5I80A

Brd4 in complex with cpd2 (n,n-dimethyl-3-(6-methyl-7-oxo-6,7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)benzamide)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
126
structure length
126
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 4
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i80A01
4O71A 3HMHA 4TTEA 5CRZA 3ZYUA 4QYLA 4CLBA 4UIYA 5ENHA 4UYEA 4WHUA 5C7NA 4YYJA 3JVKA 4GPJA 4QSQA 1X0JA 5CUAA 5J0DA 2RS9B 5C4QA 4QYDA 5A5NA 4BW2A 5DYAA 5FBXA 3SVHA 5EM3A 5CQ5A 3P1EA 5CQ3A 5A5QA 5FG6A 5HENA 4DONA 5A82A 2DATA 4YYIA 4PS5A 4OGIA 2RNXA 5CRMA 5I88A 4TS8A 3U5MA 2R10A 4YAXA 3LQHA 3UVYA 5F36A 5FE4A 5IGKA 3DWYA 3P1CA 2YELA 3MQMA 2DVRA 5DFBA 5LKTA 4BW4A 4LDFA 5EP7A 4PKLA 5E0RA 4C66A 5F2PA 5KTXA 3HMEA 4QSRA 5HEMA 5EWWA 4QSTA 4NRAA 5FE0A 5C89A 4LR6A 5FFYA 5HLSA 2L84A 4YC9A 1JM4B 4NXJA 5CUEA 2F6JA 5H1TA 2YEMA 5AMEA 4CFKA 4YYKA 5DW2A 4Y03A 4O78A 3S91A 2RNYA 4NQNA 2L85A 5I7XA 3RCWA 5EPBA 2E3KA 4UYFB 5L8UA 5II2A 5JI8A 3Q2EA 5D7XA 4HBYA 5ETBA 4HXSA 2RFJA 5A5SA 5LVQA 5I29A 4O74A 5DKHA 4IR4A 4FLPA 5FE2A 4PCEA 3UV5A 4ALHA 4J0RA 4UIVA 4UYHA 3UVXA 4BJXA 5EA1A 5FE7A 4NRBA 4O75A 4LC2A 3UVWA 4J1PA 3O35A 4XUBA 4CUUA 5HCLA 5EWDA 5EK9A 5C85A 4QUTA 4QSXA 4TQNA 5DX4A 5DYUA 5LJ0A 3LJWA 4QR5A 5EV9A 5EVAA 5CQTA 5EWCA 5LVRA 3O33A 5FB1A 5LKZA 4YYNA 3UW9A 5E74A 5ENCA 4OUFA 5FFWA 4XUAA 5A5PA 5CUDA 3U5PA 5KTUA 5A83A 5E9KA 5CQAA 3ONIA 4IR6A 5HQ6A 5CGPA 3FKMX 3JVJA 1WUMA 2FSAA 5HFQA 5D24A 4MR3A 2YW5A 3HMFA 4X2IA 5DFCA 4UIUA 4NR6A 2OSSA 4QSVA 3TLPA 4HXRA 1F68A 4A9HA 2D9EA 4QNSA 5KTWA 3O34A 5D3NA 2R0VA 5CQ6A 5F60A 4O7EA 4NS5A 4A9KA 2E7NA 4YY4A 4NYXA 4ZC9A 4QUUA 5CU8A 4N4HA 2MJVB 2WP2A 4QY4A 4KCXA 4XYAA 5EPRA 4O70A 2NXBA 4YYGA 4NR8A 4O7CA 4YYMA 4LYIA 5ENBA 5JWMA 5E9VA 5CPEA 5H1VA 5L97A 4YATA 4YBMA 3MULA 5EICA 4A9IA 2N9GA 5D3TA 3SVGA 2YYNA 4NR7A 2KTBB 5A5OA 5HRXA 3D7CA 3LQJA 4NR4A 3U5NA 5EPSA 4QB3A 3LXJA 4YH4A 5C87A 5F61A 5FDZA 5I89A 4WIVA 4MENA 4MEQA 2DVQA 3Q2FA 5D3HA 5G4RA 4N4GA 5I40A 5D26A 4CL9A 5F3AA 2R0YA 4TZ2A 3MB3A 4NR9A 5A85A 5TCMA 4QBMA 5E7DA 4XY9A 4UIXA 2GRCA 5EU1A 5L98A 4YYDA 5DKCA 1WUGA 4O7AA 2OO1A 4YBSA 5IGLA 5HQ5A 1E6IA 5D25A 5F5ZA 5FFVA 5I80A 5HRVA 5L8TA 4PCIA 3U5KA 4A9OA 3IU6A 5H85A 5KO4A 5DW1A 5ENFA 5FH7A 3S92A 5F1LA 1N72A 5FE1A 5CQ4A 3I3JA 4ZQLA 5AD3A 4AKNA 4UIWA 3GG3A 5FE3A 4QC1A 5EISA 5E3GA 5EGUA 4KV4A 4MR5A 5DLZA 4A9LA 5ENIA 4QC3A 5FH8A 5D3LA 5CP5A 4HBWA 4IOQA 3IU5A 5CS8A 5DKDA 4TU6A 5II1A 3U5JA 3QZSA 4HXKA 4TT2A 5HM0A 4C67A 5BT3A 4HXNA 5CUBA 2F6NA 3LQIA 5TB6A 4TU4A 4O76A 4A9NA 4NRCA 5CY9A 4QEVA 4A9JA 3G0LA 4BW3A 5K29A 5F25A 5HQ7A 2DVSA 4BW1A 4LZ2A 1ZS5A 2I8NA 4HBVA 4HBXA 4Q0NA 5CQ8A 5E9YA 4Z1SA 4HXMA 4F3IA 2LSPB 5DY7A 5E9IA 4KV1A 4IR3A 4LYSA 5EI4A 5ETDA 4QSWA 4QZSA 5E3DA 4A9MA 5I1QA 3O36A 3MUKA 4CUPA 5FE9A 4NUCA 3QZTA 5LUUA 5EQ1A 4WHWA 5LKXA 4NYWA 4UITA 3UVDA 5I7YA 2DVVA 4N3WA 5CFWA 4MEOA 5F62A 5E73A 4A9EA 3O37A 3UV2A 3K2JA 5LKUA 4NR5A 4PY6A 4UYDA 5HFRA 5FG5A 5LJ2A 3MB4A 3AQAA 3QZVA 5C8GA 2WP1A 4TT4A 4LRGA 4UIZA 4QSPA 4E96A 2I7KA 2RNWA 5DYCA 2D82A 5DBMA 4YY6A 5L99A 4UYFA 4QR3A 5FB0A 3G0JA 4YABA 4IORA 4IOOA 5BT5A 5ENGA 5FG4A 4QSUA 4N4IA 5D3JA 2G4AA 1JSPB 5I83A 2E7OA 4LYWA 4LZRA 4MR6A 5KHMA 5ENEA 5DLXA 2RI7A 4QEWA 5HRWA 2YEKA 4QSSA 3U5LA 3JVMA 3U5OA 5FH6A 4N4FA 4YYHA 4O7FA 5EWVA 5CQ7A 5CUGA 5IIDA 5AD2A 5D3SA 5FE5A 1EQFA 3AADA 5COIA 4NYVA 4TT6A 5I86A 4CURA 5A7CA 4ZW1A 2YDWA 5FE8A 3P1DA 4Z6IA 4O77A 3JVLA 4NUEA 5BT4A 2DWWA 4ALGA 5ACYA 3SVFA 5KU3A 4CFLA 5IGMA 5A81A 4Z1QA 4IR5A 4YK0A 5CUCA 5AMFA 4O72A 4BHWA 4J3IA 5HJCA 5IG6A 5CZGA 3P1FA 4TYLA 2OUOA 4TZ8A 5HELA 4PTBA 2RO1A 4QR4A 3DAIA 4NUDA 5H1UA 4J0SA 4Z93A 5F63A 4OGJA 4MR4A 4CUSA 4HXOA 5DFDA 5FE6A 5DYXA 5E9MA 3UV4A 5CTLA 5F1HA 4O7BA 5E9LA 2L5EA 4YBTA 5ENJA 4Q0OA 4YH3A 4CUQA 5G4SA 4YADA 5A5RA 5L96A 4HXLA 4HXPA 4XY8A 4CUTA 5IBNA 4QEUA 5D3PA 5D0CA 2H60A 2YQDA 5EWHA 3MXFA 3P5OA 4MEPA 4UYGA 5LJ1A 4A9FA 5D3RA 3NXBA 5IGNA 4LZSA 2DKWA 4RVRA 2R0SA 4Z6HA 4NQMA
