5I40A

Brd9 in complex with cpd1 (6-methyl-1,6-dihydro-7h-pyrrolo[2,3-c]pyridin-7-one)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
102
structure length
102
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Bromodomain-containing protein 9
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i40A00
5D3JA 3UVWA 5HQ6A 4ALHA 1JM4B 5FE4A 5HFQA 3SVGA 5CQ7A 2DWWA 5TCMA 3D7CA 5K29A 5L99A 5LKZA 5FE7A 5A5QA 4YYMA 4HXKA 5ENCA 4IR3A 5CGPA 5HLSA 4Z6IA 4YBMA 3LJWA 4NR6A 5DY7A 1EQFA 4N4HA 4WIVA 5I83A 5AMEA 4UYFA 4NUDA 4NQNA 5C85A 4J0SA 4QSSA 4QR4A 4HBYA 4UYDA 4OGJA 4PCIA 4TU6A 5CZGA 3P1DA 4PY6A 4A9NA 4YAXA 3O34A 5D26A 4QEVA 5BT4A 5D25A 5DLXA 5FG6A 4O7BA 5D3LA 2OO1A 4NRAA 5EPBA 4O77A 4IR4A 3HMHA 3G0JA 5IGNA 2YDWA 5HFRA 5BT5A 2YW5A 3MQMA 3HMFA 4BW2A 5E9VA 4MEOA 3MB3A 2I8NA 3UVDA 4BW3A 5A5NA 5DFBA 4NQMA 2L85A 3S92A 5ACYA 4UIZA 4F3IA 2MJVB 4QUTA 5DKDA 5ENHA 5ETDA 3P1CA 3UW9A 5D0CA 2E3KA 5DFCA 5HENA 4YY6A 4A9IA 4TU4A 4A9JA 4NR4A 5EQ1A 5EWWA 4QZSA 5EWCA 4O70A 5DW1A 3QZSA 5A85A 5CUCA 5CPEA 3O37A 5DYUA 5FH7A 4DONA 5FE6A 4MR5A 4NS5A 5HQ7A 5I89A 5ENGA 4Z6HA 5FE2A 5C8GA 5E9LA 4YH4A 4KV1A 5IGLA 4TTEA 5ENEA 4QSQA 5FE9A 5D24A 3HMEA 4RVRA 4UYFB 1ZS5A 2OUOA 5CTLA 4QSWA 4QB3A 4O74A 4A9LA 5KTUA 4HXLA 4NYWA 5DYAA 5E7DA 5EGUA 2WP2A 1E6IA 5HELA 4YABA 5EPSA 4TZ8A 3AQAA 5LJ2A 5AMFA 5I7YA 5CFWA 4BHWA 4Y03A 3DAIA 4XUAA 5EV9A 5IIDA 4NYXA 2DVQA 5HCLA 4A9MA 2RNWA 5HM0A 5FH6A 5DW2A 4QYDA 5FDZA 3U5NA 4CLBA 2D82A 5H1VA 5EVAA 4MENA 5JI8A 3P1EA 4MR4A 4CFLA 4YYNA 5CQAA 5IG6A 2G4AA 5H85A 5H1UA 4ZQLA 5HRXA 4NRCA 5EPRA 3U5PA 3G0LA 5EP7A 2YEMA 2RFJA 2N9GA 2OSSA 4IORA 5LVRA 5CY9A 2R0YA 5A7CA 4LRGA 5FE1A 5CQ8A 2F6NA 4A9OA 4LZRA 5E3GA 4HXRA 5A5PA 5AD2A 5D3HA 2YYNA 5LKTA 5I88A 5D3NA 5F62A 4QUUA 5CRMA 4ZW1A 5A83A 4A9FA 4ALGA 5H1TA 4QC3A 4CL9A 4QSPA 5CUBA 4Q0OA 5FG4A 4HXSA 4XY9A 2DVSA 3SVFA 2YELA 5E3DA 5A81A 4O7FA 5L97A 4KV4A 5EICA 4QR3A 4CUQA 4O78A 5EISA 4IR5A 5BT3A 4YY4A 3Q2FA 5ENJA 4LYWA 4TT4A 4XY8A 5DKHA 5FH8A 4O75A 1WUMA 2DATA 3O36A 2I7KA 3JVMA 5A82A 5F1LA 4KCXA 5I7XA 4TS8A 5FG5A 5E9IA 5EI4A 4CUSA 4WHWA 4O76A 3U5KA 2RS9B 3QZTA 3U5JA 4QSVA 4O7EA 3UV5A 5DX4A 5HRVA 5HRWA 5A5OA 4PTBA 4CUTA 3U5OA 4HBXA 5F36A 5CUAA 4MEQA 5CRZA 4UIUA 4QYLA 4IR6A 4LDFA 4BJXA 5CQ4A 3JVJA 4O7AA 3MUKA 2LSPB 5CUDA 4N4IA 5I29A 3O33A 5HQ5A 5HEMA 3RCWA 5ENFA 4NR5A 4LR6A 5II2A 4J1PA 2R0SA 3MXFA 5DFDA 5F3AA 2RNYA 2L84A 3IU6A 4LZ2A 5A5RA 5DLZA 4QC1A 3UVXA 3JVLA 4IOOA 5DYCA 4QNSA 5IGKA 2L5EA 5FE5A 4YK0A 2H60A 4MR3A 4UIYA 5EM3A 4IOQA 4YC9A 5C7NA 3AADA 5L98A 4NUCA 4XYAA 3Q2EA 2DVRA 5DKCA 5EWHA 5KU3A 2E7NA 5CU8A 5CQ5A 4TZ2A 2RI7A 5L8TA 4GPJA 5LVQA 4O71A 4YYKA 4CUPA 5F2PA 5HJCA 4NUEA 5FFYA 4O7CA 5EU1A 4C67A 4YYJA 5KTWA 2DVVA 5ENBA 2F6JA 5L96A 5A5SA 5C87A 4CURA 5D3SA 5I40A 5E73A 4BW4A 4C66A 4HXOA 4TQNA 5LKUA 3UV2A 2KTBB 4TT6A 5D3TA 4QR5A 5F1HA 3MULA 4UIWA 5LKXA 4YYDA 5CQ6A 3ONIA 4PS5A 4N4FA 5E9MA 4YH3A 2DKWA 5D7XA 5KTXA 5CQTA 4HXPA 4N4GA 4YATA 3GG3A 4Z1QA 4CFKA 5CS8A 5IBNA 4CUUA 4NR9A 5G4RA 4J3IA 5CUGA 5FB1A 5JWMA 4Z1SA 4UYEA 5F60A 4PKLA 5I1QA 4O72A 4XUBA 4A9HA 3UV4A 4LZSA 3K2JA 4YBSA 3JVKA 5FFVA 5FE3A 4ZC9A 5II1A 3QZVA 5E9KA 3SVHA 4YBTA 5FBXA 2D9EA 4NRBA 5I86A 3MB4A 4QSXA 1X0JA 5FE8A 3LXJA 4TT2A 4X2IA 5F25A 4UIXA 4HXNA 5C4QA 4N3WA 4OGIA 5F63A 3TLPA 4Q0NA 4UYHA 3I3JA 5F5ZA 3ZYUA 5FFWA 5E0RA 4YADA 4Z93A 4A9EA 5I80A 4LYSA 3U5MA 5DYXA 1N72A 4YYGA 4NXJA 4A9KA 5ENIA 2FSAA 5E74A 5CP5A 5LJ1A 3P5OA 5EWDA 5G4SA 5EA1A 3DWYA 5C89A 3O35A 4NR8A 4QBMA 4MR6A 3LQIA 1F68A 5L8UA 4QEWA 2NXBA 4LC2A 3LQHA 4UYGA 2R10A 5KO4A 5FE0A 5EWVA 3P1FA 4PCEA 5D3PA 3FKMX 4UITA 4WHUA 1WUGA 5DBMA 5F61A 5LUUA 5KHMA 5ETBA 5FB0A 3UVYA 4QSUA 3U5LA 2RO1A 4QEUA 4J0RA 4QY4A 5TB6A 3S91A 2YEKA 3LQJA 4NR7A 4MEPA 4QSTA 4HBWA 5J0DA 4E96A 2WP1A 4LYIA 4NYVA 2RNXA 5CQ3A 2GRCA 3IU5A 4QSRA 5E9YA 5LJ0A 5IGMA 2YQDA 4YYIA 5EK9A 4BW1A 4HBVA 4YYHA 5AD3A 2R0VA 5COIA 4OUFA 4HXMA 2E7OA 4UIVA 5D3RA 4FLPA 1JSPB 4AKNA 3NXBA 5CUEA 4TYLA
