5I83A

Crystal structure of the bromodomain of human crebbp bound to the benzodiazepinone g02773986
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
114
structure length
114
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/inhibitor
molecule keywords CREB-binding protein
publication title Fragment-Based Discovery of a Selective and Cell-Active Benzodiazepinone CBP/EP300 Bromodomain Inhibitor (CPI-637).
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 114
sequence length 114
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i83A00
2L84A 5E9VA 5FFWA 5BT5A 4YC9A 5FE7A 3UV4A 5DY7A 5F3AA 4HXOA 4LZ2A 4QC3A 3IU6A 4XUBA 5E9KA 3Q2EA 2DVRA 3LQHA 4Z1SA 2OSSA 2GRCA 5KTUA 4PY6A 5F1LA 1ZS5A 5FG6A 4AKNA 5CQAA 4O78A 5EM3A 5C85A 5I40A 2RS9B 5A83A 4NYXA 4YYKA 5A7CA 3MB3A 4ALGA 4XY9A 3UVXA 5EA1A 5CU8A 5CFWA 5CRMA 4N4HA 5CZGA 3QZSA 2R0VA 5C8GA 5HENA 5HFQA 5ENGA 5FE2A 4A9NA 5D26A 4BW4A 3IU5A 4NRCA 4NYVA 4PTBA 3AADA 5FFVA 5IGLA 3G0JA 2R0YA 5CQ8A 2DKWA 5H1VA 5D3PA 4HXKA 4CL9A 5A5SA 4O7FA 3S91A 4MEOA 3P1CA 3U5PA 5DYCA 4LC2A 3O34A 4IOOA 5D3NA 5KO4A 1N72A 2L85A 3Q2FA 4UYHA 5FBXA 3P1EA 4NR8A 4HBVA 4O7AA 3NXBA 5CQ4A 5FG4A 4LZSA 3RCWA 4ALHA 5ETDA 4XYAA 4TU6A 4WHWA 5ETBA 4WIVA 4LYWA 2FSAA 4QSPA 4LZRA 5LKTA 4GPJA 4OGJA 4QSVA 3U5JA 5E7DA 5L96A 5IGKA 4QY4A 5G4RA 5KTWA 3U5OA 4N3WA 4QR5A 5DW1A 4O72A 5D3RA 4NXJA 4QB3A 5FE4A 5F1HA 4RVRA 4QR3A 5I80A 5C7NA 2RNYA 4NQMA 3JVKA 4Z6HA 5EWDA 4HXPA 5D24A 3QZVA 5LVRA 5E74A 4YYDA 4FLPA 2E7NA 4C66A 4QYDA 5CP5A 4UIVA 5FE6A 1JSPB 4TTEA 5F5ZA 4YABA 5EV9A 5CPEA 1WUMA 5ENCA 4QUTA 4ZQLA 4WHUA 5HEMA 5CQ3A 3U5LA 5L8UA 4HXSA 4NR5A 4OUFA 4MEQA 5I88A 5F2PA 2YELA 5EVAA 4BW3A 5DFBA 3JVJA 4Z6IA 4MR4A 3MUKA 4Y03A 5CUDA 2OO1A 5L99A 5CUAA 5EGUA 4LYIA 2DVVA 5E3GA 5A82A 5KTXA 5AMEA 5TB6A 5EPRA 2F6NA 5ENIA 3UVYA 5D25A 3MB4A 4IOQA 5AD2A 5FB1A 4A9LA 4BHWA 4J0RA 4NS5A 5F62A 5H85A 5IGNA 5CUGA 5A5OA 4NR7A 4O7CA 5HFRA 5E73A 5LKUA 3UV2A 4C67A 5G4SA 4YYGA 4DONA 4LYSA 4J1PA 5CS8A 5I83A 5D3JA 5D3LA 5CTLA 4QSQA 5FG5A 4UYGA 4NR9A 2LSPB 4A9EA 3D7CA 3QZTA 2F6JA 3JVMA 3AQAA 5D3TA 5ENFA 4KV4A 4QSXA 5A81A 4O71A 4NYWA 3MQMA 4NR4A 5E9YA 2YW5A 3K2JA 2L5EA 3HMEA 4O74A 4UIUA 5LJ0A 5FFYA 4HXMA 4UYFB 4TZ8A 5FH8A 4MR6A 4NRAA 3MXFA 5E3DA 5C4QA 5FE9A 1JM4B 4KV1A 4F3IA 4TYLA 5FH6A 3SVFA 5COIA 5BT4A 4CUTA 2RFJA 4TU4A 5FE0A 5FDZA 5D0CA 4J0SA 5IG6A 3U5MA 2YYNA 5J0DA 5HLSA 4NQNA 2R10A 5HQ7A 3ONIA 2D82A 4QSUA 4A9HA 5LVQA 4NR6A 5DYAA 5TCMA 2G4AA 4O7EA 5II2A 5F60A 5LKZA 5DLXA 5FE5A 5H1TA 5EI4A 4QEVA 3O37A 3HMHA 2RI7A 4QC1A 4A9OA 4Z93A 4A9KA 5LJ2A 2YQDA 3FKMX 2N9GA 4YYIA 5C87A 5L97A 2DATA 3O35A 3ZYUA 2NXBA 2R0SA 4QZSA 5DX4A 5AMFA 5DFCA 5I89A 2KTBB 4Q0NA 4YK0A 5D3SA 5HM0A 4O75A 5CQTA 5I86A 4PCIA 5C89A 4O7BA 3LXJA 4HXNA 5EISA 5BT3A 4YYJA 4YY4A 5E9LA 1X0JA 5DKDA 2E7OA 4IR4A 5II1A 4TT4A 5D7XA 5A5NA 4YADA 4IR3A 4CUPA 4UIWA 3O33A 3UV5A 4QNSA 3GG3A 5AD3A 5EPBA 2YEMA 5CUBA 5CY9A 5E9IA 4MENA 4CFLA 5EPSA 2DVQA 5E9MA 5EWWA 4NRBA 5EWHA 4CUSA 2I7KA 5HQ6A 5JI8A 4CURA 5EK9A 3I3JA 4LDFA 2E3KA 5F61A 4Z1QA 3MULA 4Q0OA 2DWWA 4OGIA 4YYNA 4NUEA 3SVHA 5EU1A 4E96A 4QEUA 5I7XA 5HCLA 4IR6A 4PKLA 1EQFA 3SVGA 4PCEA 4CLBA 5EP7A 4HXLA 4YAXA 5DYUA 3JVLA 4X2IA 2D9EA 5DLZA 4QEWA 5EWCA 5JWMA 4HXRA 4A9FA 5KHMA 4YBSA 2WP1A 4N4FA 5CQ7A 4ZC9A 5KU3A 4O77A 5A85A 5I29A 4LR6A 4UYDA 5D3HA 1WUGA 4XUAA 5DW2A 3LJWA 3DWYA 3S92A 2H60A 4IORA 2YEKA 5IBNA 5ENEA 4UIYA 2DVSA 3P1FA 4J3IA 2RO1A 5LUUA 4N4IA 5F63A 4A9MA 5HELA 4TZ2A 4HBYA 4MR5A 5CRZA 4XY8A 5FE1A 3U5NA 4O70A 3TLPA 5F25A 5CQ6A 3LQJA 