5I88A

Brd4 in complex with cpd4 ((e)-3-(6-(but-2-en-1-yl)-7-oxo-6,7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)-n,n-dimethylbenzamide)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
126
structure length
126
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 4
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i88A01
3JVKA 5FG5A 4LZSA 4LDFA 4IR5A 2R0YA 4IR4A 4YC9A 4YATA 4NYWA 2DVVA 5EPRA 4NYXA 4WHUA 5FB1A 4IOQA 5DFBA 4YYNA 5KHMA 4YYIA 3G0JA 5A82A 4QSTA 4MEOA 3LQHA 4N4GA 4PY6A 5HJCA 5G4SA 5LKXA 5EISA 5A81A 3DWYA 5E9MA 5LJ0A 4UIZA 4RVRA 5CQAA 4NYVA 4TS8A 3UV2A 2DVSA 3HMFA 3O33A 4WIVA 3P1CA 4YH4A 2E3KA 5ENGA 5A5OA 4BW3A 5I89A 5F25A 5A5RA 4PCEA 2RNYA 3UVXA 3RCWA 2E7OA 5D24A 5D3NA 5BT4A 4MR6A 5F36A 5D25A 4YYJA 5A5PA 5C89A 2KTBB 4LRGA 3G0LA 4NUCA 4A9JA 4E96A 5CPEA 5CUBA 5COIA 4J1PA 4O72A 5HELA 2R10A 4OGJA 5HRWA 5LUUA 4X2IA 4XUBA 5EK9A 4O77A 2I7KA 5FE1A 4QNSA 4LC2A 4N4HA 4O74A 5EI4A 5ETDA 2DKWA 5I29A 2OO1A 5KO4A 4TQNA 5EWWA 1JM4B 3AADA 4QZSA 2OUOA 5ENCA 5F2PA 5DX4A 5ENJA 5IG6A 5CS8A 5LVRA 4NR8A 5IIDA 3QZVA 3I3JA 5EA1A 3UVWA 2LSPB 5DLZA 5AD3A 5IGNA 4A9OA 5C85A 3D7CA 5EICA 3LXJA 5EPBA 2R0SA 5JI8A 3LQJA 3Q2FA 5ENIA 4O7BA 3UVYA 4KV1A 3DAIA 5E9LA 4N4IA 5EWDA 5F61A 4A9MA 2YELA 4HXNA 4NRCA 3NXBA 5FH6A 4ALHA 5CUGA 4A9NA 2F6NA 5DKCA 3HMHA 4Q0NA 3MB3A 5I86A 4YY6A 4QY4A 5FDZA 4A9FA 3MUKA 5F62A 5FE3A 5D3PA 2DWWA 5HENA 4YABA 5EQ1A 5D26A 5DLXA 3P1EA 5KTXA 4QB3A 4NUDA 5DBMA 5I83A 4GPJA 3JVLA 4QR4A 2YDWA 5E73A 4LYWA 4MEQA 4UIWA 5KTWA 5A5NA 3QZTA 5A5SA 5F63A 5C4QA 4YADA 4UYHA 2FSAA 1ZS5A 5HQ5A 5LKZA 5L8UA 4QSPA 3JVJA 4YH3A 5FE4A 4PCIA 4MR5A 4F3IA 5E0RA 5CY9A 4NS5A 4HBYA 4NR4A 4IOOA 2D9EA 5H1VA 4QC3A 4MR3A 4XY9A 4QEWA 1JSPB 5CQ5A 3LQIA 5EWCA 4UIXA 5D3HA 4MEPA 4YYDA 4QSRA 2RS9B 4NR5A 5FE5A 5HFRA 5AMEA 5LVQA 3SVGA 4TZ2A 5FG4A 5D3RA 4CLBA 3UV5A 5A5QA 4J3IA 5LJ2A 5EWVA 5L98A 4Q0OA 5FBXA 4LYSA 5ENFA 4BHWA 3O35A 5E9KA 3QZSA 5KTUA 4TZ8A 3GG3A 5EU1A 5LKUA 4PTBA 4QSUA 5H85A 4LZRA 5FG6A 3U5NA 1WUMA 4XYAA 4UIUA 5D3TA 3MQMA 4CFKA 4OUFA 2NXBA 5CFWA 5D0CA 5FE0A 5G4RA 4TT2A 5L8TA 2L84A 5FE6A 4YYMA 4QBMA 5CUDA 4HXSA 4AKNA 3O34A 5HRXA 5KU3A 4A9HA 4QUTA 3MXFA 3ZYUA 3SVHA 2I8NA 4YBMA 4YK0A 4NR9A 2DVRA 4CUUA 5IGLA 5DYCA 4IORA 4UITA 5ENEA 5F3AA 4HXPA 3ONIA 5CU8A 4Z1QA 1E6IA 4BW2A 4DONA 3K2JA 4IR6A 4CUTA 3U5OA 4QUUA 5TB6A 5F60A 2RNWA 5FB0A 5K29A 2GRCA 4N3WA 5E74A 4QEUA 2G4AA 2WP2A 2YQDA 5II1A 5FFVA 3O36A 3U5PA 4QSXA 2H60A 5E9IA 5DKHA 5EGUA 5F5ZA 4BJXA 4YYKA 4MENA 5CP5A 5F1HA 4Z6HA 4A9KA 4CFLA 4CL9A 5A83A 5CGPA 4NXJA 5H1TA 2L5EA 4LZ2A 5FH8A 4YBSA 5FFYA 5EPSA 4BW1A 4O7AA 5TCMA 5DY7A 5H1UA 1F68A 4C66A 5A85A 4TTEA 4TYLA 2RI7A 4HXOA 5BT3A 5ETBA 4ZW1A 4ZQLA 5CQ7A 5CUEA 5FH7A 5C8GA 3IU5A 4XY8A 2YW5A 4OGIA 4PKLA 5DW2A 3UW9A 5HFQA 3SVFA 5CQTA 4O71A 5DFCA 5CQ4A 5EM3A 4XUAA 5DYUA 3S91A 3AQAA 5ENBA 5L99A 5E9YA 4CUQA 3P1DA 5F1LA 2D82A 3P1FA 1X0JA 5II2A 5HLSA 3MULA 5CRMA 3LJWA 2YEKA 4TT4A 2RFJA 4TT6A 3U5LA 4KV4A 2YYNA 3Q2EA 2RO1A 2E7NA 5I1QA 5C7NA 4HXMA 5CUAA 5IGKA 4O7EA 2F6JA 4YYHA 4NRAA 5HEMA 4NRBA 4QSQA 5CQ8A 5E3GA 3TLPA 5FE7A 2MJVB 5D3JA 4HBWA 4C67A 5AD2A 4A9EA 4NR7A 5CZGA 4UYDA 2YEMA 5HCLA 3O37A 4Z6IA 4QEVA 3U5JA 3UVDA 3IU6A 4UYFA 5FE9A 5DKDA 4ZC9A 5J0DA 4QSWA 5LKTA 4CUSA 5DW1A 5A7CA 4QYDA 4O78A 5I7YA 4YYGA 4QYLA 4QC1A 4TU4A 4O76A 5EP7A 5FFWA 4YY4A 2DVQA 2N9GA 2R0VA 2WP1A 5HQ6A 4QSSA 5EWHA 4UYEA 5D3LA 4ALGA 5IBNA 5E7DA 2DATA 4HBXA 4QR3A 2L85A 5CRZA 5L96A 4HXRA 4BW4A 5IGMA 5CQ3A 3U5KA 5AMFA 4YBTA 1N72A 5BT5A 4QR5A 5DYAA 2OSSA 4HBVA 4CUPA 5E3DA 1EQFA 4FLPA 5FE8A 4J0SA 4Z93A 4Y03A 4O70A 4UIYA 4HXLA 5DYXA 4O7CA 4KCXA 4A9LA 4LYIA 5ACYA 3U5MA 5HM0A 5CQ6A 5EVAA 4NR6A 5I88A 3FKMX 4O75A 4J0RA 4UYFB 4UYGA 4WHWA 5I40A 5CUCA 3S92A 5HRVA 5D7XA 2RNXA 4QSVA 5CTLA 4PS5A 3HMEA 5HQ7A 5LJ1A 5D3SA 4TU6A 4O7FA 3UV4A 4Z1SA 4NQMA 4NUEA 5E9VA 5JWMA 4NQNA 5ENHA 5DFDA 4N4FA 4MR4A 4CURA 5FE2A 4A9IA 5C87A 4LR6A 5I7XA 5L97A 3MB4A 1WUGA 4IR3A 5I80A 4YAXA 4HXKA 5EV9A 3JVMA 4UIVA 3P5OA
