5I7YA

Brd9 in complex with cpd4 ((e)-3-(6-(but-2-en-1-yl)-7-oxo-6,7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)-n,n-dimethylbenzamide)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
101
structure length
101
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 9
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i7yA00
5FG5A 5E9LA 4E96A 4CUQA 2YELA 5IIDA 1WUMA 2N9GA 3O35A 4TTEA 5EPBA 5A5NA 4A9JA 4MR5A 4TYLA 4HXLA 1EQFA 4WIVA 3P1EA 4KV1A 4CUTA 4YY4A 3MULA 2R10A 4QSTA 4YBTA 5EPRA 4UIZA 4MENA 4A9KA 4UIWA 4QEWA 5BT4A 4O7CA 5ENFA 4IR4A 4PKLA 3UV2A 2RNXA 3UV4A 2R0SA 3DAIA 2DWWA 5DFDA 5FH6A 5HFQA 5H1UA 5CQ6A 5HCLA 3D7CA 4QYDA 2NXBA 4TS8A 4TZ2A 5CZGA 5DLZA 4A9NA 5F63A 5FE1A 4BHWA 3P1DA 4YYGA 5C87A 4KCXA 4UYDA 3QZVA 5CQAA 5I29A 5EI4A 4QSUA 5KU3A 4UYHA 4YBMA 3HMFA 2YYNA 4QNSA 5FG6A 5F25A 5F60A 4YYNA 5CUDA 3UVXA 2YQDA 5HENA 5BT5A 4CURA 5EM3A 3Q2EA 5C8GA 5F3AA 5DKCA 5G4SA 4YYDA 3O36A 3U5PA 2L85A 2RFJA 3LJWA 4NR4A 5L99A 4BW3A 4CUSA 5FE2A 5HELA 3SVFA 5E3DA 3NXBA 5A83A 4NYVA 2H60A 5HQ7A 4QEUA 5D3LA 4QSSA 5A81A 4HXKA 5LVQA 5IG6A 5CUGA 4QZSA 3IU5A 4ZW1A 4YYJA 3P5OA 4YH3A 3MB4A 4LZRA 5DYUA 4Z6IA 2KTBB 4UYFB 5ENGA 2WP1A 4LYIA 4J0RA 3G0JA 4A9FA 2DVVA 2D9EA 2I8NA 5ENCA 4QSWA 2G4AA 3FKMX 2YEKA 4YAXA 5IGLA 4F3IA 4C66A 5FE9A 3O37A 5LVRA 5D7XA 4MR4A 4XUBA 5HRVA 5ENEA 5CRMA 5HEMA 4HBXA 5FE6A 5G4RA 5CQTA 4HXOA 5I40A 4NQNA 5TB6A 2L84A 5I86A 5EQ1A 4XY8A 5KO4A 4ZQLA 5D3JA 5DLXA 5CQ4A 4LYSA 4ALGA 5CU8A 4UYFA 4NR8A 3QZTA 5A85A 3UV5A 3ZYUA 3MXFA 3K2JA 4NR6A 5HFRA 3S92A 4QY4A 5FE3A 5E3GA 4O76A 5CQ3A 5FB0A 5L97A 4YYIA 4O7EA 4Z1QA 1X0JA 5F1HA 4NUDA 4TT6A 5IBNA 3SVHA 2RNYA 4O72A 1N72A 4HXMA 4QSVA 5LJ1A 5CUBA 5IGMA 5HM0A 4N3WA 5FE8A 4O78A 5D24A 5AD3A 4NR7A 4PY6A 2RNWA 5I1QA 5D3SA 5D3HA 5CP5A 5EGUA 5ETBA 5EU1A 5FE0A 3UVYA 2DVSA 3O34A 4TT4A 3P1CA 3RCWA 5E0RA 4J0SA 3JVJA 5EWDA 4O75A 4N4FA 3U5LA 4O71A 4MEOA 4NYWA 4IORA 4YADA 4HBWA 4QEVA 4WHWA 5HRWA 4Z6HA 4QYLA 5C85A 5JI8A 4YC9A 3LQHA 2DATA 5D25A 2DVRA 3AADA 4TU4A 4HXPA 5DBMA 5L98A 5D0CA 5DKDA 5C4QA 4HXSA 3TLPA 5TCMA 2E7OA 5ENIA 3O33A 5ENBA 4A9IA 5DKHA 5D3PA 5EICA 5FDZA 3JVKA 5AD2A 5D26A 4A9MA 3LXJA 4J3IA 4TT2A 4DONA 4BW2A 5ENHA 5BT3A 2OO1A 5FG4A 4GPJA 4TQNA 5CTLA 5EWCA 4CL9A 1JSPB 4IR6A 2E7NA 5COIA 4N4HA 5CFWA 5KTWA 4X2IA 4UITA 4XYAA 5A82A 4UIXA 5L8TA 5DFBA 4AKNA 5L8UA 5J0DA 4YK0A 5FE4A 5EWWA 3JVLA 4Z93A 4QUUA 4IOQA 4QR4A 3Q2FA 2YEMA 5A5RA 3AQAA 2R0VA 5H85A 5LUUA 4UIVA 5CS8A 5E9MA 4WHUA 4OUFA 2DVQA 2F6NA 4UYEA 5II1A 5E74A 4NQMA 5IGKA 5HRXA 4OGJA 5EWVA 4O7BA 4PS5A 4QSRA 4QSXA 5C7NA 2DKWA 5KTUA 1WUGA 3SVGA 5DW2A 4A9OA 4XUAA 5EK9A 3LQIA 4HBVA 1ZS5A 2F6JA 3U5KA 4J1PA 4LDFA 5FB1A 5A5SA 4HBYA 4O74A 5FE7A 3HMHA 5H1VA 3U5OA 3UVWA 5FE5A 5A5OA 5I7YA 4NR5A 5D3RA 5E9IA 4BW1A 3ONIA 2OSSA 3I3JA 4IR5A 5AMEA 4BW4A 4O7AA 4YYKA 2D82A 5EA1A 5LJ0A 5CQ7A 3S91A 4NXJA 5AMFA 4CFKA 1E6IA 4YH4A 4YBSA 5HLSA 5A7CA 2E3KA 5DFCA 5DW1A 3U5JA 2FSAA 4PTBA 4A9LA 2MJVB 5DY7A 3MQMA 2RI7A 4Y03A 4YABA 5HJCA 4ZC9A 4A9EA 5L96A 3HMEA 5FFYA 5K29A 5ENJA 4MEQA 5LKUA 4MR6A 4QR5A 2GRCA 5E73A 4LYWA 5F36A 2WP2A 4NUEA 5A5QA 2R0YA 4NRBA 5IGNA 4OGIA 5II2A 4FLPA 3JVMA 5DYXA 4QUTA 5KTXA 5CQ8A 4NS5A 5CQ5A 1JM4B 4KV4A 4N4GA 5EWHA 4HXNA 4MEPA 4RVRA 5HQ6A 5CRZA 5CY9A 4NRCA 3U5MA 4IR3A 4O70A 5F61A 4YYMA 4LRGA 4QC3A 4PCIA 4PCEA 5F62A 5I88A 5I83A 5FBXA 2OUOA 5EISA 4N4IA 3P1FA 3IU6A 1F68A 4Q0OA 3GG3A 5KHMA 4O7FA 4LZ2A 5FH8A 2YW5A 4NUCA 3UVDA 5I80A 4LZSA 5E9KA 5EVAA 4QB3A 3UW9A 4QR3A 4HXRA 4YATA 5DYAA 3LQJA 5FFWA 5HQ5A 3MUKA 3DWYA 5I7XA 4BJXA 5DYCA 4NRAA 4MR3A 5LKXA 5A5PA 5D3TA 5CUAA 4Z1SA 4O77A 2RS9B 2LSPB 4UIYA 3MB3A 5LJ2A 4NR9A 5EP7A 4Q0NA 3U5NA 4CUPA 5F2PA 4A9HA 4XY9A 5CUEA 4UYGA 4IOOA 5CPEA 5E9VA 4UIUA 5ACYA 5LKTA 4QSPA 5LKZA 5FH7A 2L5EA 2I7KA 4QBMA 5EPSA 4TU6A 5CUCA 5E9YA 5I89A 5D3NA 5FFVA 5F1LA 5CGPA 4CLBA 5JWMA 4YY6A 2YDWA 5DX4A 4ALHA 4CUUA 4C67A 3G0LA 5ETDA 4LC2A 4YYHA 5C89A 5E7DA 4NYXA 5F5ZA 3QZSA 4QC1A 2RO1A 5EV9A 4TZ8A 4QSQA 4LR6A 5H1TA 4CFLA