4HBXA 3UVDA 5EQ1A 3P1DA 3UW9A 4HBWA 5ENHA 5I1QA 4TQNA 4UYFA 3O36A 3UVWA 4YH4A 4TS8A 3P5OA 5HJCA 2RNXA 5FB0A 5HRVA 5H1UA 5ACYA 5FE3A 5F36A 5DYXA 4PS5A 4BW2A 4BW1A 4ZW1A 1E6IA 5I7YA 4KCXA 5EICA 5DFDA 5IIDA 3G0LA 4YH3A 2RNWA 5A5QA 4YATA 4YYHA 4NUCA 2MJVB 4UIXA 5LKXA 5K29A 5DKHA 4QSWA 4QYLA 5E0RA 4IR5A 4UIZA 2WP2A 3U5KA 5HRWA 5FH7A 5FE8A 4QSSA 5CUEA 4TT2A 4YY6A 4CUUA 4UITA 2I8NA 1F68A 4CUQA 4UYEA 3HMFA 4A9IA 4CFKA 4QSRA 3LQIA 5ENJA 5CUCA 5A5PA 4MR3A 4TT6A 4QSTA 4YYMA 5A5RA 4NUDA 5LJ1A 4O76A 5IGMA 4A9JA 5DBMA 4QR4A 2OUOA 5ENBA 5EWVA 4YBMA 4LRGA 3DAIA 5L8TA 4N4GA 4BJXA 5DKCA 5L98A 5HRXA 2YDWA 5HQ5A 4QUUA 5CQ5A 5CGPA 4YBTA 4MEPA 4QBMA
chains in the Genus database with same CATH superfamily
2L84A 5E9VA 5FFWA 5BT5A 4YC9A 5FE7A 3UV4A 5DY7A 5F3AA 4HXOA 4LZ2A 4QC3A 3IU6A 4XUBA 5E9KA 3Q2EA 2DVRA 3LQHA 4Z1SA 2OSSA 2GRCA 5KTUA 4PY6A 5F1LA 1ZS5A 5FG6A 4AKNA 5CQAA 4O78A 5EM3A 5C85A 5I40A 2RS9B 5A83A 4NYXA 4YYKA 5A7CA 3MB3A 4ALGA 4XY9A 3UVXA 5EA1A 5CU8A 5CFWA 5CRMA 4N4HA 3ERRA 5CZGA 3QZSA 2R0VA 5C8GA 5HENA 5HFQA 5ENGA 5FE2A 4A9NA 5D26A 4BW4A 3IU5A 4NRCA 4NYVA 4PTBA 3AADA 5FFVA 5IGLA 3G0JA 2R0YA 5CQ8A 2DKWA 5H1VA 5D3PA 4HXKA 4CL9A 5A5SA 4O7FA 3S91A 4MEOA 3P1CA 3U5PA 5DYCA 4LC2A 3O34A 4IOOA 5D3NA 5KO4A 1N72A 2L85A 3Q2FA 4UYHA 5FBXA 3P1EA 4NR8A 4HBVA 4O7AA 3NXBA 5CQ4A 5FG4A 4LZSA 3RCWA 4ALHA 5ETDA 4XYAA 4TU6A 4WHWA 5ETBA 4WIVA 4LYWA 2FSAA 4QSPA 4LZRA 5LKTA 4GPJA 4OGJA 4QSVA 3U5JA 5E7DA 5L96A 5IGKA 4QY4A 5G4RA 5KTWA 3U5OA 4N3WA 4QR5A 5DW1A 4O72A 5D3RA 4NXJA 4QB3A 5FE4A 5F1HA 4RVRA 4QR3A 5I80A 5C7NA 2RNYA 4NQMA 3JVKA 4Z6HA 5EWDA 4HXPA 5D24A 3QZVA 5LVRA 5E74A 4YYDA 4FLPA 2E7NA 4C66A 4QYDA 5CP5A 4UIVA 5FE6A 1JSPB 4TTEA 5F5ZA 4YABA 5EV9A 1PUOA 5CPEA 1WUMA 5ENCA 4QUTA 4ZQLA 4WHUA 5HEMA 5CQ3A 3U5LA 5L8UA 4HXSA 4NR5A 4OUFA 4MEQA 5I88A 5F2PA 2YELA 5EVAA 4BW3A 5DFBA 3JVJA 4Z6IA 4MR4A 3MUKA 4Y03A 5CUDA 2OO1A 5L99A 5CUAA 5EGUA 4LYIA 2DVVA 5E3GA 5A82A 5KTXA 5AMEA 5TB6A 5EPRA 2F6NA 5ENIA 3UVYA 5D25A 3MB4A 4IOQA 5AD2A 5FB1A 4A9LA 4BHWA 4J0RA 4NS5A 5F62A 5H85A 5IGNA 5CUGA 5A5OA 4NR7A 4O7CA 5HFRA 5E73A 5LKUA 3UV2A 4C67A 5G4SA 4YYGA 4DONA 4LYSA 4J1PA 5CS8A 3VKGA 5I83A 5D3JA 5D3LA 5CTLA 4QSQA 5FG5A 4UYGA 4NR9A 2LSPB 4A9EA 3D7CA 3QZTA 2F6JA 3JVMA 3AQAA 5D3TA 5ENFA 4KV4A 4QSXA 5A81A 4O71A 4NYWA 3MQMA 4NR4A 5E9YA 2YW5A 3K2JA 2L5EA 3HMEA 4O74A 2EJNA 4UIUA 5LJ0A 5FFYA 4HXMA 4UYFB 4TZ8A 5FH8A 4MR6A 4NRAA 3MXFA 5E3DA 5C4QA 5FE9A 1JM4B 4KV1A 4F3IA 4TYLA 5FH6A 3SVFA 5COIA 5BT4A 4CUTA 2RFJA 4TU4A 5FE0A 5FDZA 5D0CA 4J0SA 5IG6A 3U5MA 2YYNA 5J0DA 5HLSA 4NQNA 2R10A 5HQ7A 3ONIA 2D82A 4QSUA 4A9HA 5LVQA 4NR6A 5DYAA 5TCMA 2G4AA 4O7EA 5II2A 5F60A 5LKZA 5DLXA 5FE5A 5H1TA 5EI4A 4QEVA 3O37A 3HMHA 2RI7A 4QC1A 4A9OA 4Z93A 4A9KA 5LJ2A 2YQDA 3FKMX 2N9GA 4YYIA 5C87A 5L97A 2DATA 3O35A 3ZYUA 2NXBA 2R0SA 4QZSA 5DX4A 5AMFA 5DFCA 5I89A 2KTBB 4Q0NA 4YK0A 4AKHA 5D3SA 5HM0A 4O75A 1ZKRA 5CQTA 5I86A 4PCIA 5C89A 4O7BA 3LXJA 4HXNA 5EISA 5BT3A 4YYJA 4YY4A 5E9LA 1X0JA 5DKDA 2E7OA 4IR4A 5II1A 4TT4A 5D7XA 5A5NA 4YADA 4IR3A 4CUPA 4UIWA 3O33A 3UV5A 4QNSA 3GG3A 5AD3A 5EPBA 2YEMA 5CUBA 5CY9A 5E9IA 4MENA 4CFLA 5EPSA 2DVQA 5E9MA 5EWWA 4NRBA 5EWHA 4CUSA 2I7KA 5HQ6A 5JI8A 4CURA 5EK9A 3I3JA 4LDFA 2E3KA 5F61A 4Z1QA 3MULA 4Q0OA 2DWWA 4OGIA 4YYNA 4NUEA 3SVHA 5EU1A 4E96A 4QEUA 5I7XA 5HCLA 4IR6A 4PKLA 1EQFA 3SVGA 4PCEA 4CLBA 5EP7A 4HXLA 4YAXA 5DYUA 3JVLA 4X2IA 2D9EA 5DLZA 4QEWA 5EWCA 5JWMA 4HXRA 4A9FA 5KHMA 4YBSA 2WP1A 4N4FA 5CQ7A 4ZC9A 5KU3A 4O77A 5A85A 5I29A 4LR6A 4UYDA 5D3HA 1WUGA 4XUAA 5DW2A 