chains in the Genus database with same CATH superfamily
3JVKA 5FG5A 4LZSA 4LDFA 4IR5A 2R0YA 4IR4A 4YC9A 4YATA 4NYWA 2DVVA 5EPRA 4NYXA 4WHUA 5FB1A 4IOQA 5DFBA 4YYNA 5KHMA 4YYIA 3G0JA 5A82A 4QSTA 4MEOA 3LQHA 1ZKRA 4N4GA 4PY6A 5HJCA 5G4SA 5LKXA 5EISA 5A81A 3DWYA 5E9MA 5LJ0A 4UIZA 4RVRA 5CQAA 4NYVA 4TS8A 3UV2A 2DVSA 3HMFA 3O33A 4WIVA 3P1CA 4YH4A 2E3KA 5ENGA 5A5OA 4BW3A 5I89A 5F25A 5A5RA 4PCEA 2RNYA 3UVXA 3RCWA 2E7OA 5D24A 5D3NA 3ERRA 5BT4A 4MR6A 5F36A 5D25A 4YYJA 5A5PA 5C89A 2KTBB 4LRGA 3G0LA 4NUCA 4A9JA 4E96A 5CPEA 5CUBA 5COIA 4J1PA 4O72A 5HELA 2R10A 4OGJA 5HRWA 5LUUA 4X2IA 4XUBA 5EK9A 4O77A 2I7KA 5FE1A 4QNSA 4LC2A 4N4HA 4AKHA 4O74A 5EI4A 5ETDA 2DKWA 5I29A 2OO1A 5KO4A 4TQNA 5EWWA 1JM4B 3AADA 4QZSA 2OUOA 5ENCA 5F2PA 5DX4A 5ENJA 5IG6A 5CS8A 5LVRA 4NR8A 5IIDA 3QZVA 3I3JA 5EA1A 3UVWA 2LSPB 5DLZA 5AD3A 5IGNA 4A9OA 5C85A 3D7CA 5EICA 3LXJA 5EPBA 2R0SA 5JI8A 3LQJA 3Q2FA 5ENIA 4O7BA 3UVYA 4KV1A 3DAIA 5E9LA 4N4IA 5EWDA 5F61A 4A9MA 2YELA 4HXNA 4NRCA 3NXBA 5FH6A 4ALHA 5CUGA 4A9NA 2F6NA 5DKCA 3HMHA 4Q0NA 3MB3A 5I86A 4YY6A 4QY4A 5FDZA 4A9FA 3MUKA 5F62A 5FE3A 5D3PA 2DWWA 5HENA 4YABA 5EQ1A 5D26A 5DLXA 3P1EA 5KTXA 4QB3A 4NUDA 5DBMA 5I83A 4GPJA 3JVLA 4QR4A 2YDWA 5E73A 4LYWA 4MEQA 4UIWA 5KTWA 5A5NA 3QZTA 5A5SA 5F63A 5C4QA 4YADA 4UYHA 2FSAA 1ZS5A 5HQ5A 5LKZA 5L8UA 4QSPA 3JVJA 4YH3A 5FE4A 4PCIA 4MR5A 4F3IA 5E0RA 5CY9A 4NS5A 4HBYA 4NR4A 4IOOA 2D9EA 5H1VA 4QC3A 4MR3A 4XY9A 4QEWA 1JSPB 5CQ5A 3LQIA 5EWCA 4UIXA 5D3HA 4MEPA 4YYDA 4QSRA 2RS9B 4NR5A 2EJNA 5FE5A 5HFRA 5AMEA 5LVQA 3SVGA 4TZ2A 5FG4A 5D3RA 4CLBA 3UV5A 5A5QA 4J3IA 5LJ2A 5EWVA 5L98A 4Q0OA 5FBXA 4LYSA 5ENFA 4BHWA 3O35A 5E9KA 3QZSA 5KTUA 4TZ8A 3GG3A 5EU1A 5LKUA 4PTBA 4QSUA 5H85A 4LZRA 5FG6A 3U5NA 1WUMA 4XYAA 4UIUA 5D3TA 3MQMA 4CFKA 4OUFA 2NXBA 5CFWA 5D0CA 5FE0A 5G4RA 4TT2A 5L8TA 2L84A 5FE6A 4YYMA 4QBMA 5CUDA 4HXSA 4AKNA 3O34A 5HRXA 5KU3A 4A9HA 4QUTA 3MXFA 3ZYUA 3SVHA 2I8NA 4YBMA 4YK0A 4NR9A 2DVRA 4CUUA 5IGLA 5DYCA 4IORA 4UITA 5ENEA 5F3AA 4HXPA 3ONIA 5CU8A 4Z1QA 1E6IA 4BW2A 4DONA 3K2JA 4IR6A 4CUTA 3U5OA 4QUUA 5TB6A 5F60A 2RNWA 5FB0A 5K29A 2GRCA 4N3WA 5E74A 4QEUA 2G4AA 2WP2A 2YQDA 5II1A 5FFVA 3O36A 3U5PA 4QSXA 2H60A 5E9IA 5DKHA 5EGUA 5F5ZA 4BJXA 4YYKA 4MENA 5CP5A 5F1HA 4Z6HA 4A9KA 4CFLA 4CL9A 5A83A 5CGPA 4NXJA 5H1TA 2L5EA 4LZ2A 5FH8A 4YBSA 5FFYA 5EPSA 4BW1A 4O7AA 5TCMA 5DY7A 5H1UA 1F68A 4C66A 5A85A 4TTEA 4TYLA 2RI7A 4HXOA 5BT3A 5ETBA 4ZW1A 4ZQLA 5CQ7A 5CUEA 5FH7A 5C8GA 3IU5A 4XY8A 2YW5A 4OGIA 4PKLA 5DW2A 3UW9A 5HFQA 3SVFA 5CQTA 4O71A 5DFCA 5CQ4A 5EM3A 4XUAA 5DYUA 3S91A 3AQAA 5ENBA 5L99A 3D1DA 5E9YA 4CUQA 3P1DA 5F1LA 3VKHA 2D82A 3P1FA 1X0JA 5II2A 1PUOA 5HLSA 3MULA 5CRMA 3LJWA 2YEKA 4TT4A 2RFJA 4TT6A 3U5LA 4KV4A 2YYNA 3Q2EA 2RO1A 2E7NA 5I1QA 5C7NA 4HXMA 5CUAA 5IGKA 4O7EA 2F6JA 4YYHA 4NRAA 5HEMA 4NRBA 4QSQA 5CQ8A 5E3GA 3TLPA 5FE7A 2MJVB 5D3JA 4HBWA 4C67A 5AD2A 4A9EA 4NR7A 5CZGA 4UYDA 2YEMA 5HCLA 3O37A 4Z6IA 4QEVA 3U5JA 3UVDA 3IU6A 4UYFA 5FE9A 5DKDA 4ZC9A 5J0DA 4QSWA 5LKTA 4CUSA 5DW1A 5A7CA 4QYDA 4O78A 5I7YA 4YYGA 