chains in the Genus database with same CATH superfamily
5D3JA 3UVWA 5HQ6A 4ALHA 1JM4B 5FE4A 5HFQA 3SVGA 5CQ7A 2DWWA 5TCMA 3D7CA 5K29A 5L99A 5LKZA 5FE7A 5A5QA 4YYMA 4HXKA 5ENCA 4IR3A 5CGPA 5HLSA 4Z6IA 4YBMA 3LJWA 4NR6A 5DY7A 1EQFA 4N4HA 4WIVA 5I83A 5AMEA 4UYFA 4NUDA 4NQNA 5C85A 4J0SA 4QSSA 4QR4A 4HBYA 4UYDA 3ERRA 4OGJA 4PCIA 4TU6A 5CZGA 3P1DA 4PY6A 4A9NA 4YAXA 3O34A 5D26A 4QEVA 5BT4A 5D25A 5DLXA 5FG6A 4O7BA 5D3LA 2OO1A 4NRAA 5EPBA 4O77A 4IR4A 3HMHA 3G0JA 2EJNA 2YDWA 5IGNA 5HFRA 5BT5A 2YW5A 3MQMA 3HMFA 4BW2A 5E9VA 4MEOA 3MB3A 2I8NA 3UVDA 4BW3A 5A5NA 5DFBA 4NQMA 2L85A 3S92A 5ACYA 4UIZA 3D1BA 4F3IA 2MJVB 4QUTA 3D1DA 5DKDA 5ENHA 5ETDA 3P1CA 3UW9A 5D0CA 2E3KA 5DFCA 5HENA 4YY6A 4A9IA 4TU4A 4A9JA 4NR4A 5EQ1A 5EWWA 4QZSA 5EWCA 4O70A 5DW1A 3QZSA 5A85A 5CUCA 5CPEA 3O37A 5DYUA 5FH7A 4DONA 5FE6A 4MR5A 4NS5A 5HQ7A 5I89A 5ENGA 4Z6HA 5FE2A 4AKIA 5C8GA 5E9LA 4YH4A 4KV1A 5IGLA 4TTEA 5ENEA 4QSQA 5FE9A 5D24A 3HMEA 4RVRA 4UYFB 1ZS5A 2OUOA 5CTLA 4QSWA 4QB3A 4O74A 4A9LA 1PUOA 5KTUA 4HXLA 4NYWA 5DYAA 5E7DA 5EGUA 2WP2A 1E6IA 5HELA 4YABA 5EPSA 4TZ8A 3AQAA 5LJ2A 5AMFA 5I7YA 5CFWA 4BHWA 4Y03A 3DAIA 4XUAA 5EV9A 5IIDA 4NYXA 2DVQA 5HCLA 4A9MA 2RNWA 5HM0A 5FH6A 5DW2A 4QYDA 5FDZA 3U5NA 4CLBA 2D82A 5H1VA 5EVAA 4MENA 5JI8A 3P1EA 4MR4A 4CFLA 4YYNA 5CQAA 5IG6A 2G4AA 5H85A 5H1UA 4ZQLA 5HRXA 4NRCA 5EPRA 3U5PA 3G0LA 5EP7A 2YEMA 2RFJA 2N9GA 2OSSA 4IORA 5LVRA 5CY9A 2R0YA 5A7CA 4LRGA 5FE1A 5CQ8A 2F6NA 4A9OA 4LZRA 5E3GA 4HXRA 5A5PA 5AD2A 5D3HA 2YYNA 5LKTA 5I88A 5D3NA 5F62A 4QUUA 5CRMA 4ZW1A 5A83A 4A9FA 4ALGA 5H1TA 4QC3A 4CL9A 4QSPA 5CUBA 4Q0OA 5FG4A 4HXSA 4XY9A 2DVSA 3SVFA 2YELA 5E3DA 5A81A 4O7FA 5L97A 4KV4A 5EICA 4QR3A 4CUQA 4O78A 5EISA 4IR5A 5BT3A 4YY4A 3Q2FA 5ENJA 4LYWA 4TT4A 4XY8A 5DKHA 5FH8A 4O75A 1WUMA 2DATA 3O36A 2I7KA 3JVMA 5A82A 5F1LA 4KCXA 5I7XA 4TS8A 5FG5A 5E9IA 5EI4A 4CUSA 4WHWA 4O76A 3U5KA 2RS9B 3QZTA 3U5JA 4QSVA 4O7EA 3UV5A 5DX4A 5HRVA 5HRWA 5A5OA 4PTBA 4CUTA 4AKHA 3U5OA 4HBXA 5F36A 5CUAA 4MEQA 5CRZA 4UIUA 4QYLA 4IR6A 4LDFA 4BJXA 5CQ4A 3JVJA 4O7AA 3MUKA 2LSPB 5CUDA 4N4IA 5I29A 3O33A 5HQ5A 5HEMA 3RCWA 5ENFA 4NR5A 4LR6A 5II2A 4J1PA 2R0SA 3VKHA 3MXFA 5DFDA 1ZKRA 5F3AA 2RNYA 2L84A 3IU6A 4LZ2A 5A5RA 5DLZA 4QC1A 3UVXA 3JVLA 4IOOA 5DYCA 4QNSA 5IGKA 2L5EA 5FE5A 4YK0A 2H60A 4MR3A 4UIYA 5EM3A 4IOQA 4YC9A 5C7NA 3AADA 5L98A 4NUCA 4XYAA 3Q2EA 2DVRA 5DKCA 5EWHA 5KU3A 2E7NA 5CU8A 5CQ5A 4TZ2A 2RI7A 5L8TA 4GPJA 5LVQA 4O71A 4YYKA 4CUPA 5F2PA 5HJCA 4NUEA 5FFYA 4O7CA 5EU1A 4C67A 4YYJA 5KTWA 2DVVA 5ENBA 2F6JA 5L96A 5A5SA 5C87A 4CURA 5D3SA 5I40A 5E73A 4BW4A 4C66A 4HXOA 4TQNA 5LKUA 3UV2A 2KTBB 4TT6A 5D3TA 4QR5A 5F1HA 3MULA 4UIWA 5LKXA 4YYDA 5CQ6A 3ONIA 4PS5A 4N4FA 5E9MA 4YH3A 2DKWA 5D7XA 5KTXA 5CQTA 4HXPA 4N4GA 4YATA 3GG3A 4Z1QA 4CFKA 5CS8A 5IBNA 4CUUA 4NR9A 5G4RA 4J3IA 5CUGA 5FB1A 5JWMA 4Z1SA 4UYEA 5F60A 4PKLA 5I1QA 4O72A 4XUBA 4A9HA 3UV4A 4LZSA 3K2JA 4YBSA 3JVKA 5FFVA 5FE3A 4ZC9A 5II1A 3QZVA 5E9KA 3SVHA 4YBTA 5FBXA 2D9EA 4NRBA 5I86A 3MB4A 4QSXA 1X0JA 5FE8A 3LXJA 4TT2A 4X2IA 4AI6A 5F25A 4UIXA 4HXNA 5C4QA 4N3WA 