chains in the Genus database with same CATH superfamily
4O71A 3HMHA 4TTEA 5CRZA 4AKIA 3ZYUA 4QYLA 4CLBA 4UIYA 5ENHA 4UYEA 4WHUA 5C7NA 4YYJA 3JVKA 4GPJA 4QSQA 1X0JA 5CUAA 5J0DA 2RS9B 5C4QA 4QYDA 5A5NA 4BW2A 5DYAA 5FBXA 3SVHA 5EM3A 5CQ5A 3P1EA 5CQ3A 5A5QA 5FG6A 5HENA 4DONA 5A82A 2DATA 4YYIA 4PS5A 4OGIA 2RNXA 5CRMA 5I88A 4TS8A 3VKHA 3U5MA 2EJNA 2R10A 4YAXA 3LQHA 3UVYA 5F36A 5FE4A 5IGKA 3DWYA 3P1CA 2YELA 3MQMA 2DVRA 5DFBA 5LKTA 4BW4A 4LDFA 5EP7A 4PKLA 5E0RA 4C66A 5F2PA 5KTXA 3HMEA 4QSRA 5HEMA 5EWWA 4QSTA 4NRAA 5FE0A 5C89A 4LR6A 5FFYA 5HLSA 2L84A 4YC9A 1JM4B 4NXJA 5CUEA 2F6JA 5H1TA 2YEMA 5AMEA 4CFKA 4YYKA 5DW2A 4Y03A 4O78A 3S91A 2RNYA 4NQNA 2L85A 5I7XA 3RCWA 5EPBA 2E3KA 4UYFB 5L8UA 5II2A 5JI8A 3Q2EA 5D7XA 4HBYA 5ETBA 4HXSA 2RFJA 5A5SA 5LVQA 5I29A 4O74A 5DKHA 4IR4A 4FLPA 5FE2A 4PCEA 3UV5A 4ALHA 4J0RA 4UIVA 4UYHA 3UVXA 4BJXA 5EA1A 5FE7A 4NRBA 4O75A 4LC2A 3UVWA 4J1PA 3O35A 4XUBA 4CUUA 5HCLA 5EWDA 5EK9A 5C85A 4QUTA 4QSXA 4TQNA 5DX4A 5DYUA 5LJ0A 3LJWA 4QR5A 5EV9A 5EVAA 5CQTA 5EWCA 5LVRA 3O33A 5FB1A 5LKZA 4YYNA 3UW9A 5E74A 5ENCA 4OUFA 5FFWA 4XUAA 5A5PA 5CUDA 3U5PA 5KTUA 5A83A 5E9KA 5CQAA 3ONIA 4IR6A 5HQ6A 5CGPA 3FKMX 1WUMA 3JVJA 2FSAA 5HFQA 5D24A 4MR3A 2YW5A 3HMFA 4X2IA 5DFCA 4UIUA 4NR6A 2OSSA 4QSVA 3TLPA 4HXRA 1F68A 4A9HA 2D9EA 4QNSA 5KTWA 3O34A 5D3NA 2R0VA 5CQ6A 5F60A 4O7EA 4NS5A 4A9KA 2E7NA 4YY4A 4NYXA 4ZC9A 4QUUA 5CU8A 4N4HA 2MJVB 2WP2A 4QY4A 4KCXA 4XYAA 5EPRA 4O70A 2NXBA 4YYGA 4NR8A 4O7CA 4YYMA 4LYIA 5ENBA 5JWMA 5E9VA 5CPEA 5H1VA 5L97A 4YATA 4YBMA 3MULA 5EICA 4A9IA 2N9GA 5D3TA 3SVGA 2YYNA 4NR7A 2KTBB 5A5OA 5HRXA 3D7CA 3LQJA 4NR4A 3U5NA 5EPSA 4QB3A 3LXJA 4YH4A 5C87A 5F61A 5FDZA 5I89A 4WIVA 4MENA 4MEQA 2DVQA 3Q2FA 5D3HA 5G4RA 4N4GA 5I40A 5D26A 4AKHA 4CL9A 5F3AA 2R0YA 4TZ2A 3MB3A 4NR9A 5A85A 5TCMA 4AI6A 4QBMA 5E7DA 4XY9A 4UIXA 2GRCA 5EU1A 5L98A 4YYDA 5DKCA 1WUGA 4O7AA 2OO1A 4YBSA 5IGLA 5HQ5A 1E6IA 5D25A 5F5ZA 5FFVA 5I80A 5HRVA 5L8TA 4PCIA 3U5KA 4A9OA 3IU6A 5H85A 5KO4A 5DW1A 5ENFA 5FH7A 3S92A 5F1LA 1N72A 5FE1A 5CQ4A 3I3JA 4ZQLA 5AD3A 4AKNA 4UIWA 3GG3A 5FE3A 4QC1A 5EISA 5E3GA 5EGUA 4KV4A 4MR5A 5DLZA 4A9LA 5ENIA 4QC3A 5FH8A 5D3LA 5CP5A 4HBWA 4IOQA 3VKGA 3IU5A 5CS8A 5DKDA 4TU6A 5II1A 3U5JA 3QZSA 4HXKA 4TT2A 5HM0A 4C67A 5BT3A 4HXNA 5CUBA 2F6NA 3LQIA 5TB6A 4TU4A 4O76A 4A9NA 4NRCA 5CY9A 4QEVA 4A9JA 3ERRA 3G0LA 4BW3A 5K29A 1PUOA 5F25A 5HQ7A 2DVSA 4BW1A 4LZ2A 1ZS5A 2I8NA 4HBVA 4HBXA 4Q0NA 5CQ8A 5E9YA 4Z1SA 4HXMA 4F3IA 2LSPB 5DY7A 5E9IA 3D1DA 4KV1A 4IR3A 4LYSA 5EI4A 5ETDA 4QSWA 4QZSA 5E3DA 4A9MA 5I1QA 3O36A 3MUKA 4CUPA 5FE9A 4NUCA 3QZTA 5LUUA 4AKGA 5EQ1A 4WHWA 5LKXA 4NYWA 4UITA 3UVDA 5I7YA 2DVVA 4N3WA 5CFWA 4MEOA 5F62A 5E73A 4A9EA 3O37A 3UV2A 3K2JA 5LKUA 4NR5A 4PY6A 4UYDA 5HFRA 5FG5A 5LJ2A 3MB4A 3AQAA 3QZVA 5C8GA 2WP1A 4TT4A 4LRGA 3D1BA 4UIZA 4QSPA 4E96A 2I7KA 2RNWA 5DYCA 2D82A 5DBMA 4YY6A 5L99A 4UYFA 4QR3A 5FB0A 3G0JA 4YABA 4IORA 4IOOA 5BT5A 5ENGA 5FG4A 4QSUA 4N4IA 5D3JA 2G4AA 1JSPB 5I83A 2E7OA 4LYWA 4LZRA 4MR6A 5KHMA 5ENEA 5DLXA 2RI7A 4QEWA 5HRWA 2YEKA 4QSSA 3U5LA 