5I29A

Taf1(2) bound to a pyrrolopyridone compound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
139
structure length
139
Chain Sequence
DDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/inhibitor
molecule keywords Transcription initiation factor TFIID subunit 1
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 139
sequence length 139
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i29A00
4XUBA 4TU4A 5I89A 4NUEA 2D82A 4YYMA 3LJWA 3G0LA 5EPBA 5ETBA 4O71A 5F2PA 5F62A 4QSQA 5D3JA 5H85A 2MJVB 2R10A 5DYAA 5F25A 2L84A 4BJXA 2DVVA 3G0JA 5LUUA 4IR3A 5E74A 5LKZA 5C8GA 4NR9A 5KTWA 5TCMA 5J0DA 2R0VA 3HMEA 2GRCA 5AMEA 2OUOA 4AKNA 4YH3A 4LC2A 2NXBA 4BW4A 4QSUA 4TYLA 3QZSA 1WUGA 4N4IA 5C7NA 4O7AA 4Q0NA 5I40A 2E7NA 5ENEA 3AQAA 3UV2A 5CTLA 4NR6A 4NR8A 4GPJA 4A9FA 3UVYA 4QC3A 4MEOA 5EU1A 3Q2FA 4HXOA 4OGIA 4NUCA 4NRAA 5HJCA 5ACYA 5F3AA 4CURA 4IOQA 5D3LA 4KCXA 4O74A 5DKHA 2YELA 5CY9A 5ETDA 5CQTA 3ONIA 5EPRA 5HLSA 4QSTA 5HQ6A 5BT3A 4YY4A 4TZ8A 5LVQA 5E3GA 4NR5A 4NXJA 4CFKA 4YYDA 3UV5A 4OUFA 3JVMA 4A9HA 4ALGA 4C66A 5CUCA 4UIVA 2RNWA 5A83A 2DVQA 4BHWA 2N9GA 4CL9A 5DX4A 5K29A 2F6NA 5ENJA 5F36A 5IGKA 4YH4A 5HEMA 3JVLA 2FSAA 5D3TA 4YYNA 4YC9A 5EWCA 5L97A 3S92A 5FDZA 5CQ3A 4CUSA 4IR5A 5EK9A 5FH6A 3SVFA 3UW9A 5DY7A 5HELA 5EP7A 3QZVA 2YYNA 3AADA 4NYVA 5EWWA 4Z6HA 3U5NA 4J0SA 4A9OA 4RVRA 5L8UA 5KTXA 2RS9B 2DKWA 3ZYUA 4IR4A 1X0JA 4QYLA 5EGUA 5A7CA 4YBTA 5CUDA 2L5EA 4HBVA 4YYKA 4NUDA 5DFCA 5D3SA 5CS8A 5FE3A 5DKDA 5EWHA 5F61A 2R0SA 5FE8A 5KU3A 5BT4A 5G4RA 4TTEA 2YQDA 4PY6A 3DAIA 4UYHA 5A85A 4HXNA 1E6IA 4BW2A 4LZ2A 4QC1A 5CUAA 5D3NA 4UIZA 4CUPA 5CFWA 3MULA 4LYSA 1WUMA 3U5JA 5IG6A 5A5RA 4CUQA 5FE9A 2RI7A 5I88A 2WP2A 4CFLA 4UIYA 5CQAA 5ENBA 4N4HA 4LZRA 5D0CA 3MQMA 4HXRA 4TT2A 5CUEA 5HRXA 3O34A 5EISA 4ZC9A 3D7CA 4UYFA 5HFRA 4J3IA 4YABA 4QSSA 5FG5A 5AD2A 5II1A 1ZS5A 5I86A 4QR3A 2R0YA 5EICA 3U5KA 5CQ4A 4YYGA 1JM4B 4LDFA 4F3IA 4NQNA 4FLPA 4WHUA 5EWVA 5A5OA 3SVGA 4BW1A 2H60A 4NYXA 5F63A 5LKUA 5CQ5A 2F6JA 4A9LA 4XYAA 5AD3A 2LSPB 4MR6A 5I7YA 4IOOA 4WHWA 4TT6A 5E73A 5EA1A 4O7BA 3DWYA 4IR6A 3O33A 5FB1A 5DW2A 5E7DA 4MEPA 4UYGA 5FB0A 5FE6A 5I83A 4MEQA 2OO1A 4O7EA 4QUTA 4MR5A 1N72A 4N3WA 5FG4A 5DLZA 5A5QA 5FE2A 2DATA 5FFVA 3JVJA 5CUGA 4HBXA 4UYFB 5D26A 4LRGA 5H1VA 4Q0OA 4HXSA 1JSPB 5C87A 4O78A 5EWDA 4CUTA 4YYIA 5E9YA 2YW5A 5I29A 5FE4A 2L85A 3RCWA 5ENFA 4X2IA 5A81A 3LQIA 5KO4A 4QSRA 4YADA 5FFYA 4NQMA 5D7XA 4N4FA 4BW3A 5L98A 4YBSA 3U5LA 5IBNA 5E9IA 5ENGA 4O76A 5FG6A 4HXPA 5IGNA 4QY4A 5EM3A 4QEUA 4XY8A 4O75A 5JWMA 2G4AA 5KHMA 5KTUA 4PS5A 3NXBA 5EI4A 5HFQA 2RNYA 2WP1A 5EVAA 4PCEA 5A5SA 3O37A 3P1FA 4QYDA 5LJ1A 4LYIA 4ALHA 5FE1A 3GG3A 3MUKA 4UYEA 4QSVA 3MB4A 5CQ7A 4WIVA 5ENCA 5D3HA 2RNXA 4YK0A 5BT5A 4HXMA 5FE0A 4CUUA 5CGPA 5F60A 4YAXA 4C67A 5E9LA 5TB6A 5LJ0A 4Z1QA 5G4SA 5FE7A 4Z6IA 5E0RA 4ZW1A 5LKTA 3IU6A 5D3RA 4UIWA 5A5NA 4Y03A 4QB3A 5DYUA 5IGMA 5CRZA 4QEWA 2RFJA 3UVDA 3LQHA 4CLBA 3LQJA 4MENA 4O70A 5DLXA 4O7CA 5L96A 5HQ5A 5CZGA 4UIXA 5FH7A 5HM0A 4HBYA 5HQ7A 4HBWA 4TZ2A 3HMHA 3O36A 4J0RA 4OGJA 3P1DA 5ENHA 4YBMA 4Z1SA 4QEVA 3FKMX 4HXKA 2RO1A 4QR5A 5CQ6A 5CQ8A 3U5OA 4XY9A 5IIDA 4UITA 3JVKA 5LVRA 1F68A 5D25A 3K2JA 3O35A 4O77A 5CRMA 5FBXA 3UVWA 4UYDA 2OSSA 5C4QA 5A82A 3P1CA 4PKLA 2DVSA 4KV4A 5DBMA 4A9NA 4A9MA 4QNSA 3UV4A 2YEMA 4TU6A 2E3KA 2YDWA 3LXJA 5HENA 5I7XA 4QSXA 4NR7A 4UIUA 5D3PA 4Z93A 3MXFA 3P1EA 5LKXA 4QSWA 5DKCA 5II2A 2I7KA 5EPSA 5FE5A 4TS8A 2YEKA 4NS5A 5HCLA 4YATA 5DYXA 4O7FA 5DYCA 5IGLA 5HRVA 5F1LA 2E7OA 4XUAA 