5I1QA

Second bromodomain of taf1 bound to a pyrrolopyridone compound
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
135
structure length
135
Chain Sequence
DDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/inhibitor
molecule keywords Transcription initiation factor TFIID subunit 1
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 135
sequence length 135
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i1qA00
5F1LA 5FG6A 4CFKA 5FH8A 1WUGA 4LZ2A 1EQFA 5E3DA 5I83A 4KCXA 4F3IA 5HQ5A 5EISA 2RNYA 4A9EA 5IGNA 2OO1A 4N4HA 5I40A 3P1EA 5FE1A 5DKHA 4NYVA 5D7XA 4Q0OA 5CQ3A 2RNWA 4KV1A 5LVRA 4NUEA 3TLPA 5I80A 5LKZA 4N4IA 3O34A 5D0CA 5LJ1A 3MQMA 5CQ7A 4YY4A 5CUCA 5EWWA 5EPBA 4PKLA 5CQ5A 5BT5A 4IR6A 4QSPA 4BW2A 3FKMX 5L98A 4PCEA 5K29A 4LRGA 5CQAA 4Z1SA 4UIUA 4PY6A 3I3JA 5EQ1A 2KTBB 4PCIA 3UV4A 5KHMA 5CS8A 5EP7A 5TB6A 4A9JA 5I7XA 4Y03A 5ENIA 2YQDA 3P1FA 4QNSA 5HENA 5F63A 3HMEA 5FB1A 2YYNA 4TU6A 4UITA 2FSAA 5IGKA 4YH4A 4YYIA 3U5OA 2G4AA 4CUQA 5EWVA 3U5PA 5AD3A 4PTBA 5FE4A 2E7NA 3HMFA 4YYNA 5EWHA 3JVLA 4QUTA 3G0LA 4LR6A 5C87A 4O76A 4J1PA 4YABA 5CY9A 5D3NA 5DKCA 4Z93A 4BJXA 4NRBA 4HXSA 5AMEA 5JI8A 4HBXA 4YK0A 5HFQA 3SVFA 5TCMA 4QC3A 5E9LA 5BT4A 4O75A 5EVAA 4CURA 5H1UA 4LZSA 5FFYA 4C66A 5DW2A 5KTWA 5F2PA 3O35A 2WP1A 2YDWA 5HLSA 5HQ6A 4QYDA 5E3GA 4LYIA 2DKWA 4TT4A 5F60A 5L97A 5BT3A 3AQAA 5ENHA 4NRCA 2F6NA 5D3HA 4QEUA 5HQ7A 5IBNA 3SVGA 4OUFA 4TTEA 5ENFA 4ALGA 5E9MA 3U5LA 4IR3A 4MR4A 4NR5A 4O78A 5H85A 4YH3A 5A83A 5H1TA 5ENEA 4NUDA 4FLPA 4TQNA 5DKDA 3P5OA 5A5QA 4BW1A 5CUEA 5ENBA 4A9NA 5EU1A 5C4QA 2OUOA 5CQ8A 4DONA 4J0SA 3S91A 2YELA 5HEMA 5L8TA 4ZQLA 4YYHA 5C89A 3HMHA 4RVRA 5DLXA 5EPSA 2D9EA 5LKTA 5ENCA 4HBWA 5C8GA 5LKUA 5LUUA 5ENJA 4MR3A 2I7KA 4TS8A 4NR9A 5CUBA 4TT2A 4A9OA 1JM4B 4AKNA 4QC1A 4Z1QA 2R0VA 4A9FA 4MR5A 5EPRA 4YBSA 2DVVA 2R0SA 5CU8A 4XY9A 4UYEA 5HCLA 4YYJA 4QSRA 3UV5A 4O74A 4TZ2A 2N9GA 5L99A 4YY6A 5EA1A 2RI7A 3UW9A 4MR6A 5HRXA 4N4FA 3LQHA 4NR8A 4QR5A 5EGUA 4XUAA 5HELA 4YYKA 4N3WA 4NR6A 4TT6A 4HXLA 2L84A 5CRZA 4HXRA 4YC9A 5D26A 5L8UA 4O7AA 5EI4A 3LQIA 3JVKA 1F68A 1E6IA 5FE6A 3DWYA 4NUCA 5E7DA 4LZRA 3P1DA 4O70A 1N72A 5II1A 5EM3A 3S92A 2LSPB 4QZSA 5D3RA 4QUUA 5D25A 5E74A 4UIYA 4ALHA 5I29A 2L85A 2YW5A 3UVDA 4UIVA 4WHUA 5A82A 5AMFA 5FH6A 4QSWA 5KTUA 3D7CA 4MENA 5DYCA 2DVSA 2RO1A 5FE8A 4LYSA 5FBXA 4YBTA 5FH7A 3MB3A 4BHWA 4UIWA 5C7NA 4NQNA 2D82A 4UYHA 4HXOA 4Q0NA 4YYGA 3RCWA 2E7OA 5A5PA 3O36A 4CUPA 5CGPA 4UYGA 5CP5A 5L96A 3AADA 5EV9A 5DYAA 5II2A 5A85A 5I89A 5J0DA 5DBMA 4XY8A 5EWDA 4J0RA 4A9HA 4O7BA 3SVHA 5DFBA 5DFDA 4O77A 5LVQA 4QSTA 5DYXA 3MXFA 5D3JA 3UV2A 1JSPB 4UYFA 3U5KA 2YEKA 4QY4A 5IGMA 2OSSA 4A9LA 3LXJA 4O7FA 4Z6HA 4YYDA 4HXKA 5DFCA 2RS9B 5KU3A 5ENGA 5F25A 2DVRA 4C67A 4A9MA 4NR4A 4TYLA 2I8NA 5DY7A 3K2JA 5FFWA 5HRVA 5HM0A 5E0RA 5A81A 5CRMA 4HXNA 4YATA 5A5OA 3GG3A 4QSUA 3ZYUA 5A5NA 4HBVA 5FE0A 4QSVA 5HJCA 5FE5A 5F62A 4QSSA 3U5NA 5CUGA 4CUSA 5C85A 4BW3A 4MEOA 3G0JA 5D24A 3IU6A 2DATA 5IGLA 5I7YA 4QEWA 3MB4A 5JWMA 4IOOA 3UVYA 5HFRA 4MEPA 4PS5A 4QYLA 2YEMA 5I88A 5D3TA 4E96A 3U5MA 5F61A 4CFLA 5FG5A 4CLBA 5CUAA 4YBMA 4A9IA 4HBYA 2DWWA 4O72A 5I1QA 5E9KA 3LQJA 4UIZA 5KTXA 2MJVB 2R10A 5CZGA 4IOQA 2F6JA 4CUUA 5AD2A 5CTLA 5A5SA 5CFWA 5HRWA 2H60A 3QZTA 4IORA 5E9VA 5FG4A 2RNXA 3MULA 5D3SA 5CQ6A 5DYUA 4ZC9A 3UVXA 3IU5A 5F1HA 5FDZA 5ETDA 5ACYA 1WUMA 5D3LA 5EWCA 5FE7A 5H1VA 5FE9A 5F5ZA 4X2IA 4J3IA 4IR5A 4NYWA 3U5JA 5EK9A 5F3AA 4NQMA 3NXBA 3Q2FA 4XYAA 4UYDA 3O37A 5KO4A 5IIDA 5CQ4A 4QEVA 5DLZA 4WHWA 