3JVMA 3U5OA 5FH6A 4N4FA 4YYHA 4O7FA 5EWVA 5CQ7A 5CUGA 5IIDA 5AD2A 5D3SA 5FE5A 1EQFA 3AADA 5COIA 4NYVA 4TT6A 5I86A 4CURA 5A7CA 4ZW1A 2YDWA 5FE8A 3P1DA 4Z6IA 4O77A 3JVLA 4NUEA 5BT4A 2DWWA 4ALGA 5ACYA 3SVFA 5KU3A 4CFLA 5IGMA 5A81A 4Z1QA 4IR5A 4YK0A 5CUCA 5AMFA 4O72A 4BHWA 4J3IA 5HJCA 5IG6A 5CZGA 3P1FA 4TYLA 2OUOA 4TZ8A 5HELA 4PTBA 1ZKRA 2RO1A 4QR4A 3DAIA 4NUDA 5H1UA 4J0SA 4Z93A 5F63A 4OGJA 4MR4A 4CUSA 4HXOA 5DFDA 5FE6A 5DYXA 5E9MA 3UV4A 5CTLA 5F1HA 4O7BA 5E9LA 2L5EA 4YBTA 5ENJA 4Q0OA 4YH3A 4CUQA 5G4SA 4YADA 5A5RA 5L96A 4HXLA 4HXPA 4XY8A 4CUTA 5IBNA 4QEUA 5D3PA 5D0CA 2H60A 2YQDA 5EWHA 3MXFA 3P5OA 4MEPA 4UYGA 5LJ1A 4A9FA 5D3RA 3NXBA 5IGNA 4LZSA 2DKWA 4RVRA 2R0SA 4Z6HA 4NQMA
chains in the Genus database with same CATH topology
4O71A 3HMHA 4TTEA 5CRZA 3ZYUA 4QYLA 4CLBA 4UIYA 5ENHA 4UYEA 4WHUA 5C7NA 4YYJA 3JVKA 4GPJA 4QSQA 1X0JA 5CUAA 5J0DA 2RS9B 5C4QA 4QYDA 5A5NA 4BW2A 5DYAA 5FBXA 3SVHA 5EM3A 5CQ5A 3P1EA 5CQ3A 5A5QA 5FG6A 5HENA 4DONA 5A82A 2DATA 4YYIA 4PS5A 4OGIA 2RNXA 5CRMA 5I88A 4TS8A 3U5MA 2R10A 4YAXA 3LQHA 3UVYA 5F36A 5FE4A 5IGKA 3DWYA 3P1CA 2YELA 3MQMA 2DVRA 5DFBA 5LKTA 4BW4A 4LDFA 5EP7A 4PKLA 5E0RA 4C66A 5F2PA 5KTXA 3HMEA 4QSRA 5HEMA 5EWWA 4QSTA 4NRAA 5FE0A 5C89A 4LR6A 5FFYA 5HLSA 2L84A 4YC9A 1JM4B 4NXJA 5CUEA 2F6JA 5H1TA 2YEMA 5AMEA 4CFKA 4YYKA 5DW2A 4Y03A 4O78A 3S91A 2RNYA 4NQNA 2L85A 5I7XA 3RCWA 5EPBA 2E3KA 4UYFB 5L8UA 5II2A 5JI8A 3Q2EA 5D7XA 4HBYA 5ETBA 4HXSA 2RFJA 5A5SA 5LVQA 5I29A 4O74A 5DKHA 4IR4A 4FLPA 5FE2A 4PCEA 3UV5A 4ALHA 4J0RA 4UIVA 4UYHA 3UVXA 4BJXA 5EA1A 5FE7A 4NRBA 4O75A 4LC2A 3UVWA 4J1PA 3O35A 4XUBA 4CUUA 5HCLA 5EWDA 5EK9A 5C85A 4QUTA 4QSXA 4TQNA 5DX4A 5DYUA 5LJ0A 3LJWA 4QR5A 5EV9A 5EVAA 5CQTA 5EWCA 5LVRA 3O33A 5FB1A 5LKZA 4YYNA 3UW9A 5E74A 5ENCA 4OUFA 5FFWA 4XUAA 5A5PA 5CUDA 3U5PA 5KTUA 5A83A 5E9KA 5CQAA 3ONIA 4IR6A 5HQ6A 5CGPA 3FKMX 3JVJA 1WUMA 2FSAA 5HFQA 5D24A 4MR3A 2YW5A 3HMFA 4X2IA 5DFCA 4UIUA 4NR6A 2OSSA 4QSVA 3TLPA 4HXRA 1F68A 4A9HA 2D9EA 4QNSA 5KTWA 3O34A 5D3NA 2R0VA 5CQ6A 5F60A 4O7EA 4NS5A 4A9KA 2E7NA 4YY4A 4NYXA 4ZC9A 4QUUA 5CU8A 4N4HA 2MJVB 2WP2A 4QY4A 4KCXA 4XYAA 5EPRA 4O70A 2NXBA 4YYGA 4NR8A 4O7CA 4YYMA 4LYIA 5ENBA 5JWMA 5E9VA 5CPEA 5H1VA 5L97A 4YATA 4YBMA 3MULA 5EICA 4A9IA 2N9GA 5D3TA 3SVGA 2YYNA 4NR7A 2KTBB 5A5OA 5HRXA 3D7CA 3LQJA 4NR4A 3U5NA 5EPSA 4QB3A 3LXJA 4YH4A 5C87A 5F61A 5FDZA 5I89A 4WIVA 4MENA 4MEQA 2DVQA 3Q2FA 5D3HA 5G4RA 4N4GA 5I40A 5D26A 4CL9A 5F3AA 2R0YA 4TZ2A 3MB3A 4NR9A 5A85A 5TCMA 4QBMA 5E7DA 4XY9A 4UIXA 2GRCA 5EU1A 5L98A 4YYDA 5DKCA 1WUGA 4O7AA 2OO1A 4YBSA 5IGLA 5HQ5A 1E6IA 5D25A 5F5ZA 5FFVA 5I80A 5HRVA 5L8TA 4PCIA 3U5KA 4A9OA 3IU6A 5H85A 5KO4A 5DW1A 5ENFA 5FH7A 3S92A 5F1LA 1N72A 5FE1A 5CQ4A 3I3JA 4ZQLA 5AD3A 4AKNA 4UIWA 3GG3A 5FE3A 4QC1A 5EISA 5E3GA 5EGUA 4KV4A 4MR5A 5DLZA 4A9LA 5ENIA 4QC3A 5FH8A 5D3LA 5CP5A 4HBWA 4IOQA 3IU5A 5CS8A 5DKDA 4TU6A 5II1A 3U5JA 3QZSA 4HXKA 4TT2A 5HM0A 4C67A 5BT3A 4HXNA 5CUBA 2F6NA 3LQIA 5TB6A 4TU4A 4O76A 4A9NA 4NRCA 5CY9A 4QEVA 4A9JA 3G0LA 4BW3A 5K29A 5F25A 5HQ7A 2DVSA 4BW1A 4LZ2A 1ZS5A 2I8NA 4HBVA 4HBXA 4Q0NA 5CQ8A 5E9YA 4Z1SA 4HXMA 4F3IA 2LSPB 5DY7A 5E9IA 4KV1A 4IR3A 4LYSA 5EI4A 5ETDA 4QSWA 4QZSA 5E3DA 4A9MA 5I1QA 3O36A 3MUKA 4CUPA 5FE9A 4NUCA 3QZTA 5LUUA 5EQ1A 4WHWA 5LKXA 4NYWA 4UITA 3UVDA 5I7YA 2DVVA 4N3WA 5CFWA 4MEOA 5F62A 5E73A 4A9EA 3O37A 3UV2A 3K2JA 5LKUA 4NR5A 4PY6A 4UYDA 5HFRA 5FG5A 5LJ2A 3MB4A 3AQAA 3QZVA 5C8GA 2WP1A 4TT4A 4LRGA 4UIZA 4QSPA 4E96A 2I7KA 2RNWA 5DYCA 2D82A 5DBMA 4YY6A 5L99A 