4QYLA 4QC1A 4TU4A 4O76A 5EP7A 5FFWA 4YY4A 2DVQA 2N9GA 2R0VA 2WP1A 5HQ6A 4QSSA 5EWHA 4UYEA 5D3LA 4ALGA 5IBNA 5E7DA 2DATA 4HBXA 4QR3A 2L85A 5CRZA 5L96A 4HXRA 4BW4A 5IGMA 5CQ3A 3U5KA 5AMFA 4YBTA 1N72A 5BT5A 4QR5A 5DYAA 2OSSA 4HBVA 4CUPA 5E3DA 1EQFA 3D1BA 4FLPA 5FE8A 4J0SA 4Z93A 4Y03A 4O70A 4UIYA 4HXLA 5DYXA 4O7CA 4KCXA 4A9LA 4LYIA 5ACYA 3U5MA 5HM0A 5CQ6A 4AI6A 5EVAA 4NR6A 5I88A 3FKMX 4O75A 4J0RA 4UYFB 4UYGA 4WHWA 5I40A 5CUCA 3S92A 5HRVA 2RNXA 5D7XA 4QSVA 5CTLA 4PS5A 3HMEA 5HQ7A 5LJ1A 5D3SA 4TU6A 4O7FA 3UV4A 4Z1SA 4NQMA 4NUEA 5E9VA 4AKIA 5JWMA 4NQNA 5ENHA 5DFDA 4N4FA 4MR4A 4AKGA 4CURA 5FE2A 4A9IA 5C87A 4LR6A 5I7XA 5L97A 3MB4A 1WUGA 4IR3A 5I80A 4YAXA 4HXKA 5EV9A 3VKGA 3JVMA 4UIVA 3P5OA
chains in the Genus database with same CATH topology
3JVKA 5FG5A 4LZSA 4LDFA 4IR5A 2R0YA 4IR4A 4YC9A 4YATA 4NYWA 2DVVA 5EPRA 4NYXA 4WHUA 5FB1A 4IOQA 5DFBA 4YYNA 5KHMA 4YYIA 3G0JA 5A82A 4QSTA 4MEOA 3LQHA 4N4GA 4PY6A 5HJCA 5G4SA 5LKXA 5EISA 5A81A 3DWYA 5E9MA 5LJ0A 4UIZA 4RVRA 5CQAA 4NYVA 4TS8A 3UV2A 2DVSA 3HMFA 3O33A 4WIVA 3P1CA 4YH4A 2E3KA 5ENGA 5A5OA 4BW3A 5I89A 5F25A 5A5RA 4PCEA 2RNYA 3UVXA 3RCWA 2E7OA 5D24A 5D3NA 5BT4A 4MR6A 5F36A 5D25A 4YYJA 5A5PA 5C89A 2KTBB 4LRGA 3G0LA 4NUCA 4A9JA 4E96A 5CPEA 5CUBA 5COIA 4J1PA 4O72A 5HELA 2R10A 4OGJA 5HRWA 5LUUA 4X2IA 4XUBA 5EK9A 4O77A 2I7KA 5FE1A 4QNSA 4LC2A 4N4HA 4O74A 5EI4A 5ETDA 2DKWA 5I29A 2OO1A 5KO4A 4TQNA 5EWWA 1JM4B 3AADA 4QZSA 2OUOA 5ENCA 5F2PA 5DX4A 5ENJA 5IG6A 5CS8A 5LVRA 4NR8A 5IIDA 3QZVA 3I3JA 5EA1A 3UVWA 2LSPB 5DLZA 5AD3A 5IGNA 4A9OA 5C85A 3D7CA 5EICA 3LXJA 5EPBA 2R0SA 5JI8A 3LQJA 3Q2FA 5ENIA 4O7BA 3UVYA 4KV1A 3DAIA 5E9LA 4N4IA 5EWDA 5F61A 4A9MA 2YELA 4HXNA 4NRCA 3NXBA 5FH6A 4ALHA 5CUGA 4A9NA 2F6NA 5DKCA 3HMHA 4Q0NA 3MB3A 5I86A 4YY6A 4QY4A 5FDZA 4A9FA 3MUKA 5F62A 5FE3A 5D3PA 2DWWA 5HENA 4YABA 5EQ1A 5D26A 5DLXA 3P1EA 5KTXA 4QB3A 4NUDA 5DBMA 5I83A 4GPJA 3JVLA 4QR4A 2YDWA 5E73A 4LYWA 4MEQA 4UIWA 5KTWA 5A5NA 3QZTA 5A5SA 5F63A 5C4QA 4YADA 4UYHA 2FSAA 1ZS5A 5HQ5A 5LKZA 5L8UA 4QSPA 3JVJA 4YH3A 5FE4A 4PCIA 4MR5A 4F3IA 5E0RA 5CY9A 4NS5A 4HBYA 4NR4A 4IOOA 2D9EA 5H1VA 4QC3A 4MR3A 4XY9A 4QEWA 1JSPB 5CQ5A 3LQIA 5EWCA 4UIXA 5D3HA 4MEPA 4YYDA 4QSRA 2RS9B 4NR5A 5FE5A 5HFRA 5AMEA 5LVQA 3SVGA 4TZ2A 5FG4A 5D3RA 4CLBA 3UV5A 5A5QA 4J3IA 5LJ2A 5EWVA 5L98A 4Q0OA 5FBXA 4LYSA 5ENFA 4BHWA 3O35A 5E9KA 3QZSA 5KTUA 4TZ8A 3GG3A 5EU1A 5LKUA 4PTBA 4QSUA 5H85A 4LZRA 5FG6A 3U5NA 1WUMA 4XYAA 4UIUA 5D3TA 3MQMA 4CFKA 4OUFA 2NXBA 5CFWA 5D0CA 5FE0A 5G4RA 4TT2A 5L8TA 2L84A 5FE6A 4YYMA 4QBMA 5CUDA 4HXSA 4AKNA 3O34A 5HRXA 5KU3A 4A9HA 4QUTA 3MXFA 3ZYUA 3SVHA 2I8NA 4YBMA 4YK0A 4NR9A 2DVRA 4CUUA 5IGLA 5DYCA 4IORA 4UITA 5ENEA 5F3AA 4HXPA 3ONIA 5CU8A 4Z1QA 1E6IA 4BW2A 4DONA 3K2JA 4IR6A 4CUTA 3U5OA 4QUUA 5TB6A 5F60A 2RNWA 5FB0A 5K29A 2GRCA 4N3WA 5E74A 4QEUA 2G4AA 2WP2A 2YQDA 5II1A 5FFVA 3O36A 3U5PA 4QSXA 2H60A 5E9IA 5DKHA 5EGUA 5F5ZA 4BJXA 4YYKA 4MENA 5CP5A 5F1HA 4Z6HA 4A9KA 4CFLA 4CL9A 5A83A 5CGPA 4NXJA 5H1TA 2L5EA 4LZ2A 5FH8A 4YBSA 5FFYA 5EPSA 4BW1A 4O7AA 5TCMA 5DY7A 5H1UA 1F68A 4C66A 5A85A 4TTEA 4TYLA 2RI7A 4HXOA 5BT3A 5ETBA 4ZW1A 4ZQLA 5CQ7A 5CUEA 5FH7A 5C8GA 3IU5A 4XY8A 2YW5A 4OGIA 4PKLA 5DW2A 3UW9A 5HFQA 3SVFA 5CQTA 4O71A 5DFCA 5CQ4A 5EM3A 4XUAA 5DYUA 3S91A 3AQAA 5ENBA 5L99A 5E9YA 4CUQA 3P1DA 5F1LA 2D82A 3P1FA 1X0JA 5II2A 5HLSA 3MULA 5CRMA 3LJWA 2YEKA 4TT4A 2RFJA 4TT6A 3U5LA 4KV4A 2YYNA 3Q2EA 2RO1A 2E7NA 5I1QA 5C7NA 4HXMA 5CUAA 5IGKA 4O7EA 2F6JA 4YYHA 4NRAA 5HEMA 4NRBA 4QSQA 5CQ8A 5E3GA 3TLPA 