chains in the Genus database with same CATH superfamily
5FG5A 5E9LA 4E96A 4CUQA 2YELA 5IIDA 1WUMA 2N9GA 3O35A 4TTEA 5EPBA 5A5NA 4A9JA 4MR5A 4TYLA 4HXLA 1EQFA 4WIVA 3P1EA 4KV1A 4CUTA 4YY4A 3MULA 2R10A 4QSTA 4YBTA 5EPRA 4UIZA 4MENA 4A9KA 4UIWA 4QEWA 5BT4A 4O7CA 5ENFA 4IR4A 4PKLA 3UV2A 2RNXA 3UV4A 2R0SA 3DAIA 2DWWA 5DFDA 5FH6A 5HFQA 5H1UA 5CQ6A 5HCLA 3D7CA 4QYDA 2NXBA 4TS8A 4TZ2A 5CZGA 5DLZA 4A9NA 5F63A 5FE1A 4BHWA 3P1DA 4YYGA 5C87A 4KCXA 4UYDA 3QZVA 5CQAA 5I29A 5EI4A 4QSUA 5KU3A 4UYHA 4YBMA 3HMFA 4AKHA 2YYNA 4QNSA 5FG6A 5F25A 5F60A 4YYNA 5CUDA 3UVXA 2YQDA 5HENA 5BT5A 4CURA 5EM3A 3Q2EA 5C8GA 5F3AA 3VKGA 5DKCA 5G4SA 4YYDA 3O36A 3U5PA 2L85A 2RFJA 3LJWA 4NR4A 5L99A 4BW3A 4CUSA 5FE2A 5HELA 3SVFA 5E3DA 3NXBA 5A83A 4NYVA 2H60A 5HQ7A 4QEUA 5D3LA 4QSSA 5A81A 4HXKA 5LVQA 5IG6A 5CUGA 4QZSA 3IU5A 4ZW1A 4YYJA 3P5OA 4YH3A 3MB4A 4LZRA 5DYUA 4Z6IA 2KTBB 3VKHA 4UYFB 5ENGA 2WP1A 4LYIA 4J0RA 3G0JA 4A9FA 2DVVA 2D9EA 2I8NA 5ENCA 4QSWA 2G4AA 3FKMX 2YEKA 4YAXA 5IGLA 4F3IA 4C66A 5FE9A 3O37A 5LVRA 5D7XA 4MR4A 4XUBA 5HRVA 5ENEA 5CRMA 5HEMA 4HBXA 5FE6A 5G4RA 5CQTA 4HXOA 5I40A 4NQNA 5TB6A 2L84A 5I86A 5EQ1A 4XY8A 5KO4A 4ZQLA 5D3JA 5DLXA 5CQ4A 4LYSA 3D1DA 4ALGA 5CU8A 4UYFA 4NR8A 3QZTA 5A85A 3UV5A 3ZYUA 3MXFA 3K2JA 4NR6A 5HFRA 3S92A 4QY4A 5FE3A 5E3GA 4O76A 5CQ3A 5FB0A 5L97A 4YYIA 4O7EA 4Z1QA 1X0JA 5F1HA 4NUDA 4TT6A 5IBNA 3SVHA 2RNYA 4O72A 1N72A 4HXMA 4QSVA 5LJ1A 3D1BA 5CUBA 5IGMA 5HM0A 4N3WA 5FE8A 4O78A 5D24A 5AD3A 4NR7A 4PY6A 2RNWA 5I1QA 5D3SA 5D3HA 5CP5A 5EGUA 5ETBA 5EU1A 5FE0A 3UVYA 2DVSA 3O34A 4TT4A 3P1CA 3RCWA 5E0RA 4J0SA 3JVJA 5EWDA 4O75A 4N4FA 3U5LA 4O71A 4MEOA 4NYWA 4IORA 4YADA 4HBWA 4QEVA 4WHWA 5HRWA 4Z6HA 4QYLA 5C85A 5JI8A 4YC9A 3LQHA 2DATA 5D25A 2DVRA 3AADA 4TU4A 4HXPA 5DBMA 5L98A 5D0CA 5DKDA 5C4QA 4HXSA 3TLPA 5TCMA 2E7OA 5ENIA 3O33A 5ENBA 4A9IA 5DKHA 5D3PA 5EICA 5FDZA 3JVKA 5AD2A 5D26A 4A9MA 3LXJA 4J3IA 4TT2A 4DONA 4BW2A 5ENHA 5BT3A 2OO1A 5FG4A 4GPJA 4TQNA 5CTLA 5EWCA 4CL9A 1JSPB 4IR6A 2E7NA 5COIA 4N4HA 5CFWA 5KTWA 4X2IA 4UITA 4XYAA 5A82A 4UIXA 5L8TA 5DFBA 4AKNA 5L8UA 5J0DA 4YK0A 5FE4A 5EWWA 3JVLA 4Z93A 4QUUA 4IOQA 4QR4A 3Q2FA 2YEMA 5A5RA 3AQAA 2R0VA 5H85A 5LUUA 4AKIA 4UIVA 5CS8A 5E9MA 4WHUA 4OUFA 2DVQA 2F6NA 4UYEA 5II1A 5E74A 4NQMA 5IGKA 5HRXA 4OGJA 5EWVA 4O7BA 4PS5A 4QSRA 4QSXA 5C7NA 2DKWA 5KTUA 1WUGA 3SVGA 5DW2A 4A9OA 4XUAA 5EK9A 3LQIA 4HBVA 4AKGA 1ZS5A 2F6JA 3U5KA 4J1PA 4LDFA 5FB1A 5A5SA 4HBYA 4O74A 5FE7A 3HMHA 5H1VA 3U5OA 3UVWA 5FE5A 5A5OA 5I7YA 4NR5A 5D3RA 5E9IA 4BW1A 3ONIA 2OSSA 3I3JA 4IR5A 2EJNA 5AMEA 4BW4A 4O7AA 4YYKA 2D82A 3ERRA 5EA1A 5LJ0A 5CQ7A 3S91A 4NXJA 5AMFA 4CFKA 1E6IA 4YH4A 4YBSA 5HLSA 5A7CA 2E3KA 5DFCA 5DW1A 3U5JA 2FSAA 4PTBA 4A9LA 2MJVB 5DY7A 3MQMA 2RI7A 4Y03A 4YABA 5HJCA 4ZC9A 4A9EA 5L96A 3HMEA 5FFYA 5K29A 5ENJA 4MEQA 5LKUA 4MR6A 4QR5A 2GRCA 5E73A 4LYWA 5F36A 2WP2A 4NUEA 4AI6A 5A5QA 2R0YA 4NRBA 5IGNA 4OGIA 5II2A 4FLPA 1PUOA 3JVMA 5DYXA 4QUTA 5KTXA 5CQ8A 4NS5A 5CQ5A 1JM4B 4KV4A 4N4GA 5EWHA 4HXNA 4MEPA 4RVRA 5HQ6A 5CRZA 5CY9A 4NRCA 3U5MA 