4OGIA 5F63A 3TLPA 4Q0NA 4UYHA 3I3JA 5F5ZA 3ZYUA 5FFWA 5E0RA 4YADA 4Z93A 4A9EA 5I80A 4LYSA 3U5MA 5DYXA 3VKGA 1N72A 4YYGA 4NXJA 4A9KA 5ENIA 2FSAA 5E74A 5CP5A 5LJ1A 3P5OA 5EWDA 5G4SA 5EA1A 3DWYA 5C89A 3O35A 4NR8A 4QBMA 4MR6A 3LQIA 1F68A 5L8UA 4QEWA 2NXBA 4LC2A 3LQHA 4UYGA 2R10A 5KO4A 4AKGA 5FE0A 5EWVA 3P1FA 4PCEA 5D3PA 3FKMX 4UITA 4WHUA 1WUGA 5DBMA 5F61A 5LUUA 5KHMA 5ETBA 5FB0A 3UVYA 4QSUA 3U5LA 2RO1A 4QEUA 4J0RA 4QY4A 5TB6A 3S91A 2YEKA 3LQJA 4NR7A 4MEPA 4QSTA 4HBWA 5J0DA 4E96A 2WP1A 4LYIA 4NYVA 2RNXA 5CQ3A 2GRCA 3IU5A 4QSRA 5E9YA 5LJ0A 5IGMA 2YQDA 4YYIA 5EK9A 4BW1A 4HBVA 4YYHA 5AD3A 2R0VA 5COIA 4OUFA 4HXMA 2E7OA 4UIVA 5D3RA 4FLPA 1JSPB 4AKNA 3NXBA 5CUEA 4TYLA
chains in the Genus database with same CATH topology
5D3JA 3UVWA 5HQ6A 4ALHA 1JM4B 5FE4A 5HFQA 3SVGA 5CQ7A 2DWWA 5TCMA 3D7CA 5K29A 5L99A 5LKZA 5FE7A 5A5QA 4YYMA 4HXKA 5ENCA 4IR3A 5CGPA 5HLSA 4Z6IA 4YBMA 3LJWA 4NR6A 5DY7A 1EQFA 4N4HA 4WIVA 5I83A 5AMEA 4UYFA 4NUDA 4NQNA 5C85A 4J0SA 4QSSA 4QR4A 4HBYA 4UYDA 4OGJA 4PCIA 4TU6A 5CZGA 3P1DA 4PY6A 4A9NA 4YAXA 3O34A 5D26A 4QEVA 5BT4A 5D25A 5DLXA 5FG6A 4O7BA 5D3LA 2OO1A 4NRAA 5EPBA 4O77A 4IR4A 3HMHA 3G0JA 5IGNA 2YDWA 5HFRA 5BT5A 2YW5A 3MQMA 3HMFA 4BW2A 5E9VA 4MEOA 3MB3A 2I8NA 3UVDA 4BW3A 5A5NA 5DFBA 4NQMA 2L85A 3S92A 5ACYA 4UIZA 4F3IA 2MJVB 4QUTA 5DKDA 5ENHA 5ETDA 3P1CA 3UW9A 5D0CA 2E3KA 5DFCA 5HENA 4YY6A 4A9IA 4TU4A 4A9JA 4NR4A 5EQ1A 5EWWA 4QZSA 5EWCA 4O70A 5DW1A 3QZSA 5A85A 5CUCA 5CPEA 3O37A 5DYUA 5FH7A 4DONA 5FE6A 4MR5A 4NS5A 5HQ7A 5I89A 5ENGA 4Z6HA 5FE2A 5C8GA 5E9LA 4YH4A 4KV1A 5IGLA 4TTEA 5ENEA 4QSQA 5FE9A 5D24A 3HMEA 4RVRA 4UYFB 1ZS5A 2OUOA 5CTLA 4QSWA 4QB3A 4O74A 4A9LA 5KTUA 4HXLA 4NYWA 5DYAA 5E7DA 5EGUA 2WP2A 1E6IA 5HELA 4YABA 5EPSA 4TZ8A 3AQAA 5LJ2A 5AMFA 5I7YA 5CFWA 4BHWA 4Y03A 3DAIA 4XUAA 5EV9A 5IIDA 4NYXA 2DVQA 5HCLA 4A9MA 2RNWA 5HM0A 5FH6A 5DW2A 4QYDA 5FDZA 3U5NA 4CLBA 2D82A 5H1VA 5EVAA 4MENA 5JI8A 3P1EA 4MR4A 4CFLA 4YYNA 5CQAA 5IG6A 2G4AA 5H85A 5H1UA 4ZQLA 5HRXA 4NRCA 5EPRA 3U5PA 3G0LA 5EP7A 2YEMA 2RFJA 2N9GA 2OSSA 4IORA 5LVRA 5CY9A 2R0YA 5A7CA 4LRGA 5FE1A 5CQ8A 2F6NA 4A9OA 4LZRA 5E3GA 4HXRA 5A5PA 5AD2A 5D3HA 2YYNA 5LKTA 5I88A 5D3NA 5F62A 4QUUA 5CRMA 4ZW1A 5A83A 4A9FA 4ALGA 5H1TA 4QC3A 4CL9A 4QSPA 5CUBA 4Q0OA 5FG4A 4HXSA 4XY9A 2DVSA 3SVFA 2YELA 5E3DA 5A81A 4O7FA 5L97A 4KV4A 5EICA 4QR3A 4CUQA 4O78A 5EISA 4IR5A 5BT3A 4YY4A 3Q2FA 5ENJA 4LYWA 4TT4A 4XY8A 5DKHA 5FH8A 4O75A 1WUMA 2DATA 3O36A 2I7KA 3JVMA 5A82A 5F1LA 4KCXA 5I7XA 4TS8A 5FG5A 5E9IA 5EI4A 4CUSA 4WHWA 4O76A 3U5KA 2RS9B 3QZTA 3U5JA 4QSVA 4O7EA 3UV5A 5DX4A 5HRVA 5HRWA 5A5OA 4PTBA 4CUTA 3U5OA 4HBXA 5F36A 5CUAA 4MEQA 5CRZA 4UIUA 4QYLA 4IR6A 4LDFA 4BJXA 5CQ4A 3JVJA 4O7AA 3MUKA 2LSPB 5CUDA 4N4IA 5I29A 3O33A 5HQ5A 5HEMA 3RCWA 5ENFA 4NR5A 4LR6A 5II2A 4J1PA 2R0SA 3MXFA 5DFDA 5F3AA 2RNYA 2L84A 3IU6A 4LZ2A 5A5RA 5DLZA 4QC1A 3UVXA 3JVLA 4IOOA 5DYCA 4QNSA 5IGKA 2L5EA 5FE5A 4YK0A 2H60A 4MR3A 4UIYA 5EM3A 4IOQA 4YC9A 5C7NA 3AADA 5L98A 4NUCA 4XYAA 3Q2EA 2DVRA 5DKCA 5EWHA 5KU3A 2E7NA 5CU8A 5CQ5A 4TZ2A 2RI7A 5L8TA 4GPJA 5LVQA 4O71A 4YYKA 4CUPA 5F2PA 5HJCA 4NUEA 5FFYA 4O7CA 5EU1A 4C67A 4YYJA 5KTWA 2DVVA 5ENBA 2F6JA 5L96A 5A5SA 5C87A 4CURA 5D3SA 5I40A 5E73A 4BW4A 4C66A 4HXOA 4TQNA 5LKUA 3UV2A 2KTBB 4TT6A 5D3TA 4QR5A 5F1HA 3MULA 4UIWA 5LKXA 4YYDA 5CQ6A 3ONIA 4PS5A 4N4FA 5E9MA 4YH3A 2DKWA 5D7XA 5KTXA 5CQTA 4HXPA 4N4GA 4YATA 3GG3A 4Z1QA 4CFKA 5CS8A 5IBNA 4CUUA 4NR9A 5G4RA 4J3IA 5CUGA 5FB1A 5JWMA 4Z1SA 4UYEA 5F60A 4PKLA 5I1QA 4O72A 4XUBA 