5IGLA

Crystal structure of the second bromodomain of human taf1l in complex with bromosporine (bsp)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
139
structure length
139
Chain Sequence
LGTENLYFQSMQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAKEAALEEAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription initiation factor TFIID subunit 1-like
publication title Promiscuous targeting of bromodomains by bromosporine identifies BET proteins as master regulators of primary transcription response in leukemia.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2016-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5iglA00
5CP5A 5KO4A 5C8GA 5IIDA 5CPEA 2RS9B 4KV4A 5FH8A 5AMFA 4HXMA 5FE4A 5F25A 4QEVA 5DYUA 5HQ5A 4QY4A 5DKDA 5HFRA 5FE6A 3ZYUA 5KU3A 5F62A 4QEUA 5D3NA 5E74A 3UVWA 4XUBA 4QSTA 4NUEA 4UIXA 2MJVB 4A9EA 4CLBA 5HRWA 4YYGA 4UIVA 4CURA 5A5NA 3LQHA 4QC1A 4YATA 2YEKA 5TCMA 4O75A 5EA1A 5F60A 2YEMA 3LQJA 4Z6HA 5IGLA 5A5OA 5L97A 3QZVA 3JVKA 4CFLA 5FE5A 5DLXA 2YYNA 5E9IA 1WUMA 5FH7A 4OGJA 4O7BA 4IR6A 5CZGA 5FFWA 2RI7A 5CRZA 3U5KA 5F2PA 4C66A 2I7KA 4QSWA 5A82A 3P1FA 4NUCA 5KTUA 5HELA 5ENBA 2RNWA 2RNXA 5DW2A 5FE3A 5BT4A 4ALGA 4C67A 4KCXA 2DWWA 4TU6A 4N3WA 4QSPA 5E9KA 5I1QA 5KTXA 5D3RA 5L8UA 1X0JA 5HLSA 3U5LA 4HXNA 4HXLA 4UYGA 3ONIA 5ETDA 5FB0A 4YBTA 4TT6A 3S91A 4A9IA 4ZW1A 4NUDA 4YK0A 5F1LA 4A9LA 5D3HA 2OO1A 2DATA 4HBXA 4QZSA 5EGUA 4OUFA 2L84A 4YY4A 5FH6A 5II2A 5HCLA 4NYWA 4QSRA 5E7DA 2R0VA 4NRCA 5DKCA 5D3TA 2OSSA 3GG3A 4N4GA 4MENA 4WHUA 4CUTA 5H1UA 5E3DA 3SVFA 4HXSA 3HMHA 5EV9A 4X2IA 5D7XA 4Q0OA 4QR3A 3U5JA 5F5ZA 4HBWA 5HQ7A 3DAIA 5FE9A 3UV2A 1ZS5A 5EM3A 4A9JA 4IOOA 4UYFA 5EQ1A 4YYDA 5FG4A 4QUUA 5ENCA 4BJXA 5E9YA 2N9GA 4YYJA 4GPJA 5C89A 5AMEA 4MR5A 5A7CA 5E3GA 4OGIA 5A83A 3MB4A 5EI4A 4QEWA 5FE1A 5FDZA 5K29A 2NXBA 5LJ1A 5DFCA 5F3AA 5C7NA 4MEPA 4F3IA 4BW3A 4LYSA 5CS8A 5FB1A 5LKZA 3O36A 4A9NA 5EVAA 4QSQA 4O74A 5HRVA 4BW1A 4TQNA 4LZSA 5CUGA 5II1A 5C87A 5ENFA 2DVRA 4QR4A 5FBXA 5D26A 4HXKA 4UIYA 5IBNA 5E9LA 4YBMA 3NXBA 2DVQA 5BT3A 4QSUA 5AD3A 2L85A 5HJCA 5LJ2A 5EWDA 3FKMX 5EPRA 1JM4B 2I8NA 4PY6A 5DYAA 4UIUA 5I40A 5FG5A 5DX4A 5FE0A 2FSAA 5AD2A 4J1PA 5EICA 5FE2A 4YY6A 5EU1A 4A9OA 4NR8A 4QBMA 5D3PA 5EWVA 4FLPA 4YYKA 4XY8A 5HQ6A 4Z6IA 4TZ8A 4Y03A 5F63A 4XYAA 3O33A 5EISA 5ENJA 3K2JA 3O37A 