5ENIA 2I8NA 5DFDA 4YY6A 4O72A 3TLPA 4LR6A 5L99A 3U5PA 5E3DA 5FH8A 3I3JA 2D9EA 4NRBA 4HXLA 4KV1A 4A9EA 4PTBA 3P5OA 5EV9A 5CUBA 1EQFA 5F1HA 4J1PA 3UVXA 5L8TA 5DW1A 5H1UA 5H1TA 4MR3A 4QZSA 5LJ2A 5DFBA 4LYWA 3IU5A 5C85A 4YYJA 4TQNA 3S91A 4DONA 4NR4A 5COIA 5E9VA 3Q2EA 4IORA 5E9MA 4NRCA 4QUUA 3U5MA 5A5PA 3QZTA 4PCIA 4A9JA 4A9IA 5D24A 4NYWA 5CU8A 5I80A 4E96A 5AMFA 4LZSA 4QR4A 5HRWA 4N4GA 3SVHA 5I1QA 5CP5A 5E9KA 4YYHA 2DVRA 5JI8A 4MR4A 2KTBB 3HMFA 4QBMA 5CPEA 4TT4A 4A9KA 5EQ1A 2DWWA 4ZQLA 5FFWA 3MB3A 4QSPA 5C89A 5F5ZA
chains in the Genus database with same CATH superfamily
4XUBA 4TU4A 5I89A 4NUEA 2D82A 4YYMA 3LJWA 3G0LA 5EPBA 5ETBA 4O71A 5F2PA 5F62A 4QSQA 5D3JA 5H85A 2MJVB 2R10A 5DYAA 5F25A 2L84A 4BJXA 2DVVA 3G0JA 5LUUA 4IR3A 5E74A 5LKZA 5C8GA 4NR9A 5KTWA 5TCMA 5J0DA 2R0VA 3HMEA 2GRCA 5AMEA 2OUOA 4AKNA 4YH3A 4LC2A 2NXBA 4BW4A 4QSUA 4TYLA 3QZSA 1WUGA 4N4IA 5C7NA 4O7AA 4Q0NA 5I40A 2E7NA 5ENEA 3AQAA 3UV2A 5CTLA 4NR6A 3D1BA 4NR8A 4GPJA 4A9FA 3UVYA 4QC3A 4MEOA 5EU1A 3Q2FA 4HXOA 4OGIA 4NUCA 4NRAA 5HJCA 5ACYA 5F3AA 4CURA 4IOQA 5D3LA 1PUOA 4KCXA 4O74A 5DKHA 2YELA 5CY9A 5ETDA 5CQTA 3ONIA 5EPRA 5HLSA 4QSTA 5HQ6A 3VKGA 5BT3A 4YY4A 4TZ8A 5LVQA 5E3GA 4NR5A 4NXJA 4CFKA 4YYDA 3UV5A 4OUFA 3JVMA 4A9HA 4ALGA 4C66A 5CUCA 4UIVA 2RNWA 5A83A 2DVQA 4BHWA 2N9GA 4CL9A 5DX4A 5K29A 2F6NA 5ENJA 5F36A 5IGKA 4YH4A 4AI6A 5HEMA 3JVLA 2FSAA 5D3TA 4YYNA 4YC9A 5EWCA 5L97A 3S92A 5FDZA 5CQ3A 4CUSA 4IR5A 5EK9A 5FH6A 3SVFA 3UW9A 5DY7A 5HELA 5EP7A 3QZVA 2YYNA 3AADA 4NYVA 5EWWA 4Z6HA 3U5NA 4J0SA 4A9OA 4RVRA 5L8UA 5KTXA 2RS9B 2DKWA 3ZYUA 4IR4A 1X0JA 4QYLA 5EGUA 5A7CA 4YBTA 5CUDA 2L5EA 4HBVA 3ERRA 4NUDA 4YYKA 5DFCA 5D3SA 5CS8A 5FE3A 5DKDA 5EWHA 5F61A 2R0SA 5FE8A 5KU3A 5BT4A 5G4RA 4TTEA 2YQDA 4PY6A 3DAIA 4UYHA 5A85A 4HXNA 1E6IA 4BW2A 4LZ2A 4QC1A 4AKGA 5CUAA 5D3NA 4UIZA 4CUPA 5CFWA 3MULA 4LYSA 1WUMA 3U5JA 5IG6A 5A5RA 4CUQA 5FE9A 2RI7A 5I88A 2WP2A 4CFLA 4UIYA 5CQAA 5ENBA 4N4HA 4LZRA 5D0CA 3MQMA 4HXRA 4TT2A 5CUEA 5HRXA 3O34A 5EISA 4ZC9A 3D7CA 4UYFA 5HFRA 4J3IA 4YABA 4QSSA 5FG5A 5AD2A 5II1A 1ZS5A 5I86A 4QR3A 2R0YA 5EICA 3U5KA 5CQ4A 4YYGA 1JM4B 4LDFA 4F3IA 4NQNA 4FLPA 4WHUA 4AKHA 5EWVA 5A5OA 3SVGA 4BW1A 2H60A 4NYXA 5F63A 5LKUA 5CQ5A 2F6JA 4A9LA 4XYAA 5AD3A 2LSPB 4MR6A 5I7YA 4IOOA 4WHWA 4TT6A 5E73A 5EA1A 4O7BA 3DWYA 4IR6A 3O33A 5FB1A 5DW2A 5E7DA 4MEPA 4UYGA 5FB0A 5FE6A 5I83A 4MEQA 2OO1A 4O7EA 4QUTA 4MR5A 1N72A 4N3WA 5FG4A 5DLZA 5A5QA 5FE2A 2DATA 5FFVA 3JVJA 5CUGA 4HBXA 4UYFB 5D26A 4LRGA 5H1VA 4AKIA 4Q0OA 4HXSA 1JSPB 5C87A 4O78A 5EWDA 4CUTA 4YYIA 5E9YA 2YW5A 5I29A 5FE4A 2L85A 3RCWA 5ENFA 4X2IA 3D1DA 3LQIA 5A81A 5KO4A 4QSRA 4YADA 5FFYA 4NQMA 5D7XA 4N4FA 4BW3A 5L98A 4YBSA 3U5LA 5IBNA 5E9IA 5ENGA 4O76A 5FG6A 4HXPA 5IGNA 4QY4A 5EM3A 4QEUA 4XY8A 4O75A 5JWMA 2G4AA 5KHMA 5KTUA 4PS5A 3NXBA 5EI4A 5HFQA 2RNYA 2WP1A 5EVAA 4PCEA 5A5SA 3O37A 3P1FA 4QYDA 5LJ1A 4LYIA 4ALHA 5FE1A 3GG3A 3MUKA 4UYEA 4QSVA 3MB4A 5CQ7A 4WIVA 5ENCA 5D3HA 2RNXA 4YK0A 5BT5A 4HXMA 5FE0A 4CUUA 5CGPA 5F60A 4YAXA 4C67A 5E9LA 5TB6A 5LJ0A 4Z1QA 5G4SA 5FE7A 4Z6IA 5E0RA 4ZW1A 5LKTA 3IU6A 5D3RA 4UIWA 5A5NA 4Y03A 4QB3A 5DYUA 5IGMA 5CRZA 4QEWA 2RFJA 3UVDA 3LQHA 4CLBA 3LQJA 4MENA 4O70A 5DLXA 4O7CA 5L96A 5HQ5A 5CZGA 4UIXA 5FH7A 5HM0A 4HBYA 5HQ7A 4HBWA 4TZ2A 3HMHA 3O36A 4J0RA 4OGJA 2EJNA 3P1DA 5ENHA 4YBMA 4Z1SA 4QEVA 3FKMX 4HXKA 2RO1A 4QR5A 5CQ6A 5CQ8A 3U5OA 4XY9A 5IIDA 4UITA 3JVKA 5LVRA 1F68A 5D25A 3K2JA 3O35A 4O77A 5CRMA 5FBXA 3UVWA 4UYDA 2OSSA 5C4QA 5A82A 1ZKRA 3P1CA 4PKLA 2DVSA 4KV4A 5DBMA 4A9NA 