5FE7A 2MJVB 5D3JA 4HBWA 4C67A 5AD2A 4A9EA 4NR7A 5CZGA 4UYDA 2YEMA 5HCLA 3O37A 4Z6IA 4QEVA 3U5JA 3UVDA 3IU6A 4UYFA 5FE9A 5DKDA 4ZC9A 5J0DA 4QSWA 5LKTA 4CUSA 5DW1A 5A7CA 4QYDA 4O78A 5I7YA 4YYGA 4QYLA 4QC1A 4TU4A 4O76A 5EP7A 5FFWA 4YY4A 2DVQA 2N9GA 2R0VA 2WP1A 5HQ6A 4QSSA 5EWHA 4UYEA 5D3LA 4ALGA 5IBNA 5E7DA 2DATA 4HBXA 4QR3A 2L85A 5CRZA 5L96A 4HXRA 4BW4A 5IGMA 5CQ3A 3U5KA 5AMFA 4YBTA 1N72A 5BT5A 4QR5A 5DYAA 2OSSA 4HBVA 4CUPA 5E3DA 1EQFA 4FLPA 5FE8A 4J0SA 4Z93A 4Y03A 4O70A 4UIYA 4HXLA 5DYXA 4O7CA 4KCXA 4A9LA 4LYIA 5ACYA 3U5MA 5HM0A 5CQ6A 5EVAA 4NR6A 5I88A 3FKMX 4O75A 4J0RA 4UYFB 4UYGA 4WHWA 5I40A 5CUCA 3S92A 5HRVA 5D7XA 2RNXA 4QSVA 5CTLA 4PS5A 3HMEA 5HQ7A 5LJ1A 5D3SA 4TU6A 4O7FA 3UV4A 4Z1SA 4NQMA 4NUEA 5E9VA 5JWMA 4NQNA 5ENHA 5DFDA 4N4FA 4MR4A 4CURA 5FE2A 4A9IA 5C87A 4LR6A 5I7XA 5L97A 3MB4A 1WUGA 4IR3A 5I80A 4YAXA 4HXKA 5EV9A 3JVMA 4UIVA 3P5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVK A;  5FG5 A;  4LZS A;  4LDF A;  4IR5 A;  2R0Y A;  4IR4 A;  4YC9 A;  4YAT A;  4NYW A;  2DVV A;  5EPR A;  4NYX A;  4WHU A;  5FB1 A;  4IOQ A;  5DFB A;  4YYN A;  5KHM A;  4YYI A;  3G0J A;  5A82 A;  4QST A;  4MEO A;  3LQH A;  4N4G A;  4PY6 A;  5HJC A;  5G4S A;  5LKX A;  5EIS A;  5A81 A;  3DWY A;  5E9M A;  5LJ0 A;  4UIZ A;  4RVR A;  5CQA A;  4NYV A;  4TS8 A;  3UV2 A;  2DVS A;  3HMF A;  3O33 A;  4WIV A;  3P1C A;  4YH4 A;  2E3K A;  5ENG A;  5A5O A;  4BW3 A;  5I89 A;  5F25 A;  5A5R A;  4PCE A;  2RNY A;  3UVX A;  3RCW A;  2E7O A;  5D24 A;  5D3N A;  5BT4 A;  4MR6 A;  5F36 A;  5D25 A;  4YYJ A;  5A5P A;  5C89 A;  2KTB B;  4LRG A;  3G0L A;  4NUC A;  4A9J A;  4E96 A;  5CPE A;  5CUB A;  5COI A;  4J1P A;  4O72 A;  5HEL A;  2R10 A;  4OGJ A;  5HRW A;  5LUU A;  4X2I A;  4XUB A;  5EK9 A;  4O77 A;  2I7K A;  5FE1 A;  4QNS A;  4LC2 A;  4N4H A;  4O74 A;  5EI4 A;  5ETD A;  2DKW A;  5I29 A;  2OO1 A;  5KO4 A;  4TQN A;  5EWW A;  1JM4 B;  3AAD A;  4QZS A;  2OUO A;  5ENC A;  5F2P A;  5DX4 A;  5ENJ A;  5IG6 A;  5CS8 A;  5LVR A;  4NR8 A;  5IID A;  3QZV A;  3I3J A;  5EA1 A;  3UVW A;  2LSP B;  5DLZ A;  5AD3 A;  5IGN A;  4A9O A;  5C85 A;  3D7C A;  5EIC A;  3LXJ A;  5EPB A;  2R0S A;  5JI8 A;  3LQJ A;  3Q2F A;  5ENI A;  4O7B A;  3UVY A;  4KV1 A;  3DAI A;  5E9L A;  4N4I A;  5EWD A;  5F61 A;  4A9M A;  2YEL A;  4HXN A;  4NRC A;  3NXB A;  5FH6 A;  4ALH A;  5CUG A;  4A9N A;  2F6N A;  5DKC A;  3HMH A;  4Q0N A;  3MB3 A;  5I86 A;  4YY6 A;  4QY4 A;  5FDZ A;  4A9F A;  3MUK A;  5F62 A;  5FE3 A;  5D3P A;  2DWW A;  5HEN A;  4YAB A;  5EQ1 A;  5D26 A;  5DLX A;  3P1E A;  5KTX A;  4QB3 A;  4NUD A;  5DBM A;  5I83 A;  4GPJ A;  3JVL A;  4QR4 A;  2YDW A;  5E73 A;  4LYW A;  4MEQ A;  4UIW A;  5KTW A;  5A5N A;  3QZT A;  5A5S A;  5F63 A;  5C4Q A;  4YAD A;  4UYH A;  2FSA A;  1ZS5 A;  5HQ5 A;  5LKZ A;  5L8U A;  4QSP A;  3JVJ A;  4YH3 A;  5FE4 A;  4PCI A;  4MR5 A;  4F3I A;  5E0R A;  5CY9 A;  4NS5 A;  4HBY A;  4NR4 A;  4IOO A;  2D9E A;  5H1V A;  4QC3 A;  4MR3 A;  4XY9 A;  4QEW A;  1JSP B;  5CQ5 A;  3LQI A;  5EWC A;  4UIX A;  5D3H A;  4MEP A;  4YYD A;  4QSR A;  2RS9 B;  4NR5 A;  5FE5 A;  5HFR A;  5AME A;  5LVQ A;  3SVG A;  4TZ2 A;  5FG4 A;  5D3R A;  4CLB A;  3UV5 A;  5A5Q A;  4J3I A;  5LJ2 A;  5EWV A;  5L98 A;  4Q0O A;  5FBX A;  4LYS A;  5ENF A;  4BHW A;  3O35 A;  5E9K A;  3QZS A;  5KTU A;  4TZ8 A;  3GG3 A;  5EU1 A;  5LKU A;  4PTB A;  4QSU A;  5H85 A;  4LZR A;  5FG6 A;  3U5N A;  1WUM A;  4XYA A;  4UIU A;  5D3T A;  3MQM A;  4CFK A;  4OUF A;  2NXB A;  5CFW