4J3IA 5EPBA 2D82A 5EP7A 4NRBA 5JWMA 5CQ4A 4TYLA 4YH4A 4BW2A 2YQDA 5DW1A 3O34A 4NR7A 3UV4A 4CUUA 3UVYA 2YDWA 4NR5A 4A9MA 5D24A 4CUPA 5HRXA 2DVSA 3LJWA 3IU5A 4IOQA 1JSPB 5CQ3A 4NR6A 4N4IA 3AADA 4O71A 5F61A 4TZ2A 5DY7A 5I29A 4HBVA 5I83A 2E7OA 5CFWA 2H60A 5DYCA 4CL9A 3UW9A 4LZRA 5I88A 5D25A 4QYLA 2R0SA 5HENA 3MQMA 1EQFA 4Z93A 4HXOA 5H1VA 5L99A 3QZTA 5FG6A 4A9FA 5F1HA 5DFBA 5I7YA 2E7NA 4Z1SA 5A5QA 4KV1A 5FE8A 5EWHA 2YELA 4N4HA 4QUTA 4O7AA 3P1CA 3SVGA 4QNSA 5CU8A 5COIA 2D9EA 3G0LA 2RNYA 3IU6A 4LYIA 5LJ0A 4LYWA 4A9HA 4UIWA 5DFDA 5G4SA 2WP1A 4IR3A 4IORA 4LC2A 5CUAA 5ACYA 5EWCA 5CGPA 5DBMA 3I3JA 5BT5A 3LQIA 5ENHA 3U5OA 4O77A 2RFJA 3MXFA 3UV5A 3SVHA 3QZSA 4TS8A 4Z1QA 4PCEA 3P1EA 5ETBA 4E96A 5L96A 3P5OA 2L5EA 2DVVA 5DYXA 4NYVA 5KTWA 4YH3A 4YAXA 4DONA 4PKLA 3DWYA 5DLZA 5A5RA 5JI8A 3G0JA 4CUQA 2KTBB 4RVRA 5D3LA 4MR4A 5CQ7A 5CTLA 5FFYA 4QYDA 4O7CA 5EPSA 2RO1A 5DKHA 3U5NA 4CUSA 4BHWA 4YBSA 5J0DA 5I7XA 5ENGA 5ENIA 3MB3A 3U5MA 5HFQA 4CFKA 4PCIA 5KHMA 1WUGA 4YADA 3UVDA 4NR9A 3U5PA 2DKWA 2YW5A 4QB3A 4LDFA 4O70A 2WP2A 4QSXA 4LRGA 3TLPA 4YYIA 5I86A 5CUCA 5LVRA 5HEMA 5H1TA 4UYFB 5CQ8A 3LXJA 1F68A 5E9MA 1E6IA 4XY9A 3HMFA 5A81A 5FE7A 4ZC9A 2R0YA 4NS5A 4ZQLA 4YYMA 4BW4A 3HMEA 5ENEA 4MR6A 3UVXA 5LVQA 3MUKA 2E3KA 3JVMA 5CQAA 5L8TA 5IGKA 3Q2EA 5G4RA 5IG6A 4AKNA 4J0SA 4O7FA 5C85A 4UYEA 5EK9A 4TU4A 5CRMA 4O7EA 5C4QA 5LKUA 5H85A 4MEOA 4YYNA 4UYDA 4UYHA 2GRCA 5CUEA 2F6NA 4O76A 5D0CA 5CY9A 4UIZA 5D3SA 4NR4A 4NQMA 5A5SA 5IGNA 5I89A 4IR4A 4MEQA 5CQ6A 5HM0A 4HXRA 5CUDA 5FFVA 4TTEA 4YABA 5LKXA 5E73A 4YC9A 4NQNA 5TB6A 3Q2FA 4IR5A 4QSSA 4QSVA 4ALHA 2G4AA 2R10A 2LSPB 4QR5A 4NXJA 1N72A 4TT2A 4QC3A 5CQ5A 4A9KA 4UITA 3S92A 4LR6A 4PS5A 2OUOA 4LZ2A 5E9VA 5D3JA 5E0RA 4PTBA 4HBYA 5IGMA 4YYHA 4NYXA 3AQAA 4TT4A 2F6JA 4O78A 5I80A 5F36A 4NRAA 4MR3A 4J0RA 3P1DA 3D7CA 5L98A 5CUBA 5LKTA 3MULA 5CQTA 3O35A 4HXPA 4O72A 4Q0NA 4WIVA 5LUUA 3JVJA 4N4FA 5EWWA 3RCWA 5A85A 5A5PA 4WHWA 4XUAA 3JVLA
chains in the Genus database with same CATH superfamily