4A9HA 3UV4A 4LZSA 3K2JA 4YBSA 3JVKA 5FFVA 5FE3A 4ZC9A 5II1A 3QZVA 5E9KA 3SVHA 4YBTA 5FBXA 2D9EA 4NRBA 5I86A 3MB4A 4QSXA 1X0JA 5FE8A 3LXJA 4TT2A 4X2IA 5F25A 4UIXA 4HXNA 5C4QA 4N3WA 4OGIA 5F63A 3TLPA 4Q0NA 4UYHA 3I3JA 5F5ZA 3ZYUA 5FFWA 5E0RA 4YADA 4Z93A 4A9EA 5I80A 4LYSA 3U5MA 5DYXA 1N72A 4YYGA 4NXJA 4A9KA 5ENIA 2FSAA 5E74A 5CP5A 5LJ1A 3P5OA 5EWDA 5G4SA 5EA1A 3DWYA 5C89A 3O35A 4NR8A 4QBMA 4MR6A 3LQIA 1F68A 5L8UA 4QEWA 2NXBA 4LC2A 3LQHA 4UYGA 2R10A 5KO4A 5FE0A 5EWVA 3P1FA 4PCEA 5D3PA 3FKMX 4UITA 4WHUA 1WUGA 5DBMA 5F61A 5LUUA 5KHMA 5ETBA 5FB0A 3UVYA 4QSUA 3U5LA 2RO1A 4QEUA 4J0RA 4QY4A 5TB6A 3S91A 2YEKA 3LQJA 4NR7A 4MEPA 4QSTA 4HBWA 5J0DA 4E96A 2WP1A 4LYIA 4NYVA 2RNXA 5CQ3A 2GRCA 3IU5A 4QSRA 5E9YA 5LJ0A 5IGMA 2YQDA 4YYIA 5EK9A 4BW1A 4HBVA 4YYHA 5AD3A 2R0VA 5COIA 4OUFA 4HXMA 2E7OA 4UIVA 5D3RA 4FLPA 1JSPB 4AKNA 3NXBA 5CUEA 4TYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3J A;  3UVW A;  5HQ6 A;  4ALH A;  1JM4 B;  5FE4 A;  5HFQ A;  3SVG A;  5CQ7 A;  2DWW A;  5TCM A;  3D7C A;  5K29 A;  5L99 A;  5LKZ A;  5FE7 A;  5A5Q A;  4YYM A;  4HXK A;  5ENC A;  4IR3 A;  5CGP A;  5HLS A;  4Z6I A;  4YBM A;  3LJW A;  4NR6 A;  5DY7 A;  1EQF A;  4N4H A;  4WIV A;  5I83 A;  5AME A;  4UYF A;  4NUD A;  4NQN A;  5C85 A;  4J0S A;  4QSS A;  4QR4 A;  4HBY A;  4UYD A;  4OGJ A;  4PCI A;  4TU6 A;  5CZG A;  3P1D A;  4PY6 A;  4A9N A;  4YAX A;  3O34 A;  5D26 A;  4QEV A;  5BT4 A;  5D25 A;  5DLX A;  5FG6 A;  4O7B A;  5D3L A;  2OO1 A;  4NRA A;  5EPB A;  4O77 A;  4IR4 A;  3HMH A;  3G0J A;  5IGN A;  2YDW A;  5HFR A;  5BT5 A;  2YW5 A;  3MQM A;  3HMF A;  4BW2 A;  5E9V A;  4MEO A;  3MB3 A;  2I8N A;  3UVD A;  4BW3 A;  5A5N A;  5DFB A;  4NQM A;  2L85 A;  3S92 A;  5ACY A;  4UIZ A;  4F3I A;  2MJV B;  4QUT A;  5DKD A;  5ENH A;  5ETD A;  3P1C A;  3UW9 A;  5D0C A;  2E3K A;  5DFC A;  5HEN A;  4YY6 A;  4A9I A;  4TU4 A;  4A9J A;  4NR4 A;  5EQ1 A;  5EWW A;  4QZS A;  5EWC A;  4O70 A;  5DW1 A;  3QZS A;  5A85 A;  5CUC A;  5CPE A;  3O37 A;  5DYU A;  5FH7 A;  4DON A;  5FE6 A;  4MR5 A;  4NS5 A;  5HQ7 A;  5I89 A;  5ENG A;  4Z6H A;  5FE2 A;  5C8G A;  5E9L A;  4YH4 A;  4KV1 A;  5IGL A;  4TTE A;  5ENE A;  4QSQ A;  5FE9 A;  5D24 A;  3HME A;  4RVR A;  4UYF B;  1ZS5 A;  2OUO A;  5CTL A;  4QSW A;  4QB3 A;  4O74 A;  4A9L A;  5KTU A;  4HXL A;  4NYW A;  5DYA A;  5E7D A;  5EGU A;  2WP2 A;  1E6I A;  5HEL A;  4YAB A;  5EPS A;  4TZ8 A;  3AQA A;  5LJ2 A;  5AMF A;  5I7Y A;  5CFW A;  4BHW A;  4Y03 A;  3DAI A;  4XUA A;  5EV9 A;  5IID A;  4NYX A;  2DVQ A;  5HCL A;  4A9M A;  2RNW A;  5HM0 A;  5FH6 A;  5DW2 A;  4QYD A;  5FDZ A;  3U5N A;  4CLB A;  2D82 A;  5H1V A;  5EVA A;  4MEN A;  5JI8 A;  3P1E A;  4MR4 A;  4CFL A;  4YYN A;  5CQA A;  5IG6 A;  2G4A A;  5H85 A;  5H1U A;  4ZQL A;  5HRX A;  4NRC A;  5EPR A;  3U5P A;  3G0L A;  5EP7 A;  2YEM A;  2RFJ A;  2N9G A;  2OSS A;  4IOR A;  5LVR A;  5CY9 A;  2R0Y A;  5A7C A;  4LRG A;  5FE1 A;  5CQ8 A;  2F6N A;  4A9O A;  4LZR A;  5E3G A;  4HXR A;  5A5P A;  5AD2 A;  5D3H A;  2YYN A;  5LKT A;  5I88 A;  5D3N A;  5F62 A;  4QUU A;  5CRM A;  4ZW1 A;  5A83 A;  4A9F A;  4ALG A;  5H1T A;  4QC3 A;  4CL9 A;  4QSP A;  5CUB A;  4Q0O A;  5FG4 A;  4HXS A;  4XY9 A;  2DVS A;  3SVF A;  2YEL A;  5E3D A;  5A81 A;  4O7F A;  5L97 A;  4KV4 A;  5EIC A;  4QR3 A;  4CUQ A;  4O78 A;  5EIS A;  4IR5 A;  5BT3 A;  4YY4 A;  3Q2F A;  5ENJ A;  4LYW A;  4TT4 A;  4XY8 A;  5DKH A;  5FH8 A;  4O75 A;  1WUM A;  2DAT A;  3O36 A;  2I7K A;  3JVM A;  5A82 A;  5F1L