3MUKA 5FE3A 2E3KA 5CUDA 5A5RA 3ONIA 4OGJA 5A7CA 2DVQA 2L5EA 5FFVA 5CQTA 4UYFB 4ZW1A 1X0JA 4QB3A 4NYXA 4IR4A 3DAIA 4O71A 4QR4A 5DW1A 4QR3A 2R0YA 3QZSA 4WIVA 5I86A 4O7CA 4XUBA 4YADA 5LKXA 4N4GA 5EICA 4O7EA 4LYWA 2NXBA 4UIXA 4GPJA 1ZS5A 4KV4A 4MEQA 5LJ0A 5FE2A 4CL9A 5E9YA 4QBMA 5F36A 3O33A 3JVJA 5G4SA 5ETBA 5IG6A 5CPEA 2RFJA 4YYMA 2WP2A 4NXJA 4QSXA 4QSQA 4LDFA 4LC2A 4YAXA 3P1CA 4NR7A 4NRAA 3LJWA 5LJ2A 3Q2EA 5DX4A 4HXPA 3JVMA 2GRCA 4NS5A 5FB0A 4CUTA 5G4RA 3UVWA 5E9IA 5D3PA 4TZ8A 4HXMA 4OGIA 5COIA 4Z6IA 4BW4A 4TU4A 5E73A 3QZVA 4A9KA
chains in the Genus database with same CATH superfamily
5F1LA 5FG6A 4CFKA 5FH8A 1WUGA 4LZ2A 1EQFA 5E3DA 5I83A 4KCXA 4F3IA 5HQ5A 5EISA 2RNYA 4A9EA 5IGNA 2OO1A 4N4HA 5I40A 3P1EA 5FE1A 2EJNA 5DKHA 4NYVA 5D7XA 4Q0OA 5CQ3A 2RNWA 4KV1A 5LVRA 4NUEA 3TLPA 5I80A 5LKZA 4N4IA 3O34A 5D0CA 5LJ1A 3MQMA 5CQ7A 4YY4A 5CUCA 5EWWA 5EPBA 4PKLA 5CQ5A 5BT5A 4IR6A 4QSPA 4BW2A 3FKMX 5L98A 4PCEA 5K29A 4LRGA 5CQAA 4Z1SA 4UIUA 4PY6A 3I3JA 5EQ1A 2KTBB 4PCIA 3UV4A 5KHMA 5CS8A 5EP7A 5TB6A 4A9JA 5I7XA 4Y03A 5ENIA 2YQDA 3P1FA 4QNSA 1PUOA 5HENA 5F63A 3HMEA 5FB1A 2YYNA 4TU6A 4UITA 2FSAA 5IGKA 4YH4A 4YYIA 3U5OA 2G4AA 4CUQA 5EWVA 3U5PA 5AD3A 4PTBA 5FE4A 2E7NA 3HMFA 4YYNA 5EWHA 3JVLA 4QUTA 3G0LA 4LR6A 5C87A 4O76A 4J1PA 4YABA 5CY9A 5D3NA 5DKCA 4Z93A 4BJXA 4NRBA 4HXSA 5AMEA 5JI8A 4HBXA 4AKIA 4YK0A 5HFQA 3SVFA 5TCMA 4QC3A 5E9LA 5BT4A 4O75A 5EVAA 4CURA 5H1UA 4LZSA 5FFYA 4C66A 5DW2A 5KTWA 5F2PA 3O35A 2WP1A 2YDWA 5HLSA 5HQ6A 4QYDA 5E3GA 4LYIA 2DKWA 4TT4A 5F60A 5L97A 3D1BA 5BT3A 3AQAA 5ENHA 4NRCA 2F6NA 5D3HA 4QEUA 5HQ7A 5IBNA 3SVGA 4OUFA 4TTEA 5ENFA 4ALGA 5E9MA 3U5LA 4IR3A 4AI6A 4MR4A 4NR5A 4O78A 5H85A 4YH3A 5A83A 5H1TA 5ENEA 4NUDA 4FLPA 4TQNA 5DKDA 3P5OA 5A5QA 4BW1A 5CUEA 5ENBA 4A9NA 5EU1A 5C4QA 3VKHA 2OUOA 5CQ8A 4DONA 4J0SA 3S91A 2YELA 5HEMA 5L8TA 4ZQLA 4YYHA 5C89A 3HMHA 4RVRA 5DLXA 5EPSA 2D9EA 5LKTA 5ENCA 4HBWA 5C8GA 5LKUA 5LUUA 5ENJA 4MR3A 2I7KA 4TS8A 4NR9A 5CUBA 4TT2A 4A9OA 1JM4B 4AKNA 4QC1A 4Z1QA 2R0VA 4A9FA 4MR5A 5EPRA 4YBSA 2DVVA 2R0SA 5CU8A 4XY9A 4UYEA 4AKGA 5HCLA 4YYJA 4QSRA 3UV5A 4O74A 4TZ2A 2N9GA 5L99A 4YY6A 5EA1A 2RI7A 3UW9A 4MR6A 5HRXA 4N4FA 3LQHA 4NR8A 4QR5A 5EGUA 4XUAA 5HELA 4YYKA 4N3WA 4NR6A 4TT6A 4HXLA 2L84A 5CRZA 4HXRA 4YC9A 5D26A 5L8UA 4O7AA 5EI4A 3LQIA 3JVKA 1F68A 1E6IA 5FE6A 3DWYA 4NUCA 5E7DA 4LZRA 3P1DA 4AKHA 4O70A 1N72A 5II1A 5EM3A 3S92A 2LSPB 4QZSA 3D1DA 5D3RA 4QUUA 5D25A 5E74A 4UIYA 4ALHA 5I29A 2L85A 2YW5A 3UVDA 4UIVA 4WHUA 5A82A 5AMFA 5FH6A 4QSWA 5KTUA 3D7CA 4MENA 5DYCA 2DVSA 2RO1A 5FE8A 4LYSA 5FBXA 4YBTA 5FH7A 3MB3A 4BHWA 4UIWA 5C7NA 4NQNA 2D82A 4UYHA 4HXOA 4Q0NA 4YYGA 3RCWA 2E7OA 5A5PA 3O36A 4CUPA 5CGPA 4UYGA 5CP5A 5L96A 3AADA 5EV9A 5DYAA 5II2A 5A85A 5I89A 5J0DA 5DBMA 4XY8A 5EWDA 4J0RA 4A9HA 4O7BA 3SVHA 5DFBA 5DFDA 4O77A 5LVQA 4QSTA 5DYXA 3MXFA 5D3JA 3UV2A 1JSPB 4UYFA 3U5KA 2YEKA 4QY4A 5IGMA 2OSSA 4A9LA 3LXJA 4O7FA 4Z6HA 4YYDA 4HXKA 5DFCA 2RS9B 5KU3A 5ENGA 5F25A 2DVRA 4C67A 4A9MA 4NR4A 4TYLA 2I8NA 5DY7A 3K2JA 5FFWA 5HRVA 5HM0A 5E0RA 5A81A 5CRMA 4HXNA 4YATA 5A5OA 3GG3A 4QSUA 3ZYUA 5A5NA 4HBVA 5FE0A 4QSVA 5HJCA 5FE5A 5F62A 4QSSA 3U5NA 5CUGA 4CUSA 5C85A 4BW3A 4MEOA 3G0JA 5D24A 3IU6A 2DATA 5IGLA 5I7YA 4QEWA 3MB4A 5JWMA 4IOOA 3UVYA 5HFRA 4MEPA 4PS5A 4QYLA 2YEMA 5I88A 5D3TA 4E96A 3U5MA 5F61A 4CFLA 5FG5A 4CLBA 5CUAA 4YBMA 4A9IA 4HBYA 2DWWA 4O72A 5I1QA 5E9KA 3LQJA 4UIZA 5KTXA 2MJVB 2R10A 5CZGA 4IOQA 2F6JA 4CUUA 5AD2A 5CTLA 5A5SA 5CFWA 5HRWA 2H60A 3QZTA 4IORA 5E9VA 5FG4A 2RNXA 3MULA 3ERRA 