3LJWA 3DWYA 3S92A 2H60A 4IORA 2YEKA 5IBNA 5ENEA 4UIYA 2DVSA 3P1FA 4J3IA 2RO1A 5LUUA 4N4IA 5F63A 4A9MA 5HELA 4TZ2A 4HBYA 4MR5A 5CRZA 4XY8A 5FE1A 3U5NA 4O70A 3TLPA 5F25A 5CQ6A 3LQJA 4HBXA 3UVDA 5EQ1A 3P1DA 3UW9A 4HBWA 5ENHA 5I1QA 4TQNA 4UYFA 3O36A 3D1DA 3UVWA 4YH4A 4TS8A 3P5OA 5HJCA 2RNXA 5FB0A 5HRVA 5H1UA 5ACYA 5FE3A 5F36A 5DYXA 4PS5A 4BW2A 4BW1A 4ZW1A 4AI6A 1E6IA 5I7YA 4KCXA 5EICA 5DFDA 5IIDA 3G0LA 4YH3A 2RNWA 5A5QA 4YATA 4YYHA 4NUCA 2MJVB 4UIXA 5LKXA 5K29A 5DKHA 3D1BA 4QSWA 4QYLA 5E0RA 4IR5A 4UIZA 2WP2A 3U5KA 5HRWA 5FH7A 5FE8A 4QSSA 5CUEA 4TT2A 4YY6A 4CUUA 4UITA 2I8NA 1F68A 4CUQA 4UYEA 3HMFA 4A9IA 4CFKA 4QSRA 3LQIA 5ENJA 4AKGA 5CUCA 5A5PA 4AKIA 4MR3A 4TT6A 4QSTA 4YYMA 5A5RA 4NUDA 5LJ1A 4O76A 5IGMA 4A9JA 5DBMA 4QR4A 2OUOA 5ENBA 5EWVA 4YBMA 4LRGA 3DAIA 5L8TA 4N4GA 4BJXA 5DKCA 5L98A 5HRXA 2YDWA 5HQ5A 4QUUA 5CQ5A 3VKHA 5CGPA 4YBTA 4MEPA 4QBMA
chains in the Genus database with same CATH topology
2L84A 5E9VA 5FFWA 5BT5A 4YC9A 5FE7A 3UV4A 5DY7A 5F3AA 4HXOA 4LZ2A 4QC3A 3IU6A 4XUBA 5E9KA 3Q2EA 2DVRA 3LQHA 4Z1SA 2OSSA 2GRCA 5KTUA 4PY6A 5F1LA 1ZS5A 5FG6A 4AKNA 5CQAA 4O78A 5EM3A 5C85A 5I40A 2RS9B 5A83A 4NYXA 4YYKA 5A7CA 3MB3A 4ALGA 4XY9A 3UVXA 5EA1A 5CU8A 5CFWA 5CRMA 4N4HA 5CZGA 3QZSA 2R0VA 5C8GA 5HENA 5HFQA 5ENGA 5FE2A 4A9NA 5D26A 4BW4A 3IU5A 4NRCA 4NYVA 4PTBA 3AADA 5FFVA 5IGLA 3G0JA 2R0YA 5CQ8A 2DKWA 5H1VA 5D3PA 4HXKA 4CL9A 5A5SA 4O7FA 3S91A 4MEOA 3P1CA 3U5PA 5DYCA 4LC2A 3O34A 4IOOA 5D3NA 5KO4A 1N72A 2L85A 3Q2FA 4UYHA 5FBXA 3P1EA 4NR8A 4HBVA 4O7AA 3NXBA 5CQ4A 5FG4A 4LZSA 3RCWA 4ALHA 5ETDA 4XYAA 4TU6A 4WHWA 5ETBA 4WIVA 4LYWA 2FSAA 4QSPA 4LZRA 5LKTA 4GPJA 4OGJA 4QSVA 3U5JA 5E7DA 5L96A 5IGKA 4QY4A 5G4RA 5KTWA 3U5OA 4N3WA 4QR5A 5DW1A 4O72A 5D3RA 4NXJA 4QB3A 5FE4A 5F1HA 4RVRA 4QR3A 5I80A 5C7NA 2RNYA 4NQMA 3JVKA 4Z6HA 5EWDA 4HXPA 5D24A 3QZVA 5LVRA 5E74A 4YYDA 4FLPA 2E7NA 4C66A 4QYDA 5CP5A 4UIVA 5FE6A 1JSPB 4TTEA 5F5ZA 4YABA 5EV9A 5CPEA 1WUMA 5ENCA 4QUTA 4ZQLA 4WHUA 5HEMA 5CQ3A 3U5LA 5L8UA 4HXSA 4NR5A 4OUFA 4MEQA 5I88A 5F2PA 2YELA 5EVAA 4BW3A 5DFBA 3JVJA 4Z6IA 4MR4A 3MUKA 4Y03A 5CUDA 2OO1A 5L99A 5CUAA 5EGUA 4LYIA 2DVVA 5E3GA 5A82A 5KTXA 5AMEA 5TB6A 5EPRA 2F6NA 5ENIA 3UVYA 5D25A 3MB4A 4IOQA 5AD2A 5FB1A 4A9LA 4BHWA 4J0RA 4NS5A 5F62A 5H85A 5IGNA 5CUGA 5A5OA 4NR7A 4O7CA 5HFRA 5E73A 5LKUA 3UV2A 4C67A 5G4SA 4YYGA 4DONA 4LYSA 4J1PA 5CS8A 5I83A 5D3JA 5D3LA 5CTLA 4QSQA 5FG5A 4UYGA 4NR9A 2LSPB 4A9EA 3D7CA 3QZTA 2F6JA 3JVMA 3AQAA 5D3TA 5ENFA 4KV4A 4QSXA 5A81A 4O71A 4NYWA 3MQMA 4NR4A 5E9YA 2YW5A 3K2JA 2L5EA 3HMEA 4O74A 4UIUA 5LJ0A 5FFYA 4HXMA 4UYFB 4TZ8A 5FH8A 4MR6A 4NRAA 3MXFA 5E3DA 5C4QA 5FE9A 1JM4B 4KV1A 4F3IA 4TYLA 5FH6A 3SVFA 5COIA 5BT4A 4CUTA 2RFJA 4TU4A 5FE0A 5FDZA 5D0CA 4J0SA 5IG6A 3U5MA 2YYNA 5J0DA 5HLSA 4NQNA 2R10A 5HQ7A 3ONIA 2D82A 4QSUA 4A9HA 5LVQA 4NR6A 5DYAA 5TCMA 2G4AA 4O7EA 5II2A 5F60A 5LKZA 5DLXA 5FE5A 5H1TA 5EI4A 4QEVA 3O37A 3HMHA 2RI7A 4QC1A 4A9OA 4Z93A 4A9KA 5LJ2A 2YQDA 3FKMX 2N9GA 4YYIA 5C87A 5L97A 2DATA 3O35A 3ZYUA 2NXBA 2R0SA 4QZSA 5DX4A 5AMFA 5DFCA 5I89A 2KTBB 4Q0NA 4YK0A 5D3SA 5HM0A 4O75A 5CQTA 5I86A 4PCIA 5C89A 4O7BA 3LXJA 4HXNA 5EISA 5BT3A 4YYJA 4YY4A 5E9LA 1X0JA 5DKDA 2E7OA 4IR4A 5II1A 4TT4A 5D7XA 5A5NA 4YADA 4IR3A 4CUPA 4UIWA 3O33A 3UV5A 4QNSA 3GG3A 5AD3A 5EPBA 2YEMA 5CUBA 5CY9A 5E9IA 4MENA 4CFLA 5EPSA 2DVQA 5E9MA 5EWWA 4NRBA 5EWHA 4CUSA 2I7KA 5HQ6A 5JI8A 4CURA 5EK9A 3I3JA 4LDFA 2E3KA 5F61A 4Z1QA 3MULA 4Q0OA 2DWWA 4OGIA 4YYNA 4NUEA 3SVHA 5EU1A 4E96A 4QEUA 5I7XA 5HCLA 4IR6A 4PKLA 1EQFA 3SVGA 4PCEA 4CLBA 