4UYFA 4QR3A 5FB0A 3G0JA 4YABA 4IORA 4IOOA 5BT5A 5ENGA 5FG4A 4QSUA 4N4IA 5D3JA 2G4AA 1JSPB 5I83A 2E7OA 4LYWA 4LZRA 4MR6A 5KHMA 5ENEA 5DLXA 2RI7A 4QEWA 5HRWA 2YEKA 4QSSA 3U5LA 3JVMA 3U5OA 5FH6A 4N4FA 4YYHA 4O7FA 5EWVA 5CQ7A 5CUGA 5IIDA 5AD2A 5D3SA 5FE5A 1EQFA 3AADA 5COIA 4NYVA 4TT6A 5I86A 4CURA 5A7CA 4ZW1A 2YDWA 5FE8A 3P1DA 4Z6IA 4O77A 3JVLA 4NUEA 5BT4A 2DWWA 4ALGA 5ACYA 3SVFA 5KU3A 4CFLA 5IGMA 5A81A 4Z1QA 4IR5A 4YK0A 5CUCA 5AMFA 4O72A 4BHWA 4J3IA 5HJCA 5IG6A 5CZGA 3P1FA 4TYLA 2OUOA 4TZ8A 5HELA 4PTBA 2RO1A 4QR4A 3DAIA 4NUDA 5H1UA 4J0SA 4Z93A 5F63A 4OGJA 4MR4A 4CUSA 4HXOA 5DFDA 5FE6A 5DYXA 5E9MA 3UV4A 5CTLA 5F1HA 4O7BA 5E9LA 2L5EA 4YBTA 5ENJA 4Q0OA 4YH3A 4CUQA 5G4SA 4YADA 5A5RA 5L96A 4HXLA 4HXPA 4XY8A 4CUTA 5IBNA 4QEUA 5D3PA 5D0CA 2H60A 2YQDA 5EWHA 3MXFA 3P5OA 4MEPA 4UYGA 5LJ1A 4A9FA 5D3RA 3NXBA 5IGNA 4LZSA 2DKWA 4RVRA 2R0SA 4Z6HA 4NQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O71 A;  3HMH A;  4TTE A;  5CRZ A;  3ZYU A;  4QYL A;  4CLB A;  4UIY A;  5ENH A;  4UYE A;  4WHU A;  5C7N A;  4YYJ A;  3JVK A;  4GPJ A;  4QSQ A;  1X0J A;  5CUA A;  5J0D A;  2RS9 B;  5C4Q A;  4QYD A;  5A5N A;  4BW2 A;  5DYA A;  5FBX A;  3SVH A;  5EM3 A;  5CQ5 A;  3P1E A;  5CQ3 A;  5A5Q A;  5FG6 A;  5HEN A;  4DON A;  5A82 A;  2DAT A;  4YYI A;  4PS5 A;  4OGI A;  2RNX A;  5CRM A;  5I88 A;  4TS8 A;  3U5M A;  2R10 A;  4YAX A;  3LQH A;  3UVY A;  5F36 A;  5FE4 A;  5IGK A;  3DWY A;  3P1C A;  2YEL A;  3MQM A;  2DVR A;  5DFB A;  5LKT A;  4BW4 A;  4LDF A;  5EP7 A;  4PKL A;  5E0R A;  4C66 A;  5F2P A;  5KTX A;  3HME A;  4QSR A;  5HEM A;  5EWW A;  4QST A;  4NRA A;  5FE0 A;  5C89 A;  4LR6 A;  5FFY A;  5HLS A;  2L84 A;  4YC9 A;  1JM4 B;  4NXJ A;  5CUE A;  2F6J A;  5H1T A;  2YEM A;  5AME A;  4CFK A;  4YYK A;  5DW2 A;  4Y03 A;  4O78 A;  3S91 A;  2RNY A;  4NQN A;  2L85 A;  5I7X A;  3RCW A;  5EPB A;  2E3K A;  4UYF B;  5L8U A;  5II2 A;  5JI8 A;  3Q2E A;  5D7X A;  4HBY A;  5ETB A;  4HXS A;  2RFJ A;  5A5S A;  5LVQ A;  5I29 A;  4O74 A;  5DKH A;  4IR4 A;  4FLP A;  5FE2 A;  4PCE A;  3UV5 A;  4ALH A;  4J0R A;  4UIV A;  4UYH A;  3UVX A;  4BJX A;  5EA1 A;  5FE7 A;  4NRB A;  4O75 A;  4LC2 A;  3UVW A;  4J1P A;  3O35 A;  4XUB A;  4CUU A;  5HCL A;  5EWD A;  5EK9 A;  5C85 A;  4QUT A;  4QSX A;  4TQN A;  5DX4 A;  5DYU A;  5LJ0 A;  3LJW A;  4QR5 A;  5EV9 A;  5EVA A;  5CQT A;  5EWC A;  5LVR A;  3O33 A;  5FB1 A;  5LKZ A;  4YYN A;  3UW9 A;  5E74 A;  5ENC A;  4OUF A;  5FFW A;  4XUA A;  5A5P A;  5CUD A;  3U5P A;  5KTU A;  5A83 A;  5E9K A;  5CQA A;  3ONI A;  4IR6 A;  5HQ6 A;  5CGP A;  3FKM X;  3JVJ A;  1WUM A;  2FSA A;  5HFQ A;  5D24 A;  4MR3 A;  2YW5 A;  3HMF A;  4X2I A;  5DFC A;  4UIU A;  4NR6 A;  2OSS A;  4QSV A;  3TLP A;  4HXR A;  1F68 A;  4A9H A;  2D9E A;  4QNS A;  5KTW A;  3O34 A;  5D3N A;  2R0V A;  5CQ6 A;  5F60 A;  4O7E A;  4NS5 A;  4A9K A;  2E7N A;  4YY4 A;  4NYX A;  4ZC9 A;  4QUU A;  5CU8 A;  4N4H A;  2MJV B;  2WP2 A;  4QY4 A;  4KCX A;  4XYA A;  5EPR A;  4O70 A;  2NXB A;  4YYG A;  4NR8 A;  4O7C A;  4YYM A;  4LYI A;  5ENB A;  5JWM A;  5E9V A;  5CPE A;  5H1V A;  5L97 A;  4YAT A;  4YBM A;  3MUL A;  5EIC A;  4A9I A;  2N9G A;  5D3T A;  3SVG A;  2YYN A;  4NR7 A;  2KTB B;  5A5O A;  5HRX A;  3D7C A;  3LQJ A;  4NR4 A;  3U5N A;  5EPS A;  4QB3 A;  3LXJ A;  4YH4 A;  5C87 A;  5F61 A;  5FDZ A;  5I89 A;  4WIV A;  4MEN A;  4MEQ A;  2DVQ A;  3Q2F A;  5D3H A;  5G4R A;  4N4G A;  5I40 A;  5D26 A;  4CL9 A;  5F3A A;  2R0Y A;  4TZ2 A;  3MB3 A;  4NR9 A;  5A85 