A;  4KCX A;  5I7X A;  4TS8 A;  5FG5 A;  5E9I A;  5EI4 A;  4CUS A;  4WHW A;  4O76 A;  3U5K A;  2RS9 B;  3QZT A;  3U5J A;  4QSV A;  4O7E A;  3UV5 A;  5DX4 A;  5HRV A;  5HRW A;  5A5O A;  4PTB A;  4CUT A;  3U5O A;  4HBX A;  5F36 A;  5CUA A;  4MEQ A;  5CRZ A;  4UIU A;  4QYL A;  4IR6 A;  4LDF A;  4BJX A;  5CQ4 A;  3JVJ A;  4O7A A;  3MUK A;  2LSP B;  5CUD A;  4N4I A;  5I29 A;  3O33 A;  5HQ5 A;  5HEM A;  3RCW A;  5ENF A;  4NR5 A;  4LR6 A;  5II2 A;  4J1P A;  2R0S A;  3MXF A;  5DFD A;  5F3A A;  2RNY A;  2L84 A;  3IU6 A;  4LZ2 A;  5A5R A;  5DLZ A;  4QC1 A;  3UVX A;  3JVL A;  4IOO A;  5DYC A;  4QNS A;  5IGK A;  2L5E A;  5FE5 A;  4YK0 A;  2H60 A;  4MR3 A;  4UIY A;  5EM3 A;  4IOQ A;  4YC9 A;  5C7N A;  3AAD A;  5L98 A;  4NUC A;  4XYA A;  3Q2E A;  2DVR A;  5DKC A;  5EWH A;  5KU3 A;  2E7N A;  5CU8 A;  5CQ5 A;  4TZ2 A;  2RI7 A;  5L8T A;  4GPJ A;  5LVQ A;  4O71 A;  4YYK A;  4CUP A;  5F2P A;  5HJC A;  4NUE A;  5FFY A;  4O7C A;  5EU1 A;  4C67 A;  4YYJ A;  5KTW A;  2DVV A;  5ENB A;  2F6J A;  5L96 A;  5A5S A;  5C87 A;  4CUR A;  5D3S A;  5I40 A;  5E73 A;  4BW4 A;  4C66 A;  4HXO A;  4TQN A;  5LKU A;  3UV2 A;  2KTB B;  4TT6 A;  5D3T A;  4QR5 A;  5F1H A;  3MUL A;  4UIW A;  5LKX A;  4YYD A;  5CQ6 A;  3ONI A;  4PS5 A;  4N4F A;  5E9M A;  4YH3 A;  2DKW A;  5D7X A;  5KTX A;  5CQT A;  4HXP A;  4N4G A;  4YAT A;  3GG3 A;  4Z1Q A;  4CFK A;  5CS8 A;  5IBN A;  4CUU A;  4NR9 A;  5G4R A;  4J3I A;  5CUG A;  5FB1 A;  5JWM A;  4Z1S A;  4UYE A;  5F60 A;  4PKL A;  5I1Q A;  4O72 A;  4XUB A;  4A9H A;  3UV4 A;  4LZS A;  3K2J A;  4YBS A;  3JVK A;  5FFV A;  5FE3 A;  4ZC9 A;  5II1 A;  3QZV A;  5E9K A;  3SVH A;  4YBT A;  5FBX A;  2D9E A;  4NRB A;  5I86 A;  3MB4 A;  4QSX A;  1X0J A;  5FE8 A;  3LXJ A;  4TT2 A;  4X2I A;  5F25 A;  4UIX A;  4HXN A;  5C4Q A;  4N3W A;  4OGI A;  5F63 A;  3TLP A;  4Q0N A;  4UYH A;  3I3J A;  5F5Z A;  3ZYU A;  5FFW A;  5E0R A;  4YAD A;  4Z93 A;  4A9E A;  5I80 A;  4LYS A;  3U5M A;  5DYX A;  1N72 A;  4YYG A;  4NXJ A;  4A9K A;  5ENI A;  2FSA A;  5E74 A;  5CP5 A;  5LJ1 A;  3P5O A;  5EWD A;  5G4S A;  5EA1 A;  3DWY A;  5C89 A;  3O35 A;  4NR8 A;  4QBM A;  4MR6 A;  3LQI A;  1F68 A;  5L8U A;  4QEW A;  2NXB A;  4LC2 A;  3LQH A;  4UYG A;  2R10 A;  5KO4 A;  5FE0 A;  5EWV A;  3P1F A;  4PCE A;  5D3P A;  3FKM X;  4UIT A;  4WHU A;  1WUG A;  5DBM A;  5F61 A;  5LUU A;  5KHM A;  5ETB A;  5FB0 A;  3UVY A;  4QSU A;  3U5L A;  2RO1 A;  4QEU A;  4J0R A;  4QY4 A;  5TB6 A;  3S91 A;  2YEK A;  3LQJ A;  4NR7 A;  4MEP A;  4QST A;  4HBW A;  5J0D A;  4E96 A;  2WP1 A;  4LYI A;  4NYV A;  2RNX A;  5CQ3 A;  2GRC A;  3IU5 A;  4QSR A;  5E9Y A;  5LJ0 A;  5IGM A;  2YQD A;  4YYI A;  5EK9 A;  4BW1 A;  4HBV A;  4YYH A;  5AD3 A;  2R0V A;  5COI A;  4OUF A;  4HXM A;  2E7O A;  4UIV A;  5D3R A;  4FLP A;  1JSP B;  4AKN A;  3NXB A;  5CUE A;  4TYL A; 
#chains in the Genus database with same CATH topology
 5D3J A;  3UVW A;  5HQ6 A;  4ALH A;  1JM4 B;  5FE4 A;  5HFQ A;  3SVG A;  5CQ7 A;  2DWW A;  5TCM A;  3D7C A;  5K29 A;  5L99 A;  5LKZ A;  5FE7 A;  5A5Q A;  4YYM A;  4HXK A;  5ENC A;  4IR3 A;  5CGP A;  5HLS A;  4Z6I A;  4YBM A;  3LJW A;  4NR6 A;  5DY7 A;  1EQF A;  4N4H A;  4WIV A;  5I83 A;  5AME A;  4UYF A;  4NUD A;  4NQN A;  5C85 A;  4J0S A;  4QSS A;  4QR4 A;  4HBY A;  4UYD A;  3ERR A;  4OGJ A;  4PCI A;  4TU6 A;  5CZG A;  3P1D A;  4PY6 A;  4A9N A;  4YAX A;  3O34 A;  5D26 A;  4QEV A;  5BT4 A;  5D25 A;  5DLX A;  5FG6 A;  4O7B A;  5D3L A;  2OO1 A;  4NRA A;  