5EP7A 4HXLA 4YAXA 5DYUA 3JVLA 4X2IA 2D9EA 5DLZA 4QEWA 5EWCA 5JWMA 4HXRA 4A9FA 5KHMA 4YBSA 2WP1A 4N4FA 5CQ7A 4ZC9A 5KU3A 4O77A 5A85A 5I29A 4LR6A 4UYDA 5D3HA 1WUGA 4XUAA 5DW2A 3LJWA 3DWYA 3S92A 2H60A 4IORA 2YEKA 5IBNA 5ENEA 4UIYA 2DVSA 3P1FA 4J3IA 2RO1A 5LUUA 4N4IA 5F63A 4A9MA 5HELA 4TZ2A 4HBYA 4MR5A 5CRZA 4XY8A 5FE1A 3U5NA 4O70A 3TLPA 5F25A 5CQ6A 3LQJA 4HBXA 3UVDA 5EQ1A 3P1DA 3UW9A 4HBWA 5ENHA 5I1QA 4TQNA 4UYFA 3O36A 3UVWA 4YH4A 4TS8A 3P5OA 5HJCA 2RNXA 5FB0A 5HRVA 5H1UA 5ACYA 5FE3A 5F36A 5DYXA 4PS5A 4BW2A 4BW1A 4ZW1A 1E6IA 5I7YA 4KCXA 5EICA 5DFDA 5IIDA 3G0LA 4YH3A 2RNWA 5A5QA 4YATA 4YYHA 4NUCA 2MJVB 4UIXA 5LKXA 5K29A 5DKHA 4QSWA 4QYLA 5E0RA 4IR5A 4UIZA 2WP2A 3U5KA 5HRWA 5FH7A 5FE8A 4QSSA 5CUEA 4TT2A 4YY6A 4CUUA 4UITA 2I8NA 1F68A 4CUQA 4UYEA 3HMFA 4A9IA 4CFKA 4QSRA 3LQIA 5ENJA 5CUCA 5A5PA 4MR3A 4TT6A 4QSTA 4YYMA 5A5RA 4NUDA 5LJ1A 4O76A 5IGMA 4A9JA 5DBMA 4QR4A 2OUOA 5ENBA 5EWVA 4YBMA 4LRGA 3DAIA 5L8TA 4N4GA 4BJXA 5DKCA 5L98A 5HRXA 2YDWA 5HQ5A 4QUUA 5CQ5A 5CGPA 4YBTA 4MEPA 4QBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L84 A;  5E9V A;  5FFW A;  5BT5 A;  4YC9 A;  5FE7 A;  3UV4 A;  5DY7 A;  5F3A A;  4HXO A;  4LZ2 A;  4QC3 A;  3IU6 A;  4XUB A;  5E9K A;  3Q2E A;  2DVR A;  3LQH A;  4Z1S A;  2OSS A;  2GRC A;  5KTU A;  4PY6 A;  5F1L A;  1ZS5 A;  5FG6 A;  4AKN A;  5CQA A;  4O78 A;  5EM3 A;  5C85 A;  5I40 A;  2RS9 B;  5A83 A;  4NYX A;  4YYK A;  5A7C A;  3MB3 A;  4ALG A;  4XY9 A;  3UVX A;  5EA1 A;  5CU8 A;  5CFW A;  5CRM A;  4N4H A;  5CZG A;  3QZS A;  2R0V A;  5C8G A;  5HEN A;  5HFQ A;  5ENG A;  5FE2 A;  4A9N A;  5D26 A;  4BW4 A;  3IU5 A;  4NRC A;  4NYV A;  4PTB A;  3AAD A;  5FFV A;  5IGL A;  3G0J A;  2R0Y A;  5CQ8 A;  2DKW A;  5H1V A;  5D3P A;  4HXK A;  4CL9 A;  5A5S A;  4O7F A;  3S91 A;  4MEO A;  3P1C A;  3U5P A;  5DYC A;  4LC2 A;  3O34 A;  4IOO A;  5D3N A;  5KO4 A;  1N72 A;  2L85 A;  3Q2F A;  4UYH A;  5FBX A;  3P1E A;  4NR8 A;  4HBV A;  4O7A A;  3NXB A;  5CQ4 A;  5FG4 A;  4LZS A;  3RCW A;  4ALH A;  5ETD A;  4XYA A;  4TU6 A;  4WHW A;  5ETB A;  4WIV A;  4LYW A;  2FSA A;  4QSP A;  4LZR A;  5LKT A;  4GPJ A;  4OGJ A;  4QSV A;  3U5J A;  5E7D A;  5L96 A;  5IGK A;  4QY4 A;  5G4R A;  5KTW A;  3U5O A;  4N3W A;  4QR5 A;  5DW1 A;  4O72 A;  5D3R A;  4NXJ A;  4QB3 A;  5FE4 A;  5F1H A;  4RVR A;  4QR3 A;  5I80 A;  5C7N A;  2RNY A;  4NQM A;  3JVK A;  4Z6H A;  5EWD A;  4HXP A;  5D24 A;  3QZV A;  5LVR A;  5E74 A;  4YYD A;  4FLP A;  2E7N A;  4C66 A;  4QYD A;  5CP5 A;  4UIV A;  5FE6 A;  1JSP B;  4TTE A;  5F5Z A;  4YAB A;  5EV9 A;  5CPE A;  1WUM A;  5ENC A;  4QUT A;  4ZQL A;  4WHU A;  5HEM A;  5CQ3 A;  3U5L A;  5L8U A;  4HXS A;  4NR5 A;  4OUF A;  4MEQ A;  5I88 A;  5F2P A;  2YEL A;  5EVA A;  4BW3 A;  5DFB A;  3JVJ A;  4Z6I A;  4MR4 A;  3MUK A;  4Y03 A;  5CUD A;  2OO1 A;  5L99 A;  5CUA A;  5EGU A;  4LYI A;  2DVV A;  5E3G A;  5A82 A;  5KTX A;  5AME A;  5TB6 A;  5EPR A;  2F6N A;  5ENI A;  3UVY A;  5D25 A;  3MB4 A;  4IOQ A;  5AD2 A;  5FB1 A;  4A9L A;  4BHW A;  4J0R A;  4NS5 A;  5F62 A;  5H85 A;  5IGN A;  5CUG A;  5A5O A;  4NR7 A;  4O7C A;  5HFR A;  5E73 A;  5LKU A;  3UV2 A;  4C67 A;  5G4S A;  4YYG A;  4DON A;  4LYS A;  4J1P A;  5CS8 A;  5I83 A;  5D3J A;  5D3L A;  5CTL A;  4QSQ A;  5FG5 A;  4UYG A;  4NR9 A;  2LSP B;  4A9E A;  3D7C A;  3QZT A;  2F6J A;  3JVM A;  3AQA A;  5D3T A;  5ENF A;  4KV4 A;  4QSX A;  5A81 A;  4O71 A;  4NYW A;  3MQM A;  4NR4 A;  5E9Y A;  2YW5 A;  3K2J A;  2L5E A;  3HME A;  4O74 A;  4UIU A;  5LJ0 A;  5FFY A;  4HXM A;  