5CP5A 5KO4A 5C8GA 5IIDA 5CPEA 2RS9B 4KV4A 5FH8A 3D1BA 4HXMA 5AMFA 5FE4A 5F25A 4QEVA 5DYUA 5HQ5A 4QY4A 5DKDA 5HFRA 5FE6A 3ZYUA 5KU3A 5F62A 3ERRA 4QEUA 5D3NA 5E74A 3UVWA 4XUBA 4QSTA 4NUEA 4UIXA 2MJVB 4A9EA 4CLBA 5HRWA 4YYGA 4UIVA 4CURA 5A5NA 3LQHA 4QC1A 4YATA 2YEKA 5TCMA 4O75A 5EA1A 5F60A 2YEMA 3LQJA 4Z6HA 5IGLA 5A5OA 5L97A 3QZVA 3JVKA 4CFLA 5FE5A 5DLXA 2YYNA 5E9IA 1WUMA 5FH7A 4OGJA 4O7BA 4IR6A 5CZGA 5FFWA 2RI7A 5CRZA 3U5KA 5F2PA 4C66A 2I7KA 4QSWA 5A82A 3P1FA 4NUCA 5KTUA 5HELA 5ENBA 2RNWA 2RNXA 5DW2A 5FE3A 5BT4A 4ALGA 4C67A 4KCXA 2DWWA 4TU6A 4N3WA 4QSPA 5E9KA 5I1QA 5KTXA 5D3RA 5L8UA 1X0JA 5HLSA 3U5LA 4HXNA 4HXLA 4UYGA 3ONIA 5ETDA 5FB0A 4YBTA 4TT6A 3S91A 4A9IA 4ZW1A 4NUDA 4YK0A 5F1LA 4A9LA 5D3HA 2OO1A 2DATA 4HBXA 4QZSA 3VKHA 5EGUA 4OUFA 2L84A 4YY4A 5FH6A 5II2A 5HCLA 4NYWA 4QSRA 5E7DA 2R0VA 4NRCA 5DKCA 5D3TA 2OSSA 3GG3A 4N4GA 4MENA 4WHUA 4CUTA 5H1UA 5E3DA 3SVFA 4HXSA 3HMHA 5EV9A 4X2IA 5D7XA 4Q0OA 4QR3A 3U5JA 2EJNA 5F5ZA 4HBWA 5HQ7A 3DAIA 5FE9A 3UV2A 1ZS5A 5EM3A 4A9JA 4IOOA 4AKHA 4UYFA 5EQ1A 4YYDA 5FG4A 4QUUA 5ENCA 4BJXA 5E9YA 2N9GA 4YYJA 4GPJA 5C89A 5AMEA 4MR5A 5A7CA 5E3GA 4OGIA 5A83A 3MB4A 5EI4A 4QEWA 5FE1A 5FDZA 5K29A 2NXBA 5LJ1A 5DFCA 5F3AA 5C7NA 4MEPA 4F3IA 4BW3A 4LYSA 5CS8A 5FB1A 5LKZA 3O36A 4A9NA 5EVAA 4QSQA 4O74A 5HRVA 4BW1A 4TQNA 4LZSA 5CUGA 5II1A 5C87A 5ENFA 2DVRA 4QR4A 5FBXA 5D26A 4HXKA 4AKIA 4UIYA 5IBNA 5E9LA 4YBMA 3NXBA 2DVQA 5BT3A 4QSUA 5AD3A 2L85A 5HJCA 5LJ2A 5EWDA 3FKMX 5EPRA 1JM4B 2I8NA 4PY6A 5DYAA 4UIUA 5I40A 5FG5A 5DX4A 5FE0A 2FSAA 5AD2A 4J1PA 5EICA 5FE2A 4YY6A 5EU1A 4A9OA 4NR8A 4QBMA 5D3PA 5EWVA 4FLPA 4YYKA 4XY8A 5HQ6A 4Z6IA 4TZ8A 4Y03A 5F63A 4XYAA 3O33A 5EISA 5ENJA 3K2JA 3O37A 4J3IA 5EPBA 2D82A 5EP7A 4NRBA 5JWMA 5CQ4A 4TYLA 4YH4A 4BW2A 2YQDA 5DW1A 3O34A 4NR7A 3UV4A 4CUUA 3UVYA 2YDWA 4NR5A 4A9MA 5D24A 4CUPA 5HRXA 2DVSA 3LJWA 3IU5A 4IOQA 1JSPB 5CQ3A 4NR6A 4N4IA 3AADA 4O71A 5F61A 4TZ2A 5DY7A 5I29A 4HBVA 5I83A 2E7OA 5CFWA 2H60A 5DYCA 4CL9A 3UW9A 4LZRA 5I88A 5D25A 4QYLA 2R0SA 5HENA 3MQMA 1EQFA 4Z93A 4HXOA 5H1VA 5L99A 3QZTA 5FG6A 4A9FA 5F1HA 5DFBA 5I7YA 2E7NA 4Z1SA 5A5QA 4KV1A 5FE8A 5EWHA 2YELA 4N4HA 4QUTA 4O7AA 3P1CA 3SVGA 4QNSA 5CU8A 5COIA 2D9EA 3G0LA 2RNYA 3IU6A 4LYIA 5LJ0A 4LYWA 4A9HA 4UIWA 5DFDA 5G4SA 2WP1A 4IR3A 4IORA 4LC2A 5CUAA 5ACYA 5EWCA 5CGPA 5DBMA 3I3JA 5BT5A 3LQIA 5ENHA 3U5OA 4O77A 2RFJA 3MXFA 3UV5A 3SVHA 3QZSA 4TS8A 4Z1QA 4PCEA 3P1EA 5ETBA 4E96A 5L96A 3P5OA 2L5EA 2DVVA 5DYXA 4NYVA 5KTWA 4YH3A 4YAXA 4DONA 4PKLA 3DWYA 5DLZA 5A5RA 1PUOA 5JI8A 3G0JA 4CUQA 2KTBB 4RVRA 5D3LA 4MR4A 5CQ7A 5CTLA 5FFYA 4QYDA 4O7CA 5EPSA 2RO1A 5DKHA 3U5NA 4CUSA 4BHWA 4YBSA 5J0DA 5I7XA 5ENGA 5ENIA 3MB3A 