5D3SA 5CQ6A 5DYUA 4ZC9A 3UVXA 3IU5A 5F1HA 5FDZA 5ETDA 5ACYA 1WUMA 5D3LA 5EWCA 5FE7A 5H1VA 5FE9A 5F5ZA 4X2IA 4J3IA 4IR5A 4NYWA 3U5JA 5EK9A 5F3AA 4NQMA 3NXBA 3Q2FA 4XYAA 4UYDA 3O37A 5KO4A 5IIDA 5CQ4A 4QEVA 5DLZA 4WHWA 3MUKA 5FE3A 2E3KA 5CUDA 5A5RA 3ONIA 4OGJA 5A7CA 2DVQA 2L5EA 5FFVA 5CQTA 4UYFB 4ZW1A 1X0JA 4QB3A 4NYXA 4IR4A 3DAIA 4O71A 4QR4A 5DW1A 4QR3A 2R0YA 3QZSA 4WIVA 5I86A 4O7CA 4XUBA 4YADA 5LKXA 4N4GA 5EICA 4O7EA 4LYWA 2NXBA 4UIXA 4GPJA 1ZS5A 4KV4A 4MEQA 5LJ0A 5FE2A 4CL9A 5E9YA 4QBMA 5F36A 3O33A 3JVJA 5G4SA 5ETBA 5IG6A 5CPEA 2RFJA 4YYMA 2WP2A 4NXJA 4QSXA 4QSQA 4LDFA 1ZKRA 4LC2A 4YAXA 3P1CA 4NR7A 4NRAA 3LJWA 5LJ2A 3VKGA 3Q2EA 5DX4A 4HXPA 3JVMA 2GRCA 4NS5A 5FB0A 4CUTA 5G4RA 3UVWA 5E9IA 5D3PA 4TZ8A 4HXMA 4OGIA 5COIA 4Z6IA 4BW4A 4TU4A 5E73A 3QZVA 4A9KA
chains in the Genus database with same CATH topology
5F1LA 5FG6A 4CFKA 5FH8A 1WUGA 4LZ2A 1EQFA 5E3DA 5I83A 4KCXA 4F3IA 5HQ5A 5EISA 2RNYA 4A9EA 5IGNA 2OO1A 4N4HA 5I40A 3P1EA 5FE1A 5DKHA 4NYVA 5D7XA 4Q0OA 5CQ3A 2RNWA 4KV1A 5LVRA 4NUEA 3TLPA 5I80A 5LKZA 4N4IA 3O34A 5D0CA 5LJ1A 3MQMA 5CQ7A 4YY4A 5CUCA 5EWWA 5EPBA 4PKLA 5CQ5A 5BT5A 4IR6A 4QSPA 4BW2A 3FKMX 5L98A 4PCEA 5K29A 4LRGA 5CQAA 4Z1SA 4UIUA 4PY6A 3I3JA 5EQ1A 2KTBB 4PCIA 3UV4A 5KHMA 5CS8A 5EP7A 5TB6A 4A9JA 5I7XA 4Y03A 5ENIA 2YQDA 3P1FA 4QNSA 5HENA 5F63A 3HMEA 5FB1A 2YYNA 4TU6A 4UITA 2FSAA 5IGKA 4YH4A 4YYIA 3U5OA 2G4AA 4CUQA 5EWVA 3U5PA 5AD3A 4PTBA 5FE4A 2E7NA 3HMFA 4YYNA 5EWHA 3JVLA 4QUTA 3G0LA 4LR6A 5C87A 4O76A 4J1PA 4YABA 5CY9A 5D3NA 5DKCA 4Z93A 4BJXA 4NRBA 4HXSA 5AMEA 5JI8A 4HBXA 4YK0A 5HFQA 3SVFA 5TCMA 4QC3A 5E9LA 5BT4A 4O75A 5EVAA 4CURA 5H1UA 4LZSA 5FFYA 4C66A 5DW2A 5KTWA 5F2PA 3O35A 2WP1A 2YDWA 5HLSA 5HQ6A 4QYDA 5E3GA 4LYIA 2DKWA 4TT4A 5F60A 5L97A 5BT3A 3AQAA 5ENHA 4NRCA 2F6NA 5D3HA 4QEUA 5HQ7A 5IBNA 3SVGA 4OUFA 4TTEA 5ENFA 4ALGA 5E9MA 3U5LA 4IR3A 4MR4A 4NR5A 4O78A 5H85A 4YH3A 5A83A 5H1TA 5ENEA 4NUDA 4FLPA 4TQNA 5DKDA 3P5OA 5A5QA 4BW1A 5CUEA 5ENBA 4A9NA 5EU1A 5C4QA 2OUOA 5CQ8A 4DONA 4J0SA 3S91A 2YELA 5HEMA 5L8TA 4ZQLA 4YYHA 5C89A 3HMHA 4RVRA 5DLXA 5EPSA 2D9EA 5LKTA 5ENCA 4HBWA 5C8GA 5LKUA 5LUUA 5ENJA 4MR3A 2I7KA 4TS8A 4NR9A 5CUBA 4TT2A 4A9OA 1JM4B 4AKNA 4QC1A 4Z1QA 2R0VA 4A9FA 4MR5A 5EPRA 4YBSA 2DVVA 2R0SA 5CU8A 4XY9A 4UYEA 5HCLA 4YYJA 4QSRA 3UV5A 4O74A 4TZ2A 2N9GA 5L99A 4YY6A 5EA1A 2RI7A 3UW9A 4MR6A 5HRXA 4N4FA 3LQHA 4NR8A 4QR5A 5EGUA 4XUAA 5HELA 4YYKA 4N3WA 4NR6A 4TT6A 4HXLA 2L84A 5CRZA 4HXRA 4YC9A 5D26A 5L8UA 4O7AA 5EI4A 3LQIA 3JVKA 1F68A 1E6IA 5FE6A 3DWYA 4NUCA 5E7DA 4LZRA 3P1DA 4O70A 1N72A 5II1A 5EM3A 3S92A 2LSPB 4QZSA 5D3RA 4QUUA 5D25A 5E74A 4UIYA 4ALHA 5I29A 2L85A 2YW5A 3UVDA 4UIVA 4WHUA 5A82A 5AMFA 5FH6A 4QSWA 5KTUA 3D7CA 4MENA 5DYCA 2DVSA 2RO1A 5FE8A 4LYSA 5FBXA 4YBTA 5FH7A 3MB3A 4BHWA 4UIWA 5C7NA 4NQNA 2D82A 4UYHA 4HXOA 4Q0NA 4YYGA 3RCWA 2E7OA 5A5PA 3O36A 4CUPA 5CGPA 4UYGA 5CP5A 5L96A 3AADA 5EV9A 5DYAA 5II2A 5A85A 5I89A 5J0DA 5DBMA 4XY8A 5EWDA 4J0RA 4A9HA 4O7BA 3SVHA 5DFBA 5DFDA 4O77A 5LVQA 4QSTA 5DYXA 3MXFA 5D3JA 3UV2A 1JSPB 4UYFA 3U5KA 2YEKA 4QY4A 5IGMA 2OSSA 4A9LA 3LXJA 4O7FA 4Z6HA 4YYDA 4HXKA 5DFCA 2RS9B 5KU3A 5ENGA 5F25A 2DVRA 4C67A 4A9MA 4NR4A 4TYLA 2I8NA 5DY7A 3K2JA 5FFWA 5HRVA 5HM0A 5E0RA 5A81A 5CRMA 4HXNA 4YATA 5A5OA 3GG3A 4QSUA 3ZYUA 5A5NA 4HBVA 5FE0A 4QSVA 5HJCA 5FE5A 5F62A 4QSSA 3U5NA 5CUGA 4CUSA 5C85A 4BW3A 4MEOA 3G0JA 5D24A 3IU6A 2DATA 5IGLA 5I7YA 4QEWA 3MB4A 5JWMA 4IOOA 3UVYA 5HFRA 4MEPA 4PS5A 4QYLA 2YEMA 5I88A 5D3TA 4E96A 3U5MA 5F61A 4CFLA 5FG5A 4CLBA 5CUAA 4YBMA 