4UYF B;  4TZ8 A;  5FH8 A;  4MR6 A;  4NRA A;  3MXF A;  5E3D A;  5C4Q A;  5FE9 A;  1JM4 B;  4KV1 A;  4F3I A;  4TYL A;  5FH6 A;  3SVF A;  5COI A;  5BT4 A;  4CUT A;  2RFJ A;  4TU4 A;  5FE0 A;  5FDZ A;  5D0C A;  4J0S A;  5IG6 A;  3U5M A;  2YYN A;  5J0D A;  5HLS A;  4NQN A;  2R10 A;  5HQ7 A;  3ONI A;  2D82 A;  4QSU A;  4A9H A;  5LVQ A;  4NR6 A;  5DYA A;  5TCM A;  2G4A A;  4O7E A;  5II2 A;  5F60 A;  5LKZ A;  5DLX A;  5FE5 A;  5H1T A;  5EI4 A;  4QEV A;  3O37 A;  3HMH A;  2RI7 A;  4QC1 A;  4A9O A;  4Z93 A;  4A9K A;  5LJ2 A;  2YQD A;  3FKM X;  2N9G A;  4YYI A;  5C87 A;  5L97 A;  2DAT A;  3O35 A;  3ZYU A;  2NXB A;  2R0S A;  4QZS A;  5DX4 A;  5AMF A;  5DFC A;  5I89 A;  2KTB B;  4Q0N A;  4YK0 A;  5D3S A;  5HM0 A;  4O75 A;  5CQT A;  5I86 A;  4PCI A;  5C89 A;  4O7B A;  3LXJ A;  4HXN A;  5EIS A;  5BT3 A;  4YYJ A;  4YY4 A;  5E9L A;  1X0J A;  5DKD A;  2E7O A;  4IR4 A;  5II1 A;  4TT4 A;  5D7X A;  5A5N A;  4YAD A;  4IR3 A;  4CUP A;  4UIW A;  3O33 A;  3UV5 A;  4QNS A;  3GG3 A;  5AD3 A;  5EPB A;  2YEM A;  5CUB A;  5CY9 A;  5E9I A;  4MEN A;  4CFL A;  5EPS A;  2DVQ A;  5E9M A;  5EWW A;  4NRB A;  5EWH A;  4CUS A;  2I7K A;  5HQ6 A;  5JI8 A;  4CUR A;  5EK9 A;  3I3J A;  4LDF A;  2E3K A;  5F61 A;  4Z1Q A;  3MUL A;  4Q0O A;  2DWW A;  4OGI A;  4YYN A;  4NUE A;  3SVH A;  5EU1 A;  4E96 A;  4QEU A;  5I7X A;  5HCL A;  4IR6 A;  4PKL A;  1EQF A;  3SVG A;  4PCE A;  4CLB A;  5EP7 A;  4HXL A;  4YAX A;  5DYU A;  3JVL A;  4X2I A;  2D9E A;  5DLZ A;  4QEW A;  5EWC A;  5JWM A;  4HXR A;  4A9F A;  5KHM A;  4YBS A;  2WP1 A;  4N4F A;  5CQ7 A;  4ZC9 A;  5KU3 A;  4O77 A;  5A85 A;  5I29 A;  4LR6 A;  4UYD A;  5D3H A;  1WUG A;  4XUA A;  5DW2 A;  3LJW A;  3DWY A;  3S92 A;  2H60 A;  4IOR A;  2YEK A;  5IBN A;  5ENE A;  4UIY A;  2DVS A;  3P1F A;  4J3I A;  2RO1 A;  5LUU A;  4N4I A;  5F63 A;  4A9M A;  5HEL A;  4TZ2 A;  4HBY A;  4MR5 A;  5CRZ A;  4XY8 A;  5FE1 A;  3U5N A;  4O70 A;  3TLP A;  5F25 A;  5CQ6 A;  3LQJ A;  4HBX A;  3UVD A;  5EQ1 A;  3P1D A;  3UW9 A;  4HBW A;  5ENH A;  5I1Q A;  4TQN A;  4UYF A;  3O36 A;  3UVW A;  4YH4 A;  4TS8 A;  3P5O A;  5HJC A;  2RNX A;  5FB0 A;  5HRV A;  5H1U A;  5ACY A;  5FE3 A;  5F36 A;  5DYX A;  4PS5 A;  4BW2 A;  4BW1 A;  4ZW1 A;  1E6I A;  5I7Y A;  4KCX A;  5EIC A;  5DFD A;  5IID A;  3G0L A;  4YH3 A;  2RNW A;  5A5Q A;  4YAT A;  4YYH A;  4NUC A;  2MJV B;  4UIX A;  5LKX A;  5K29 A;  5DKH A;  4QSW A;  4QYL A;  5E0R A;  4IR5 A;  4UIZ A;  2WP2 A;  3U5K A;  5HRW A;  5FH7 A;  5FE8 A;  4QSS A;  5CUE A;  4TT2 A;  4YY6 A;  4CUU A;  4UIT A;  2I8N A;  1F68 A;  4CUQ A;  4UYE A;  3HMF A;  4A9I A;  4CFK A;  4QSR A;  3LQI A;  5ENJ A;  5CUC A;  5A5P A;  4MR3 A;  4TT6 A;  4QST A;  4YYM A;  5A5R A;  4NUD A;  5LJ1 A;  4O76 A;  5IGM A;  4A9J A;  5DBM A;  4QR4 A;  2OUO A;  5ENB A;  5EWV A;  4YBM A;  4LRG A;  3DAI A;  5L8T A;  4N4G A;  4BJX A;  5DKC A;  5L98 A;  5HRX A;  2YDW A;  5HQ5 A;  4QUU A;  5CQ5 A;  5CGP A;  4YBT A;  4MEP A;  4QBM A; 
#chains in the Genus database with same CATH topology