3U5MA 5HFQA 4CFKA 4PCIA 5KHMA 1WUGA 4YADA 3UVDA 4NR9A 3U5PA 4AKGA 2DKWA 2YW5A 4QB3A 4LDFA 4O70A 2WP2A 4QSXA 4LRGA 3TLPA 4YYIA 5I86A 5CUCA 5LVRA 5HEMA 5H1TA 4UYFB 5CQ8A 3LXJA 1F68A 3D1DA 5E9MA 1E6IA 4XY9A 3HMFA 5A81A 5FE7A 4ZC9A 2R0YA 4NS5A 4ZQLA 4YYMA 4BW4A 3HMEA 5ENEA 4MR6A 3UVXA 5LVQA 3MUKA 2E3KA 3JVMA 5CQAA 5L8TA 5IGKA 3Q2EA 5G4RA 5IG6A 4AKNA 4J0SA 4O7FA 5C85A 4UYEA 5EK9A 4TU4A 5CRMA 4O7EA 5C4QA 5LKUA 5H85A 4MEOA 4YYNA 4UYDA 4UYHA 2GRCA 5CUEA 2F6NA 4O76A 5D0CA 5CY9A 4UIZA 5D3SA 4NR4A 4NQMA 5A5SA 5IGNA 5I89A 4IR4A 4MEQA 5CQ6A 5HM0A 4HXRA 5CUDA 5FFVA 4TTEA 4YABA 5LKXA 5E73A 4YC9A 4NQNA 5TB6A 3Q2FA 4IR5A 4QSSA 4QSVA 4ALHA 2G4AA 2R10A 2LSPB 4QR5A 4NXJA 1N72A 4TT2A 4QC3A 5CQ5A 4A9KA 4UITA 3S92A 4LR6A 4PS5A 2OUOA 4LZ2A 5E9VA 5D3JA 5E0RA 4PTBA 4HBYA 5IGMA 4YYHA 4NYXA 3AQAA 4TT4A 2F6JA 4O78A 5I80A 5F36A 4NRAA 4AI6A 4MR3A 4J0RA 3P1DA 3D7CA 5L98A 5CUBA 5LKTA 3MULA 5CQTA 3O35A 4HXPA 4O72A 4Q0NA 3VKGA 4WIVA 5LUUA 3JVJA 4N4FA 1ZKRA 5EWWA 3RCWA 5A85A 5A5PA 4WHWA 4XUAA 3JVLA
chains in the Genus database with same CATH topology
5CP5A 5KO4A 5C8GA 5IIDA 5CPEA 2RS9B 4KV4A 5FH8A 5AMFA 4HXMA 5FE4A 5F25A 4QEVA 5DYUA 5HQ5A 4QY4A 5DKDA 5HFRA 5FE6A 3ZYUA 5KU3A 5F62A 4QEUA 5D3NA 5E74A 3UVWA 4XUBA 4QSTA 4NUEA 4UIXA 2MJVB 4A9EA 4CLBA 5HRWA 4YYGA 4UIVA 4CURA 5A5NA 3LQHA 4QC1A 4YATA 2YEKA 5TCMA 4O75A 5EA1A 5F60A 2YEMA 3LQJA 4Z6HA 5IGLA 5A5OA 5L97A 3QZVA 3JVKA 4CFLA 5FE5A 5DLXA 2YYNA 5E9IA 1WUMA 5FH7A 4OGJA 4O7BA 4IR6A 5CZGA 5FFWA 2RI7A 5CRZA 3U5KA 5F2PA 4C66A 2I7KA 4QSWA 5A82A 3P1FA 4NUCA 5KTUA 5HELA 5ENBA 2RNWA 2RNXA 5DW2A 5FE3A 5BT4A 4ALGA 4C67A 4KCXA 2DWWA 4TU6A 4N3WA 4QSPA 5E9KA 5I1QA 5KTXA 5D3RA 5L8UA 1X0JA 5HLSA 3U5LA 4HXNA 4HXLA 4UYGA 3ONIA 5ETDA 5FB0A 4YBTA 4TT6A 3S91A 4A9IA 4ZW1A 4NUDA 4YK0A 5F1LA 4A9LA 5D3HA 2OO1A 2DATA 4HBXA 4QZSA 5EGUA 4OUFA 2L84A 4YY4A 5FH6A 5II2A 5HCLA 4NYWA 4QSRA 5E7DA 2R0VA 4NRCA 5DKCA 5D3TA 2OSSA 3GG3A 4N4GA 4MENA 4WHUA 4CUTA 5H1UA 5E3DA 3SVFA 4HXSA 3HMHA 5EV9A 4X2IA 5D7XA 4Q0OA 4QR3A 3U5JA 5F5ZA 4HBWA 5HQ7A 3DAIA 5FE9A 3UV2A 1ZS5A 5EM3A 4A9JA 4IOOA 4UYFA 5EQ1A 4YYDA 5FG4A 4QUUA 5ENCA 4BJXA 5E9YA 2N9GA 4YYJA 4GPJA 5C89A 5AMEA 4MR5A 5A7CA 5E3GA 4OGIA 5A83A 3MB4A 5EI4A 4QEWA 5FE1A 5FDZA 5K29A 2NXBA 5LJ1A 5DFCA 5F3AA 5C7NA 4MEPA 4F3IA 4BW3A 4LYSA 5CS8A 5FB1A 5LKZA 3O36A 4A9NA 5EVAA 4QSQA 