4A9IA 4HBYA 2DWWA 4O72A 5I1QA 5E9KA 3LQJA 4UIZA 5KTXA 2MJVB 2R10A 5CZGA 4IOQA 2F6JA 4CUUA 5AD2A 5CTLA 5A5SA 5CFWA 5HRWA 2H60A 3QZTA 4IORA 5E9VA 5FG4A 2RNXA 3MULA 5D3SA 5CQ6A 5DYUA 4ZC9A 3UVXA 3IU5A 5F1HA 5FDZA 5ETDA 5ACYA 1WUMA 5D3LA 5EWCA 5FE7A 5H1VA 5FE9A 5F5ZA 4X2IA 4J3IA 4IR5A 4NYWA 3U5JA 5EK9A 5F3AA 4NQMA 3NXBA 3Q2FA 4XYAA 4UYDA 3O37A 5KO4A 5IIDA 5CQ4A 4QEVA 5DLZA 4WHWA 3MUKA 5FE3A 2E3KA 5CUDA 5A5RA 3ONIA 4OGJA 5A7CA 2DVQA 2L5EA 5FFVA 5CQTA 4UYFB 4ZW1A 1X0JA 4QB3A 4NYXA 4IR4A 3DAIA 4O71A 4QR4A 5DW1A 4QR3A 2R0YA 3QZSA 4WIVA 5I86A 4O7CA 4XUBA 4YADA 5LKXA 4N4GA 5EICA 4O7EA 4LYWA 2NXBA 4UIXA 4GPJA 1ZS5A 4KV4A 4MEQA 5LJ0A 5FE2A 4CL9A 5E9YA 4QBMA 5F36A 3O33A 3JVJA 5G4SA 5ETBA 5IG6A 5CPEA 2RFJA 4YYMA 2WP2A 4NXJA 4QSXA 4QSQA 4LDFA 4LC2A 4YAXA 3P1CA 4NR7A 4NRAA 3LJWA 5LJ2A 3Q2EA 5DX4A 4HXPA 3JVMA 2GRCA 4NS5A 5FB0A 4CUTA 5G4RA 3UVWA 5E9IA 5D3PA 4TZ8A 4HXMA 4OGIA 5COIA 4Z6IA 4BW4A 4TU4A 5E73A 3QZVA 4A9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F1L A;  5FG6 A;  4CFK A;  5FH8 A;  1WUG A;  4LZ2 A;  1EQF A;  5E3D A;  5I83 A;  4KCX A;  4F3I A;  5HQ5 A;  5EIS A;  2RNY A;  4A9E A;  5IGN A;  2OO1 A;  4N4H A;  5I40 A;  3P1E A;  5FE1 A;  5DKH A;  4NYV A;  5D7X A;  4Q0O A;  5CQ3 A;  2RNW A;  4KV1 A;  5LVR A;  4NUE A;  3TLP A;  5I80 A;  5LKZ A;  4N4I A;  3O34 A;  5D0C A;  5LJ1 A;  3MQM A;  5CQ7 A;  4YY4 A;  5CUC A;  5EWW A;  5EPB A;  4PKL A;  5CQ5 A;  5BT5 A;  4IR6 A;  4QSP A;  4BW2 A;  3FKM X;  5L98 A;  4PCE A;  5K29 A;  4LRG A;  5CQA A;  4Z1S A;  4UIU A;  4PY6 A;  3I3J A;  5EQ1 A;  2KTB B;  4PCI A;  3UV4 A;  5KHM A;  5CS8 A;  5EP7 A;  5TB6 A;  4A9J A;  5I7X A;  4Y03 A;  5ENI A;  2YQD A;  3P1F A;  4QNS A;  5HEN A;  5F63 A;  3HME A;  5FB1 A;  2YYN A;  4TU6 A;  4UIT A;  2FSA A;  5IGK A;  4YH4 A;  4YYI A;  3U5O A;  2G4A A;  4CUQ A;  5EWV A;  3U5P A;  5AD3 A;  4PTB A;  5FE4 A;  2E7N A;  3HMF A;  4YYN A;  5EWH A;  3JVL A;  4QUT A;  3G0L A;  4LR6 A;  5C87 A;  4O76 A;  4J1P A;  4YAB A;  5CY9 A;  5D3N A;  5DKC A;  4Z93 A;  4BJX A;  4NRB A;  4HXS A;  5AME A;  5JI8 A;  4HBX A;  4YK0 A;  5HFQ A;  3SVF A;  5TCM A;  4QC3 A;  5E9L A;  5BT4 A;  4O75 A;  5EVA A;  4CUR A;  5H1U A;  4LZS A;  5FFY A;  4C66 A;  5DW2 A;  5KTW A;  5F2P A;  3O35 A;  2WP1 A;  2YDW A;  5HLS A;  5HQ6 A;  4QYD A;  5E3G A;  4LYI A;  2DKW A;  4TT4 A;  5F60 A;  5L97 A;  5BT3 A;  3AQA A;  5ENH A;  4NRC A;  2F6N A;  5D3H A;  4QEU A;  5HQ7 A;  5IBN A;  3SVG A;  4OUF A;  4TTE A;  5ENF A;  4ALG A;  5E9M A;  3U5L A;  4IR3 A;  4MR4 A;  4NR5 A;  4O78 A;  5H85 A;  4YH3 A;  5A83 A;  5H1T A;  5ENE A;  4NUD A;  4FLP A;  4TQN A;  5DKD A;  3P5O A;  5A5Q A;  4BW1 A;  5CUE A;  5ENB A;  4A9N A;  5EU1 A;  5C4Q A;  2OUO A;  5CQ8 A;  4DON A;  4J0S A;  3S91 A;  2YEL A;  5HEM A;  5L8T A;  4ZQL A;  4YYH A;  5C89 A;  3HMH A;  4RVR A;  5DLX A;  5EPS A;  2D9E A;  5LKT A;  5ENC A;  4HBW A;  5C8G A;  5LKU A;  5LUU A;  5ENJ A;  4MR3 A;  2I7K A;  4TS8 A;  4NR9 A;  5CUB A;  4TT2 A;  4A9O A;  1JM4 B;  4AKN A;  4QC1 A;  4Z1Q A;  2R0V A;  4A9F A;  4MR5 A;  5EPR A;  4YBS A;  2DVV A;  2R0S A;  5CU8 A;  4XY9 A;  4UYE A;  5HCL A;  4YYJ A;  4QSR A;  3UV5 A;  4O74 A;  4TZ2 A;  2N9G A;  5L99 A;  4YY6 A;  5EA1 A;  2RI7 A;  3UW9 A;  4MR6 A;  5HRX A;  4N4F A;  3LQH A;  4NR8 A;  4QR5 A;  5EGU A;  4XUA A;  5HEL A;  4YYK A;  4N3W A;  4NR6 A;  4TT6 A;  4HXL A;  2L84 A;  5CRZ A;  4HXR A;  4YC9 A;  5D26 A;  5L8U A;  4O7A A;  5EI4 A;  3LQI A;  3JVK A;  1F68 A;  1E6I A;  5FE6 A;  3DWY A;  4NUC