4A9MA 4QNSA 3UV4A 3VKHA 2YEMA 4TU6A 2E3KA 2YDWA 3LXJA 5HENA 5I7XA 4QSXA 4NR7A 4UIUA 5D3PA 4Z93A 3MXFA 3P1EA 5LKXA 4QSWA 5DKCA 5II2A 2I7KA 5EPSA 5FE5A 4TS8A 2YEKA 4NS5A 5HCLA 4YATA 5DYXA 4O7FA 5DYCA 5IGLA 5HRVA 5F1LA 2E7OA 4XUAA 5ENIA 2I8NA 5DFDA 4YY6A 4O72A 3TLPA 4LR6A 5L99A 3U5PA 5E3DA 5FH8A 3I3JA 2D9EA 4NRBA 4HXLA 4KV1A 4A9EA 4PTBA 3P5OA 5EV9A 5CUBA 1EQFA 5F1HA 4J1PA 3UVXA 5L8TA 5DW1A 5H1UA 5H1TA 4MR3A 4QZSA 5LJ2A 5DFBA 4LYWA 3IU5A 5C85A 4YYJA 4TQNA 3S91A 4DONA 4NR4A 5COIA 5E9VA 3Q2EA 4IORA 5E9MA 4NRCA 4QUUA 3U5MA 5A5PA 3QZTA 4PCIA 4A9JA 4A9IA 5D24A 4NYWA 5CU8A 5I80A 4E96A 5AMFA 4LZSA 4QR4A 5HRWA 4N4GA 3SVHA 5I1QA 5CP5A 5E9KA 4YYHA 2DVRA 5JI8A 4MR4A 2KTBB 3HMFA 4QBMA 5CPEA 4TT4A 4A9KA 5EQ1A 2DWWA 4ZQLA 5FFWA 3MB3A 4QSPA 5C89A 5F5ZA
chains in the Genus database with same CATH topology
4XUBA 4TU4A 5I89A 4NUEA 2D82A 4YYMA 3LJWA 3G0LA 5EPBA 5ETBA 4O71A 5F2PA 5F62A 4QSQA 5D3JA 5H85A 2MJVB 2R10A 5DYAA 5F25A 2L84A 4BJXA 2DVVA 3G0JA 5LUUA 4IR3A 5E74A 5LKZA 5C8GA 4NR9A 5KTWA 5TCMA 5J0DA 2R0VA 3HMEA 2GRCA 5AMEA 2OUOA 4AKNA 4YH3A 4LC2A 2NXBA 4BW4A 4QSUA 4TYLA 3QZSA 1WUGA 4N4IA 5C7NA 4O7AA 4Q0NA 5I40A 2E7NA 5ENEA 3AQAA 3UV2A 5CTLA 4NR6A 4NR8A 4GPJA 4A9FA 3UVYA 4QC3A 4MEOA 5EU1A 3Q2FA 4HXOA 4OGIA 4NUCA 4NRAA 5HJCA 5ACYA 5F3AA 4CURA 4IOQA 5D3LA 4KCXA 4O74A 5DKHA 2YELA 5CY9A 5ETDA 5CQTA 3ONIA 5EPRA 5HLSA 4QSTA 5HQ6A 5BT3A 4YY4A 4TZ8A 5LVQA 5E3GA 4NR5A 4NXJA 4CFKA 4YYDA 3UV5A 4OUFA 3JVMA 4A9HA 4ALGA 4C66A 5CUCA 4UIVA 2RNWA 5A83A 2DVQA 4BHWA 2N9GA 4CL9A 5DX4A 5K29A 2F6NA 5ENJA 5F36A 5IGKA 4YH4A 5HEMA 3JVLA 2FSAA 5D3TA 4YYNA 4YC9A 5EWCA 5L97A 3S92A 5FDZA 5CQ3A 4CUSA 4IR5A 5EK9A 5FH6A 3SVFA 3UW9A 5DY7A 5HELA 5EP7A 3QZVA 2YYNA 3AADA 4NYVA 5EWWA 4Z6HA 3U5NA 4J0SA 4A9OA 4RVRA 5L8UA 5KTXA 2RS9B 2DKWA 3ZYUA 4IR4A 1X0JA 4QYLA 5EGUA 5A7CA 4YBTA 5CUDA 2L5EA 4HBVA 4YYKA 4NUDA 5DFCA 5D3SA 5CS8A 5FE3A 5DKDA 5EWHA 5F61A 2R0SA 5FE8A 5KU3A 5BT4A 5G4RA 4TTEA 2YQDA 4PY6A 3DAIA 4UYHA 5A85A 4HXNA 1E6IA 4BW2A 4LZ2A 4QC1A 5CUAA 5D3NA 4UIZA 4CUPA 5CFWA 3MULA 4LYSA 1WUMA 3U5JA 5IG6A 5A5RA 4CUQA 5FE9A 2RI7A 5I88A 2WP2A 4CFLA 4UIYA 5CQAA 5ENBA 4N4HA 4LZRA 5D0CA 3MQMA 4HXRA 4TT2A 5CUEA 5HRXA 3O34A 5EISA 4ZC9A 3D7CA 4UYFA 5HFRA 4J3IA 4YABA 4QSSA 5FG5A 5AD2A 5II1A 1ZS5A 5I86A 4QR3A 2R0YA 5EICA 3U5KA 5CQ4A 4YYGA 1JM4B 4LDFA 4F3IA 4NQNA 4FLPA 4WHUA 5EWVA 5A5OA 3SVGA 4BW1A 2H60A 4NYXA 5F63A 5LKUA 5CQ5A 2F6JA 4A9LA 4XYAA 5AD3A 2LSPB 4MR6A 5I7YA 4IOOA 4WHWA 4TT6A 5E73A 5EA1A 4O7BA 3DWYA 4IR6A 3O33A 5FB1A 5DW2A 5E7DA 4MEPA 4UYGA 5FB0A 5FE6A 5I83A 4MEQA 2OO1A 4O7EA 4QUTA 4MR5A 1N72A 4N3WA 5FG4A 5DLZA 5A5QA 5FE2A 2DATA 5FFVA 3JVJA 5CUGA 4HBXA 4UYFB 5D26A 4LRGA 5H1VA 4Q0OA 4HXSA 1JSPB 5C87A 4O78A 5EWDA 4CUTA 4YYIA 5E9YA 2YW5A 5I29A 5FE4A 2L85A 3RCWA 5ENFA 4X2IA 5A81A 3LQIA 5KO4A 4QSRA 4YADA 5FFYA 4NQMA 5D7XA 4N4FA 4BW3A 5L98A 4YBSA 3U5LA 5IBNA 5E9IA 5ENGA 4O76A 5FG6A 4HXPA 5IGNA 4QY4A 5EM3A 4QEUA 4XY8A 4O75A 5JWMA 2G4AA 5KHMA 5KTUA 4PS5A 3NXBA 5EI4A 5HFQA 2RNYA 2WP1A 5EVAA 4PCEA 5A5SA 3O37A 3P1FA 4QYDA 5LJ1A 4LYIA 4ALHA 5FE1A 3GG3A 3MUKA 4UYEA 4QSVA 3MB4A 5CQ7A 4WIVA 5ENCA 5D3HA 2RNXA 4YK0A 5BT5A 4HXMA 5FE0A 4CUUA 5CGPA 5F60A 4YAXA 4C67A 5E9LA 5TB6A 5LJ0A 4Z1QA 5G4SA 5FE7A 4Z6IA 5E0RA 4ZW1A 5LKTA 3IU6A 5D3RA 4UIWA 5A5NA 4Y03A 4QB3A 5DYUA 5IGMA 5CRZA 4QEWA 2RFJA 3UVDA 3LQHA 4CLBA 3LQJA 4MENA 4O70A 5DLXA 4O7CA 5L96A 5HQ5A 5CZGA 4UIXA 5FH7A 5HM0A 4HBYA 5HQ7A 4HBWA 4TZ2A 3HMHA 3O36A 4J0RA 4OGJA 3P1DA 5ENHA 4YBMA 4Z1SA 4QEVA 3FKMX 4HXKA 2RO1A 