A;  5TCM A;  4QBM A;  5E7D A;  4XY9 A;  4UIX A;  2GRC A;  5EU1 A;  5L98 A;  4YYD A;  5DKC A;  1WUG A;  4O7A A;  2OO1 A;  4YBS A;  5IGL A;  5HQ5 A;  1E6I A;  5D25 A;  5F5Z A;  5FFV A;  5I80 A;  5HRV A;  5L8T A;  4PCI A;  3U5K A;  4A9O A;  3IU6 A;  5H85 A;  5KO4 A;  5DW1 A;  5ENF A;  5FH7 A;  3S92 A;  5F1L A;  1N72 A;  5FE1 A;  5CQ4 A;  3I3J A;  4ZQL A;  5AD3 A;  4AKN A;  4UIW A;  3GG3 A;  5FE3 A;  4QC1 A;  5EIS A;  5E3G A;  5EGU A;  4KV4 A;  4MR5 A;  5DLZ A;  4A9L A;  5ENI A;  4QC3 A;  5FH8 A;  5D3L A;  5CP5 A;  4HBW A;  4IOQ A;  3IU5 A;  5CS8 A;  5DKD A;  4TU6 A;  5II1 A;  3U5J A;  3QZS A;  4HXK A;  4TT2 A;  5HM0 A;  4C67 A;  5BT3 A;  4HXN A;  5CUB A;  2F6N A;  3LQI A;  5TB6 A;  4TU4 A;  4O76 A;  4A9N A;  4NRC A;  5CY9 A;  4QEV A;  4A9J A;  3G0L A;  4BW3 A;  5K29 A;  5F25 A;  5HQ7 A;  2DVS A;  4BW1 A;  4LZ2 A;  1ZS5 A;  2I8N A;  4HBV A;  4HBX A;  4Q0N A;  5CQ8 A;  5E9Y A;  4Z1S A;  4HXM A;  4F3I A;  2LSP B;  5DY7 A;  5E9I A;  4KV1 A;  4IR3 A;  4LYS A;  5EI4 A;  5ETD A;  4QSW A;  4QZS A;  5E3D A;  4A9M A;  5I1Q A;  3O36 A;  3MUK A;  4CUP A;  5FE9 A;  4NUC A;  3QZT A;  5LUU A;  5EQ1 A;  4WHW A;  5LKX A;  4NYW A;  4UIT A;  3UVD A;  5I7Y A;  2DVV A;  4N3W A;  5CFW A;  4MEO A;  5F62 A;  5E73 A;  4A9E A;  3O37 A;  3UV2 A;  3K2J A;  5LKU A;  4NR5 A;  4PY6 A;  4UYD A;  5HFR A;  5FG5 A;  5LJ2 A;  3MB4 A;  3AQA A;  3QZV A;  5C8G A;  2WP1 A;  4TT4 A;  4LRG A;  4UIZ A;  4QSP A;  4E96 A;  2I7K A;  2RNW A;  5DYC A;  2D82 A;  5DBM A;  4YY6 A;  5L99 A;  4UYF A;  4QR3 A;  5FB0 A;  3G0J A;  4YAB A;  4IOR A;  4IOO A;  5BT5 A;  5ENG A;  5FG4 A;  4QSU A;  4N4I A;  5D3J A;  2G4A A;  1JSP B;  5I83 A;  2E7O A;  4LYW A;  4LZR A;  4MR6 A;  5KHM A;  5ENE A;  5DLX A;  2RI7 A;  4QEW A;  5HRW A;  2YEK A;  4QSS A;  3U5L A;  3JVM A;  3U5O A;  5FH6 A;  4N4F A;  4YYH A;  4O7F A;  5EWV A;  5CQ7 A;  5CUG A;  5IID A;  5AD2 A;  5D3S A;  5FE5 A;  1EQF A;  3AAD A;  5COI A;  4NYV A;  4TT6 A;  5I86 A;  4CUR A;  5A7C A;  4ZW1 A;  2YDW A;  5FE8 A;  3P1D A;  4Z6I A;  4O77 A;  3JVL A;  4NUE A;  5BT4 A;  2DWW A;  4ALG A;  5ACY A;  3SVF A;  5KU3 A;  4CFL A;  5IGM A;  5A81 A;  4Z1Q A;  4IR5 A;  4YK0 A;  5CUC A;  5AMF A;  4O72 A;  4BHW A;  4J3I A;  5HJC A;  5IG6 A;  5CZG A;  3P1F A;  4TYL A;  2OUO A;  4TZ8 A;  5HEL A;  4PTB A;  2RO1 A;  4QR4 A;  3DAI A;  4NUD A;  5H1U A;  4J0S A;  4Z93 A;  5F63 A;  4OGJ A;  4MR4 A;  4CUS A;  4HXO A;  5DFD A;  5FE6 A;  5DYX A;  5E9M A;  3UV4 A;  5CTL A;  5F1H A;  4O7B A;  5E9L A;  2L5E A;  4YBT A;  5ENJ A;  4Q0O A;  4YH3 A;  4CUQ A;  5G4S A;  4YAD A;  5A5R A;  5L96 A;  4HXL A;  4HXP A;  4XY8 A;  4CUT A;  5IBN A;  4QEU A;  5D3P A;  5D0C A;  2H60 A;  2YQD A;  5EWH A;  3MXF A;  3P5O A;  4MEP A;  4UYG A;  5LJ1 A;  4A9F A;  5D3R A;  3NXB A;  5IGN A;  4LZS A;  2DKW A;  4RVR A;  2R0S A;  4Z6H A;  4NQM A; 
#chains in the Genus database with same CATH topology
 4O71 A;  3HMH A;  4TTE A;  5CRZ A;  4AKI A;  3ZYU A;  4QYL A;  4CLB A;  4UIY A;  5ENH A;  4UYE A;  4WHU A;  5C7N A;  4YYJ A;  3JVK A;  4GPJ A;  4QSQ A;  1X0J A;  5CUA A;  5J0D A;  2RS9 B;  5C4Q A;  4QYD A;  5A5N A;  4BW2 A;  5DYA A;  5FBX A;  3SVH A;  5EM3 A;  5CQ5 A;  3P1E A;  5CQ3 A;  5A5Q A;  5FG6 A;  5HEN A;  4DON A;  5A82 A;  2DAT A;  4YYI A;  4PS5 A;  4OGI A;  2RNX A;  5CRM A;  5I88 A;  4TS8 A;  3VKH A;  3U5M A;  2EJN A;  2R10 A;  4YAX A;  3LQH A;  3UVY A;  5F36 A;  5FE4 A;  5IGK A;  3DWY A;  3P1C A;  2YEL A;  3MQM A;  2DVR A;  5DFB A;  