A;  5E7D A;  4LZR A;  3P1D A;  4O70 A;  1N72 A;  5II1 A;  5EM3 A;  3S92 A;  2LSP B;  4QZS A;  5D3R A;  4QUU A;  5D25 A;  5E74 A;  4UIY A;  4ALH A;  5I29 A;  2L85 A;  2YW5 A;  3UVD A;  4UIV A;  4WHU A;  5A82 A;  5AMF A;  5FH6 A;  4QSW A;  5KTU A;  3D7C A;  4MEN A;  5DYC A;  2DVS A;  2RO1 A;  5FE8 A;  4LYS A;  5FBX A;  4YBT A;  5FH7 A;  3MB3 A;  4BHW A;  4UIW A;  5C7N A;  4NQN A;  2D82 A;  4UYH A;  4HXO A;  4Q0N A;  4YYG A;  3RCW A;  2E7O A;  5A5P A;  3O36 A;  4CUP A;  5CGP A;  4UYG A;  5CP5 A;  5L96 A;  3AAD A;  5EV9 A;  5DYA A;  5II2 A;  5A85 A;  5I89 A;  5J0D A;  5DBM A;  4XY8 A;  5EWD A;  4J0R A;  4A9H A;  4O7B A;  3SVH A;  5DFB A;  5DFD A;  4O77 A;  5LVQ A;  4QST A;  5DYX A;  3MXF A;  5D3J A;  3UV2 A;  1JSP B;  4UYF A;  3U5K A;  2YEK A;  4QY4 A;  5IGM A;  2OSS A;  4A9L A;  3LXJ A;  4O7F A;  4Z6H A;  4YYD A;  4HXK A;  5DFC A;  2RS9 B;  5KU3 A;  5ENG A;  5F25 A;  2DVR A;  4C67 A;  4A9M A;  4NR4 A;  4TYL A;  2I8N A;  5DY7 A;  3K2J A;  5FFW A;  5HRV A;  5HM0 A;  5E0R A;  5A81 A;  5CRM A;  4HXN A;  4YAT A;  5A5O A;  3GG3 A;  4QSU A;  3ZYU A;  5A5N A;  4HBV A;  5FE0 A;  4QSV A;  5HJC A;  5FE5 A;  5F62 A;  4QSS A;  3U5N A;  5CUG A;  4CUS A;  5C85 A;  4BW3 A;  4MEO A;  3G0J A;  5D24 A;  3IU6 A;  2DAT A;  5IGL A;  5I7Y A;  4QEW A;  3MB4 A;  5JWM A;  4IOO A;  3UVY A;  5HFR A;  4MEP A;  4PS5 A;  4QYL A;  2YEM A;  5I88 A;  5D3T A;  4E96 A;  3U5M A;  5F61 A;  4CFL A;  5FG5 A;  4CLB A;  5CUA A;  4YBM A;  4A9I A;  4HBY A;  2DWW A;  4O72 A;  5I1Q A;  5E9K A;  3LQJ A;  4UIZ A;  5KTX A;  2MJV B;  2R10 A;  5CZG A;  4IOQ A;  2F6J A;  4CUU A;  5AD2 A;  5CTL A;  5A5S A;  5CFW A;  5HRW A;  2H60 A;  3QZT A;  4IOR A;  5E9V A;  5FG4 A;  2RNX A;  3MUL A;  5D3S A;  5CQ6 A;  5DYU A;  4ZC9 A;  3UVX A;  3IU5 A;  5F1H A;  5FDZ A;  5ETD A;  5ACY A;  1WUM A;  5D3L A;  5EWC A;  5FE7 A;  5H1V A;  5FE9 A;  5F5Z A;  4X2I A;  4J3I A;  4IR5 A;  4NYW A;  3U5J A;  5EK9 A;  5F3A A;  4NQM A;  3NXB A;  3Q2F A;  4XYA A;  4UYD A;  3O37 A;  5KO4 A;  5IID A;  5CQ4 A;  4QEV A;  5DLZ A;  4WHW A;  3MUK A;  5FE3 A;  2E3K A;  5CUD A;  5A5R A;  3ONI A;  4OGJ A;  5A7C A;  2DVQ A;  2L5E A;  5FFV A;  5CQT A;  4UYF B;  4ZW1 A;  1X0J A;  4QB3 A;  4NYX A;  4IR4 A;  3DAI A;  4O71 A;  4QR4 A;  5DW1 A;  4QR3 A;  2R0Y A;  3QZS A;  4WIV A;  5I86 A;  4O7C A;  4XUB A;  4YAD A;  5LKX A;  4N4G A;  5EIC A;  4O7E A;  4LYW A;  2NXB A;  4UIX A;  4GPJ A;  1ZS5 A;  4KV4 A;  4MEQ A;  5LJ0 A;  5FE2 A;  4CL9 A;  5E9Y A;  4QBM A;  5F36 A;  3O33 A;  3JVJ A;  5G4S A;  5ETB A;  5IG6 A;  5CPE A;  2RFJ A;  4YYM A;  2WP2 A;  4NXJ A;  4QSX A;  4QSQ A;  4LDF A;  4LC2 A;  4YAX A;  3P1C A;  4NR7 A;  4NRA A;  3LJW A;  5LJ2 A;  3Q2E A;  5DX4 A;  4HXP A;  3JVM A;  2GRC A;  4NS5 A;  5FB0 A;  4CUT A;  5G4R A;  3UVW A;  5E9I A;  5D3P A;  4TZ8 A;  4HXM A;  4OGI A;  5COI A;  4Z6I A;  4BW4 A;  4TU4 A;  5E73 A;  3QZV A;  4A9K A; 
#chains in the Genus database with same CATH topology
 5F1L A;  5FG6 A;  4CFK A;  5FH8 A;  1WUG A;  4LZ2 A;  1EQF A;  5E3D A;  5I83 A;  4KCX A;  4F3I A;  5HQ5 A;  5EIS A;  2RNY A;  4A9E A;  5IGN A;  2OO1 A;  4N4H A;  5I40 A;  3P1E A;  5FE1 A;  2EJN A;  5DKH A;  4NYV A;  5D7X A;  4Q0O A;  5CQ3 A;  2RNW A;  4KV1 A;  5LVR A;  4NUE A;  3TLP A;  5I80 A;  5LKZ A;  4N4I A;  3O34 A;  5D0C A;  5LJ1 A;  3MQM A;  5CQ7 A;  4YY4 A;  5CUC A;  5EWW A;  5EPB A;  4PKL A;  5CQ5 A;  5BT5 A;  4IR6 A;  4QSP A;  4BW2 A;  3FKM X;  5L98 A;  4PCE A;  5K29 A;  4LRG A;  5CQA A;  4Z1S