4IR3A 4O70A 1ZKRA 5F61A 4YYMA 4LRGA 4QC3A 4PCIA 4PCEA 5F62A 5I88A 5I83A 5FBXA 2OUOA 5EISA 4N4IA 3P1FA 3IU6A 1F68A 4Q0OA 3GG3A 5KHMA 4O7FA 4LZ2A 5FH8A 2YW5A 4NUCA 3UVDA 5I80A 4LZSA 5E9KA 5EVAA 4QB3A 3UW9A 4QR3A 4HXRA 4YATA 5DYAA 3LQJA 5FFWA 5HQ5A 3MUKA 3DWYA 5I7XA 4BJXA 5DYCA 4NRAA 4MR3A 5LKXA 5A5PA 5D3TA 5CUAA 4Z1SA 4O77A 2RS9B 2LSPB 4UIYA 3MB3A 5LJ2A 4NR9A 5EP7A 4Q0NA 3U5NA 4CUPA 5F2PA 4A9HA 4XY9A 5CUEA 4UYGA 4IOOA 5CPEA 5E9VA 4UIUA 5ACYA 5LKTA 4QSPA 5LKZA 5FH7A 2L5EA 2I7KA 4QBMA 5EPSA 4TU6A 5CUCA 5E9YA 5I89A 5D3NA 5FFVA 5F1LA 5CGPA 4CLBA 5JWMA 4YY6A 2YDWA 5DX4A 4ALHA 4CUUA 4C67A 3G0LA 5ETDA 4LC2A 4YYHA 5C89A 5E7DA 4NYXA 5F5ZA 3QZSA 4QC1A 2RO1A 5EV9A 4TZ8A 4QSQA 4LR6A 5H1TA 4CFLA
chains in the Genus database with same CATH topology
5FG5A 5E9LA 4E96A 4CUQA 2YELA 5IIDA 1WUMA 2N9GA 3O35A 4TTEA 5EPBA 5A5NA 4A9JA 4MR5A 4TYLA 4HXLA 1EQFA 4WIVA 3P1EA 4KV1A 4CUTA 4YY4A 3MULA 2R10A 4QSTA 4YBTA 5EPRA 4UIZA 4MENA 4A9KA 4UIWA 4QEWA 5BT4A 4O7CA 5ENFA 4IR4A 4PKLA 3UV2A 2RNXA 3UV4A 2R0SA 3DAIA 2DWWA 5DFDA 5FH6A 5HFQA 5H1UA 5CQ6A 5HCLA 3D7CA 4QYDA 2NXBA 4TS8A 4TZ2A 5CZGA 5DLZA 4A9NA 5F63A 5FE1A 4BHWA 3P1DA 4YYGA 5C87A 4KCXA 4UYDA 3QZVA 5CQAA 5I29A 5EI4A 4QSUA 5KU3A 4UYHA 4YBMA 3HMFA 2YYNA 4QNSA 5FG6A 5F25A 5F60A 4YYNA 5CUDA 3UVXA 2YQDA 5HENA 5BT5A 4CURA 5EM3A 3Q2EA 5C8GA 5F3AA 5DKCA 5G4SA 4YYDA 3O36A 3U5PA 2L85A 2RFJA 3LJWA 4NR4A 5L99A 4BW3A 4CUSA 5FE2A 5HELA 3SVFA 5E3DA 3NXBA 5A83A 4NYVA 2H60A 5HQ7A 4QEUA 5D3LA 4QSSA 5A81A 4HXKA 5LVQA 5IG6A 5CUGA 4QZSA 3IU5A 4ZW1A 4YYJA 3P5OA 4YH3A 3MB4A 4LZRA 5DYUA 4Z6IA 2KTBB 4UYFB 5ENGA 2WP1A 4LYIA 4J0RA 3G0JA 4A9FA 2DVVA 2D9EA 2I8NA 5ENCA 4QSWA 2G4AA 3FKMX 2YEKA 4YAXA 5IGLA 4F3IA 4C66A 5FE9A 3O37A 5LVRA 5D7XA 4MR4A 4XUBA 5HRVA 5ENEA 5CRMA 5HEMA 4HBXA 5FE6A 5G4RA 5CQTA 4HXOA 5I40A 4NQNA 5TB6A 2L84A 5I86A 5EQ1A 4XY8A 5KO4A 4ZQLA 5D3JA 5DLXA 5CQ4A 4LYSA 4ALGA 5CU8A 4UYFA 4NR8A 3QZTA 5A85A 3UV5A 3ZYUA 3MXFA 3K2JA 4NR6A 5HFRA 3S92A 4QY4A 5FE3A 5E3GA 4O76A 5CQ3A 5FB0A 5L97A 4YYIA 4O7EA 4Z1QA 1X0JA 5F1HA 4NUDA 4TT6A 5IBNA 3SVHA 2RNYA 4O72A 1N72A 4HXMA 4QSVA 5LJ1A 5CUBA 5IGMA 5HM0A 4N3WA 5FE8A 4O78A 5D24A 5AD3A 4NR7A 4PY6A 2RNWA 5I1QA 5D3SA 5D3HA 5CP5A 5EGUA 5ETBA 5EU1A 5FE0A 3UVYA 2DVSA 3O34A 4TT4A 3P1CA 3RCWA 5E0RA 4J0SA 3JVJA 5EWDA 4O75A 4N4FA 3U5LA 4O71A 4MEOA 4NYWA 4IORA 4YADA 4HBWA 4QEVA 4WHWA 5HRWA 4Z6HA 4QYLA 5C85A 5JI8A 4YC9A 3LQHA 2DATA 5D25A 2DVRA 3AADA 4TU4A 4HXPA 5DBMA 5L98A 5D0CA 5DKDA 5C4QA 4HXSA 3TLPA 5TCMA 2E7OA 5ENIA 3O33A 5ENBA 4A9IA 5DKHA 5D3PA 5EICA 5FDZA 3JVKA 5AD2A 5D26A 4A9MA 3LXJA 4J3IA 4TT2A 4DONA 4BW2A 5ENHA 5BT3A 2OO1A 5FG4A 4GPJA 4TQNA 5CTLA 5EWCA 4CL9A 1JSPB 4IR6A 2E7NA 5COIA 4N4HA 5CFWA 5KTWA 4X2IA 4UITA 4XYAA 5A82A 4UIXA 5L8TA 5DFBA 4AKNA 5L8UA 5J0DA 4YK0A 5FE4A 5EWWA 3JVLA 4Z93A 4QUUA 4IOQA 4QR4A 3Q2FA 2YEMA 5A5RA 3AQAA 2R0VA 5H85A 5LUUA 4UIVA 5CS8A 5E9MA 4WHUA 4OUFA 2DVQA 2F6NA 4UYEA 5II1A 5E74A 4NQMA 5IGKA 5HRXA 4OGJA 5EWVA 4O7BA 4PS5A 4QSRA 4QSXA 5C7NA 2DKWA 5KTUA 1WUGA 3SVGA 5DW2A 4A9OA 4XUAA 5EK9A 3LQIA 4HBVA 1ZS5A 2F6JA 3U5KA 4J1PA 4LDFA 5FB1A 5A5SA 4HBYA 4O74A 5FE7A 3HMHA 5H1VA 3U5OA 3UVWA 5FE5A 5A5OA 5I7YA 4NR5A 5D3RA 5E9IA 4BW1A 3ONIA 2OSSA 3I3JA 4IR5A 5AMEA 4BW4A 4O7AA 4YYKA 2D82A 5EA1A 5LJ0A 5CQ7A 3S91A 4NXJA 5AMFA 4CFKA 1E6IA 4YH4A 4YBSA 5HLSA 5A7CA 2E3KA 5DFCA 5DW1A 3U5JA 2FSAA 4PTBA 4A9LA 2MJVB 5DY7A 3MQMA 2RI7A 4Y03A 4YABA 5HJCA 4ZC9A 4A9EA 5L96A 3HMEA 5FFYA 5K29A 5ENJA 4MEQA 5LKUA 4MR6A 4QR5A 2GRCA 5E73A 4LYWA 5F36A 