5LKT A;  4BW4 A;  4LDF A;  5EP7 A;  4PKL A;  5E0R A;  4C66 A;  5F2P A;  5KTX A;  3HME A;  4QSR A;  5HEM A;  5EWW A;  4QST A;  4NRA A;  5FE0 A;  5C89 A;  4LR6 A;  5FFY A;  5HLS A;  2L84 A;  4YC9 A;  1JM4 B;  4NXJ A;  5CUE A;  2F6J A;  5H1T A;  2YEM A;  5AME A;  4CFK A;  4YYK A;  5DW2 A;  4Y03 A;  4O78 A;  3S91 A;  2RNY A;  4NQN A;  2L85 A;  5I7X A;  3RCW A;  5EPB A;  2E3K A;  4UYF B;  5L8U A;  5II2 A;  5JI8 A;  3Q2E A;  5D7X A;  4HBY A;  5ETB A;  4HXS A;  2RFJ A;  5A5S A;  5LVQ A;  5I29 A;  4O74 A;  5DKH A;  4IR4 A;  4FLP A;  5FE2 A;  4PCE A;  3UV5 A;  4ALH A;  4J0R A;  4UIV A;  4UYH A;  3UVX A;  4BJX A;  5EA1 A;  5FE7 A;  4NRB A;  4O75 A;  4LC2 A;  3UVW A;  4J1P A;  3O35 A;  4XUB A;  4CUU A;  5HCL A;  5EWD A;  5EK9 A;  5C85 A;  4QUT A;  4QSX A;  4TQN A;  5DX4 A;  5DYU A;  5LJ0 A;  3LJW A;  4QR5 A;  5EV9 A;  5EVA A;  5CQT A;  5EWC A;  5LVR A;  3O33 A;  5FB1 A;  5LKZ A;  4YYN A;  3UW9 A;  5E74 A;  5ENC A;  4OUF A;  5FFW A;  4XUA A;  5A5P A;  5CUD A;  3U5P A;  5KTU A;  5A83 A;  5E9K A;  5CQA A;  3ONI A;  4IR6 A;  5HQ6 A;  5CGP A;  3FKM X;  1WUM A;  3JVJ A;  2FSA A;  5HFQ A;  5D24 A;  4MR3 A;  2YW5 A;  3HMF A;  4X2I A;  5DFC A;  4UIU A;  4NR6 A;  2OSS A;  4QSV A;  3TLP A;  4HXR A;  1F68 A;  4A9H A;  2D9E A;  4QNS A;  5KTW A;  3O34 A;  5D3N A;  2R0V A;  5CQ6 A;  5F60 A;  4O7E A;  4NS5 A;  4A9K A;  2E7N A;  4YY4 A;  4NYX A;  4ZC9 A;  4QUU A;  5CU8 A;  4N4H A;  2MJV B;  2WP2 A;  4QY4 A;  4KCX A;  4XYA A;  5EPR A;  4O70 A;  2NXB A;  4YYG A;  4NR8 A;  4O7C A;  4YYM A;  4LYI A;  5ENB A;  5JWM A;  5E9V A;  5CPE A;  5H1V A;  5L97 A;  4YAT A;  4YBM A;  3MUL A;  5EIC A;  4A9I A;  2N9G A;  5D3T A;  3SVG A;  2YYN A;  4NR7 A;  2KTB B;  5A5O A;  5HRX A;  3D7C A;  3LQJ A;  4NR4 A;  3U5N A;  5EPS A;  4QB3 A;  3LXJ A;  4YH4 A;  5C87 A;  5F61 A;  5FDZ A;  5I89 A;  4WIV A;  4MEN A;  4MEQ A;  2DVQ A;  3Q2F A;  5D3H A;  5G4R A;  4N4G A;  5I40 A;  5D26 A;  4AKH A;  4CL9 A;  5F3A A;  2R0Y A;  4TZ2 A;  3MB3 A;  4NR9 A;  5A85 A;  5TCM A;  4AI6 A;  4QBM A;  5E7D A;  4XY9 A;  4UIX A;  2GRC A;  5EU1 A;  5L98 A;  4YYD A;  5DKC A;  1WUG A;  4O7A A;  2OO1 A;  4YBS A;  5IGL A;  5HQ5 A;  1E6I A;  5D25 A;  5F5Z A;  5FFV A;  5I80 A;  5HRV A;  5L8T A;  4PCI A;  3U5K A;  4A9O A;  3IU6 A;  5H85 A;  5KO4 A;  5DW1 A;  5ENF A;  5FH7 A;  3S92 A;  5F1L A;  1N72 A;  5FE1 A;  5CQ4 A;  3I3J A;  4ZQL A;  5AD3 A;  4AKN A;  4UIW A;  3GG3 A;  5FE3 A;  4QC1 A;  5EIS A;  5E3G A;  5EGU A;  4KV4 A;  4MR5 A;  5DLZ A;  4A9L A;  5ENI A;  4QC3 A;  5FH8 A;  5D3L A;  5CP5 A;  4HBW A;  4IOQ A;  3VKG A;  3IU5 A;  5CS8 A;  5DKD A;  4TU6 A;  5II1 A;  3U5J A;  3QZS A;  4HXK A;  4TT2 A;  5HM0 A;  4C67 A;  5BT3 A;  4HXN A;  5CUB A;  2F6N A;  3LQI A;  5TB6 A;  4TU4 A;  4O76 A;  4A9N A;  4NRC A;  5CY9 A;  4QEV A;  4A9J A;  3ERR A;  3G0L A;  4BW3 A;  5K29 A;  1PUO A;  5F25 A;  5HQ7 A;  2DVS A;  4BW1 A;  4LZ2 A;  1ZS5 A;  2I8N A;  4HBV A;  4HBX A;  4Q0N A;  5CQ8 A;  5E9Y A;  4Z1S A;  4HXM A;  4F3I A;  2LSP B;  5DY7 A;  5E9I A;  3D1D A;  4KV1 A;  4IR3 A;  4LYS A;  5EI4 A;  5ETD A;  4QSW A;  4QZS A;  5E3D A;  4A9M A;  5I1Q A;  3O36 A;  3MUK A;  4CUP A;  5FE9 A;  4NUC A;  3QZT A;  5LUU A;  4AKG A;  5EQ1 A;  4WHW A;  5LKX A;  4NYW A;  4UIT A;  3UVD A;  5I7Y A;  2DVV A;  4N3W A;  5CFW A;  4MEO A;  5F62 A;  5E73 A;  4A9E A;  3O37 A;  3UV2 A;  3K2J A;  5LKU A;  4NR5 A;  4PY6 A;  4UYD A;  5HFR A;  5FG5 A;  5LJ2 A;  3MB4 A;  3AQA A;  3QZV A;  5C8G A;  2WP1 A;  