A;  4UIU A;  4PY6 A;  3I3J A;  5EQ1 A;  2KTB B;  4PCI A;  3UV4 A;  5KHM A;  5CS8 A;  5EP7 A;  5TB6 A;  4A9J A;  5I7X A;  4Y03 A;  5ENI A;  2YQD A;  3P1F A;  4QNS A;  1PUO A;  5HEN A;  5F63 A;  3HME A;  5FB1 A;  2YYN A;  4TU6 A;  4UIT A;  2FSA A;  5IGK A;  4YH4 A;  4YYI A;  3U5O A;  2G4A A;  4CUQ A;  5EWV A;  3U5P A;  5AD3 A;  4PTB A;  5FE4 A;  2E7N A;  3HMF A;  4YYN A;  5EWH A;  3JVL A;  4QUT A;  3G0L A;  4LR6 A;  5C87 A;  4O76 A;  4J1P A;  4YAB A;  5CY9 A;  5D3N A;  5DKC A;  4Z93 A;  4BJX A;  4NRB A;  4HXS A;  5AME A;  5JI8 A;  4HBX A;  4AKI A;  4YK0 A;  5HFQ A;  3SVF A;  5TCM A;  4QC3 A;  5E9L A;  5BT4 A;  4O75 A;  5EVA A;  4CUR A;  5H1U A;  4LZS A;  5FFY A;  4C66 A;  5DW2 A;  5KTW A;  5F2P A;  3O35 A;  2WP1 A;  2YDW A;  5HLS A;  5HQ6 A;  4QYD A;  5E3G A;  4LYI A;  2DKW A;  4TT4 A;  5F60 A;  5L97 A;  3D1B A;  5BT3 A;  3AQA A;  5ENH A;  4NRC A;  2F6N A;  5D3H A;  4QEU A;  5HQ7 A;  5IBN A;  3SVG A;  4OUF A;  4TTE A;  5ENF A;  4ALG A;  5E9M A;  3U5L A;  4IR3 A;  4AI6 A;  4MR4 A;  4NR5 A;  4O78 A;  5H85 A;  4YH3 A;  5A83 A;  5H1T A;  5ENE A;  4NUD A;  4FLP A;  4TQN A;  5DKD A;  3P5O A;  5A5Q A;  4BW1 A;  5CUE A;  5ENB A;  4A9N A;  5EU1 A;  5C4Q A;  3VKH A;  2OUO A;  5CQ8 A;  4DON A;  4J0S A;  3S91 A;  2YEL A;  5HEM A;  5L8T A;  4ZQL A;  4YYH A;  5C89 A;  3HMH A;  4RVR A;  5DLX A;  5EPS A;  2D9E A;  5LKT A;  5ENC A;  4HBW A;  5C8G A;  5LKU A;  5LUU A;  5ENJ A;  4MR3 A;  2I7K A;  4TS8 A;  4NR9 A;  5CUB A;  4TT2 A;  4A9O A;  1JM4 B;  4AKN A;  4QC1 A;  4Z1Q A;  2R0V A;  4A9F A;  4MR5 A;  5EPR A;  4YBS A;  2DVV A;  2R0S A;  5CU8 A;  4XY9 A;  4UYE A;  4AKG A;  5HCL A;  4YYJ A;  4QSR A;  3UV5 A;  4O74 A;  4TZ2 A;  2N9G A;  5L99 A;  4YY6 A;  5EA1 A;  2RI7 A;  3UW9 A;  4MR6 A;  5HRX A;  4N4F A;  3LQH A;  4NR8 A;  4QR5 A;  5EGU A;  4XUA A;  5HEL A;  4YYK A;  4N3W A;  4NR6 A;  4TT6 A;  4HXL A;  2L84 A;  5CRZ A;  4HXR A;  4YC9 A;  5D26 A;  5L8U A;  4O7A A;  5EI4 A;  3LQI A;  3JVK A;  1F68 A;  1E6I A;  5FE6 A;  3DWY A;  4NUC A;  5E7D A;  4LZR A;  3P1D A;  4AKH A;  4O70 A;  1N72 A;  5II1 A;  5EM3 A;  3S92 A;  2LSP B;  4QZS A;  3D1D A;  5D3R A;  4QUU A;  5D25 A;  5E74 A;  4UIY A;  4ALH A;  5I29 A;  2L85 A;  2YW5 A;  3UVD A;  4UIV A;  4WHU A;  5A82 A;  5AMF A;  5FH6 A;  4QSW A;  5KTU A;  3D7C A;  4MEN A;  5DYC A;  2DVS A;  2RO1 A;  5FE8 A;  4LYS A;  5FBX A;  4YBT A;  5FH7 A;  3MB3 A;  4BHW A;  4UIW A;  5C7N A;  4NQN A;  2D82 A;  4UYH A;  4HXO A;  4Q0N A;  4YYG A;  3RCW A;  2E7O A;  5A5P A;  3O36 A;  4CUP A;  5CGP A;  4UYG A;  5CP5 A;  5L96 A;  3AAD A;  5EV9 A;  5DYA A;  5II2 A;  5A85 A;  5I89 A;  5J0D A;  5DBM A;  4XY8 A;  5EWD A;  4J0R A;  4A9H A;  4O7B A;  3SVH A;  5DFB A;  5DFD A;  4O77 A;  5LVQ A;  4QST A;  5DYX A;  3MXF A;  5D3J A;  3UV2 A;  1JSP B;  4UYF A;  3U5K A;  2YEK A;  4QY4 A;  5IGM A;  2OSS A;  4A9L A;  3LXJ A;  4O7F A;  4Z6H A;  4YYD A;  4HXK A;  5DFC A;  2RS9 B;  5KU3 A;  5ENG A;  5F25 A;  2DVR A;  4C67 A;  4A9M A;  4NR4 A;  4TYL A;  2I8N A;  5DY7 A;  3K2J A;  5FFW A;  5HRV A;  5HM0 A;  5E0R A;  5A81 A;  5CRM A;  4HXN A;  4YAT A;  5A5O A;  3GG3 A;  4QSU A;  3ZYU A;  5A5N A;  4HBV A;  5FE0 A;  4QSV A;  5HJC A;  5FE5 A;  5F62 A;  4QSS A;  3U5N A;  5CUG A;  4CUS A;  5C85 A;  4BW3 A;  4MEO A;  3G0J A;  5D24 A;  3IU6 A;  2DAT A;  5IGL A;  5I7Y A;  4QEW A;  3MB4 A;  5JWM A;  4IOO A;  3UVY A;  5HFR A;  4MEP A;  4PS5 A;  4QYL A;  2YEM A;  5I88 A;  5D3T A;  4E96 A;  3U5M A;  5F61 A;  4CFL A;  5FG5 A;  