4O74A 5HRVA 4BW1A 4TQNA 4LZSA 5CUGA 5II1A 5C87A 5ENFA 2DVRA 4QR4A 5FBXA 5D26A 4HXKA 4UIYA 5IBNA 5E9LA 4YBMA 3NXBA 2DVQA 5BT3A 4QSUA 5AD3A 2L85A 5HJCA 5LJ2A 5EWDA 3FKMX 5EPRA 1JM4B 2I8NA 4PY6A 5DYAA 4UIUA 5I40A 5FG5A 5DX4A 5FE0A 2FSAA 5AD2A 4J1PA 5EICA 5FE2A 4YY6A 5EU1A 4A9OA 4NR8A 4QBMA 5D3PA 5EWVA 4FLPA 4YYKA 4XY8A 5HQ6A 4Z6IA 4TZ8A 4Y03A 5F63A 4XYAA 3O33A 5EISA 5ENJA 3K2JA 3O37A 4J3IA 5EPBA 2D82A 5EP7A 4NRBA 5JWMA 5CQ4A 4TYLA 4YH4A 4BW2A 2YQDA 5DW1A 3O34A 4NR7A 3UV4A 4CUUA 3UVYA 2YDWA 4NR5A 4A9MA 5D24A 4CUPA 5HRXA 2DVSA 3LJWA 3IU5A 4IOQA 1JSPB 5CQ3A 4NR6A 4N4IA 3AADA 4O71A 5F61A 4TZ2A 5DY7A 5I29A 4HBVA 5I83A 2E7OA 5CFWA 2H60A 5DYCA 4CL9A 3UW9A 4LZRA 5I88A 5D25A 4QYLA 2R0SA 5HENA 3MQMA 1EQFA 4Z93A 4HXOA 5H1VA 5L99A 3QZTA 5FG6A 4A9FA 5F1HA 5DFBA 5I7YA 2E7NA 4Z1SA 5A5QA 4KV1A 5FE8A 5EWHA 2YELA 4N4HA 4QUTA 4O7AA 3P1CA 3SVGA 4QNSA 5CU8A 5COIA 2D9EA 3G0LA 2RNYA 3IU6A 4LYIA 5LJ0A 4LYWA 4A9HA 4UIWA 5DFDA 5G4SA 2WP1A 4IR3A 4IORA 4LC2A 5CUAA 5ACYA 5EWCA 5CGPA 5DBMA 3I3JA 5BT5A 3LQIA 5ENHA 3U5OA 4O77A 2RFJA 3MXFA 3UV5A 3SVHA 3QZSA 4TS8A 4Z1QA 4PCEA 3P1EA 5ETBA 4E96A 5L96A 3P5OA 2L5EA 2DVVA 5DYXA 4NYVA 5KTWA 4YH3A 4YAXA 4DONA 4PKLA 3DWYA 5DLZA 5A5RA 5JI8A 3G0JA 4CUQA 2KTBB 4RVRA 5D3LA 4MR4A 5CQ7A 5CTLA 5FFYA 4QYDA 4O7CA 5EPSA 2RO1A 5DKHA 3U5NA 4CUSA 4BHWA 4YBSA 5J0DA 5I7XA 5ENGA 5ENIA 3MB3A 3U5MA 5HFQA 4CFKA 4PCIA 5KHMA 1WUGA 4YADA 3UVDA 4NR9A 3U5PA 2DKWA 2YW5A 4QB3A 4LDFA 4O70A 2WP2A 4QSXA 4LRGA 3TLPA 4YYIA 5I86A 5CUCA 5LVRA 5HEMA 5H1TA 4UYFB 5CQ8A 3LXJA 1F68A 5E9MA 1E6IA 4XY9A 3HMFA 5A81A 5FE7A 4ZC9A 2R0YA 4NS5A 4ZQLA 4YYMA 4BW4A 3HMEA 5ENEA 4MR6A 3UVXA 5LVQA 3MUKA 2E3KA 3JVMA 5CQAA 5L8TA 5IGKA 3Q2EA 5G4RA 5IG6A 4AKNA 4J0SA 4O7FA 5C85A 4UYEA 5EK9A 4TU4A 5CRMA 4O7EA 5C4QA 5LKUA 5H85A 4MEOA 4YYNA 4UYDA 4UYHA 2GRCA 5CUEA 2F6NA 4O76A 5D0CA 5CY9A 4UIZA 5D3SA 4NR4A 4NQMA 5A5SA 5IGNA 5I89A 4IR4A 4MEQA 5CQ6A 5HM0A 4HXRA 5CUDA 5FFVA 4TTEA 4YABA 5LKXA 5E73A 4YC9A 4NQNA 5TB6A 3Q2FA 4IR5A 4QSSA 4QSVA 4ALHA 2G4AA 2R10A 2LSPB 4QR5A 4NXJA 1N72A 4TT2A 4QC3A 5CQ5A 4A9KA 4UITA 3S92A 4LR6A 4PS5A 2OUOA 4LZ2A 5E9VA 5D3JA 5E0RA 4PTBA 4HBYA 5IGMA 4YYHA 4NYXA 3AQAA 4TT4A 2F6JA 4O78A 5I80A 5F36A 4NRAA 4MR3A 4J0RA 3P1DA 3D7CA 5L98A 5CUBA 5LKTA 3MULA 5CQTA 3O35A 4HXPA 4O72A 4Q0NA 4WIVA 5LUUA 3JVJA 4N4FA 5EWWA 3RCWA 5A85A 5A5PA 4WHWA 