5D3P A;  5G4R A;  5FH7 A;  4TT2 A;  2LSP B;  3MXF A;  5DW2 A;  4NUD A;  5EQ1 A;  3GG3 A;  4HBV A;  4KV1 A;  4QR5 A;  5E9I A;  2R0S A;  4LRG A;  3QZS A;  3QZT A;  5CQT A;  2G4A A;  5ENH A;  5DKH A;  5LJ2 A;  4IOQ A;  5CU8 A;  4YAT A;  3SVG A;  3AAD A;  5I89 A;  4QNS A;  2L85 A;  4UYF A;  5CS8 A;  2YEK A;  2DVV A;  5FE6 A;  4A9F A;  5CZG A;  3D7C A;  3P1E A;  5EV9 A;  1ZS5 A;  4UYD A;  5HFQ A;  5F60 A;  5EWC A;  4TT4 A;  2DVQ A;  4XUB A;  4O7E A;  5C89 A;  5DYA A;  4QY4 A;  5L8T A;  3U5M A;  4A9E A;  3LQJ A;  5K29 A;  4BW3 A;  4QUT A;  5EP7 A;  5HCL A;  5FG6 A;  4N4G A;  3Q2F A;  5E9V A;  5F25 A;  5H1U A;  2H60 A;  5I29 A;  3FKM X;  5DLZ A;  4YC9 A;  5I86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...