4QR5A 5CQ6A 5CQ8A 3U5OA 4XY9A 5IIDA 4UITA 3JVKA 5LVRA 1F68A 5D25A 3K2JA 3O35A 4O77A 5CRMA 5FBXA 3UVWA 4UYDA 2OSSA 5C4QA 5A82A 3P1CA 4PKLA 2DVSA 4KV4A 5DBMA 4A9NA 4A9MA 4QNSA 3UV4A 2YEMA 4TU6A 2E3KA 2YDWA 3LXJA 5HENA 5I7XA 4QSXA 4NR7A 4UIUA 5D3PA 4Z93A 3MXFA 3P1EA 5LKXA 4QSWA 5DKCA 5II2A 2I7KA 5EPSA 5FE5A 4TS8A 2YEKA 4NS5A 5HCLA 4YATA 5DYXA 4O7FA 5DYCA 5IGLA 5HRVA 5F1LA 2E7OA 4XUAA 5ENIA 2I8NA 5DFDA 4YY6A 4O72A 3TLPA 4LR6A 5L99A 3U5PA 5E3DA 5FH8A 3I3JA 2D9EA 4NRBA 4HXLA 4KV1A 4A9EA 4PTBA 3P5OA 5EV9A 5CUBA 1EQFA 5F1HA 4J1PA 3UVXA 5L8TA 5DW1A 5H1UA 5H1TA 4MR3A 4QZSA 5LJ2A 5DFBA 4LYWA 3IU5A 5C85A 4YYJA 4TQNA 3S91A 4DONA 4NR4A 5COIA 5E9VA 3Q2EA 4IORA 5E9MA 4NRCA 4QUUA 3U5MA 5A5PA 3QZTA 4PCIA 4A9JA 4A9IA 5D24A 4NYWA 5CU8A 5I80A 4E96A 5AMFA 4LZSA 4QR4A 5HRWA 4N4GA 3SVHA 5I1QA 5CP5A 5E9KA 4YYHA 2DVRA 5JI8A 4MR4A 2KTBB 3HMFA 4QBMA 5CPEA 4TT4A 4A9KA 5EQ1A 2DWWA 4ZQLA 5FFWA 3MB3A 4QSPA 5C89A 5F5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUB A;  4TU4 A;  5I89 A;  4NUE A;  2D82 A;  4YYM A;  3LJW A;  3G0L A;  5EPB A;  5ETB A;  4O71 A;  5F2P A;  5F62 A;  4QSQ A;  5D3J A;  5H85 A;  2MJV B;  2R10 A;  5DYA A;  5F25 A;  2L84 A;  4BJX A;  2DVV A;  3G0J A;  5LUU A;  4IR3 A;  5E74 A;  5LKZ A;  5C8G A;  4NR9 A;  5KTW A;  5TCM A;  5J0D A;  2R0V A;  3HME A;  2GRC A;  5AME A;  2OUO A;  4AKN A;  4YH3 A;  4LC2 A;  2NXB A;  4BW4 A;  4QSU A;  4TYL A;  3QZS A;  1WUG A;  4N4I A;  5C7N A;  4O7A A;  4Q0N A;  5I40 A;  2E7N A;  5ENE A;  3AQA A;  3UV2 A;  5CTL A;  4NR6 A;  4NR8 A;  4GPJ A;  4A9F A;  3UVY A;  4QC3 A;  4MEO A;  5EU1 A;  3Q2F A;  4HXO A;  4OGI A;  4NUC A;  4NRA A;  5HJC A;  5ACY A;  5F3A A;  4CUR A;  4IOQ A;  5D3L A;  4KCX A;  4O74 A;  5DKH A;  2YEL A;  5CY9 A;  5ETD A;  5CQT A;  3ONI A;  5EPR A;  5HLS A;  4QST A;  5HQ6 A;  5BT3 A;  4YY4 A;  4TZ8 A;  5LVQ A;  5E3G A;  4NR5 A;  4NXJ A;  4CFK A;  4YYD A;  3UV5 A;  4OUF A;  3JVM A;  4A9H A;  4ALG A;  4C66 A;  5CUC A;  4UIV A;  2RNW A;  5A83 A;  2DVQ A;  4BHW A;  2N9G A;  4CL9 A;  5DX4 A;  5K29 A;  2F6N A;  5ENJ A;  5F36 A;  5IGK A;  4YH4 A;  5HEM A;  3JVL A;  2FSA A;  5D3T A;  4YYN A;  4YC9 A;  5EWC A;  5L97 A;  3S92 A;  5FDZ A;  5CQ3 A;  4CUS A;  4IR5 A;  5EK9 A;  5FH6 A;  3SVF A;  3UW9 A;  5DY7 A;  5HEL A;  5EP7 A;  3QZV A;  2YYN A;  3AAD A;  4NYV A;  5EWW A;  4Z6H A;  3U5N A;  4J0S A;  4A9O A;  4RVR A;  5L8U A;  5KTX A;  2RS9 B;  2DKW A;  3ZYU A;  4IR4 A;  1X0J A;  4QYL A;  5EGU A;  5A7C A;  4YBT A;  5CUD A;  2L5E A;  4HBV A;  4YYK A;  4NUD A;  5DFC A;  5D3S A;  5CS8 A;  5FE3 A;  5DKD A;  5EWH A;  5F61 A;  2R0S A;  5FE8 A;  5KU3 A;  5BT4 A;  5G4R A;  4TTE A;  2YQD A;  4PY6 A;  3DAI A;  4UYH A;  5A85 A;  4HXN A;  1E6I A;  4BW2 A;  4LZ2 A;  4QC1 A;  5CUA A;  5D3N A;  4UIZ A;  4CUP A;  5CFW A;  3MUL A;  4LYS A;  1WUM A;  3U5J A;  5IG6 A;  5A5R A;  4CUQ A;  5FE9 A;  2RI7 A;  5I88 A;  2WP2 A;  4CFL A;  4UIY A;  5CQA A;  5ENB A;  4N4H A;  4LZR A;  5D0C A;  3MQM A;  4HXR A;  4TT2 A;  5CUE A;  5HRX A;  3O34 A;  5EIS A;  4ZC9 A;  3D7C A;  4UYF A;  5HFR A;  4J3I A;  4YAB A;  4QSS A;  5FG5 A;  5AD2 A;  5II1 A;  1ZS5 A;  5I86 A;  4QR3 A;  2R0Y A;  5EIC A;  3U5K A;  5CQ4 A;  4YYG A;  1JM4 B;  4LDF A;  4F3I A;  4NQN A;  4FLP A;  4WHU A;  5EWV A;  5A5O A;  3SVG A;  4BW1 A;  2H60 A;  4NYX A;  5F63 A;  5LKU A;  5CQ5 A;  2F6J A;  4A9L A;  4XYA A;  5AD3 A;  2LSP B;  4MR6 A;  5I7Y A;  4IOO A;  4WHW A;  4TT6 A;  5E73 A;  5EA1 A;  4O7B A;  3DWY A;  4IR6 A;  3O33 A;  5FB1 