5EPB A;  4O77 A;  4IR4 A;  3HMH A;  3G0J A;  2EJN A;  2YDW A;  5IGN A;  5HFR A;  5BT5 A;  2YW5 A;  3MQM A;  3HMF A;  4BW2 A;  5E9V A;  4MEO A;  3MB3 A;  2I8N A;  3UVD A;  4BW3 A;  5A5N A;  5DFB A;  4NQM A;  2L85 A;  3S92 A;  5ACY A;  4UIZ A;  3D1B A;  4F3I A;  2MJV B;  4QUT A;  3D1D A;  5DKD A;  5ENH A;  5ETD A;  3P1C A;  3UW9 A;  5D0C A;  2E3K A;  5DFC A;  5HEN A;  4YY6 A;  4A9I A;  4TU4 A;  4A9J A;  4NR4 A;  5EQ1 A;  5EWW A;  4QZS A;  5EWC A;  4O70 A;  5DW1 A;  3QZS A;  5A85 A;  5CUC A;  5CPE A;  3O37 A;  5DYU A;  5FH7 A;  4DON A;  5FE6 A;  4MR5 A;  4NS5 A;  5HQ7 A;  5I89 A;  5ENG A;  4Z6H A;  5FE2 A;  4AKI A;  5C8G A;  5E9L A;  4YH4 A;  4KV1 A;  5IGL A;  4TTE A;  5ENE A;  4QSQ A;  5FE9 A;  5D24 A;  3HME A;  4RVR A;  4UYF B;  1ZS5 A;  2OUO A;  5CTL A;  4QSW A;  4QB3 A;  4O74 A;  4A9L A;  1PUO A;  5KTU A;  4HXL A;  4NYW A;  5DYA A;  5E7D A;  5EGU A;  2WP2 A;  1E6I A;  5HEL A;  4YAB A;  5EPS A;  4TZ8 A;  3AQA A;  5LJ2 A;  5AMF A;  5I7Y A;  5CFW A;  4BHW A;  4Y03 A;  3DAI A;  4XUA A;  5EV9 A;  5IID A;  4NYX A;  2DVQ A;  5HCL A;  4A9M A;  2RNW A;  5HM0 A;  5FH6 A;  5DW2 A;  4QYD A;  5FDZ A;  3U5N A;  4CLB A;  2D82 A;  5H1V A;  5EVA A;  4MEN A;  5JI8 A;  3P1E A;  4MR4 A;  4CFL A;  4YYN A;  5CQA A;  5IG6 A;  2G4A A;  5H85 A;  5H1U A;  4ZQL A;  5HRX A;  4NRC A;  5EPR A;  3U5P A;  3G0L A;  5EP7 A;  2YEM A;  2RFJ A;  2N9G A;  2OSS A;  4IOR A;  5LVR A;  5CY9 A;  2R0Y A;  5A7C A;  4LRG A;  5FE1 A;  5CQ8 A;  2F6N A;  4A9O A;  4LZR A;  5E3G A;  4HXR A;  5A5P A;  5AD2 A;  5D3H A;  2YYN A;  5LKT A;  5I88 A;  5D3N A;  5F62 A;  4QUU A;  5CRM A;  4ZW1 A;  5A83 A;  4A9F A;  4ALG A;  5H1T A;  4QC3 A;  4CL9 A;  4QSP A;  5CUB A;  4Q0O A;  5FG4 A;  4HXS A;  4XY9 A;  2DVS A;  3SVF A;  2YEL A;  5E3D A;  5A81 A;  4O7F A;  5L97 A;  4KV4 A;  5EIC A;  4QR3 A;  4CUQ A;  4O78 A;  5EIS A;  4IR5 A;  5BT3 A;  4YY4 A;  3Q2F A;  5ENJ A;  4LYW A;  4TT4 A;  4XY8 A;  5DKH A;  5FH8 A;  4O75 A;  1WUM A;  2DAT A;  3O36 A;  2I7K A;  3JVM A;  5A82 A;  5F1L A;  4KCX A;  5I7X A;  4TS8 A;  5FG5 A;  5E9I A;  5EI4 A;  4CUS A;  4WHW A;  4O76 A;  3U5K A;  2RS9 B;  3QZT A;  3U5J A;  4QSV A;  4O7E A;  3UV5 A;  5DX4 A;  5HRV A;  5HRW A;  5A5O A;  4PTB A;  4CUT A;  4AKH A;  3U5O A;  4HBX A;  5F36 A;  5CUA A;  4MEQ A;  5CRZ A;  4UIU A;  4QYL A;  4IR6 A;  4LDF A;  4BJX A;  5CQ4 A;  3JVJ A;  4O7A A;  3MUK A;  2LSP B;  5CUD A;  4N4I A;  5I29 A;  3O33 A;  5HQ5 A;  5HEM A;  3RCW A;  5ENF A;  4NR5 A;  4LR6 A;  5II2 A;  4J1P A;  2R0S A;  3VKH A;  3MXF A;  5DFD A;  1ZKR A;  5F3A A;  2RNY A;  2L84 A;  3IU6 A;  4LZ2 A;  5A5R A;  5DLZ A;  4QC1 A;  3UVX A;  3JVL A;  4IOO A;  5DYC A;  4QNS A;  5IGK A;  2L5E A;  5FE5 A;  4YK0 A;  2H60 A;  4MR3 A;  4UIY A;  5EM3 A;  4IOQ A;  4YC9 A;  5C7N A;  3AAD A;  5L98 A;  4NUC A;  4XYA A;  3Q2E A;  2DVR A;  5DKC A;  5EWH A;  5KU3 A;  2E7N A;  5CU8 A;  5CQ5 A;  4TZ2 A;  2RI7 A;  5L8T A;  4GPJ A;  5LVQ A;  4O71 A;  4YYK A;  4CUP A;  5F2P A;  5HJC A;  4NUE A;  5FFY A;  4O7C A;  5EU1 A;  4C67 A;  4YYJ A;  5KTW A;  2DVV A;  5ENB A;  2F6J A;  5L96 A;  5A5S A;  5C87 A;  4CUR A;  5D3S A;  5I40 A;  5E73 A;  4BW4 A;  4C66 A;  4HXO A;  4TQN A;  5LKU A;  3UV2 A;  2KTB B;  4TT6 A;  5D3T A;  4QR5 A;  5F1H A;  3MUL A;  4UIW A;  5LKX A;  4YYD A;  5CQ6 A;  3ONI A;  4PS5 A;  4N4F A;  5E9M A;  4YH3 A;  2DKW A;  5D7X A;  5KTX A;  5CQT A;  4HXP A;  4N4G A;  4YAT A;  3GG3 A;  4Z1Q A;  4CFK A;  5CS8 A;  5IBN A;  4CUU A;  4NR9 