2WP2A 4NUEA 5A5QA 2R0YA 4NRBA 5IGNA 4OGIA 5II2A 4FLPA 3JVMA 5DYXA 4QUTA 5KTXA 5CQ8A 4NS5A 5CQ5A 1JM4B 4KV4A 4N4GA 5EWHA 4HXNA 4MEPA 4RVRA 5HQ6A 5CRZA 5CY9A 4NRCA 3U5MA 4IR3A 4O70A 5F61A 4YYMA 4LRGA 4QC3A 4PCIA 4PCEA 5F62A 5I88A 5I83A 5FBXA 2OUOA 5EISA 4N4IA 3P1FA 3IU6A 1F68A 4Q0OA 3GG3A 5KHMA 4O7FA 4LZ2A 5FH8A 2YW5A 4NUCA 3UVDA 5I80A 4LZSA 5E9KA 5EVAA 4QB3A 3UW9A 4QR3A 4HXRA 4YATA 5DYAA 3LQJA 5FFWA 5HQ5A 3MUKA 3DWYA 5I7XA 4BJXA 5DYCA 4NRAA 4MR3A 5LKXA 5A5PA 5D3TA 5CUAA 4Z1SA 4O77A 2RS9B 2LSPB 4UIYA 3MB3A 5LJ2A 4NR9A 5EP7A 4Q0NA 3U5NA 4CUPA 5F2PA 4A9HA 4XY9A 5CUEA 4UYGA 4IOOA 5CPEA 5E9VA 4UIUA 5ACYA 5LKTA 4QSPA 5LKZA 5FH7A 2L5EA 2I7KA 4QBMA 5EPSA 4TU6A 5CUCA 5E9YA 5I89A 5D3NA 5FFVA 5F1LA 5CGPA 4CLBA 5JWMA 4YY6A 2YDWA 5DX4A 4ALHA 4CUUA 4C67A 3G0LA 5ETDA 4LC2A 4YYHA 5C89A 5E7DA 4NYXA 5F5ZA 3QZSA 4QC1A 2RO1A 5EV9A 4TZ8A 4QSQA 4LR6A 5H1TA 4CFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FG5 A;  5E9L A;  4E96 A;  4CUQ A;  2YEL A;  5IID A;  1WUM A;  2N9G A;  3O35 A;  4TTE A;  5EPB A;  5A5N A;  4A9J A;  4MR5 A;  4TYL A;  4HXL A;  1EQF A;  4WIV A;  3P1E A;  4KV1 A;  4CUT A;  4YY4 A;  3MUL A;  2R10 A;  4QST A;  4YBT A;  5EPR A;  4UIZ A;  4MEN A;  4A9K A;  4UIW A;  4QEW A;  5BT4 A;  4O7C A;  5ENF A;  4IR4 A;  4PKL A;  3UV2 A;  2RNX A;  3UV4 A;  2R0S A;  3DAI A;  2DWW A;  5DFD A;  5FH6 A;  5HFQ A;  5H1U A;  5CQ6 A;  5HCL A;  3D7C A;  4QYD A;  2NXB A;  4TS8 A;  4TZ2 A;  5CZG A;  5DLZ A;  4A9N A;  5F63 A;  5FE1 A;  4BHW A;  3P1D A;  4YYG A;  5C87 A;  4KCX A;  4UYD A;  3QZV A;  5CQA A;  5I29 A;  5EI4 A;  4QSU A;  5KU3 A;  4UYH A;  4YBM A;  3HMF A;  2YYN A;  4QNS A;  5FG6 A;  5F25 A;  5F60 A;  4YYN A;  5CUD A;  3UVX A;  2YQD A;  5HEN A;  5BT5 A;  4CUR A;  5EM3 A;  3Q2E A;  5C8G A;  5F3A A;  5DKC A;  5G4S A;  4YYD A;  3O36 A;  3U5P A;  2L85 A;  2RFJ A;  3LJW A;  4NR4 A;  5L99 A;  4BW3 A;  4CUS A;  5FE2 A;  5HEL A;  3SVF A;  5E3D A;  3NXB A;  5A83 A;  4NYV A;  2H60 A;  5HQ7 A;  4QEU A;  5D3L A;  4QSS A;  5A81 A;  4HXK A;  5LVQ A;  5IG6 A;  5CUG A;  4QZS A;  3IU5 A;  4ZW1 A;  4YYJ A;  3P5O A;  4YH3 A;  3MB4 A;  4LZR A;  5DYU A;  4Z6I A;  2KTB B;  4UYF B;  5ENG A;  2WP1 A;  4LYI A;  4J0R A;  3G0J A;  4A9F A;  2DVV A;  2D9E A;  2I8N A;  5ENC A;  4QSW A;  2G4A A;  3FKM X;  2YEK A;  4YAX A;  5IGL A;  4F3I A;  4C66 A;  5FE9 A;  3O37 A;  5LVR A;  5D7X A;  4MR4 A;  4XUB A;  5HRV A;  5ENE A;  5CRM A;  5HEM A;  4HBX A;  5FE6 A;  5G4R A;  5CQT A;  4HXO A;  5I40 A;  4NQN A;  5TB6 A;  2L84 A;  5I86 A;  5EQ1 A;  4XY8 A;  5KO4 A;  4ZQL A;  5D3J A;  5DLX A;  5CQ4 A;  4LYS A;  4ALG A;  5CU8 A;  4UYF A;  4NR8 A;  3QZT A;  5A85 A;  3UV5 A;  3ZYU A;  3MXF A;  3K2J A;  4NR6 A;  5HFR A;  3S92 A;  4QY4 A;  5FE3 A;  5E3G A;  4O76 A;  5CQ3 A;  5FB0 A;  5L97 A;  4YYI A;  4O7E A;  4Z1Q A;  1X0J A;  5F1H A;  4NUD A;  4TT6 A;  5IBN A;  3SVH A;  2RNY A;  4O72 A;  1N72 A;  4HXM A;  4QSV A;  5LJ1 A;  5CUB A;  5IGM A;  5HM0 A;  4N3W A;  5FE8 A;  4O78 A;  5D24 A;  5AD3 A;  4NR7 A;  4PY6 A;  2RNW A;  5I1Q A;  5D3S A;  5D3H A;  5CP5 A;  5EGU A;  5ETB A;  5EU1 A;  5FE0 A;  3UVY A;  2DVS A;  3O34 A;  4TT4 A;  3P1C A;  3RCW A;  5E0R A;  4J0S A;  3JVJ A;  5EWD A;  4O75 A;  4N4F A;  3U5L A;  4O71 A;  4MEO A;  4NYW A;  4IOR A;  4YAD A;  4HBW A;  4QEV A;  4WHW A;  5HRW A;  4Z6H A;  4QYL A;  5C85 A;  5JI8 A;  4YC9 A;  3LQH A;  2DAT A;  5D25 A;  2DVR A;  3AAD A;  4TU4 A;  4HXP A;  5DBM A;  5L98 A;  5D0C A;  5DKD A;  5C4Q A;  4HXS