4XUAA 3JVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP5 A;  5KO4 A;  5C8G A;  5IID A;  5CPE A;  2RS9 B;  4KV4 A;  5FH8 A;  5AMF A;  4HXM A;  5FE4 A;  5F25 A;  4QEV A;  5DYU A;  5HQ5 A;  4QY4 A;  5DKD A;  5HFR A;  5FE6 A;  3ZYU A;  5KU3 A;  5F62 A;  4QEU A;  5D3N A;  5E74 A;  3UVW A;  4XUB A;  4QST A;  4NUE A;  4UIX A;  2MJV B;  4A9E A;  4CLB A;  5HRW A;  4YYG A;  4UIV A;  4CUR A;  5A5N A;  3LQH A;  4QC1 A;  4YAT A;  2YEK A;  5TCM A;  4O75 A;  5EA1 A;  5F60 A;  2YEM A;  3LQJ A;  4Z6H A;  5IGL A;  5A5O A;  5L97 A;  3QZV A;  3JVK A;  4CFL A;  5FE5 A;  5DLX A;  2YYN A;  5E9I A;  1WUM A;  5FH7 A;  4OGJ A;  4O7B A;  4IR6 A;  5CZG A;  5FFW A;  2RI7 A;  5CRZ A;  3U5K A;  5F2P A;  4C66 A;  2I7K A;  4QSW A;  5A82 A;  3P1F A;  4NUC A;  5KTU A;  5HEL A;  5ENB A;  2RNW A;  2RNX A;  5DW2 A;  5FE3 A;  5BT4 A;  4ALG A;  4C67 A;  4KCX A;  2DWW A;  4TU6 A;  4N3W A;  4QSP A;  5E9K A;  5I1Q A;  5KTX A;  5D3R A;  5L8U A;  1X0J A;  5HLS A;  3U5L A;  4HXN A;  4HXL A;  4UYG A;  3ONI A;  5ETD A;  5FB0 A;  4YBT A;  4TT6 A;  3S91 A;  4A9I A;  4ZW1 A;  4NUD A;  4YK0 A;  5F1L A;  4A9L A;  5D3H A;  2OO1 A;  2DAT A;  4HBX A;  4QZS A;  5EGU A;  4OUF A;  2L84 A;  4YY4 A;  5FH6 A;  5II2 A;  5HCL A;  4NYW A;  4QSR A;  5E7D A;  2R0V A;  4NRC A;  5DKC A;  5D3T A;  2OSS A;  3GG3 A;  4N4G A;  4MEN A;  4WHU A;  4CUT A;  5H1U A;  5E3D A;  3SVF A;  4HXS A;  3HMH A;  5EV9 A;  4X2I A;  5D7X A;  4Q0O A;  4QR3 A;  3U5J A;  5F5Z A;  4HBW A;  5HQ7 A;  3DAI A;  5FE9 A;  3UV2 A;  1ZS5 A;  5EM3 A;  4A9J A;  4IOO A;  4UYF A;  5EQ1 A;  4YYD A;  5FG4 A;  4QUU A;  5ENC A;  4BJX A;  5E9Y A;  2N9G A;  4YYJ A;  4GPJ A;  5C89 A;  5AME A;  4MR5 A;  5A7C A;  5E3G A;  4OGI A;  5A83 A;  3MB4 A;  5EI4 A;  4QEW A;  5FE1 A;  5FDZ A;  5K29 A;  2NXB A;  5LJ1 A;  5DFC A;  5F3A A;  5C7N A;  4MEP A;  4F3I A;  4BW3 A;  4LYS A;  5CS8 A;  5FB1 A;  5LKZ A;  3O36 A;  4A9N A;  5EVA A;  4QSQ A;  4O74 A;  5HRV A;  4BW1 A;  4TQN A;  4LZS A;  5CUG A;  5II1 A;  5C87 A;  5ENF A;  2DVR A;  4QR4 A;  5FBX A;  5D26 A;  4HXK A;  4UIY A;  5IBN A;  5E9L A;  4YBM A;  3NXB A;  2DVQ A;  5BT3 A;  4QSU A;  5AD3 A;  2L85 A;  5HJC A;  5LJ2 A;  5EWD A;  3FKM X;  5EPR A;  1JM4 B;  2I8N A;  4PY6 A;  5DYA A;  4UIU A;  5I40 A;  5FG5 A;  5DX4 A;  5FE0 A;  2FSA A;  5AD2 A;  4J1P A;  