 2L84 A;  5E9V A;  5FFW A;  5BT5 A;  4YC9 A;  5FE7 A;  3UV4 A;  5DY7 A;  5F3A A;  4HXO A;  4LZ2 A;  4QC3 A;  3IU6 A;  4XUB A;  5E9K A;  3Q2E A;  2DVR A;  3LQH A;  4Z1S A;  2OSS A;  2GRC A;  5KTU A;  4PY6 A;  5F1L A;  1ZS5 A;  5FG6 A;  4AKN A;  5CQA A;  4O78 A;  5EM3 A;  5C85 A;  5I40 A;  2RS9 B;  5A83 A;  4NYX A;  4YYK A;  5A7C A;  3MB3 A;  4ALG A;  4XY9 A;  3UVX A;  5EA1 A;  5CU8 A;  5CFW A;  5CRM A;  4N4H A;  3ERR A;  5CZG A;  3QZS A;  2R0V A;  5C8G A;  5HEN A;  5HFQ A;  5ENG A;  5FE2 A;  4A9N A;  5D26 A;  4BW4 A;  3IU5 A;  4NRC A;  4NYV A;  4PTB A;  3AAD A;  5FFV A;  5IGL A;  3G0J A;  2R0Y A;  5CQ8 A;  2DKW A;  5H1V A;  5D3P A;  4HXK A;  4CL9 A;  5A5S A;  4O7F A;  3S91 A;  4MEO A;  3P1C A;  3U5P A;  5DYC A;  4LC2 A;  3O34 A;  4IOO A;  5D3N A;  5KO4 A;  1N72 A;  2L85 A;  3Q2F A;  4UYH A;  5FBX A;  3P1E A;  4NR8 A;  4HBV A;  4O7A A;  3NXB A;  5CQ4 A;  5FG4 A;  4LZS A;  3RCW A;  4ALH A;  5ETD A;  4XYA A;  4TU6 A;  4WHW A;  5ETB A;  4WIV A;  4LYW A;  2FSA A;  4QSP A;  4LZR A;  5LKT A;  4GPJ A;  4OGJ A;  4QSV A;  3U5J A;  5E7D A;  5L96 A;  5IGK A;  4QY4 A;  5G4R A;  5KTW A;  3U5O A;  4N3W A;  4QR5 A;  5DW1 A;  4O72 A;  5D3R A;  4NXJ A;  4QB3 A;  5FE4 A;  5F1H A;  4RVR A;  4QR3 A;  5I80 A;  5C7N A;  2RNY A;  4NQM A;  3JVK A;  4Z6H A;  5EWD A;  4HXP A;  5D24 A;  3QZV A;  5LVR A;  5E74 A;  4YYD A;  4FLP A;  2E7N A;  4C66 A;  4QYD A;  5CP5 A;  4UIV A;  5FE6 A;  1JSP B;  4TTE A;  5F5Z A;  4YAB A;  5EV9 A;  1PUO A;  5CPE A;  1WUM A;  5ENC A;  4QUT A;  4ZQL A;  4WHU A;  5HEM A;  5CQ3 A;  3U5L A;  5L8U A;  4HXS A;  4NR5 A;  4OUF A;  4MEQ A;  5I88 A;  5F2P A;  2YEL A;  5EVA A;  4BW3 A;  5DFB A;  3JVJ A;  4Z6I A;  4MR4 A;  3MUK A;  4Y03 A;  5CUD A;  2OO1 A;  5L99 A;  5CUA A;  5EGU A;  4LYI A;  2DVV A;  5E3G A;  5A82 A;  5KTX A;  5AME A;  5TB6 A;  5EPR A;  2F6N A;  5ENI A;  3UVY A;  5D25 A;  3MB4 A;  4IOQ A;  5AD2 A;  5FB1 A;  4A9L A;  4BHW A;  4J0R A;  4NS5 A;  5F62 A;  5H85 A;  5IGN A;  5CUG A;  5A5O A;  4NR7 A;  4O7C A;  5HFR A;  5E73 A;  5LKU A;  3UV2 A;  4C67 A;  5G4S A;  4YYG A;  4DON A;  4LYS A;  4J1P A;  5CS8 A;  3VKG A;  5I83 A;  5D3J A;  5D3L A;  5CTL A;  4QSQ A;  5FG5 A;  4UYG A;  4NR9 A;  2LSP B;  4A9E A;  3D7C A;  3QZT A;  2F6J A;  3JVM A;  3AQA A;  5D3T A;  5ENF A;  4KV4 A;  4QSX A;  5A81 A;  4O71 A;  4NYW A;  3MQM A;  4NR4 A;  5E9Y A;  2YW5 A;  3K2J A;  2L5E A;  3HME A;  4O74 A;  2EJN A;  4UIU A;  5LJ0 A;  5FFY A;  4HXM A;  4UYF B;  4TZ8 A;  5FH8 A;  4MR6 A;  4NRA A;  3MXF A;  5E3D A;  5C4Q A;  5FE9 A;  1JM4 B;  4KV1 A;  4F3I A;  4TYL A;  5FH6 A;  3SVF A;  5COI A;  5BT4 A;  4CUT A;  2RFJ A;  4TU4 A;  5FE0 A;  5FDZ A;  5D0C A;  4J0S A;  5IG6 A;  3U5M A;  2YYN A;  5J0D A;  5HLS A;  4NQN A;  2R10 A;  5HQ7 A;  3ONI A;  2D82 A;  4QSU A;  4A9H A;  5LVQ A;  4NR6 A;  5DYA A;  5TCM A;  2G4A A;  4O7E A;  5II2 A;  5F60 A;  5LKZ A;  5DLX A;  5FE5 A;  5H1T A;  5EI4 A;  4QEV A;  3O37 A;  3HMH A;  2RI7 A;  4QC1 A;  4A9O A;  4Z93 A;  4A9K A;  5LJ2 A;  2YQD A;  3FKM X;  2N9G A;  4YYI A;  5C87 A;  5L97 A;  2DAT A;  3O35 A;  3ZYU A;  2NXB A;  2R0S A;  4QZS A;  5DX4 A;  5AMF A;  5DFC A;  5I89 A;  2KTB B;  4Q0N A;  4YK0 A;  4AKH A;  5D3S A;  5HM0 A;  4O75 A;  1ZKR A;  5CQT A;  5I86 A;  4PCI A;  5C89 A;  4O7B A;  3LXJ A;  4HXN A;  5EIS A;  5BT3 A;  4YYJ A;  4YY4 A;  5E9L A;  1X0J A;  5DKD A;  2E7O A;  4IR4 A;  5II1 A;  4TT4 A;  5D7X A;  5A5N A;  4YAD A;  4IR3 A;  4CUP A;  4UIW A;  3O33 A;  3UV5 A;  4QNS A;  3GG3 A;  5AD3 A;  5EPB A;  2YEM A;  5CUB A;  5CY9 A;  5E9I A;  4MEN A;  4CFL A;  5EPS A;  2DVQ A;  5E9M A;  5EWW A;  4NRB A;  5EWH A;  4CUS A;  2I7K A;  5HQ6 A;  5JI8 A;  4CUR A;  5EK9 A;  3I3J A;  4LDF A;  2E3K A;  5F61 A;  4Z1Q A;  3MUL A;  4Q0O A;  2DWW A;  4OGI A;  4YYN A;  4NUE A;  3SVH A;  5EU1 A;  4E96 A;  4QEU A;  5I7X A;  5HCL A;  4IR6 A;  4PKL A;  1EQF A;  3SVG A;  4PCE A;  4CLB A;  5EP7 A;  4HXL A;  4YAX A;  5DYU A;  3JVL A;  4X2I A;  2D9E A;  5DLZ A;  4QEW A;  5EWC