A;  5DW2 A;  5E7D A;  4MEP A;  4UYG A;  5FB0 A;  5FE6 A;  5I83 A;  4MEQ A;  2OO1 A;  4O7E A;  4QUT A;  4MR5 A;  1N72 A;  4N3W A;  5FG4 A;  5DLZ A;  5A5Q A;  5FE2 A;  2DAT A;  5FFV A;  3JVJ A;  5CUG A;  4HBX A;  4UYF B;  5D26 A;  4LRG A;  5H1V A;  4Q0O A;  4HXS A;  1JSP B;  5C87 A;  4O78 A;  5EWD A;  4CUT A;  4YYI A;  5E9Y A;  2YW5 A;  5I29 A;  5FE4 A;  2L85 A;  3RCW A;  5ENF A;  4X2I A;  5A81 A;  3LQI A;  5KO4 A;  4QSR A;  4YAD A;  5FFY A;  4NQM A;  5D7X A;  4N4F A;  4BW3 A;  5L98 A;  4YBS A;  3U5L A;  5IBN A;  5E9I A;  5ENG A;  4O76 A;  5FG6 A;  4HXP A;  5IGN A;  4QY4 A;  5EM3 A;  4QEU A;  4XY8 A;  4O75 A;  5JWM A;  2G4A A;  5KHM A;  5KTU A;  4PS5 A;  3NXB A;  5EI4 A;  5HFQ A;  2RNY A;  2WP1 A;  5EVA A;  4PCE A;  5A5S A;  3O37 A;  3P1F A;  4QYD A;  5LJ1 A;  4LYI A;  4ALH A;  5FE1 A;  3GG3 A;  3MUK A;  4UYE A;  4QSV A;  3MB4 A;  5CQ7 A;  4WIV A;  5ENC A;  5D3H A;  2RNX A;  4YK0 A;  5BT5 A;  4HXM A;  5FE0 A;  4CUU A;  5CGP A;  5F60 A;  4YAX A;  4C67 A;  5E9L A;  5TB6 A;  5LJ0 A;  4Z1Q A;  5G4S A;  5FE7 A;  4Z6I A;  5E0R A;  4ZW1 A;  5LKT A;  3IU6 A;  5D3R A;  4UIW A;  5A5N A;  4Y03 A;  4QB3 A;  5DYU A;  5IGM A;  5CRZ A;  4QEW A;  2RFJ A;  3UVD A;  3LQH A;  4CLB A;  3LQJ A;  4MEN A;  4O70 A;  5DLX A;  4O7C A;  5L96 A;  5HQ5 A;  5CZG A;  4UIX A;  5FH7 A;  5HM0 A;  4HBY A;  5HQ7 A;  4HBW A;  4TZ2 A;  3HMH A;  3O36 A;  4J0R A;  4OGJ A;  3P1D A;  5ENH A;  4YBM A;  4Z1S A;  4QEV A;  3FKM X;  4HXK A;  2RO1 A;  4QR5 A;  5CQ6 A;  5CQ8 A;  3U5O A;  4XY9 A;  5IID A;  4UIT A;  3JVK A;  5LVR A;  1F68 A;  5D25 A;  3K2J A;  3O35 A;  4O77 A;  5CRM A;  5FBX A;  3UVW A;  4UYD A;  2OSS A;  5C4Q A;  5A82 A;  3P1C A;  4PKL A;  2DVS A;  4KV4 A;  5DBM A;  4A9N A;  4A9M A;  4QNS A;  3UV4 A;  2YEM A;  4TU6 A;  2E3K A;  2YDW A;  3LXJ A;  5HEN A;  5I7X A;  4QSX A;  4NR7 A;  4UIU A;  5D3P A;  4Z93 A;  3MXF A;  3P1E A;  5LKX A;  4QSW A;  5DKC A;  5II2 A;  2I7K A;  5EPS A;  5FE5 A;  4TS8 A;  2YEK A;  4NS5 A;  5HCL A;  4YAT A;  5DYX A;  4O7F A;  5DYC A;  5IGL A;  5HRV A;  5F1L A;  2E7O A;  4XUA A;  5ENI A;  2I8N A;  5DFD A;  4YY6 A;  4O72 A;  3TLP A;  4LR6 A;  5L99 A;  3U5P A;  5E3D A;  5FH8 A;  3I3J A;  2D9E A;  4NRB A;  4HXL A;  4KV1 A;  4A9E A;  4PTB A;  3P5O A;  5EV9 A;  5CUB A;  1EQF A;  5F1H A;  4J1P A;  3UVX A;  5L8T A;  5DW1 A;  5H1U A;  5H1T A;  4MR3 A;  4QZS A;  5LJ2 A;  5DFB A;  4LYW A;  3IU5 A;  5C85 A;  4YYJ A;  4TQN A;  3S91 A;  4DON A;  4NR4 A;  5COI A;  5E9V A;  3Q2E A;  4IOR A;  5E9M A;  4NRC A;  4QUU A;  3U5M A;  5A5P A;  3QZT A;  4PCI A;  4A9J A;  4A9I A;  5D24 A;  4NYW A;  5CU8 A;  5I80 A;  4E96 A;  5AMF A;  4LZS A;  4QR4 A;  5HRW A;  4N4G A;  3SVH A;  5I1Q A;  5CP5 A;  5E9K A;  4YYH A;  2DVR A;  5JI8 A;  4MR4 A;  2KTB B;  3HMF A;  4QBM A;  5CPE A;  4TT4 A;  4A9K A;  5EQ1 A;  2DWW A;  4ZQL A;  5FFW A;  3MB3 A;  4QSP A;  5C89 A;  5F5Z A; 
#chains in the Genus database with same CATH topology
 4XUB A;  4TU4 A;  5I89 A;  4NUE A;  2D82 A;  4YYM A;  3LJW A;  3G0L A;  5EPB A;  5ETB A;  4O71 A;  5F2P A;  5F62 A;  4QSQ A;  5D3J A;  5H85 A;  2MJV B;  2R10 A;  5DYA A;  5F25 A;  2L84 A;  4BJX A;  2DVV A;  3G0J A;  5LUU A;  4IR3 A;  5E74 A;  5LKZ A;  5C8G A;  4NR9 A;  5KTW A;  5TCM A;  5J0D A;  2R0V A;  3HME A;  2GRC A;  5AME A;  2OUO A;  4AKN A;  4YH3 A;  4LC2 A;  2NXB A;  4BW4 A;  4QSU A;  4TYL A;  3QZS A;  1WUG A;  4N4I A;  5C7N A;  4O7A A;  4Q0N A;  5I40 A;  2E7N A;  5ENE A;  3AQA A;  3UV2 A;  5CTL A;  4NR6 