4TT4 A;  4LRG A;  3D1B A;  4UIZ A;  4QSP A;  4E96 A;  2I7K A;  2RNW A;  5DYC A;  2D82 A;  5DBM A;  4YY6 A;  5L99 A;  4UYF A;  4QR3 A;  5FB0 A;  3G0J A;  4YAB A;  4IOR A;  4IOO A;  5BT5 A;  5ENG A;  5FG4 A;  4QSU A;  4N4I A;  5D3J A;  2G4A A;  1JSP B;  5I83 A;  2E7O A;  4LYW A;  4LZR A;  4MR6 A;  5KHM A;  5ENE A;  5DLX A;  2RI7 A;  4QEW A;  5HRW A;  2YEK A;  4QSS A;  3U5L A;  3JVM A;  3U5O A;  5FH6 A;  4N4F A;  4YYH A;  4O7F A;  5EWV A;  5CQ7 A;  5CUG A;  5IID A;  5AD2 A;  5D3S A;  5FE5 A;  1EQF A;  3AAD A;  5COI A;  4NYV A;  4TT6 A;  5I86 A;  4CUR A;  5A7C A;  4ZW1 A;  2YDW A;  5FE8 A;  3P1D A;  4Z6I A;  4O77 A;  3JVL A;  4NUE A;  5BT4 A;  2DWW A;  4ALG A;  5ACY A;  3SVF A;  5KU3 A;  4CFL A;  5IGM A;  5A81 A;  4Z1Q A;  4IR5 A;  4YK0 A;  5CUC A;  5AMF A;  4O72 A;  4BHW A;  4J3I A;  5HJC A;  5IG6 A;  5CZG A;  3P1F A;  4TYL A;  2OUO A;  4TZ8 A;  5HEL A;  4PTB A;  1ZKR A;  2RO1 A;  4QR4 A;  3DAI A;  4NUD A;  5H1U A;  4J0S A;  4Z93 A;  5F63 A;  4OGJ A;  4MR4 A;  4CUS A;  4HXO A;  5DFD A;  5FE6 A;  5DYX A;  5E9M A;  3UV4 A;  5CTL A;  5F1H A;  4O7B A;  5E9L A;  2L5E A;  4YBT A;  5ENJ A;  4Q0O A;  4YH3 A;  4CUQ A;  5G4S A;  4YAD A;  5A5R A;  5L96 A;  4HXL A;  4HXP A;  4XY8 A;  4CUT A;  5IBN A;  4QEU A;  5D3P A;  5D0C A;  2H60 A;  2YQD A;  5EWH A;  3MXF A;  3P5O A;  4MEP A;  4UYG A;  5LJ1 A;  4A9F A;  5D3R A;  3NXB A;  5IGN A;  4LZS A;  2DKW A;  4RVR A;  2R0S A;  4Z6H A;  4NQM A; 
#chains in the Genus database with same CATH homology
 4O71 A;  3HMH A;  4TTE A;  5CRZ A;  3ZYU A;  4QYL A;  4CLB A;  4UIY A;  5ENH A;  4UYE A;  4WHU A;  5C7N A;  4YYJ A;  3JVK A;  4GPJ A;  4QSQ A;  1X0J A;  5CUA A;  5J0D A;  2RS9 B;  5C4Q A;  4QYD A;  5A5N A;  4BW2 A;  5DYA A;  5FBX A;  3SVH A;  5EM3 A;  5CQ5 A;  3P1E A;  5CQ3 A;  5A5Q A;  5FG6 A;  5HEN A;  4DON A;  5A82 A;  2DAT A;  4YYI A;  4PS5 A;  4OGI A;  2RNX A;  5CRM A;  5I88 A;  4TS8 A;  3U5M A;  2R10 A;  4YAX A;  3LQH A;  3UVY A;  5F36 A;  5FE4 A;  5IGK A;  3DWY A;  3P1C A;  2YEL A;  3MQM A;  2DVR A;  5DFB A;  5LKT A;  4BW4 A;  4LDF A;  5EP7 A;  4PKL A;  5E0R A;  4C66 A;  5F2P A;  5KTX A;  3HME A;  4QSR A;  5HEM A;  5EWW A;  4QST A;  4NRA A;  5FE0 A;  5C89 A;  4LR6 A;  5FFY A;  5HLS A;  2L84 A;  4YC9 A;  1JM4 B;  4NXJ A;  5CUE A;  2F6J A;  5H1T A;  2YEM A;  5AME A;  4CFK A;  4YYK A;  5DW2 A;  4Y03 A;  4O78 A;  3S91 A;  2RNY A;  4NQN A;  2L85 A;  5I7X A;  3RCW A;  5EPB A;  2E3K A;  4UYF B;  5L8U A;  5II2 A;  5JI8 A;  3Q2E A;  5D7X A;  4HBY A;  5ETB A;  4HXS A;  2RFJ A;  5A5S A;  5LVQ A;  5I29 A;  4O74 A;  5DKH A;  4IR4 A;  4FLP A;  5FE2 A;  4PCE A;  3UV5 A;  4ALH A;  4J0R A;  4UIV A;  4UYH A;  3UVX A;  4BJX A;  5EA1 A;  5FE7 A;  4NRB A;  4O75 A;  4LC2 A;  3UVW A;  4J1P A;  3O35 A;  4XUB A;  4CUU A;  5HCL A;  5EWD A;  5EK9 A;  5C85 A;  4QUT A;  4QSX A;  4TQN A;  5DX4 A;  5DYU A;  5LJ0 A;  3LJW A;  4QR5 A;  5EV9 A;  5EVA A;  5CQT A;  5EWC A;  5LVR A;  3O33 A;  5FB1 A;  5LKZ A;  4YYN A;  3UW9 A;  5E74 A;  5ENC A;  4OUF A;  5FFW A;  4XUA A;  5A5P A;  5CUD A;  3U5P A;  5KTU A;  5A83 A;  5E9K A;  5CQA A;  3ONI A;  4IR6 A;  5HQ6 A;  5CGP A;  3FKM X;  3JVJ A;  1WUM A;  2FSA A;  5HFQ A;  5D24 A;  4MR3 A;  2YW5 A;  3HMF A;  4X2I A;  5DFC A;  4UIU A;  4NR6 A;  2OSS A;  4QSV A;  3TLP A;  4HXR A;  1F68 A;  4A9H A;  2D9E A;  4QNS A;  5KTW A;  3O34 A;  5D3N A;  2R0V A;  5CQ6 A;  5F60 A;  4O7E A;  4NS5 A;  4A9K A;  2E7N A;  4YY4 A;  4NYX A;  4ZC9 A;  4QUU A;  5CU8 