A;  3TLP A;  5TCM A;  2E7O A;  5ENI A;  3O33 A;  5ENB A;  4A9I A;  5DKH A;  5D3P A;  5EIC A;  5FDZ A;  3JVK A;  5AD2 A;  5D26 A;  4A9M A;  3LXJ A;  4J3I A;  4TT2 A;  4DON A;  4BW2 A;  5ENH A;  5BT3 A;  2OO1 A;  5FG4 A;  4GPJ A;  4TQN A;  5CTL A;  5EWC A;  4CL9 A;  1JSP B;  4IR6 A;  2E7N A;  5COI A;  4N4H A;  5CFW A;  5KTW A;  4X2I A;  4UIT A;  4XYA A;  5A82 A;  4UIX A;  5L8T A;  5DFB A;  4AKN A;  5L8U A;  5J0D A;  4YK0 A;  5FE4 A;  5EWW A;  3JVL A;  4Z93 A;  4QUU A;  4IOQ A;  4QR4 A;  3Q2F A;  2YEM A;  5A5R A;  3AQA A;  2R0V A;  5H85 A;  5LUU A;  4UIV A;  5CS8 A;  5E9M A;  4WHU A;  4OUF A;  2DVQ A;  2F6N A;  4UYE A;  5II1 A;  5E74 A;  4NQM A;  5IGK A;  5HRX A;  4OGJ A;  5EWV A;  4O7B A;  4PS5 A;  4QSR A;  4QSX A;  5C7N A;  2DKW A;  5KTU A;  1WUG A;  3SVG A;  5DW2 A;  4A9O A;  4XUA A;  5EK9 A;  3LQI A;  4HBV A;  1ZS5 A;  2F6J A;  3U5K A;  4J1P A;  4LDF A;  5FB1 A;  5A5S A;  4HBY A;  4O74 A;  5FE7 A;  3HMH A;  5H1V A;  3U5O A;  3UVW A;  5FE5 A;  5A5O A;  5I7Y A;  4NR5 A;  5D3R A;  5E9I A;  4BW1 A;  3ONI A;  2OSS A;  3I3J A;  4IR5 A;  5AME A;  4BW4 A;  4O7A A;  4YYK A;  2D82 A;  5EA1 A;  5LJ0 A;  5CQ7 A;  3S91 A;  4NXJ A;  5AMF A;  4CFK A;  1E6I A;  4YH4 A;  4YBS A;  5HLS A;  5A7C A;  2E3K A;  5DFC A;  5DW1 A;  3U5J A;  2FSA A;  4PTB A;  4A9L A;  2MJV B;  5DY7 A;  3MQM A;  2RI7 A;  4Y03 A;  4YAB A;  5HJC A;  4ZC9 A;  4A9E A;  5L96 A;  3HME A;  5FFY A;  5K29 A;  5ENJ A;  4MEQ A;  5LKU A;  4MR6 A;  4QR5 A;  2GRC A;  5E73 A;  4LYW A;  5F36 A;  2WP2 A;  4NUE A;  5A5Q A;  2R0Y A;  4NRB A;  5IGN A;  4OGI A;  5II2 A;  4FLP A;  3JVM A;  5DYX A;  4QUT A;  5KTX A;  5CQ8 A;  4NS5 A;  5CQ5 A;  1JM4 B;  4KV4 A;  4N4G A;  5EWH A;  4HXN A;  4MEP A;  4RVR A;  5HQ6 A;  5CRZ A;  5CY9 A;  4NRC A;  3U5M A;  4IR3 A;  4O70 A;  5F61 A;  4YYM A;  4LRG A;  4QC3 A;  4PCI A;  4PCE A;  5F62 A;  5I88 A;  5I83 A;  5FBX A;  2OUO A;  5EIS A;  4N4I A;  3P1F A;  3IU6 A;  1F68 A;  4Q0O A;  3GG3 A;  5KHM A;  4O7F A;  4LZ2 A;  5FH8 A;  2YW5 A;  4NUC A;  3UVD A;  5I80 A;  4LZS A;  5E9K A;  5EVA A;  4QB3 A;  3UW9 A;  4QR3 A;  4HXR A;  4YAT A;  5DYA A;  3LQJ A;  5FFW A;  5HQ5 A;  3MUK A;  3DWY A;  5I7X A;  4BJX A;  5DYC A;  4NRA A;  4MR3 A;  5LKX A;  5A5P A;  5D3T A;  5CUA A;  4Z1S A;  4O77 A;  2RS9 B;  2LSP B;  4UIY A;  3MB3 A;  5LJ2 A;  4NR9 A;  5EP7 A;  4Q0N A;  3U5N A;  4CUP A;  5F2P A;  4A9H A;  4XY9 A;  5CUE A;  4UYG A;  4IOO A;  5CPE A;  5E9V A;  4UIU A;  5ACY A;  5LKT A;  4QSP A;  5LKZ A;  5FH7 A;  2L5E A;  2I7K A;  4QBM A;  5EPS A;  4TU6 A;  5CUC A;  5E9Y A;  5I89 A;  5D3N A;  5FFV A;  5F1L A;  5CGP A;  4CLB A;  5JWM A;  4YY6 A;  2YDW A;  5DX4 A;  4ALH A;  4CUU A;  4C67 A;  3G0L A;  5ETD A;  4LC2 A;  4YYH A;  5C89 A;  5E7D A;  4NYX A;  5F5Z A;  3QZS A;  4QC1 A;  2RO1 A;  5EV9 A;  4TZ8 A;  4QSQ A;  4LR6 A;  5H1T A;  4CFL A; 
#chains in the Genus database with same CATH topology
 5FG5 A;  5E9L A;  4E96 A;  4CUQ A;  2YEL A;  5IID A;  1WUM A;  2N9G A;  3O35 A;  4TTE A;  5EPB A;  5A5N A;  4A9J A;  4MR5 A;  4TYL A;  4HXL A;  1EQF A;  4WIV A;  3P1E A;  4KV1 A;  4CUT A;  4YY4 A;  3MUL A;  2R10 A;  4QST A;  4YBT A;  5EPR A;  4UIZ A;  4MEN A;  4A9K A;  4UIW A;  4QEW A;  5BT4 A;  4O7C A;  5ENF A;  4IR4 A;  4PKL A;  3UV2 A;  2RNX A;  3UV4 A;  2R0S A;  3DAI A;  2DWW A;  5DFD A;  5FH6 A;  5HFQ A;  5H1U A;  5CQ6 A;  5HCL A;  3D7C A;  4QYD A;  2NXB A;  4TS8 A;  4TZ2 A;  5CZG A;  5DLZ A;  4A9N A;  5F63 A;  5FE1 A;  4BHW A;  3P1D