5EIC A;  5FE2 A;  4YY6 A;  5EU1 A;  4A9O A;  4NR8 A;  4QBM A;  5D3P A;  5EWV A;  4FLP A;  4YYK A;  4XY8 A;  5HQ6 A;  4Z6I A;  4TZ8 A;  4Y03 A;  5F63 A;  4XYA A;  3O33 A;  5EIS A;  5ENJ A;  3K2J A;  3O37 A;  4J3I A;  5EPB A;  2D82 A;  5EP7 A;  4NRB A;  5JWM A;  5CQ4 A;  4TYL A;  4YH4 A;  4BW2 A;  2YQD A;  5DW1 A;  3O34 A;  4NR7 A;  3UV4 A;  4CUU A;  3UVY A;  2YDW A;  4NR5 A;  4A9M A;  5D24 A;  4CUP A;  5HRX A;  2DVS A;  3LJW A;  3IU5 A;  4IOQ A;  1JSP B;  5CQ3 A;  4NR6 A;  4N4I A;  3AAD A;  4O71 A;  5F61 A;  4TZ2 A;  5DY7 A;  5I29 A;  4HBV A;  5I83 A;  2E7O A;  5CFW A;  2H60 A;  5DYC A;  4CL9 A;  3UW9 A;  4LZR A;  5I88 A;  5D25 A;  4QYL A;  2R0S A;  5HEN A;  3MQM A;  1EQF A;  4Z93 A;  4HXO A;  5H1V A;  5L99 A;  3QZT A;  5FG6 A;  4A9F A;  5F1H A;  5DFB A;  5I7Y A;  2E7N A;  4Z1S A;  5A5Q A;  4KV1 A;  5FE8 A;  5EWH A;  2YEL A;  4N4H A;  4QUT A;  4O7A A;  3P1C A;  3SVG A;  4QNS A;  5CU8 A;  5COI A;  2D9E A;  3G0L A;  2RNY A;  3IU6 A;  4LYI A;  5LJ0 A;  4LYW A;  4A9H A;  4UIW A;  5DFD A;  5G4S A;  2WP1 A;  4IR3 A;  4IOR A;  4LC2 A;  5CUA A;  5ACY A;  5EWC A;  5CGP A;  5DBM A;  3I3J A;  5BT5 A;  3LQI A;  5ENH A;  3U5O A;  4O77 A;  2RFJ A;  3MXF A;  3UV5 A;  3SVH A;  3QZS A;  4TS8 A;  4Z1Q A;  4PCE A;  3P1E A;  5ETB A;  4E96 A;  5L96 A;  3P5O A;  2L5E A;  2DVV A;  5DYX A;  4NYV A;  5KTW A;  4YH3 A;  4YAX A;  4DON A;  4PKL A;  3DWY A;  5DLZ A;  5A5R A;  5JI8 A;  3G0J A;  4CUQ A;  2KTB B;  4RVR A;  5D3L A;  4MR4 A;  5CQ7 A;  5CTL A;  5FFY A;  4QYD A;  4O7C A;  5EPS A;  2RO1 A;  5DKH A;  3U5N A;  4CUS A;  4BHW A;  4YBS A;  5J0D A;  5I7X A;  5ENG A;  5ENI A;  3MB3 A;  3U5M A;  5HFQ A;  4CFK A;  4PCI A;  5KHM A;  1WUG A;  4YAD A;  3UVD A;  4NR9 A;  3U5P A;  2DKW A;  2YW5 A;  4QB3 A;  4LDF A;  4O70 A;  2WP2 A;  4QSX A;  4LRG A;  3TLP A;  4YYI A;  5I86 A;  5CUC A;  5LVR A;  5HEM A;  5H1T A;  4UYF B;  5CQ8 A;  3LXJ A;  1F68 A;  5E9M A;  1E6I A;  4XY9 A;  3HMF A;  5A81 A;  5FE7 A;  4ZC9 A;  2R0Y A;  4NS5 A;  4ZQL A;  4YYM A;  4BW4 A;  3HME A;  5ENE A;  4MR6 A;  3UVX A;  5LVQ A;  3MUK A;  2E3K A;  3JVM A;  5CQA A;  5L8T A;  5IGK A;  3Q2E A;  5G4R A;  5IG6 A;  4AKN A;  4J0S A;  4O7F A;  5C85 A;  4UYE A;  5EK9 A;  4TU4 A;  5CRM A;  4O7E A;  5C4Q A;  5LKU A;  5H85 A;  4MEO A;  4YYN A;  4UYD A;  4UYH A;  2GRC A;  5CUE