A;  5JWM A;  4HXR A;  4A9F A;  5KHM A;  4YBS A;  2WP1 A;  4N4F A;  5CQ7 A;  4ZC9 A;  5KU3 A;  4O77 A;  5A85 A;  5I29 A;  4LR6 A;  4UYD A;  5D3H A;  1WUG A;  4XUA A;  5DW2 A;  3LJW A;  3DWY A;  3S92 A;  2H60 A;  4IOR A;  2YEK A;  5IBN A;  5ENE A;  4UIY A;  2DVS A;  3P1F A;  4J3I A;  2RO1 A;  5LUU A;  4N4I A;  5F63 A;  4A9M A;  5HEL A;  4TZ2 A;  4HBY A;  4MR5 A;  5CRZ A;  4XY8 A;  5FE1 A;  3U5N A;  4O70 A;  3TLP A;  5F25 A;  5CQ6 A;  3LQJ A;  4HBX A;  3UVD A;  5EQ1 A;  3P1D A;  3UW9 A;  4HBW A;  5ENH A;  5I1Q A;  4TQN A;  4UYF A;  3O36 A;  3D1D A;  3UVW A;  4YH4 A;  4TS8 A;  3P5O A;  5HJC A;  2RNX A;  5FB0 A;  5HRV A;  5H1U A;  5ACY A;  5FE3 A;  5F36 A;  5DYX A;  4PS5 A;  4BW2 A;  4BW1 A;  4ZW1 A;  4AI6 A;  1E6I A;  5I7Y A;  4KCX A;  5EIC A;  5DFD A;  5IID A;  3G0L A;  4YH3 A;  2RNW A;  5A5Q A;  4YAT A;  4YYH A;  4NUC A;  2MJV B;  4UIX A;  5LKX A;  5K29 A;  5DKH A;  3D1B A;  4QSW A;  4QYL A;  5E0R A;  4IR5 A;  4UIZ A;  2WP2 A;  3U5K A;  5HRW A;  5FH7 A;  5FE8 A;  4QSS A;  5CUE A;  4TT2 A;  4YY6 A;  4CUU A;  4UIT A;  2I8N A;  1F68 A;  4CUQ A;  4UYE A;  3HMF A;  4A9I A;  4CFK A;  4QSR A;  3LQI A;  5ENJ A;  4AKG A;  5CUC A;  5A5P A;  4AKI A;  4MR3 A;  4TT6 A;  4QST A;  4YYM A;  5A5R A;  4NUD A;  5LJ1 A;  4O76 A;  5IGM A;  4A9J A;  5DBM A;  4QR4 A;  2OUO A;  5ENB A;  5EWV A;  4YBM A;  4LRG A;  3DAI A;  5L8T A;  4N4G A;  4BJX A;  5DKC A;  5L98 A;  5HRX A;  2YDW A;  5HQ5 A;  4QUU A;  5CQ5 A;  3VKH A;  5CGP A;  4YBT A;  4MEP A;  4QBM A; 
#chains in the Genus database with same CATH homology
 2L84 A;  5E9V A;  5FFW A;  5BT5 A;  4YC9 A;  5FE7 A;  3UV4 A;  5DY7 A;  5F3A A;  4HXO A;  4LZ2 A;  4QC3 A;  3IU6 A;  4XUB A;  5E9K A;  3Q2E A;  2DVR A;  3LQH A;  4Z1S A;  2OSS A;  2GRC A;  5KTU A;  4PY6 A;  5F1L A;  1ZS5 A;  5FG6 A;  4AKN A;  5CQA A;  4O78 A;  5EM3 A;  5C85 A;  5I40 A;  2RS9 B;  5A83 A;  4NYX A;  4YYK A;  5A7C A;  3MB3 A;  4ALG A;  4XY9 A;  3UVX A;  5EA1 A;  5CU8 A;  5CFW A;  5CRM A;  4N4H A;  5CZG A;  3QZS A;  2R0V A;  5C8G A;  5HEN A;  5HFQ A;  5ENG A;  5FE2 A;  4A9N A;  5D26 A;  4BW4 A;  3IU5 A;  4NRC A;  4NYV A;  4PTB A;  3AAD A;  5FFV A;  5IGL A;  3G0J A;  2R0Y A;  5CQ8 A;  2DKW A;  5H1V A;  5D3P A;  4HXK A;  4CL9 A;  5A5S A;  4O7F A;  3S91 A;  4MEO A;  3P1C A;  3U5P A;  5DYC A;  4LC2 A;  3O34 A;  4IOO A;  5D3N A;  5KO4 A;  1N72 A;  2L85 A;  3Q2F A;  4UYH A;  5FBX A;  3P1E A;  4NR8 A;  4HBV A;  4O7A A;  3NXB A;  5CQ4 A;  5FG4 A;  4LZS A;  3RCW A;  4ALH A;  5ETD A;  4XYA A;  4TU6 A;  4WHW A;  5ETB A;  4WIV A;  4LYW A;  2FSA A;  4QSP A;  4LZR A;  5LKT A;  4GPJ A;  4OGJ A;  4QSV A;  3U5J A;  5E7D A;  5L96 A;  5IGK A;  4QY4 A;  5G4R A;  5KTW A;  3U5O A;  4N3W A;  4QR5 A;  5DW1 A;  4O72 A;  5D3R A;  4NXJ A;  4QB3 A;  5FE4 A;  5F1H A;  4RVR A;  4QR3 A;  5I80 A;  5C7N A;  2RNY A;  4NQM A;  3JVK A;  4Z6H A;  5EWD A;  4HXP A;  5D24 A;  3QZV A;  5LVR A;  5E74 A;  4YYD A;  4FLP A;  2E7N A;  4C66 A;  4QYD A;  5CP5 A;  4UIV A;  5FE6 A;  1JSP B;  4TTE A;  5F5Z A;  4YAB A;  5EV9 A;  5CPE A;  1WUM A;  5ENC A;  4QUT A;  4ZQL A;  4WHU A;  5HEM A;  5CQ3 A;  3U5L A;  5L8U A;  4HXS A;  4NR5 A;  4OUF A;  4MEQ A;  5I88 A;  5F2P A;  2YEL A;  5EVA A;  4BW3 A;  5DFB A;  3JVJ A;  4Z6I A;  4MR4 A;  3MUK A;  4Y03 A;  5CUD A;  2OO1 A;  5L99 A;  5CUA A;  5EGU A;  4LYI A;  2DVV A;  5E3G A;  5A82 A;  5KTX A;  5AME A;  5TB6 A;  5EPR A;  2F6N A;  5ENI A;  3UVY A;  5D25 A;  3MB4 A;  4IOQ A;  5AD2 A;  5FB1 A;  4A9L A;  4BHW A;  4J0R A;  4NS5 