A;  4YYG A;  5C87 A;  4KCX A;  4UYD A;  3QZV A;  5CQA A;  5I29 A;  5EI4 A;  4QSU A;  5KU3 A;  4UYH A;  4YBM A;  3HMF A;  4AKH A;  2YYN A;  4QNS A;  5FG6 A;  5F25 A;  5F60 A;  4YYN A;  5CUD A;  3UVX A;  2YQD A;  5HEN A;  5BT5 A;  4CUR A;  5EM3 A;  3Q2E A;  5C8G A;  5F3A A;  3VKG A;  5DKC A;  5G4S A;  4YYD A;  3O36 A;  3U5P A;  2L85 A;  2RFJ A;  3LJW A;  4NR4 A;  5L99 A;  4BW3 A;  4CUS A;  5FE2 A;  5HEL A;  3SVF A;  5E3D A;  3NXB A;  5A83 A;  4NYV A;  2H60 A;  5HQ7 A;  4QEU A;  5D3L A;  4QSS A;  5A81 A;  4HXK A;  5LVQ A;  5IG6 A;  5CUG A;  4QZS A;  3IU5 A;  4ZW1 A;  4YYJ A;  3P5O A;  4YH3 A;  3MB4 A;  4LZR A;  5DYU A;  4Z6I A;  2KTB B;  3VKH A;  4UYF B;  5ENG A;  2WP1 A;  4LYI A;  4J0R A;  3G0J A;  4A9F A;  2DVV A;  2D9E A;  2I8N A;  5ENC A;  4QSW A;  2G4A A;  3FKM X;  2YEK A;  4YAX A;  5IGL A;  4F3I A;  4C66 A;  5FE9 A;  3O37 A;  5LVR A;  5D7X A;  4MR4 A;  4XUB A;  5HRV A;  5ENE A;  5CRM A;  5HEM A;  4HBX A;  5FE6 A;  5G4R A;  5CQT A;  4HXO A;  5I40 A;  4NQN A;  5TB6 A;  2L84 A;  5I86 A;  5EQ1 A;  4XY8 A;  5KO4 A;  4ZQL A;  5D3J A;  5DLX A;  5CQ4 A;  4LYS A;  3D1D A;  4ALG A;  5CU8 A;  4UYF A;  4NR8 A;  3QZT A;  5A85 A;  3UV5 A;  3ZYU A;  3MXF A;  3K2J A;  4NR6 A;  5HFR A;  3S92 A;  4QY4 A;  5FE3 A;  5E3G A;  4O76 A;  5CQ3 A;  5FB0 A;  5L97 A;  4YYI A;  4O7E A;  4Z1Q A;  1X0J A;  5F1H A;  4NUD A;  4TT6 A;  5IBN A;  3SVH A;  2RNY A;  4O72 A;  1N72 A;  4HXM A;  4QSV A;  5LJ1 A;  3D1B A;  5CUB A;  5IGM A;  5HM0 A;  4N3W A;  5FE8 A;  4O78 A;  5D24 A;  5AD3 A;  4NR7 A;  4PY6 A;  2RNW A;  5I1Q A;  5D3S A;  5D3H A;  5CP5 A;  5EGU A;  5ETB A;  5EU1 A;  5FE0 A;  3UVY A;  2DVS A;  3O34 A;  4TT4 A;  3P1C A;  3RCW A;  5E0R A;  4J0S A;  3JVJ A;  5EWD A;  4O75 A;  4N4F A;  3U5L A;  4O71 A;  4MEO A;  4NYW A;  4IOR A;  4YAD A;  4HBW A;  4QEV A;  4WHW A;  5HRW A;  4Z6H A;  4QYL A;  5C85 A;  5JI8 A;  4YC9 A;  3LQH A;  2DAT A;  5D25 A;  2DVR A;  3AAD A;  4TU4 A;  4HXP A;  5DBM A;  5L98 A;  5D0C A;  5DKD A;  5C4Q A;  4HXS A;  3TLP A;  5TCM A;  2E7O A;  5ENI A;  3O33 A;  5ENB A;  4A9I A;  5DKH A;  5D3P A;  5EIC A;  5FDZ A;  3JVK A;  5AD2 A;  5D26 A;  4A9M A;  3LXJ A;  4J3I A;  4TT2 A;  4DON A;  4BW2 A;  5ENH A;  5BT3 A;  2OO1 A;  5FG4 A;  4GPJ A;  4TQN A;  5CTL A;  5EWC A;  4CL9 A;  1JSP B;  4IR6 A;  2E7N A;  5COI A;  4N4H A;  5CFW A;  5KTW A;  4X2I A;  4UIT A;  4XYA A;  5A82 A;  4UIX A;  5L8T A;  5DFB A;  4AKN A;  5L8U A;  5J0D A;  4YK0 A;  5FE4 A;  5EWW A;  3JVL A;  4Z93 A;  4QUU A;  4IOQ A;  4QR4 A;  3Q2F A;  2YEM A;  5A5R A;  3AQA A;  2R0V A;  5H85 A;  5LUU A;  4AKI A;  4UIV A;  5CS8 A;  5E9M A;  4WHU A;  4OUF A;  2DVQ A;  2F6N A;  4UYE A;  5II1 A;  5E74 A;  4NQM A;  5IGK A;  5HRX A;  4OGJ A;  5EWV A;  4O7B A;  4PS5 A;  4QSR A;  4QSX A;  5C7N A;  2DKW A;  5KTU A;  1WUG A;  3SVG A;  5DW2 A;  4A9O A;  4XUA A;  5EK9 A;  3LQI A;  4HBV A;  4AKG A;  1ZS5 A;  2F6J A;  3U5K A;  4J1P A;  4LDF A;  5FB1 A;  5A5S A;  4HBY A;  4O74 A;  5FE7 A;  3HMH A;  5H1V A;  3U5O A;  3UVW A;  5FE5 A;  5A5O A;  5I7Y A;  4NR5 A;  5D3R A;  5E9I A;  4BW1 A;  3ONI A;  2OSS A;  3I3J A;  4IR5 A;  2EJN A;  5AME A;  4BW4 A;  4O7A A;  4YYK A;  2D82 A;  3ERR A;  5EA1 A;  5LJ0 A;  5CQ7 A;  3S91 A;  4NXJ A;  5AMF A;  4CFK A;  1E6I A;  4YH4 A;  4YBS A;  5HLS A;  5A7C A;  2E3K A;  5DFC A;  5DW1 A;  3U5J A;  2FSA A;  4PTB A;  4A9L A;  2MJV B;  5DY7 A;  3MQM A;  2RI7 A;  4Y03 A;  4YAB A;  5HJC A;  4ZC9 A;  4A9E A;  5L96 A;  3HME A;  5FFY