A;  5D0C A;  5FE0 A;  5G4R A;  4TT2 A;  5L8T A;  2L84 A;  5FE6 A;  4YYM A;  4QBM A;  5CUD A;  4HXS A;  4AKN A;  3O34 A;  5HRX A;  5KU3 A;  4A9H A;  4QUT A;  3MXF A;  3ZYU A;  3SVH A;  2I8N A;  4YBM A;  4YK0 A;  4NR9 A;  2DVR A;  4CUU A;  5IGL A;  5DYC A;  4IOR A;  4UIT A;  5ENE A;  5F3A A;  4HXP A;  3ONI A;  5CU8 A;  4Z1Q A;  1E6I A;  4BW2 A;  4DON A;  3K2J A;  4IR6 A;  4CUT A;  3U5O A;  4QUU A;  5TB6 A;  5F60 A;  2RNW A;  5FB0 A;  5K29 A;  2GRC A;  4N3W A;  5E74 A;  4QEU A;  2G4A A;  2WP2 A;  2YQD A;  5II1 A;  5FFV A;  3O36 A;  3U5P A;  4QSX A;  2H60 A;  5E9I A;  5DKH A;  5EGU A;  5F5Z A;  4BJX A;  4YYK A;  4MEN A;  5CP5 A;  5F1H A;  4Z6H A;  4A9K A;  4CFL A;  4CL9 A;  5A83 A;  5CGP A;  4NXJ A;  5H1T A;  2L5E A;  4LZ2 A;  5FH8 A;  4YBS A;  5FFY A;  5EPS A;  4BW1 A;  4O7A A;  5TCM A;  5DY7 A;  5H1U A;  1F68 A;  4C66 A;  5A85 A;  4TTE A;  4TYL A;  2RI7 A;  4HXO A;  5BT3 A;  5ETB A;  4ZW1 A;  4ZQL A;  5CQ7 A;  5CUE A;  5FH7 A;  5C8G A;  3IU5 A;  4XY8 A;  2YW5 A;  4OGI A;  4PKL A;  5DW2 A;  3UW9 A;  5HFQ A;  3SVF A;  5CQT A;  4O71 A;  5DFC A;  5CQ4 A;  5EM3 A;  4XUA A;  5DYU A;  3S91 A;  3AQA A;  5ENB A;  5L99 A;  5E9Y A;  4CUQ A;  3P1D A;  5F1L A;  2D82 A;  3P1F A;  1X0J A;  5II2 A;  5HLS A;  3MUL A;  5CRM A;  3LJW A;  2YEK A;  4TT4 A;  2RFJ A;  4TT6 A;  3U5L A;  4KV4 A;  2YYN A;  3Q2E A;  2RO1 A;  2E7N A;  5I1Q A;  5C7N A;  4HXM A;  5CUA A;  5IGK A;  4O7E A;  2F6J A;  4YYH A;  4NRA A;  5HEM A;  4NRB A;  4QSQ A;  5CQ8 A;  5E3G A;  3TLP A;  5FE7 A;  2MJV B;  5D3J A;  4HBW A;  4C67 A;  5AD2 A;  4A9E A;  4NR7 A;  5CZG A;  4UYD A;  2YEM A;  5HCL A;  3O37 A;  4Z6I A;  4QEV A;  3U5J A;  3UVD A;  3IU6 A;  4UYF A;  5FE9 A;  5DKD A;  4ZC9 A;  5J0D A;  4QSW A;  5LKT A;  4CUS A;  5DW1 A;  5A7C A;  4QYD A;  4O78 A;  5I7Y A;  4YYG A;  4QYL A;  4QC1 A;  4TU4 A;  4O76 A;  5EP7 A;  5FFW A;  4YY4 A;  2DVQ A;  2N9G A;  2R0V A;  2WP1 A;  5HQ6 A;  4QSS A;  5EWH A;  4UYE A;  5D3L A;  4ALG A;  5IBN A;  5E7D A;  2DAT A;  4HBX A;  4QR3 A;  2L85 A;  5CRZ A;  5L96 A;  4HXR A;  4BW4 A;  5IGM A;  5CQ3 A;  3U5K A;  5AMF A;  4YBT A;  1N72 A;  5BT5 A;  4QR5 A;  5DYA A;  2OSS A;  4HBV A;  4CUP A;  5E3D A;  1EQF A;  4FLP A;  5FE8 A;  4J0S A;  4Z93 A;  4Y03 A;  4O70 A;  4UIY A;  4HXL A;  5DYX A;  4O7C A;  4KCX A;  4A9L A;  4LYI A;  5ACY A;  3U5M A;  5HM0 A;  5CQ6 A;  5EVA A;  4NR6 A;  5I88 A;  3FKM X;  4O75 A;  4J0R A;  4UYF B;  4UYG A;  4WHW A;  5I40 A;  5CUC A;  3S92 A;  5HRV A;  5D7X A;  2RNX A;  4QSV A;  5CTL A;  4PS5 A;  3HME A;  5HQ7 A;  5LJ1 A;  5D3S A;  4TU6 A;  4O7F A;  3UV4 A;  4Z1S A;  4NQM A;  4NUE A;  5E9V A;  5JWM A;  4NQN A;  5ENH A;  5DFD A;  4N4F A;  4MR4 A;  4CUR A;  5FE2 A;  4A9I A;  5C87 A;  4LR6 A;  5I7X A;  5L97 A;  3MB4 A;  1WUG A;  4IR3 A;  5I80 A;  4YAX A;  4HXK A;  5EV9 A;  3JVM A;  4UIV A;  3P5O A; 
#chains in the Genus database with same CATH topology
 3JVK A;  5FG5 A;  4LZS A;  4LDF A;  4IR5 A;  2R0Y A;  4IR4 A;  4YC9 A;  4YAT A;  4NYW A;  2DVV A;  5EPR A;  4NYX A;  4WHU A;  5FB1 A;  4IOQ A;  5DFB A;  4YYN A;  5KHM A;  4YYI A;  3G0J A;  5A82 A;  4QST A;  4MEO A;  3LQH A;  1ZKR A;  4N4G A;  4PY6 A;  5HJC A;  5G4S A;  5LKX A;  5EIS A;  5A81 A;  3DWY A;  5E9M A;  5LJ0 A;  4UIZ A;  4RVR A;  5CQA A;  4NYV A;  4TS8 A;  3UV2 A;  2DVS A;  3HMF A;  3O33 A;  4WIV A;  3P1C A;  4YH4 A;  2E3K A;  5ENG A;  5A5O A;  4BW3 A;  5I89 A;  5F25 A;  5A5R A;  4PCE A;  2RNY A;  3UVX A;  3RCW A;  2E7O A;  5D24 