A;  5F62 A;  5H85 A;  5IGN A;  5CUG A;  5A5O A;  4NR7 A;  4O7C A;  5HFR A;  5E73 A;  5LKU A;  3UV2 A;  4C67 A;  5G4S A;  4YYG A;  4DON A;  4LYS A;  4J1P A;  5CS8 A;  5I83 A;  5D3J A;  5D3L A;  5CTL A;  4QSQ A;  5FG5 A;  4UYG A;  4NR9 A;  2LSP B;  4A9E A;  3D7C A;  3QZT A;  2F6J A;  3JVM A;  3AQA A;  5D3T A;  5ENF A;  4KV4 A;  4QSX A;  5A81 A;  4O71 A;  4NYW A;  3MQM A;  4NR4 A;  5E9Y A;  2YW5 A;  3K2J A;  2L5E A;  3HME A;  4O74 A;  4UIU A;  5LJ0 A;  5FFY A;  4HXM A;  4UYF B;  4TZ8 A;  5FH8 A;  4MR6 A;  4NRA A;  3MXF A;  5E3D A;  5C4Q A;  5FE9 A;  1JM4 B;  4KV1 A;  4F3I A;  4TYL A;  5FH6 A;  3SVF A;  5COI A;  5BT4 A;  4CUT A;  2RFJ A;  4TU4 A;  5FE0 A;  5FDZ A;  5D0C A;  4J0S A;  5IG6 A;  3U5M A;  2YYN A;  5J0D A;  5HLS A;  4NQN A;  2R10 A;  5HQ7 A;  3ONI A;  2D82 A;  4QSU A;  4A9H A;  5LVQ A;  4NR6 A;  5DYA A;  5TCM A;  2G4A A;  4O7E A;  5II2 A;  5F60 A;  5LKZ A;  5DLX A;  5FE5 A;  5H1T A;  5EI4 A;  4QEV A;  3O37 A;  3HMH A;  2RI7 A;  4QC1 A;  4A9O A;  4Z93 A;  4A9K A;  5LJ2 A;  2YQD A;  3FKM X;  2N9G A;  4YYI A;  5C87 A;  5L97 A;  2DAT A;  3O35 A;  3ZYU A;  2NXB A;  2R0S A;  4QZS A;  5DX4 A;  5AMF A;  5DFC A;  5I89 A;  2KTB B;  4Q0N A;  4YK0 A;  5D3S A;  5HM0 A;  4O75 A;  5CQT A;  5I86 A;  4PCI A;  5C89 A;  4O7B A;  3LXJ A;  4HXN A;  5EIS A;  5BT3 A;  4YYJ A;  4YY4 A;  5E9L A;  1X0J A;  5DKD A;  2E7O A;  4IR4 A;  5II1 A;  4TT4 A;  5D7X A;  5A5N A;  4YAD A;  4IR3 A;  4CUP A;  4UIW A;  3O33 A;  3UV5 A;  4QNS A;  3GG3 A;  5AD3 A;  5EPB A;  2YEM A;  5CUB A;  5CY9 A;  5E9I A;  4MEN A;  4CFL A;  5EPS A;  2DVQ A;  5E9M A;  5EWW A;  4NRB A;  5EWH A;  4CUS A;  2I7K A;  5HQ6 A;  5JI8 A;  4CUR A;  5EK9 A;  3I3J A;  4LDF A;  2E3K A;  5F61 A;  4Z1Q A;  3MUL A;  4Q0O A;  2DWW A;  4OGI A;  4YYN A;  4NUE A;  3SVH A;  5EU1 A;  4E96 A;  4QEU A;  5I7X A;  5HCL A;  4IR6 A;  4PKL A;  1EQF A;  3SVG A;  4PCE A;  4CLB A;  5EP7 A;  4HXL A;  4YAX A;  5DYU A;  3JVL A;  4X2I A;  2D9E A;  5DLZ A;  4QEW A;  5EWC A;  5JWM A;  4HXR A;  4A9F A;  5KHM A;  4YBS A;  2WP1 A;  4N4F A;  5CQ7 A;  4ZC9 A;  5KU3 A;  4O77 A;  5A85 A;  5I29 A;  4LR6 A;  4UYD A;  5D3H A;  1WUG A;  4XUA A;  5DW2 A;  3LJW A;  3DWY A;  3S92 A;  2H60 A;  4IOR A;  2YEK A;  5IBN A;  5ENE A;  4UIY A;  2DVS A;  3P1F A;  4J3I A;  2RO1 A;  5LUU A;  4N4I A;  5F63 A;  4A9M A;  5HEL A;  4TZ2 A;  4HBY A;  4MR5 A;  5CRZ A;  4XY8 A;  5FE1 A;  3U5N A;  4O70 A;  3TLP A;  5F25 A;  5CQ6 A;  3LQJ A;  4HBX A;  3UVD A;  5EQ1 A;  3P1D A;  3UW9 A;  4HBW A;  5ENH A;  5I1Q A;  4TQN A;  4UYF A;  3O36 A;  3UVW A;  4YH4 A;  4TS8 A;  3P5O A;  5HJC A;  2RNX A;  5FB0 A;  5HRV A;  5H1U A;  5ACY A;  5FE3 A;  5F36 A;  5DYX A;  4PS5 A;  4BW2 A;  4BW1 A;  4ZW1 A;  1E6I A;  5I7Y A;  4KCX A;  5EIC A;  5DFD A;  5IID A;  3G0L A;  4YH3 A;  2RNW A;  5A5Q A;  4YAT A;  4YYH A;  4NUC A;  2MJV B;  4UIX A;  5LKX A;  5K29 A;  5DKH A;  4QSW A;  4QYL A;  5E0R A;  4IR5 A;  4UIZ A;  2WP2 A;  3U5K A;  5HRW A;  5FH7 A;  5FE8 A;  4QSS A;  5CUE A;  4TT2 A;  4YY6 A;  4CUU A;  4UIT A;  2I8N A;  1F68 A;  4CUQ A;  4UYE A;  3HMF A;  4A9I A;  4CFK A;  4QSR A;  3LQI A;  5ENJ A;  5CUC A;  5A5P A;  4MR3 A;  4TT6 A;  4QST A;  4YYM A;  5A5R A;  4NUD A;  5LJ1 A;  4O76 A;  5IGM A;  4A9J A;  5DBM A;  4QR4 A;  2OUO A;  5ENB A;  5EWV A;  4YBM A;  4LRG A;  3DAI A;  5L8T A;  4N4G A;  4BJX A;  5DKC A;  5L98 A;  5HRX A;  2YDW A;  5HQ5 A;  4QUU A;  5CQ5 A;  5CGP A;  4YBT A;  4MEP A;  4QBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...