A;  5G4R A;  4J3I A;  5CUG A;  5FB1 A;  5JWM A;  4Z1S A;  4UYE A;  5F60 A;  4PKL A;  5I1Q A;  4O72 A;  4XUB A;  4A9H A;  3UV4 A;  4LZS A;  3K2J A;  4YBS A;  3JVK A;  5FFV A;  5FE3 A;  4ZC9 A;  5II1 A;  3QZV A;  5E9K A;  3SVH A;  4YBT A;  5FBX A;  2D9E A;  4NRB A;  5I86 A;  3MB4 A;  4QSX A;  1X0J A;  5FE8 A;  3LXJ A;  4TT2 A;  4X2I A;  4AI6 A;  5F25 A;  4UIX A;  4HXN A;  5C4Q A;  4N3W A;  4OGI A;  5F63 A;  3TLP A;  4Q0N A;  4UYH A;  3I3J A;  5F5Z A;  3ZYU A;  5FFW A;  5E0R A;  4YAD A;  4Z93 A;  4A9E A;  5I80 A;  4LYS A;  3U5M A;  5DYX A;  3VKG A;  1N72 A;  4YYG A;  4NXJ A;  4A9K A;  5ENI A;  2FSA A;  5E74 A;  5CP5 A;  5LJ1 A;  3P5O A;  5EWD A;  5G4S A;  5EA1 A;  3DWY A;  5C89 A;  3O35 A;  4NR8 A;  4QBM A;  4MR6 A;  3LQI A;  1F68 A;  5L8U A;  4QEW A;  2NXB A;  4LC2 A;  3LQH A;  4UYG A;  2R10 A;  5KO4 A;  4AKG A;  5FE0 A;  5EWV A;  3P1F A;  4PCE A;  5D3P A;  3FKM X;  4UIT A;  4WHU A;  1WUG A;  5DBM A;  5F61 A;  5LUU A;  5KHM A;  5ETB A;  5FB0 A;  3UVY A;  4QSU A;  3U5L A;  2RO1 A;  4QEU A;  4J0R A;  4QY4 A;  5TB6 A;  3S91 A;  2YEK A;  3LQJ A;  4NR7 A;  4MEP A;  4QST A;  4HBW A;  5J0D A;  4E96 A;  2WP1 A;  4LYI A;  4NYV A;  2RNX A;  5CQ3 A;  2GRC A;  3IU5 A;  4QSR A;  5E9Y A;  5LJ0 A;  5IGM A;  2YQD A;  4YYI A;  5EK9 A;  4BW1 A;  4HBV A;  4YYH A;  5AD3 A;  2R0V A;  5COI A;  4OUF A;  4HXM A;  2E7O A;  4UIV A;  5D3R A;  4FLP A;  1JSP B;  4AKN A;  3NXB A;  5CUE A;  4TYL A; 
#chains in the Genus database with same CATH homology
 5D3J A;  3UVW A;  5HQ6 A;  4ALH A;  1JM4 B;  5FE4 A;  5HFQ A;  3SVG A;  5CQ7 A;  2DWW A;  5TCM A;  3D7C A;  5K29 A;  5L99 A;  5LKZ A;  5FE7 A;  5A5Q A;  4YYM A;  4HXK A;  5ENC A;  4IR3 A;  5CGP A;  5HLS A;  4Z6I A;  4YBM A;  3LJW A;  4NR6 A;  5DY7 A;  1EQF A;  4N4H A;  4WIV A;  5I83 A;  5AME A;  4UYF A;  4NUD A;  4NQN A;  5C85 A;  4J0S A;  4QSS A;  4QR4 A;  4HBY A;  4UYD A;  4OGJ A;  4PCI A;  4TU6 A;  5CZG A;  3P1D A;  4PY6 A;  4A9N A;  4YAX A;  3O34 A;  5D26 A;  4QEV A;  5BT4 A;  5D25 A;  5DLX A;  5FG6 A;  4O7B A;  5D3L A;  2OO1 A;  4NRA A;  5EPB A;  4O77 A;  4IR4 A;  3HMH A;  3G0J A;  5IGN A;  2YDW A;  5HFR A;  5BT5 A;  2YW5 A;  3MQM A;  3HMF A;  4BW2 A;  5E9V A;  4MEO A;  3MB3 A;  2I8N A;  3UVD A;  4BW3 A;  5A5N A;  5DFB A;  4NQM A;  2L85 A;  3S92 A;  5ACY A;  4UIZ A;  4F3I A;  2MJV B;  4QUT A;  5DKD A;  5ENH A;  5ETD A;  3P1C A;  3UW9 A;  5D0C A;  2E3K A;  5DFC A;  5HEN A;  4YY6 A;  4A9I A;  4TU4 A;  4A9J A;  4NR4 A;  5EQ1 A;  5EWW A;  4QZS A;  5EWC A;  4O70 A;  5DW1 A;  3QZS A;  5A85 A;  5CUC A;  5CPE A;  3O37 A;  5DYU A;  5FH7 A;  4DON A;  5FE6 A;  4MR5 A;  4NS5 A;  5HQ7 A;  5I89 A;  5ENG A;  4Z6H A;  5FE2 A;  5C8G A;  5E9L A;  4YH4 A;  4KV1 A;  5IGL A;  4TTE A;  5ENE A;  4QSQ A;  5FE9 A;  5D24 A;  3HME A;  4RVR A;  4UYF B;  1ZS5 A;  2OUO A;  5CTL A;  4QSW A;  4QB3 A;  4O74 A;  4A9L A;  5KTU A;  4HXL A;  4NYW A;  5DYA A;  5E7D A;  5EGU A;  2WP2 A;  1E6I A;  5HEL A;  4YAB A;  5EPS A;  4TZ8 A;  3AQA A;  5LJ2 A;  5AMF A;  5I7Y A;  5CFW A;  4BHW A;  4Y03 A;  3DAI A;  4XUA A;  5EV9 A;  5IID A;  4NYX A;  2DVQ A;  5HCL A;  4A9M A;  2RNW A;  5HM0 A;  5FH6 A;  5DW2 A;  4QYD A;  5FDZ A;  3U5N A;  4CLB A;  2D82 A;  5H1V A;  5EVA A;  4MEN A;  5JI8 A;  3P1E A;  4MR4 A;  4CFL A;  4YYN A;  5CQA A;  5IG6 A;  2G4A A;  5H85 A;  5H1U A;  4ZQL A;  5HRX A;  4NRC A;  5EPR A;  3U5P A;  3G0L A;  5EP7 A;  2YEM A;  2RFJ A;  2N9G A;  2OSS A;  4IOR A;  5LVR A;  5CY9 A;  2R0Y A;  