A;  5D3N A;  3ERR A;  5BT4 A;  4MR6 A;  5F36 A;  5D25 A;  4YYJ A;  5A5P A;  5C89 A;  2KTB B;  4LRG A;  3G0L A;  4NUC A;  4A9J A;  4E96 A;  5CPE A;  5CUB A;  5COI A;  4J1P A;  4O72 A;  5HEL A;  2R10 A;  4OGJ A;  5HRW A;  5LUU A;  4X2I A;  4XUB A;  5EK9 A;  4O77 A;  2I7K A;  5FE1 A;  4QNS A;  4LC2 A;  4N4H A;  4AKH A;  4O74 A;  5EI4 A;  5ETD A;  2DKW A;  5I29 A;  2OO1 A;  5KO4 A;  4TQN A;  5EWW A;  1JM4 B;  3AAD A;  4QZS A;  2OUO A;  5ENC A;  5F2P A;  5DX4 A;  5ENJ A;  5IG6 A;  5CS8 A;  5LVR A;  4NR8 A;  5IID A;  3QZV A;  3I3J A;  5EA1 A;  3UVW A;  2LSP B;  5DLZ A;  5AD3 A;  5IGN A;  4A9O A;  5C85 A;  3D7C A;  5EIC A;  3LXJ A;  5EPB A;  2R0S A;  5JI8 A;  3LQJ A;  3Q2F A;  5ENI A;  4O7B A;  3UVY A;  4KV1 A;  3DAI A;  5E9L A;  4N4I A;  5EWD A;  5F61 A;  4A9M A;  2YEL A;  4HXN A;  4NRC A;  3NXB A;  5FH6 A;  4ALH A;  5CUG A;  4A9N A;  2F6N A;  5DKC A;  3HMH A;  4Q0N A;  3MB3 A;  5I86 A;  4YY6 A;  4QY4 A;  5FDZ A;  4A9F A;  3MUK A;  5F62 A;  5FE3 A;  5D3P A;  2DWW A;  5HEN A;  4YAB A;  5EQ1 A;  5D26 A;  5DLX A;  3P1E A;  5KTX A;  4QB3 A;  4NUD A;  5DBM A;  5I83 A;  4GPJ A;  3JVL A;  4QR4 A;  2YDW A;  5E73 A;  4LYW A;  4MEQ A;  4UIW A;  5KTW A;  5A5N A;  3QZT A;  5A5S A;  5F63 A;  5C4Q A;  4YAD A;  4UYH A;  2FSA A;  1ZS5 A;  5HQ5 A;  5LKZ A;  5L8U A;  4QSP A;  3JVJ A;  4YH3 A;  5FE4 A;  4PCI A;  4MR5 A;  4F3I A;  5E0R A;  5CY9 A;  4NS5 A;  4HBY A;  4NR4 A;  4IOO A;  2D9E A;  5H1V A;  4QC3 A;  4MR3 A;  4XY9 A;  4QEW A;  1JSP B;  5CQ5 A;  3LQI A;  5EWC A;  4UIX A;  5D3H A;  4MEP A;  4YYD A;  4QSR A;  2RS9 B;  4NR5 A;  2EJN A;  5FE5 A;  5HFR A;  5AME A;  5LVQ A;  3SVG A;  4TZ2 A;  5FG4 A;  5D3R A;  4CLB A;  3UV5 A;  5A5Q A;  4J3I A;  5LJ2 A;  5EWV A;  5L98 A;  4Q0O A;  5FBX A;  4LYS A;  5ENF A;  4BHW A;  3O35 A;  5E9K A;  3QZS A;  5KTU A;  4TZ8 A;  3GG3 A;  5EU1 A;  5LKU A;  4PTB A;  4QSU A;  5H85 A;  4LZR A;  5FG6 A;  3U5N A;  1WUM A;  4XYA A;  4UIU A;  5D3T A;  3MQM A;  4CFK A;  4OUF A;  2NXB A;  5CFW A;  5D0C A;  5FE0 A;  5G4R A;  4TT2 A;  5L8T A;  2L84 A;  5FE6 A;  4YYM A;  4QBM A;  5CUD A;  4HXS A;  4AKN A;  3O34 A;  5HRX A;  5KU3 A;  4A9H A;  4QUT A;  3MXF A;  3ZYU A;  3SVH A;  2I8N A;  4YBM A;  4YK0 A;  4NR9 A;  2DVR A;  4CUU A;  5IGL A;  5DYC A;  4IOR A;  4UIT A;  5ENE A;  5F3A A;  4HXP A;  3ONI A;  5CU8 A;  4Z1Q A;  1E6I A;  4BW2 A;  4DON A;  3K2J A;  4IR6 A;  4CUT A;  3U5O A;  4QUU A;  5TB6 A;  5F60 A;  2RNW A;  5FB0 A;  5K29 A;  2GRC A;  4N3W A;  5E74 A;  4QEU A;  2G4A A;  2WP2 A;  2YQD A;  5II1 A;  5FFV A;  3O36 A;  3U5P A;  4QSX A;  2H60 A;  5E9I A;  5DKH A;  5EGU A;  5F5Z A;  4BJX A;  4YYK A;  4MEN A;  5CP5 A;  5F1H A;  4Z6H A;  4A9K A;  4CFL A;  4CL9 A;  5A83 A;  5CGP A;  4NXJ A;  5H1T A;  2L5E A;  4LZ2 A;  5FH8 A;  4YBS A;  5FFY A;  5EPS A;  4BW1 A;  4O7A A;  5TCM A;  5DY7 A;  5H1U A;  1F68 A;  4C66 A;  5A85 A;  4TTE A;  4TYL A;  2RI7 A;  4HXO A;  5BT3 A;  5ETB A;  4ZW1 A;  4ZQL A;  5CQ7 A;  5CUE A;  5FH7 A;  5C8G A;  3IU5 A;  4XY8 A;  2YW5 A;  4OGI A;  4PKL A;  5DW2 A;  3UW9 A;  5HFQ A;  3SVF A;  5CQT A;  4O71 A;  5DFC A;  5CQ4 A;  5EM3 A;  4XUA A;  5DYU A;  3S91 A;  3AQA A;  5ENB A;  5L99 A;  3D1D A;  5E9Y A;  4CUQ A;  3P1D A;  5F1L A;  3VKH A;  2D82 A;  3P1F A;  1X0J A;  5II2 A;  1PUO A;  5HLS A;  3MUL A;  5CRM A;  3LJW A;  2YEK A;  4TT4 A;  2RFJ A;  4TT6 A;  3U5L A;  4KV4 A;  2YYN A;  3Q2E A;  2RO1 A;  2E7N A;  5I1Q A;  5C7N A;  4HXM A;  5CUA A;  5IGK A;  4O7E A;  2F6J