A;  3D1B A;  4NR8 A;  4GPJ A;  4A9F A;  3UVY A;  4QC3 A;  4MEO A;  5EU1 A;  3Q2F A;  4HXO A;  4OGI A;  4NUC A;  4NRA A;  5HJC A;  5ACY A;  5F3A A;  4CUR A;  4IOQ A;  5D3L A;  1PUO A;  4KCX A;  4O74 A;  5DKH A;  2YEL A;  5CY9 A;  5ETD A;  5CQT A;  3ONI A;  5EPR A;  5HLS A;  4QST A;  5HQ6 A;  3VKG A;  5BT3 A;  4YY4 A;  4TZ8 A;  5LVQ A;  5E3G A;  4NR5 A;  4NXJ A;  4CFK A;  4YYD A;  3UV5 A;  4OUF A;  3JVM A;  4A9H A;  4ALG A;  4C66 A;  5CUC A;  4UIV A;  2RNW A;  5A83 A;  2DVQ A;  4BHW A;  2N9G A;  4CL9 A;  5DX4 A;  5K29 A;  2F6N A;  5ENJ A;  5F36 A;  5IGK A;  4YH4 A;  4AI6 A;  5HEM A;  3JVL A;  2FSA A;  5D3T A;  4YYN A;  4YC9 A;  5EWC A;  5L97 A;  3S92 A;  5FDZ A;  5CQ3 A;  4CUS A;  4IR5 A;  5EK9 A;  5FH6 A;  3SVF A;  3UW9 A;  5DY7 A;  5HEL A;  5EP7 A;  3QZV A;  2YYN A;  3AAD A;  4NYV A;  5EWW A;  4Z6H A;  3U5N A;  4J0S A;  4A9O A;  4RVR A;  5L8U A;  5KTX A;  2RS9 B;  2DKW A;  3ZYU A;  4IR4 A;  1X0J A;  4QYL A;  5EGU A;  5A7C A;  4YBT A;  5CUD A;  2L5E A;  4HBV A;  3ERR A;  4NUD A;  4YYK A;  5DFC A;  5D3S A;  5CS8 A;  5FE3 A;  5DKD A;  5EWH A;  5F61 A;  2R0S A;  5FE8 A;  5KU3 A;  5BT4 A;  5G4R A;  4TTE A;  2YQD A;  4PY6 A;  3DAI A;  4UYH A;  5A85 A;  4HXN A;  1E6I A;  4BW2 A;  4LZ2 A;  4QC1 A;  4AKG A;  5CUA A;  5D3N A;  4UIZ A;  4CUP A;  5CFW A;  3MUL A;  4LYS A;  1WUM A;  3U5J A;  5IG6 A;  5A5R A;  4CUQ A;  5FE9 A;  2RI7 A;  5I88 A;  2WP2 A;  4CFL A;  4UIY A;  5CQA A;  5ENB A;  4N4H A;  4LZR A;  5D0C A;  3MQM A;  4HXR A;  4TT2 A;  5CUE A;  5HRX A;  3O34 A;  5EIS A;  4ZC9 A;  3D7C A;  4UYF A;  5HFR A;  4J3I A;  4YAB A;  4QSS A;  5FG5 A;  5AD2 A;  5II1 A;  1ZS5 A;  5I86 A;  4QR3 A;  2R0Y A;  5EIC A;  3U5K A;  5CQ4 A;  4YYG A;  1JM4 B;  4LDF A;  4F3I A;  4NQN A;  4FLP A;  4WHU A;  4AKH A;  5EWV A;  5A5O A;  3SVG A;  4BW1 A;  2H60 A;  4NYX A;  5F63 A;  5LKU A;  5CQ5 A;  2F6J A;  4A9L A;  4XYA A;  5AD3 A;  2LSP B;  4MR6 A;  5I7Y A;  4IOO A;  4WHW A;  4TT6 A;  5E73 A;  5EA1 A;  4O7B A;  3DWY A;  4IR6 A;  3O33 A;  5FB1 A;  5DW2 A;  5E7D A;  4MEP A;  4UYG A;  5FB0 A;  5FE6 A;  5I83 A;  4MEQ A;  2OO1 A;  4O7E A;  4QUT A;  4MR5 A;  1N72 A;  4N3W A;  5FG4 A;  5DLZ A;  5A5Q A;  5FE2 A;  2DAT A;  5FFV A;  3JVJ A;  5CUG A;  4HBX A;  4UYF B;  5D26 A;  4LRG A;  5H1V A;  4AKI A;  4Q0O A;  4HXS A;  1JSP B;  5C87 A;  4O78 A;  5EWD A;  4CUT A;  4YYI A;  5E9Y A;  2YW5 A;  5I29 A;  5FE4 A;  2L85 A;  3RCW A;  5ENF A;  4X2I A;  3D1D A;  3LQI A;  5A81 A;  5KO4 A;  4QSR A;  4YAD A;  5FFY A;  4NQM A;  5D7X A;  4N4F A;  4BW3 A;  5L98 A;  4YBS A;  3U5L A;  5IBN A;  5E9I A;  5ENG A;  4O76 A;  5FG6 A;  4HXP A;  5IGN A;  4QY4 A;  5EM3 A;  4QEU A;  4XY8 A;  4O75 A;  5JWM A;  2G4A A;  5KHM A;  5KTU A;  4PS5 A;  3NXB A;  5EI4 A;  5HFQ A;  2RNY A;  2WP1 A;  5EVA A;  4PCE A;  5A5S A;  3O37 A;  3P1F A;  4QYD A;  5LJ1 A;  4LYI A;  4ALH A;  5FE1 A;  3GG3 A;  3MUK A;  4UYE A;  4QSV A;  3MB4 A;  5CQ7 A;  4WIV A;  5ENC A;  5D3H A;  2RNX A;  4YK0 A;  5BT5 A;  4HXM A;  5FE0 A;  4CUU A;  5CGP A;  5F60 A;  4YAX A;  4C67 A;  5E9L A;  5TB6 A;  5LJ0 A;  4Z1Q A;  5G4S A;  5FE7 A;  4Z6I A;  5E0R A;  4ZW1 A;  5LKT A;  3IU6 A;  5D3R A;  4UIW A;  5A5N A;  4Y03 A;  4QB3 A;  5DYU A;  5IGM A;  5CRZ A;  4QEW A;  2RFJ A;  3UVD A;  3LQH A;  4CLB A;  3LQJ A;  4MEN A;  4O70 A;  5DLX A;  4O7C A;  5L96 A;  5HQ5 A;  5CZG A;  4UIX A;  5FH7 A;  5HM0 A;  4HBY A;  5HQ7 A;  4HBW A;  4TZ2 A;  3HMH A;  3O36 A;  4J0R A;  4OGJ A;  2EJN A;  3P1D A;  5ENH A;  4YBM