A;  5K29 A;  5ENJ A;  4MEQ A;  5LKU A;  4MR6 A;  4QR5 A;  2GRC A;  5E73 A;  4LYW A;  5F36 A;  2WP2 A;  4NUE A;  4AI6 A;  5A5Q A;  2R0Y A;  4NRB A;  5IGN A;  4OGI A;  5II2 A;  4FLP A;  1PUO A;  3JVM A;  5DYX A;  4QUT A;  5KTX A;  5CQ8 A;  4NS5 A;  5CQ5 A;  1JM4 B;  4KV4 A;  4N4G A;  5EWH A;  4HXN A;  4MEP A;  4RVR A;  5HQ6 A;  5CRZ A;  5CY9 A;  4NRC A;  3U5M A;  4IR3 A;  4O70 A;  1ZKR A;  5F61 A;  4YYM A;  4LRG A;  4QC3 A;  4PCI A;  4PCE A;  5F62 A;  5I88 A;  5I83 A;  5FBX A;  2OUO A;  5EIS A;  4N4I A;  3P1F A;  3IU6 A;  1F68 A;  4Q0O A;  3GG3 A;  5KHM A;  4O7F A;  4LZ2 A;  5FH8 A;  2YW5 A;  4NUC A;  3UVD A;  5I80 A;  4LZS A;  5E9K A;  5EVA A;  4QB3 A;  3UW9 A;  4QR3 A;  4HXR A;  4YAT A;  5DYA A;  3LQJ A;  5FFW A;  5HQ5 A;  3MUK A;  3DWY A;  5I7X A;  4BJX A;  5DYC A;  4NRA A;  4MR3 A;  5LKX A;  5A5P A;  5D3T A;  5CUA A;  4Z1S A;  4O77 A;  2RS9 B;  2LSP B;  4UIY A;  3MB3 A;  5LJ2 A;  4NR9 A;  5EP7 A;  4Q0N A;  3U5N A;  4CUP A;  5F2P A;  4A9H A;  4XY9 A;  5CUE A;  4UYG A;  4IOO A;  5CPE A;  5E9V A;  4UIU A;  5ACY A;  5LKT A;  4QSP A;  5LKZ A;  5FH7 A;  2L5E A;  2I7K A;  4QBM A;  5EPS A;  4TU6 A;  5CUC A;  5E9Y A;  5I89 A;  5D3N A;  5FFV A;  5F1L A;  5CGP A;  4CLB A;  5JWM A;  4YY6 A;  2YDW A;  5DX4 A;  4ALH A;  4CUU A;  4C67 A;  3G0L A;  5ETD A;  4LC2 A;  4YYH A;  5C89 A;  5E7D A;  4NYX A;  5F5Z A;  3QZS A;  4QC1 A;  2RO1 A;  5EV9 A;  4TZ8 A;  4QSQ A;  4LR6 A;  5H1T A;  4CFL A; 
#chains in the Genus database with same CATH homology
 5FG5 A;  5E9L A;  4E96 A;  4CUQ A;  2YEL A;  5IID A;  1WUM A;  2N9G A;  3O35 A;  4TTE A;  5EPB A;  5A5N A;  4A9J A;  4MR5 A;  4TYL A;  4HXL A;  1EQF A;  4WIV A;  3P1E A;  4KV1 A;  4CUT A;  4YY4 A;  3MUL A;  2R10 A;  4QST A;  4YBT A;  5EPR A;  4UIZ A;  4MEN A;  4A9K A;  4UIW A;  4QEW A;  5BT4 A;  4O7C A;  5ENF A;  4IR4 A;  4PKL A;  3UV2 A;  2RNX A;  3UV4 A;  2R0S A;  3DAI A;  2DWW A;  5DFD A;  5FH6 A;  5HFQ A;  5H1U A;  5CQ6 A;  5HCL A;  3D7C A;  4QYD A;  2NXB A;  4TS8 A;  4TZ2 A;  5CZG A;  5DLZ A;  4A9N A;  5F63 A;  5FE1 A;  4BHW A;  3P1D A;  4YYG A;  5C87 A;  4KCX A;  4UYD A;  3QZV A;  5CQA A;  5I29 A;  5EI4 A;  4QSU A;  5KU3 A;  4UYH A;  4YBM A;  3HMF A;  2YYN A;  4QNS A;  5FG6 A;  5F25 A;  5F60 A;  4YYN A;  5CUD A;  3UVX A;  2YQD A;  5HEN A;  5BT5 A;  4CUR A;  5EM3 A;  3Q2E A;  5C8G A;  5F3A A;  5DKC A;  5G4S A;  4YYD A;  3O36 A;  3U5P A;  2L85 A;  2RFJ A;  3LJW A;  4NR4 A;  5L99 A;  4BW3 A;  4CUS A;  5FE2 A;  5HEL A;  3SVF A;  5E3D A;  3NXB A;  5A83 A;  4NYV A;  2H60 A;  5HQ7 A;  4QEU A;  5D3L A;  4QSS A;  5A81 A;  4HXK A;  5LVQ A;  5IG6 A;  5CUG A;  4QZS A;  3IU5 A;  4ZW1 A;  4YYJ A;  3P5O A;  4YH3 A;  3MB4 A;  4LZR A;  5DYU A;  4Z6I A;  2KTB B;  4UYF B;  5ENG A;  2WP1 A;  4LYI A;  4J0R A;  3G0J A;  4A9F A;  2DVV A;  2D9E A;  2I8N A;  5ENC A;  4QSW A;  2G4A A;  3FKM X;  2YEK A;  4YAX A;  5IGL A;  4F3I A;  4C66 A;  5FE9 A;  3O37 A;  5LVR A;  5D7X A;  4MR4 A;  4XUB A;  5HRV A;  5ENE A;  5CRM A;  5HEM A;  4HBX A;  5FE6 A;  5G4R A;  5CQT A;  4HXO A;  5I40 A;  4NQN A;  5TB6 A;  2L84 A;  5I86 A;  5EQ1 A;  4XY8 A;  5KO4 A;  4ZQL A;  5D3J A;  5DLX A;  5CQ4 A;  4LYS A;  4ALG A;  5CU8 A;  4UYF A;  4NR8 A;  3QZT A;  5A85 A;  3UV5 A;  3ZYU A;  3MXF A;  3K2J A;  4NR6 A;  5HFR A;  3S92 A;  4QY4 A;  5FE3 A;  5E3G A;  4O76 A;  5CQ3 A;  5FB0 A;  5L97 A;  4YYI A;  4O7E A;  4Z1Q A;  1X0J A;  5F1H A;  4NUD A;  4TT6 A;  5IBN A;  3SVH A;  2RNY A;  4O72 A;  1N72 A;  4HXM