A;  4YYH A;  4NRA A;  5HEM A;  4NRB A;  4QSQ A;  5CQ8 A;  5E3G A;  3TLP A;  5FE7 A;  2MJV B;  5D3J A;  4HBW A;  4C67 A;  5AD2 A;  4A9E A;  4NR7 A;  5CZG A;  4UYD A;  2YEM A;  5HCL A;  3O37 A;  4Z6I A;  4QEV A;  3U5J A;  3UVD A;  3IU6 A;  4UYF A;  5FE9 A;  5DKD A;  4ZC9 A;  5J0D A;  4QSW A;  5LKT A;  4CUS A;  5DW1 A;  5A7C A;  4QYD A;  4O78 A;  5I7Y A;  4YYG A;  4QYL A;  4QC1 A;  4TU4 A;  4O76 A;  5EP7 A;  5FFW A;  4YY4 A;  2DVQ A;  2N9G A;  2R0V A;  2WP1 A;  5HQ6 A;  4QSS A;  5EWH A;  4UYE A;  5D3L A;  4ALG A;  5IBN A;  5E7D A;  2DAT A;  4HBX A;  4QR3 A;  2L85 A;  5CRZ A;  5L96 A;  4HXR A;  4BW4 A;  5IGM A;  5CQ3 A;  3U5K A;  5AMF A;  4YBT A;  1N72 A;  5BT5 A;  4QR5 A;  5DYA A;  2OSS A;  4HBV A;  4CUP A;  5E3D A;  1EQF A;  3D1B A;  4FLP A;  5FE8 A;  4J0S A;  4Z93 A;  4Y03 A;  4O70 A;  4UIY A;  4HXL A;  5DYX A;  4O7C A;  4KCX A;  4A9L A;  4LYI A;  5ACY A;  3U5M A;  5HM0 A;  5CQ6 A;  4AI6 A;  5EVA A;  4NR6 A;  5I88 A;  3FKM X;  4O75 A;  4J0R A;  4UYF B;  4UYG A;  4WHW A;  5I40 A;  5CUC A;  3S92 A;  5HRV A;  2RNX A;  5D7X A;  4QSV A;  5CTL A;  4PS5 A;  3HME A;  5HQ7 A;  5LJ1 A;  5D3S A;  4TU6 A;  4O7F A;  3UV4 A;  4Z1S A;  4NQM A;  4NUE A;  5E9V A;  4AKI A;  5JWM A;  4NQN A;  5ENH A;  5DFD A;  4N4F A;  4MR4 A;  4AKG A;  4CUR A;  5FE2 A;  4A9I A;  5C87 A;  4LR6 A;  5I7X A;  5L97 A;  3MB4 A;  1WUG A;  4IR3 A;  5I80 A;  4YAX A;  4HXK A;  5EV9 A;  3VKG A;  3JVM A;  4UIV A;  3P5O A; 
#chains in the Genus database with same CATH homology
 3JVK A;  5FG5 A;  4LZS A;  4LDF A;  4IR5 A;  2R0Y A;  4IR4 A;  4YC9 A;  4YAT A;  4NYW A;  2DVV A;  5EPR A;  4NYX A;  4WHU A;  5FB1 A;  4IOQ A;  5DFB A;  4YYN A;  5KHM A;  4YYI A;  3G0J A;  5A82 A;  4QST A;  4MEO A;  3LQH A;  4N4G A;  4PY6 A;  5HJC A;  5G4S A;  5LKX A;  5EIS A;  5A81 A;  3DWY A;  5E9M A;  5LJ0 A;  4UIZ A;  4RVR A;  5CQA A;  4NYV A;  4TS8 A;  3UV2 A;  2DVS A;  3HMF A;  3O33 A;  4WIV A;  3P1C A;  4YH4 A;  2E3K A;  5ENG A;  5A5O A;  4BW3 A;  5I89 A;  5F25 A;  5A5R A;  4PCE A;  2RNY A;  3UVX A;  3RCW A;  2E7O A;  5D24 A;  5D3N A;  5BT4 A;  4MR6 A;  5F36 A;  5D25 A;  4YYJ A;  5A5P A;  5C89 A;  2KTB B;  4LRG A;  3G0L A;  4NUC A;  4A9J A;  4E96 A;  5CPE A;  5CUB A;  5COI A;  4J1P A;  4O72 A;  5HEL A;  2R10 A;  4OGJ A;  5HRW A;  5LUU A;  4X2I A;  4XUB A;  5EK9 A;  4O77 A;  2I7K A;  5FE1 A;  4QNS A;  4LC2 A;  4N4H A;  4O74 A;  5EI4 A;  5ETD A;  2DKW A;  5I29 A;  2OO1 A;  5KO4 A;  4TQN A;  5EWW A;  1JM4 B;  3AAD A;  4QZS A;  2OUO A;  5ENC A;  5F2P A;  5DX4 A;  5ENJ A;  5IG6 A;  5CS8 A;  5LVR A;  4NR8 A;  5IID A;  3QZV A;  3I3J A;  5EA1 A;  3UVW A;  2LSP B;  5DLZ A;  5AD3 A;  5IGN A;  4A9O A;  5C85 A;  3D7C A;  5EIC A;  3LXJ A;  5EPB A;  2R0S A;  5JI8 A;  3LQJ A;  3Q2F A;  5ENI A;  4O7B A;  3UVY A;  4KV1 A;  3DAI A;  5E9L A;  4N4I A;  5EWD A;  5F61 A;  4A9M A;  2YEL A;  4HXN A;  4NRC A;  3NXB A;  5FH6 A;  4ALH A;  5CUG A;  4A9N A;  2F6N A;  5DKC A;  3HMH A;  4Q0N A;  3MB3 A;  5I86 A;  4YY6 A;  4QY4 A;  5FDZ A;  4A9F A;  3MUK A;  5F62 A;  5FE3 A;  5D3P A;  2DWW A;  5HEN A;  4YAB A;  5EQ1 A;  5D26 A;  5DLX A;  3P1E A;  5KTX A;  4QB3 A;  4NUD A;  5DBM A;  5I83 A;  4GPJ A;  3JVL A;  4QR4 A;  2YDW A;  5E73 A;  4LYW A;  4MEQ A;  4UIW A;  5KTW A;  5A5N A;  3QZT A;  5A5S A;  5F63 A;  5C4Q A;  4YAD A;  4UYH A;  2FSA A;  1ZS5 A;  5HQ5 A;  5LKZ A;  5L8U A;  4QSP A;  3JVJ A;  4YH3 A;  5FE4 A;  4PCI A;  4MR5 A;  4F3I A;  5E0R A;  5CY9 A;  4NS5 A;  4HBY A;  4NR4 