A;  4Z1S A;  4QEV A;  3FKM X;  4HXK A;  2RO1 A;  4QR5 A;  5CQ6 A;  5CQ8 A;  3U5O A;  4XY9 A;  5IID A;  4UIT A;  3JVK A;  5LVR A;  1F68 A;  5D25 A;  3K2J A;  3O35 A;  4O77 A;  5CRM A;  5FBX A;  3UVW A;  4UYD A;  2OSS A;  5C4Q A;  5A82 A;  1ZKR A;  3P1C A;  4PKL A;  2DVS A;  4KV4 A;  5DBM A;  4A9N A;  4A9M A;  4QNS A;  3UV4 A;  3VKH A;  2YEM A;  4TU6 A;  2E3K A;  2YDW A;  3LXJ A;  5HEN A;  5I7X A;  4QSX A;  4NR7 A;  4UIU A;  5D3P A;  4Z93 A;  3MXF A;  3P1E A;  5LKX A;  4QSW A;  5DKC A;  5II2 A;  2I7K A;  5EPS A;  5FE5 A;  4TS8 A;  2YEK A;  4NS5 A;  5HCL A;  4YAT A;  5DYX A;  4O7F A;  5DYC A;  5IGL A;  5HRV A;  5F1L A;  2E7O A;  4XUA A;  5ENI A;  2I8N A;  5DFD A;  4YY6 A;  4O72 A;  3TLP A;  4LR6 A;  5L99 A;  3U5P A;  5E3D A;  5FH8 A;  3I3J A;  2D9E A;  4NRB A;  4HXL A;  4KV1 A;  4A9E A;  4PTB A;  3P5O A;  5EV9 A;  5CUB A;  1EQF A;  5F1H A;  4J1P A;  3UVX A;  5L8T A;  5DW1 A;  5H1U A;  5H1T A;  4MR3 A;  4QZS A;  5LJ2 A;  5DFB A;  4LYW A;  3IU5 A;  5C85 A;  4YYJ A;  4TQN A;  3S91 A;  4DON A;  4NR4 A;  5COI A;  5E9V A;  3Q2E A;  4IOR A;  5E9M A;  4NRC A;  4QUU A;  3U5M A;  5A5P A;  3QZT A;  4PCI A;  4A9J A;  4A9I A;  5D24 A;  4NYW A;  5CU8 A;  5I80 A;  4E96 A;  5AMF A;  4LZS A;  4QR4 A;  5HRW A;  4N4G A;  3SVH A;  5I1Q A;  5CP5 A;  5E9K A;  4YYH A;  2DVR A;  5JI8 A;  4MR4 A;  2KTB B;  3HMF A;  4QBM A;  5CPE A;  4TT4 A;  4A9K A;  5EQ1 A;  2DWW A;  4ZQL A;  5FFW A;  3MB3 A;  4QSP A;  5C89 A;  5F5Z A; 
#chains in the Genus database with same CATH homology
 4XUB A;  4TU4 A;  5I89 A;  4NUE A;  2D82 A;  4YYM A;  3LJW A;  3G0L A;  5EPB A;  5ETB A;  4O71 A;  5F2P A;  5F62 A;  4QSQ A;  5D3J A;  5H85 A;  2MJV B;  2R10 A;  5DYA A;  5F25 A;  2L84 A;  4BJX A;  2DVV A;  3G0J A;  5LUU A;  4IR3 A;  5E74 A;  5LKZ A;  5C8G A;  4NR9 A;  5KTW A;  5TCM A;  5J0D A;  2R0V A;  3HME A;  2GRC A;  5AME A;  2OUO A;  4AKN A;  4YH3 A;  4LC2 A;  2NXB A;  4BW4 A;  4QSU A;  4TYL A;  3QZS A;  1WUG A;  4N4I A;  5C7N A;  4O7A A;  4Q0N A;  5I40 A;  2E7N A;  5ENE A;  3AQA A;  3UV2 A;  5CTL A;  4NR6 A;  4NR8 A;  4GPJ A;  4A9F A;  3UVY A;  4QC3 A;  4MEO A;  5EU1 A;  3Q2F A;  4HXO A;  4OGI A;  4NUC A;  4NRA A;  5HJC A;  5ACY A;  5F3A A;  4CUR A;  4IOQ A;  5D3L A;  4KCX A;  4O74 A;  5DKH A;  2YEL A;  5CY9 A;  5ETD A;  5CQT A;  3ONI A;  5EPR A;  5HLS A;  4QST A;  5HQ6 A;  5BT3 A;  4YY4 A;  4TZ8 A;  5LVQ A;  5E3G A;  4NR5 A;  4NXJ A;  4CFK A;  4YYD A;  3UV5 A;  4OUF A;  3JVM A;  4A9H A;  4ALG A;  4C66 A;  5CUC A;  4UIV A;  2RNW A;  5A83 A;  2DVQ A;  4BHW A;  2N9G A;  4CL9 A;  5DX4 A;  5K29 A;  2F6N A;  5ENJ A;  5F36 A;  5IGK A;  4YH4 A;  5HEM A;  3JVL A;  2FSA A;  5D3T A;  4YYN A;  4YC9 A;  5EWC A;  5L97 A;  3S92 A;  5FDZ A;  5CQ3 A;  4CUS A;  4IR5 A;  5EK9 A;  5FH6 A;  3SVF A;  3UW9 A;  5DY7 A;  5HEL A;  5EP7 A;  3QZV A;  2YYN A;  3AAD A;  4NYV A;  5EWW A;  4Z6H A;  3U5N A;  4J0S A;  4A9O A;  4RVR A;  5L8U A;  5KTX A;  2RS9 B;  2DKW A;  3ZYU A;  4IR4 A;  1X0J A;  4QYL A;  5EGU A;  5A7C A;  4YBT A;  5CUD A;  2L5E A;  4HBV A;  4YYK A;  4NUD A;  5DFC A;  5D3S A;  5CS8 A;  5FE3 A;  5DKD A;  5EWH A;  5F61 A;  2R0S A;  5FE8 A;  5KU3 A;  5BT4 A;  5G4R A;  4TTE A;  2YQD A;  4PY6 A;  3DAI A;  4UYH A;  5A85 A;  4HXN A;  1E6I A;  4BW2 A;  4LZ2 A;  4QC1 A;  5CUA A;  5D3N A;  4UIZ A;  4CUP A;  5CFW A;  3MUL A;  4LYS A;  1WUM A;  3U5J A;  5IG6 A;  5A5R A;  4CUQ A;  5FE9 A;  2RI7 A;  5I88 A;  2WP2 A;  4CFL A;  4UIY A;  5CQA A;  5ENB A;  4N4H A;  4LZR