A;  4QSV A;  5LJ1 A;  5CUB A;  5IGM A;  5HM0 A;  4N3W A;  5FE8 A;  4O78 A;  5D24 A;  5AD3 A;  4NR7 A;  4PY6 A;  2RNW A;  5I1Q A;  5D3S A;  5D3H A;  5CP5 A;  5EGU A;  5ETB A;  5EU1 A;  5FE0 A;  3UVY A;  2DVS A;  3O34 A;  4TT4 A;  3P1C A;  3RCW A;  5E0R A;  4J0S A;  3JVJ A;  5EWD A;  4O75 A;  4N4F A;  3U5L A;  4O71 A;  4MEO A;  4NYW A;  4IOR A;  4YAD A;  4HBW A;  4QEV A;  4WHW A;  5HRW A;  4Z6H A;  4QYL A;  5C85 A;  5JI8 A;  4YC9 A;  3LQH A;  2DAT A;  5D25 A;  2DVR A;  3AAD A;  4TU4 A;  4HXP A;  5DBM A;  5L98 A;  5D0C A;  5DKD A;  5C4Q A;  4HXS A;  3TLP A;  5TCM A;  2E7O A;  5ENI A;  3O33 A;  5ENB A;  4A9I A;  5DKH A;  5D3P A;  5EIC A;  5FDZ A;  3JVK A;  5AD2 A;  5D26 A;  4A9M A;  3LXJ A;  4J3I A;  4TT2 A;  4DON A;  4BW2 A;  5ENH A;  5BT3 A;  2OO1 A;  5FG4 A;  4GPJ A;  4TQN A;  5CTL A;  5EWC A;  4CL9 A;  1JSP B;  4IR6 A;  2E7N A;  5COI A;  4N4H A;  5CFW A;  5KTW A;  4X2I A;  4UIT A;  4XYA A;  5A82 A;  4UIX A;  5L8T A;  5DFB A;  4AKN A;  5L8U A;  5J0D A;  4YK0 A;  5FE4 A;  5EWW A;  3JVL A;  4Z93 A;  4QUU A;  4IOQ A;  4QR4 A;  3Q2F A;  2YEM A;  5A5R A;  3AQA A;  2R0V A;  5H85 A;  5LUU A;  4UIV A;  5CS8 A;  5E9M A;  4WHU A;  4OUF A;  2DVQ A;  2F6N A;  4UYE A;  5II1 A;  5E74 A;  4NQM A;  5IGK A;  5HRX A;  4OGJ A;  5EWV A;  4O7B A;  4PS5 A;  4QSR A;  4QSX A;  5C7N A;  2DKW A;  5KTU A;  1WUG A;  3SVG A;  5DW2 A;  4A9O A;  4XUA A;  5EK9 A;  3LQI A;  4HBV A;  1ZS5 A;  2F6J A;  3U5K A;  4J1P A;  4LDF A;  5FB1 A;  5A5S A;  4HBY A;  4O74 A;  5FE7 A;  3HMH A;  5H1V A;  3U5O A;  3UVW A;  5FE5 A;  5A5O A;  5I7Y A;  4NR5 A;  5D3R A;  5E9I A;  4BW1 A;  3ONI A;  2OSS A;  3I3J A;  4IR5 A;  5AME A;  4BW4 A;  4O7A A;  4YYK A;  2D82 A;  5EA1 A;  5LJ0 A;  5CQ7 A;  3S91 A;  4NXJ A;  5AMF A;  4CFK A;  1E6I A;  4YH4 A;  4YBS A;  5HLS A;  5A7C A;  2E3K A;  5DFC A;  5DW1 A;  3U5J A;  2FSA A;  4PTB A;  4A9L A;  2MJV B;  5DY7 A;  3MQM A;  2RI7 A;  4Y03 A;  4YAB A;  5HJC A;  4ZC9 A;  4A9E A;  5L96 A;  3HME A;  5FFY A;  5K29 A;  5ENJ A;  4MEQ A;  5LKU A;  4MR6 A;  4QR5 A;  2GRC A;  5E73 A;  4LYW A;  5F36 A;  2WP2 A;  4NUE A;  5A5Q A;  2R0Y A;  4NRB A;  5IGN A;  4OGI A;  5II2 A;  4FLP A;  3JVM A;  5DYX A;  4QUT A;  5KTX A;  5CQ8 A;  4NS5 A;  5CQ5 A;  1JM4 B;  4KV4 A;  4N4G A;  5EWH A;  4HXN A;  4MEP A;  4RVR A;  5HQ6 A;  5CRZ A;  5CY9 A;  4NRC A;  3U5M A;  4IR3 A;  4O70 A;  5F61 A;  4YYM A;  4LRG A;  4QC3 A;  4PCI A;  4PCE A;  5F62 A;  5I88 A;  5I83 A;  5FBX A;  2OUO A;  5EIS A;  4N4I A;  3P1F A;  3IU6 A;  1F68 A;  4Q0O A;  3GG3 A;  5KHM A;  4O7F A;  4LZ2 A;  5FH8 A;  2YW5 A;  4NUC A;  3UVD A;  5I80 A;  4LZS A;  5E9K A;  5EVA A;  4QB3 A;  3UW9 A;  4QR3 A;  4HXR A;  4YAT A;  5DYA A;  3LQJ A;  5FFW A;  5HQ5 A;  3MUK A;  3DWY A;  5I7X A;  4BJX A;  5DYC A;  4NRA A;  4MR3 A;  5LKX A;  5A5P A;  5D3T A;  5CUA A;  4Z1S A;  4O77 A;  2RS9 B;  2LSP B;  4UIY A;  3MB3 A;  5LJ2 A;  4NR9 A;  5EP7 A;  4Q0N A;  3U5N A;  4CUP A;  5F2P A;  4A9H A;  4XY9 A;  5CUE A;  4UYG A;  4IOO A;  5CPE A;  5E9V A;  4UIU A;  5ACY A;  5LKT A;  4QSP A;  5LKZ A;  5FH7 A;  2L5E A;  2I7K A;  4QBM A;  5EPS A;  4TU6 A;  5CUC A;  5E9Y A;  5I89 A;  5D3N A;  5FFV A;  5F1L A;  5CGP A;  4CLB A;  5JWM A;  4YY6 A;  2YDW A;  5DX4 A;  4ALH A;  4CUU A;  4C67 A;  3G0L A;  5ETD A;  4LC2 A;  4YYH A;  5C89 A;  5E7D A;  4NYX A;  5F5Z A;  3QZS A;  4QC1 A;  2RO1 A;  5EV9 A;  4TZ8 A;  4QSQ A;  4LR6 A;  5H1T A;  4CFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...