A;  4IOO A;  2D9E A;  5H1V A;  4QC3 A;  4MR3 A;  4XY9 A;  4QEW A;  1JSP B;  5CQ5 A;  3LQI A;  5EWC A;  4UIX A;  5D3H A;  4MEP A;  4YYD A;  4QSR A;  2RS9 B;  4NR5 A;  5FE5 A;  5HFR A;  5AME A;  5LVQ A;  3SVG A;  4TZ2 A;  5FG4 A;  5D3R A;  4CLB A;  3UV5 A;  5A5Q A;  4J3I A;  5LJ2 A;  5EWV A;  5L98 A;  4Q0O A;  5FBX A;  4LYS A;  5ENF A;  4BHW A;  3O35 A;  5E9K A;  3QZS A;  5KTU A;  4TZ8 A;  3GG3 A;  5EU1 A;  5LKU A;  4PTB A;  4QSU A;  5H85 A;  4LZR A;  5FG6 A;  3U5N A;  1WUM A;  4XYA A;  4UIU A;  5D3T A;  3MQM A;  4CFK A;  4OUF A;  2NXB A;  5CFW A;  5D0C A;  5FE0 A;  5G4R A;  4TT2 A;  5L8T A;  2L84 A;  5FE6 A;  4YYM A;  4QBM A;  5CUD A;  4HXS A;  4AKN A;  3O34 A;  5HRX A;  5KU3 A;  4A9H A;  4QUT A;  3MXF A;  3ZYU A;  3SVH A;  2I8N A;  4YBM A;  4YK0 A;  4NR9 A;  2DVR A;  4CUU A;  5IGL A;  5DYC A;  4IOR A;  4UIT A;  5ENE A;  5F3A A;  4HXP A;  3ONI A;  5CU8 A;  4Z1Q A;  1E6I A;  4BW2 A;  4DON A;  3K2J A;  4IR6 A;  4CUT A;  3U5O A;  4QUU A;  5TB6 A;  5F60 A;  2RNW A;  5FB0 A;  5K29 A;  2GRC A;  4N3W A;  5E74 A;  4QEU A;  2G4A A;  2WP2 A;  2YQD A;  5II1 A;  5FFV A;  3O36 A;  3U5P A;  4QSX A;  2H60 A;  5E9I A;  5DKH A;  5EGU A;  5F5Z A;  4BJX A;  4YYK A;  4MEN A;  5CP5 A;  5F1H A;  4Z6H A;  4A9K A;  4CFL A;  4CL9 A;  5A83 A;  5CGP A;  4NXJ A;  5H1T A;  2L5E A;  4LZ2 A;  5FH8 A;  4YBS A;  5FFY A;  5EPS A;  4BW1 A;  4O7A A;  5TCM A;  5DY7 A;  5H1U A;  1F68 A;  4C66 A;  5A85 A;  4TTE A;  4TYL A;  2RI7 A;  4HXO A;  5BT3 A;  5ETB A;  4ZW1 A;  4ZQL A;  5CQ7 A;  5CUE A;  5FH7 A;  5C8G A;  3IU5 A;  4XY8 A;  2YW5 A;  4OGI A;  4PKL A;  5DW2 A;  3UW9 A;  5HFQ A;  3SVF A;  5CQT A;  4O71 A;  5DFC A;  5CQ4 A;  5EM3 A;  4XUA A;  5DYU A;  3S91 A;  3AQA A;  5ENB A;  5L99 A;  5E9Y A;  4CUQ A;  3P1D A;  5F1L A;  2D82 A;  3P1F A;  1X0J A;  5II2 A;  5HLS A;  3MUL A;  5CRM A;  3LJW A;  2YEK A;  4TT4 A;  2RFJ A;  4TT6 A;  3U5L A;  4KV4 A;  2YYN A;  3Q2E A;  2RO1 A;  2E7N A;  5I1Q A;  5C7N A;  4HXM A;  5CUA A;  5IGK A;  4O7E A;  2F6J A;  4YYH A;  4NRA A;  5HEM A;  4NRB A;  4QSQ A;  5CQ8 A;  5E3G A;  3TLP A;  5FE7 A;  2MJV B;  5D3J A;  4HBW A;  4C67 A;  5AD2 A;  4A9E A;  4NR7 A;  5CZG A;  4UYD A;  2YEM A;  5HCL A;  3O37 A;  4Z6I A;  4QEV A;  3U5J A;  3UVD A;  3IU6 A;  4UYF A;  5FE9 A;  5DKD A;  4ZC9 A;  5J0D A;  4QSW A;  5LKT A;  4CUS A;  5DW1 A;  5A7C A;  4QYD A;  4O78 A;  5I7Y A;  4YYG A;  4QYL A;  4QC1 A;  4TU4 A;  4O76 A;  5EP7 A;  5FFW A;  4YY4 A;  2DVQ A;  2N9G A;  2R0V A;  2WP1 A;  5HQ6 A;  4QSS A;  5EWH A;  4UYE A;  5D3L A;  4ALG A;  5IBN A;  5E7D A;  2DAT A;  4HBX A;  4QR3 A;  2L85 A;  5CRZ A;  5L96 A;  4HXR A;  4BW4 A;  5IGM A;  5CQ3 A;  3U5K A;  5AMF A;  4YBT A;  1N72 A;  5BT5 A;  4QR5 A;  5DYA A;  2OSS A;  4HBV A;  4CUP A;  5E3D A;  1EQF A;  4FLP A;  5FE8 A;  4J0S A;  4Z93 A;  4Y03 A;  4O70 A;  4UIY A;  4HXL A;  5DYX A;  4O7C A;  4KCX A;  4A9L A;  4LYI A;  5ACY A;  3U5M A;  5HM0 A;  5CQ6 A;  5EVA A;  4NR6 A;  5I88 A;  3FKM X;  4O75 A;  4J0R A;  4UYF B;  4UYG A;  4WHW A;  5I40 A;  5CUC A;  3S92 A;  5HRV A;  5D7X A;  2RNX A;  4QSV A;  5CTL A;  4PS5 A;  3HME A;  5HQ7 A;  5LJ1 A;  5D3S A;  4TU6 A;  4O7F A;  3UV4 A;  4Z1S A;  4NQM A;  4NUE A;  5E9V A;  5JWM A;  4NQN A;  5ENH A;  5DFD A;  4N4F A;  4MR4 A;  4CUR A;  5FE2 A;  4A9I A;  5C87 A;  4LR6 A;  5I7X A;  5L97 A;  3MB4 A;  1WUG A;  4IR3 A;  5I80 A;  4YAX A;  4HXK A;  5EV9 A;  3JVM A;  4UIV A;  3P5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...