4CLB A;  5CUA A;  4YBM A;  4A9I A;  4HBY A;  2DWW A;  4O72 A;  5I1Q A;  5E9K A;  3LQJ A;  4UIZ A;  5KTX A;  2MJV B;  2R10 A;  5CZG A;  4IOQ A;  2F6J A;  4CUU A;  5AD2 A;  5CTL A;  5A5S A;  5CFW A;  5HRW A;  2H60 A;  3QZT A;  4IOR A;  5E9V A;  5FG4 A;  2RNX A;  3MUL A;  3ERR A;  5D3S A;  5CQ6 A;  5DYU A;  4ZC9 A;  3UVX A;  3IU5 A;  5F1H A;  5FDZ A;  5ETD A;  5ACY A;  1WUM A;  5D3L A;  5EWC A;  5FE7 A;  5H1V A;  5FE9 A;  5F5Z A;  4X2I A;  4J3I A;  4IR5 A;  4NYW A;  3U5J A;  5EK9 A;  5F3A A;  4NQM A;  3NXB A;  3Q2F A;  4XYA A;  4UYD A;  3O37 A;  5KO4 A;  5IID A;  5CQ4 A;  4QEV A;  5DLZ A;  4WHW A;  3MUK A;  5FE3 A;  2E3K A;  5CUD A;  5A5R A;  3ONI A;  4OGJ A;  5A7C A;  2DVQ A;  2L5E A;  5FFV A;  5CQT A;  4UYF B;  4ZW1 A;  1X0J A;  4QB3 A;  4NYX A;  4IR4 A;  3DAI A;  4O71 A;  4QR4 A;  5DW1 A;  4QR3 A;  2R0Y A;  3QZS A;  4WIV A;  5I86 A;  4O7C A;  4XUB A;  4YAD A;  5LKX A;  4N4G A;  5EIC A;  4O7E A;  4LYW A;  2NXB A;  4UIX A;  4GPJ A;  1ZS5 A;  4KV4 A;  4MEQ A;  5LJ0 A;  5FE2 A;  4CL9 A;  5E9Y A;  4QBM A;  5F36 A;  3O33 A;  3JVJ A;  5G4S A;  5ETB A;  5IG6 A;  5CPE A;  2RFJ A;  4YYM A;  2WP2 A;  4NXJ A;  4QSX A;  4QSQ A;  4LDF A;  1ZKR A;  4LC2 A;  4YAX A;  3P1C A;  4NR7 A;  4NRA A;  3LJW A;  5LJ2 A;  3VKG A;  3Q2E A;  5DX4 A;  4HXP A;  3JVM A;  2GRC A;  4NS5 A;  5FB0 A;  4CUT A;  5G4R A;  3UVW A;  5E9I A;  5D3P A;  4TZ8 A;  4HXM A;  4OGI A;  5COI A;  4Z6I A;  4BW4 A;  4TU4 A;  5E73 A;  3QZV A;  4A9K A; 
#chains in the Genus database with same CATH homology
 5F1L A;  5FG6 A;  4CFK A;  5FH8 A;  1WUG A;  4LZ2 A;  1EQF A;  5E3D A;  5I83 A;  4KCX A;  4F3I A;  5HQ5 A;  5EIS A;  2RNY A;  4A9E A;  5IGN A;  2OO1 A;  4N4H A;  5I40 A;  3P1E A;  5FE1 A;  5DKH A;  4NYV A;  5D7X A;  4Q0O A;  5CQ3 A;  2RNW A;  4KV1 A;  5LVR A;  4NUE A;  3TLP A;  5I80 A;  5LKZ A;  4N4I A;  3O34 A;  5D0C A;  5LJ1 A;  3MQM A;  5CQ7 A;  4YY4 A;  5CUC A;  5EWW A;  5EPB A;  4PKL A;  5CQ5 A;  5BT5 A;  4IR6 A;  4QSP A;  4BW2 A;  3FKM X;  5L98 A;  4PCE A;  5K29 A;  4LRG A;  5CQA A;  4Z1S A;  4UIU A;  4PY6 A;  3I3J A;  5EQ1 A;  2KTB B;  4PCI A;  3UV4 A;  5KHM A;  5CS8 A;  5EP7 A;  5TB6 A;  4A9J A;  5I7X A;  4Y03 A;  5ENI A;  2YQD A;  3P1F A;  4QNS A;  5HEN A;  5F63 A;  3HME A;  5FB1 A;  2YYN A;  4TU6 A;  4UIT A;  2FSA A;  5IGK A;  4YH4 A;  4YYI A;  3U5O A;  2G4A A;  4CUQ A;  5EWV A;  3U5P A;  5AD3 A;  4PTB A;  5FE4 A;  2E7N A;  3HMF A;  4YYN A;  5EWH A;  3JVL A;  4QUT A;  3G0L A;  4LR6 A;  5C87 A;  4O76 A;  4J1P A;  4YAB A;  5CY9 A;  5D3N A;  5DKC A;  4Z93 A;  4BJX A;  4NRB A;  4HXS A;  5AME A;  5JI8 A;  4HBX A;  4YK0 A;  5HFQ A;  3SVF A;  5TCM A;  4QC3 A;  5E9L A;  5BT4 A;  4O75 A;  5EVA A;  4CUR A;  5H1U A;  4LZS A;  5FFY A;  4C66 A;  5DW2 A;  5KTW A;  5F2P A;  3O35 A;  2WP1 A;  2YDW A;  5HLS A;  5HQ6 A;  4QYD A;  5E3G A;  4LYI A;  2DKW A;  4TT4 A;  5F60 A;  5L97 A;  5BT3 A;  3AQA A;  5ENH A;  4NRC A;  2F6N A;  5D3H A;  4QEU A;  5HQ7 A;  5IBN A;  3SVG A;  4OUF A;  4TTE A;  5ENF A;  4ALG A;  5E9M A;  3U5L A;  4IR3 A;  4MR4 A;  4NR5 A;  4O78 A;  5H85 A;  4YH3 A;  5A83 A;  5H1T A;  5ENE A;  4NUD A;  4FLP A;  4TQN A;  5DKD A;  3P5O A;  5A5Q A;  4BW1 A;  5CUE A;  5ENB A;  4A9N A;  5EU1 A;  5C4Q A;  2OUO A;  5CQ8 A;  4DON A;  4J0S A;  3S91 A;  2YEL A;  5HEM A;  5L8T A;  4ZQL A;  4YYH A;  5C89 A;  3HMH A;  4RVR A;  5DLX A;  5EPS A;  2D9E A;  5LKT A;  5ENC A;  4HBW A;  5C8G A;  5LKU A;  5LUU A;  5ENJ A;  4MR3 A;  2I7K A;  4TS8 A;  4NR9 A;  