5A7C A;  4LRG A;  5FE1 A;  5CQ8 A;  2F6N A;  4A9O A;  4LZR A;  5E3G A;  4HXR A;  5A5P A;  5AD2 A;  5D3H A;  2YYN A;  5LKT A;  5I88 A;  5D3N A;  5F62 A;  4QUU A;  5CRM A;  4ZW1 A;  5A83 A;  4A9F A;  4ALG A;  5H1T A;  4QC3 A;  4CL9 A;  4QSP A;  5CUB A;  4Q0O A;  5FG4 A;  4HXS A;  4XY9 A;  2DVS A;  3SVF A;  2YEL A;  5E3D A;  5A81 A;  4O7F A;  5L97 A;  4KV4 A;  5EIC A;  4QR3 A;  4CUQ A;  4O78 A;  5EIS A;  4IR5 A;  5BT3 A;  4YY4 A;  3Q2F A;  5ENJ A;  4LYW A;  4TT4 A;  4XY8 A;  5DKH A;  5FH8 A;  4O75 A;  1WUM A;  2DAT A;  3O36 A;  2I7K A;  3JVM A;  5A82 A;  5F1L A;  4KCX A;  5I7X A;  4TS8 A;  5FG5 A;  5E9I A;  5EI4 A;  4CUS A;  4WHW A;  4O76 A;  3U5K A;  2RS9 B;  3QZT A;  3U5J A;  4QSV A;  4O7E A;  3UV5 A;  5DX4 A;  5HRV A;  5HRW A;  5A5O A;  4PTB A;  4CUT A;  3U5O A;  4HBX A;  5F36 A;  5CUA A;  4MEQ A;  5CRZ A;  4UIU A;  4QYL A;  4IR6 A;  4LDF A;  4BJX A;  5CQ4 A;  3JVJ A;  4O7A A;  3MUK A;  2LSP B;  5CUD A;  4N4I A;  5I29 A;  3O33 A;  5HQ5 A;  5HEM A;  3RCW A;  5ENF A;  4NR5 A;  4LR6 A;  5II2 A;  4J1P A;  2R0S A;  3MXF A;  5DFD A;  5F3A A;  2RNY A;  2L84 A;  3IU6 A;  4LZ2 A;  5A5R A;  5DLZ A;  4QC1 A;  3UVX A;  3JVL A;  4IOO A;  5DYC A;  4QNS A;  5IGK A;  2L5E A;  5FE5 A;  4YK0 A;  2H60 A;  4MR3 A;  4UIY A;  5EM3 A;  4IOQ A;  4YC9 A;  5C7N A;  3AAD A;  5L98 A;  4NUC A;  4XYA A;  3Q2E A;  2DVR A;  5DKC A;  5EWH A;  5KU3 A;  2E7N A;  5CU8 A;  5CQ5 A;  4TZ2 A;  2RI7 A;  5L8T A;  4GPJ A;  5LVQ A;  4O71 A;  4YYK A;  4CUP A;  5F2P A;  5HJC A;  4NUE A;  5FFY A;  4O7C A;  5EU1 A;  4C67 A;  4YYJ A;  5KTW A;  2DVV A;  5ENB A;  2F6J A;  5L96 A;  5A5S A;  5C87 A;  4CUR A;  5D3S A;  5I40 A;  5E73 A;  4BW4 A;  4C66 A;  4HXO A;  4TQN A;  5LKU A;  3UV2 A;  2KTB B;  4TT6 A;  5D3T A;  4QR5 A;  5F1H A;  3MUL A;  4UIW A;  5LKX A;  4YYD A;  5CQ6 A;  3ONI A;  4PS5 A;  4N4F A;  5E9M A;  4YH3 A;  2DKW A;  5D7X A;  5KTX A;  5CQT A;  4HXP A;  4N4G A;  4YAT A;  3GG3 A;  4Z1Q A;  4CFK A;  5CS8 A;  5IBN A;  4CUU A;  4NR9 A;  5G4R A;  4J3I A;  5CUG A;  5FB1 A;  5JWM A;  4Z1S A;  4UYE A;  5F60 A;  4PKL A;  5I1Q A;  4O72 A;  4XUB A;  4A9H A;  3UV4 A;  4LZS A;  3K2J A;  4YBS A;  3JVK A;  5FFV A;  5FE3 A;  4ZC9 A;  5II1 A;  3QZV A;  5E9K A;  3SVH A;  4YBT A;  5FBX A;  2D9E A;  4NRB A;  5I86 A;  3MB4 A;  4QSX A;  1X0J A;  5FE8 A;  3LXJ A;  4TT2 A;  4X2I A;  5F25 A;  4UIX A;  4HXN A;  5C4Q A;  4N3W A;  4OGI A;  5F63 A;  3TLP A;  4Q0N A;  4UYH A;  3I3J A;  5F5Z A;  3ZYU A;  5FFW A;  5E0R A;  4YAD A;  4Z93 A;  4A9E A;  5I80 A;  4LYS A;  3U5M A;  5DYX A;  1N72 A;  4YYG A;  4NXJ A;  4A9K A;  5ENI A;  2FSA A;  5E74 A;  5CP5 A;  5LJ1 A;  3P5O A;  5EWD A;  5G4S A;  5EA1 A;  3DWY A;  5C89 A;  3O35 A;  4NR8 A;  4QBM A;  4MR6 A;  3LQI A;  1F68 A;  5L8U A;  4QEW A;  2NXB A;  4LC2 A;  3LQH A;  4UYG A;  2R10 A;  5KO4 A;  5FE0 A;  5EWV A;  3P1F A;  4PCE A;  5D3P A;  3FKM X;  4UIT A;  4WHU A;  1WUG A;  5DBM A;  5F61 A;  5LUU A;  5KHM A;  5ETB A;  5FB0 A;  3UVY A;  4QSU A;  3U5L A;  2RO1 A;  4QEU A;  4J0R A;  4QY4 A;  5TB6 A;  3S91 A;  2YEK A;  3LQJ A;  4NR7 A;  4MEP A;  4QST A;  4HBW A;  5J0D A;  4E96 A;  2WP1 A;  4LYI A;  4NYV A;  2RNX A;  5CQ3 A;  2GRC A;  3IU5 A;  4QSR A;  5E9Y A;  5LJ0 A;  5IGM A;  2YQD A;  4YYI A;  5EK9 A;  4BW1 A;  4HBV A;  4YYH A;  5AD3 A;  2R0V A;  5COI A;  4OUF A;  4HXM A;  2E7O A;  4UIV A;  5D3R A;  4FLP A;  1JSP B;  4AKN A;  3NXB A;  5CUE A;  4TYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...