A;  4N4H A;  2MJV B;  2WP2 A;  4QY4 A;  4KCX A;  4XYA A;  5EPR A;  4O70 A;  2NXB A;  4YYG A;  4NR8 A;  4O7C A;  4YYM A;  4LYI A;  5ENB A;  5JWM A;  5E9V A;  5CPE A;  5H1V A;  5L97 A;  4YAT A;  4YBM A;  3MUL A;  5EIC A;  4A9I A;  2N9G A;  5D3T A;  3SVG A;  2YYN A;  4NR7 A;  2KTB B;  5A5O A;  5HRX A;  3D7C A;  3LQJ A;  4NR4 A;  3U5N A;  5EPS A;  4QB3 A;  3LXJ A;  4YH4 A;  5C87 A;  5F61 A;  5FDZ A;  5I89 A;  4WIV A;  4MEN A;  4MEQ A;  2DVQ A;  3Q2F A;  5D3H A;  5G4R A;  4N4G A;  5I40 A;  5D26 A;  4CL9 A;  5F3A A;  2R0Y A;  4TZ2 A;  3MB3 A;  4NR9 A;  5A85 A;  5TCM A;  4QBM A;  5E7D A;  4XY9 A;  4UIX A;  2GRC A;  5EU1 A;  5L98 A;  4YYD A;  5DKC A;  1WUG A;  4O7A A;  2OO1 A;  4YBS A;  5IGL A;  5HQ5 A;  1E6I A;  5D25 A;  5F5Z A;  5FFV A;  5I80 A;  5HRV A;  5L8T A;  4PCI A;  3U5K A;  4A9O A;  3IU6 A;  5H85 A;  5KO4 A;  5DW1 A;  5ENF A;  5FH7 A;  3S92 A;  5F1L A;  1N72 A;  5FE1 A;  5CQ4 A;  3I3J A;  4ZQL A;  5AD3 A;  4AKN A;  4UIW A;  3GG3 A;  5FE3 A;  4QC1 A;  5EIS A;  5E3G A;  5EGU A;  4KV4 A;  4MR5 A;  5DLZ A;  4A9L A;  5ENI A;  4QC3 A;  5FH8 A;  5D3L A;  5CP5 A;  4HBW A;  4IOQ A;  3IU5 A;  5CS8 A;  5DKD A;  4TU6 A;  5II1 A;  3U5J A;  3QZS A;  4HXK A;  4TT2 A;  5HM0 A;  4C67 A;  5BT3 A;  4HXN A;  5CUB A;  2F6N A;  3LQI A;  5TB6 A;  4TU4 A;  4O76 A;  4A9N A;  4NRC A;  5CY9 A;  4QEV A;  4A9J A;  3G0L A;  4BW3 A;  5K29 A;  5F25 A;  5HQ7 A;  2DVS A;  4BW1 A;  4LZ2 A;  1ZS5 A;  2I8N A;  4HBV A;  4HBX A;  4Q0N A;  5CQ8 A;  5E9Y A;  4Z1S A;  4HXM A;  4F3I A;  2LSP B;  5DY7 A;  5E9I A;  4KV1 A;  4IR3 A;  4LYS A;  5EI4 A;  5ETD A;  4QSW A;  4QZS A;  5E3D A;  4A9M A;  5I1Q A;  3O36 A;  3MUK A;  4CUP A;  5FE9 A;  4NUC A;  3QZT A;  5LUU A;  5EQ1 A;  4WHW A;  5LKX A;  4NYW A;  4UIT A;  3UVD A;  5I7Y A;  2DVV A;  4N3W A;  5CFW A;  4MEO A;  5F62 A;  5E73 A;  4A9E A;  3O37 A;  3UV2 A;  3K2J A;  5LKU A;  4NR5 A;  4PY6 A;  4UYD A;  5HFR A;  5FG5 A;  5LJ2 A;  3MB4 A;  3AQA A;  3QZV A;  5C8G A;  2WP1 A;  4TT4 A;  4LRG A;  4UIZ A;  4QSP A;  4E96 A;  2I7K A;  2RNW A;  5DYC A;  2D82 A;  5DBM A;  4YY6 A;  5L99 A;  4UYF A;  4QR3 A;  5FB0 A;  3G0J A;  4YAB A;  4IOR A;  4IOO A;  5BT5 A;  5ENG A;  5FG4 A;  4QSU A;  4N4I A;  5D3J A;  2G4A A;  1JSP B;  5I83 A;  2E7O A;  4LYW A;  4LZR A;  4MR6 A;  5KHM A;  5ENE A;  5DLX A;  2RI7 A;  4QEW A;  5HRW A;  2YEK A;  4QSS A;  3U5L A;  3JVM A;  3U5O A;  5FH6 A;  4N4F A;  4YYH A;  4O7F A;  5EWV A;  5CQ7 A;  5CUG A;  5IID A;  5AD2 A;  5D3S A;  5FE5 A;  1EQF A;  3AAD A;  5COI A;  4NYV A;  4TT6 A;  5I86 A;  4CUR A;  5A7C A;  4ZW1 A;  2YDW A;  5FE8 A;  3P1D A;  4Z6I A;  4O77 A;  3JVL A;  4NUE A;  5BT4 A;  2DWW A;  4ALG A;  5ACY A;  3SVF A;  5KU3 A;  4CFL A;  5IGM A;  5A81 A;  4Z1Q A;  4IR5 A;  4YK0 A;  5CUC A;  5AMF A;  4O72 A;  4BHW A;  4J3I A;  5HJC A;  5IG6 A;  5CZG A;  3P1F A;  4TYL A;  2OUO A;  4TZ8 A;  5HEL A;  4PTB A;  2RO1 A;  4QR4 A;  3DAI A;  4NUD A;  5H1U A;  4J0S A;  4Z93 A;  5F63 A;  4OGJ A;  4MR4 A;  4CUS A;  4HXO A;  5DFD A;  5FE6 A;  5DYX A;  5E9M A;  3UV4 A;  5CTL A;  5F1H A;  4O7B A;  5E9L A;  2L5E A;  4YBT A;  5ENJ A;  4Q0O A;  4YH3 A;  4CUQ A;  5G4S A;  4YAD A;  5A5R A;  5L96 A;  4HXL A;  4HXP A;  4XY8 A;  4CUT A;  5IBN A;  4QEU A;  5D3P A;  5D0C A;  2H60 A;  2YQD A;  5EWH A;  3MXF A;  3P5O A;  4MEP A;  4UYG A;  5LJ1 A;  4A9F A;  5D3R A;  3NXB A;  5IGN A;  4LZS A;  2DKW A;  4RVR A;  2R0S A;  4Z6H A;  4NQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...