5CUB A;  4TT2 A;  4A9O A;  1JM4 B;  4AKN A;  4QC1 A;  4Z1Q A;  2R0V A;  4A9F A;  4MR5 A;  5EPR A;  4YBS A;  2DVV A;  2R0S A;  5CU8 A;  4XY9 A;  4UYE A;  5HCL A;  4YYJ A;  4QSR A;  3UV5 A;  4O74 A;  4TZ2 A;  2N9G A;  5L99 A;  4YY6 A;  5EA1 A;  2RI7 A;  3UW9 A;  4MR6 A;  5HRX A;  4N4F A;  3LQH A;  4NR8 A;  4QR5 A;  5EGU A;  4XUA A;  5HEL A;  4YYK A;  4N3W A;  4NR6 A;  4TT6 A;  4HXL A;  2L84 A;  5CRZ A;  4HXR A;  4YC9 A;  5D26 A;  5L8U A;  4O7A A;  5EI4 A;  3LQI A;  3JVK A;  1F68 A;  1E6I A;  5FE6 A;  3DWY A;  4NUC A;  5E7D A;  4LZR A;  3P1D A;  4O70 A;  1N72 A;  5II1 A;  5EM3 A;  3S92 A;  2LSP B;  4QZS A;  5D3R A;  4QUU A;  5D25 A;  5E74 A;  4UIY A;  4ALH A;  5I29 A;  2L85 A;  2YW5 A;  3UVD A;  4UIV A;  4WHU A;  5A82 A;  5AMF A;  5FH6 A;  4QSW A;  5KTU A;  3D7C A;  4MEN A;  5DYC A;  2DVS A;  2RO1 A;  5FE8 A;  4LYS A;  5FBX A;  4YBT A;  5FH7 A;  3MB3 A;  4BHW A;  4UIW A;  5C7N A;  4NQN A;  2D82 A;  4UYH A;  4HXO A;  4Q0N A;  4YYG A;  3RCW A;  2E7O A;  5A5P A;  3O36 A;  4CUP A;  5CGP A;  4UYG A;  5CP5 A;  5L96 A;  3AAD A;  5EV9 A;  5DYA A;  5II2 A;  5A85 A;  5I89 A;  5J0D A;  5DBM A;  4XY8 A;  5EWD A;  4J0R A;  4A9H A;  4O7B A;  3SVH A;  5DFB A;  5DFD A;  4O77 A;  5LVQ A;  4QST A;  5DYX A;  3MXF A;  5D3J A;  3UV2 A;  1JSP B;  4UYF A;  3U5K A;  2YEK A;  4QY4 A;  5IGM A;  2OSS A;  4A9L A;  3LXJ A;  4O7F A;  4Z6H A;  4YYD A;  4HXK A;  5DFC A;  2RS9 B;  5KU3 A;  5ENG A;  5F25 A;  2DVR A;  4C67 A;  4A9M A;  4NR4 A;  4TYL A;  2I8N A;  5DY7 A;  3K2J A;  5FFW A;  5HRV A;  5HM0 A;  5E0R A;  5A81 A;  5CRM A;  4HXN A;  4YAT A;  5A5O A;  3GG3 A;  4QSU A;  3ZYU A;  5A5N A;  4HBV A;  5FE0 A;  4QSV A;  5HJC A;  5FE5 A;  5F62 A;  4QSS A;  3U5N A;  5CUG A;  4CUS A;  5C85 A;  4BW3 A;  4MEO A;  3G0J A;  5D24 A;  3IU6 A;  2DAT A;  5IGL A;  5I7Y A;  4QEW A;  3MB4 A;  5JWM A;  4IOO A;  3UVY A;  5HFR A;  4MEP A;  4PS5 A;  4QYL A;  2YEM A;  5I88 A;  5D3T A;  4E96 A;  3U5M A;  5F61 A;  4CFL A;  5FG5 A;  4CLB A;  5CUA A;  4YBM A;  4A9I A;  4HBY A;  2DWW A;  4O72 A;  5I1Q A;  5E9K A;  3LQJ A;  4UIZ A;  5KTX A;  2MJV B;  2R10 A;  5CZG A;  4IOQ A;  2F6J A;  4CUU A;  5AD2 A;  5CTL A;  5A5S A;  5CFW A;  5HRW A;  2H60 A;  3QZT A;  4IOR A;  5E9V A;  5FG4 A;  2RNX A;  3MUL A;  5D3S A;  5CQ6 A;  5DYU A;  4ZC9 A;  3UVX A;  3IU5 A;  5F1H A;  5FDZ A;  5ETD A;  5ACY A;  1WUM A;  5D3L A;  5EWC A;  5FE7 A;  5H1V A;  5FE9 A;  5F5Z A;  4X2I A;  4J3I A;  4IR5 A;  4NYW A;  3U5J A;  5EK9 A;  5F3A A;  4NQM A;  3NXB A;  3Q2F A;  4XYA A;  4UYD A;  3O37 A;  5KO4 A;  5IID A;  5CQ4 A;  4QEV A;  5DLZ A;  4WHW A;  3MUK A;  5FE3 A;  2E3K A;  5CUD A;  5A5R A;  3ONI A;  4OGJ A;  5A7C A;  2DVQ A;  2L5E A;  5FFV A;  5CQT A;  4UYF B;  4ZW1 A;  1X0J A;  4QB3 A;  4NYX A;  4IR4 A;  3DAI A;  4O71 A;  4QR4 A;  5DW1 A;  4QR3 A;  2R0Y A;  3QZS A;  4WIV A;  5I86 A;  4O7C A;  4XUB A;  4YAD A;  5LKX A;  4N4G A;  5EIC A;  4O7E A;  4LYW A;  2NXB A;  4UIX A;  4GPJ A;  1ZS5 A;  4KV4 A;  4MEQ A;  5LJ0 A;  5FE2 A;  4CL9 A;  5E9Y A;  4QBM A;  5F36 A;  3O33 A;  3JVJ A;  5G4S A;  5ETB A;  5IG6 A;  5CPE A;  2RFJ A;  4YYM A;  2WP2 A;  4NXJ A;  4QSX A;  4QSQ A;  4LDF A;  4LC2 A;  4YAX A;  3P1C A;  4NR7 A;  4NRA A;  3LJW A;  5LJ2 A;  3Q2E A;  5DX4 A;  4HXP A;  3JVM A;  2GRC A;  4NS5 A;  5FB0 A;  4CUT A;  5G4R A;  3UVW A;  5E9I A;  5D3P A;  4TZ8 A;  4HXM A;  4OGI A;  5COI A;  4Z6I A;  4BW4 A;  4TU4 A;  5E73 A;  3QZV A;  4A9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...