A;  5D0C A;  3MQM A;  4HXR A;  4TT2 A;  5CUE A;  5HRX A;  3O34 A;  5EIS A;  4ZC9 A;  3D7C A;  4UYF A;  5HFR A;  4J3I A;  4YAB A;  4QSS A;  5FG5 A;  5AD2 A;  5II1 A;  1ZS5 A;  5I86 A;  4QR3 A;  2R0Y A;  5EIC A;  3U5K A;  5CQ4 A;  4YYG A;  1JM4 B;  4LDF A;  4F3I A;  4NQN A;  4FLP A;  4WHU A;  5EWV A;  5A5O A;  3SVG A;  4BW1 A;  2H60 A;  4NYX A;  5F63 A;  5LKU A;  5CQ5 A;  2F6J A;  4A9L A;  4XYA A;  5AD3 A;  2LSP B;  4MR6 A;  5I7Y A;  4IOO A;  4WHW A;  4TT6 A;  5E73 A;  5EA1 A;  4O7B A;  3DWY A;  4IR6 A;  3O33 A;  5FB1 A;  5DW2 A;  5E7D A;  4MEP A;  4UYG A;  5FB0 A;  5FE6 A;  5I83 A;  4MEQ A;  2OO1 A;  4O7E A;  4QUT A;  4MR5 A;  1N72 A;  4N3W A;  5FG4 A;  5DLZ A;  5A5Q A;  5FE2 A;  2DAT A;  5FFV A;  3JVJ A;  5CUG A;  4HBX A;  4UYF B;  5D26 A;  4LRG A;  5H1V A;  4Q0O A;  4HXS A;  1JSP B;  5C87 A;  4O78 A;  5EWD A;  4CUT A;  4YYI A;  5E9Y A;  2YW5 A;  5I29 A;  5FE4 A;  2L85 A;  3RCW A;  5ENF A;  4X2I A;  5A81 A;  3LQI A;  5KO4 A;  4QSR A;  4YAD A;  5FFY A;  4NQM A;  5D7X A;  4N4F A;  4BW3 A;  5L98 A;  4YBS A;  3U5L A;  5IBN A;  5E9I A;  5ENG A;  4O76 A;  5FG6 A;  4HXP A;  5IGN A;  4QY4 A;  5EM3 A;  4QEU A;  4XY8 A;  4O75 A;  5JWM A;  2G4A A;  5KHM A;  5KTU A;  4PS5 A;  3NXB A;  5EI4 A;  5HFQ A;  2RNY A;  2WP1 A;  5EVA A;  4PCE A;  5A5S A;  3O37 A;  3P1F A;  4QYD A;  5LJ1 A;  4LYI A;  4ALH A;  5FE1 A;  3GG3 A;  3MUK A;  4UYE A;  4QSV A;  3MB4 A;  5CQ7 A;  4WIV A;  5ENC A;  5D3H A;  2RNX A;  4YK0 A;  5BT5 A;  4HXM A;  5FE0 A;  4CUU A;  5CGP A;  5F60 A;  4YAX A;  4C67 A;  5E9L A;  5TB6 A;  5LJ0 A;  4Z1Q A;  5G4S A;  5FE7 A;  4Z6I A;  5E0R A;  4ZW1 A;  5LKT A;  3IU6 A;  5D3R A;  4UIW A;  5A5N A;  4Y03 A;  4QB3 A;  5DYU A;  5IGM A;  5CRZ A;  4QEW A;  2RFJ A;  3UVD A;  3LQH A;  4CLB A;  3LQJ A;  4MEN A;  4O70 A;  5DLX A;  4O7C A;  5L96 A;  5HQ5 A;  5CZG A;  4UIX A;  5FH7 A;  5HM0 A;  4HBY A;  5HQ7 A;  4HBW A;  4TZ2 A;  3HMH A;  3O36 A;  4J0R A;  4OGJ A;  3P1D A;  5ENH A;  4YBM A;  4Z1S A;  4QEV A;  3FKM X;  4HXK A;  2RO1 A;  4QR5 A;  5CQ6 A;  5CQ8 A;  3U5O A;  4XY9 A;  5IID A;  4UIT A;  3JVK A;  5LVR A;  1F68 A;  5D25 A;  3K2J A;  3O35 A;  4O77 A;  5CRM A;  5FBX A;  3UVW A;  4UYD A;  2OSS A;  5C4Q A;  5A82 A;  3P1C A;  4PKL A;  2DVS A;  4KV4 A;  5DBM A;  4A9N A;  4A9M A;  4QNS A;  3UV4 A;  2YEM A;  4TU6 A;  2E3K A;  2YDW A;  3LXJ A;  5HEN A;  5I7X A;  4QSX A;  4NR7 A;  4UIU A;  5D3P A;  4Z93 A;  3MXF A;  3P1E A;  5LKX A;  4QSW A;  5DKC A;  5II2 A;  2I7K A;  5EPS A;  5FE5 A;  4TS8 A;  2YEK A;  4NS5 A;  5HCL A;  4YAT A;  5DYX A;  4O7F A;  5DYC A;  5IGL A;  5HRV A;  5F1L A;  2E7O A;  4XUA A;  5ENI A;  2I8N A;  5DFD A;  4YY6 A;  4O72 A;  3TLP A;  4LR6 A;  5L99 A;  3U5P A;  5E3D A;  5FH8 A;  3I3J A;  2D9E A;  4NRB A;  4HXL A;  4KV1 A;  4A9E A;  4PTB A;  3P5O A;  5EV9 A;  5CUB A;  1EQF A;  5F1H A;  4J1P A;  3UVX A;  5L8T A;  5DW1 A;  5H1U A;  5H1T A;  4MR3 A;  4QZS A;  5LJ2 A;  5DFB A;  4LYW A;  3IU5 A;  5C85 A;  4YYJ A;  4TQN A;  3S91 A;  4DON A;  4NR4 A;  5COI A;  5E9V A;  3Q2E A;  4IOR A;  5E9M A;  4NRC A;  4QUU A;  3U5M A;  5A5P A;  3QZT A;  4PCI A;  4A9J A;  4A9I A;  5D24 A;  4NYW A;  5CU8 A;  5I80 A;  4E96 A;  5AMF A;  4LZS A;  4QR4 A;  5HRW A;  4N4G A;  3SVH A;  5I1Q A;  5CP5 A;  5E9K A;  4YYH A;  2DVR A;  5JI8 A;  4MR4 A;  2KTB B;  3HMF A;  4QBM A;  5CPE A;  4TT4 A;  4A9K A;  5EQ1 A;  2DWW A;  4ZQL A;  5FFW A;  3MB3 A;  4QSP A;  5C89 A;  5F5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...