A;  2F6N A;  4O76 A;  5D0C A;  5CY9 A;  4UIZ A;  5D3S A;  4NR4 A;  4NQM A;  5A5S A;  5IGN A;  5I89 A;  4IR4 A;  4MEQ A;  5CQ6 A;  5HM0 A;  4HXR A;  5CUD A;  5FFV A;  4TTE A;  4YAB A;  5LKX A;  5E73 A;  4YC9 A;  4NQN A;  5TB6 A;  3Q2F A;  4IR5 A;  4QSS A;  4QSV A;  4ALH A;  2G4A A;  2R10 A;  2LSP B;  4QR5 A;  4NXJ A;  1N72 A;  4TT2 A;  4QC3 A;  5CQ5 A;  4A9K A;  4UIT A;  3S92 A;  4LR6 A;  4PS5 A;  2OUO A;  4LZ2 A;  5E9V A;  5D3J A;  5E0R A;  4PTB A;  4HBY A;  5IGM A;  4YYH A;  4NYX A;  3AQA A;  4TT4 A;  2F6J A;  4O78 A;  5I80 A;  5F36 A;  4NRA A;  4MR3 A;  4J0R A;  3P1D A;  3D7C A;  5L98 A;  5CUB A;  5LKT A;  3MUL A;  5CQT A;  3O35 A;  4HXP A;  4O72 A;  4Q0N A;  4WIV A;  5LUU A;  3JVJ A;  4N4F A;  5EWW A;  3RCW A;  5A85 A;  5A5P A;  4WHW A;  4XUA A;  3JVL A; 
#chains in the Genus database with same CATH topology
 5CP5 A;  5KO4 A;  5C8G A;  5IID A;  5CPE A;  2RS9 B;  4KV4 A;  5FH8 A;  3D1B A;  4HXM A;  5AMF A;  5FE4 A;  5F25 A;  4QEV A;  5DYU A;  5HQ5 A;  4QY4 A;  5DKD A;  5HFR A;  5FE6 A;  3ZYU A;  5KU3 A;  5F62 A;  3ERR A;  4QEU A;  5D3N A;  5E74 A;  3UVW A;  4XUB A;  4QST A;  4NUE A;  4UIX A;  2MJV B;  4A9E A;  4CLB A;  5HRW A;  4YYG A;  4UIV A;  4CUR A;  5A5N A;  3LQH A;  4QC1 A;  4YAT A;  2YEK A;  5TCM A;  4O75 A;  5EA1 A;  5F60 A;  2YEM A;  3LQJ A;  4Z6H A;  5IGL A;  5A5O A;  5L97 A;  3QZV A;  3JVK A;  4CFL A;  5FE5 A;  5DLX A;  2YYN A;  5E9I A;  1WUM A;  5FH7 A;  4OGJ A;  4O7B A;  4IR6 A;  5CZG A;  5FFW A;  2RI7 A;  5CRZ A;  3U5K A;  5F2P A;  4C66 A;  2I7K A;  4QSW A;  5A82 A;  3P1F A;  4NUC A;  5KTU A;  5HEL A;  5ENB A;  2RNW A;  2RNX A;  5DW2 A;  5FE3 A;  5BT4 A;  4ALG A;  4C67 A;  4KCX A;  2DWW A;  4TU6 A;  4N3W A;  4QSP A;  5E9K A;  5I1Q A;  5KTX A;  5D3R A;  5L8U A;  1X0J A;  5HLS A;  3U5L A;  4HXN A;  4HXL A;  4UYG A;  3ONI A;  5ETD A;  5FB0 A;  4YBT A;  4TT6 A;  3S91 A;  4A9I A;  4ZW1 A;  4NUD A;  4YK0 A;  5F1L A;  4A9L A;  5D3H A;  2OO1 A;  2DAT A;  4HBX A;  4QZS A;  3VKH A;  5EGU A;  4OUF A;  2L84 A;  4YY4 A;  5FH6 A;  5II2 A;  5HCL A;  4NYW A;  4QSR A;  5E7D A;  2R0V A;  4NRC A;  5DKC A;  5D3T A;  2OSS A;  3GG3 A;  4N4G A;  4MEN A;  4WHU A;  4CUT A;  5H1U A;  5E3D A;  3SVF A;  4HXS A;  3HMH A;  5EV9 A;  4X2I A;  5D7X A;  4Q0O A;  4QR3 A;  3U5J A;  2EJN A;  5F5Z A;  4HBW A;  5HQ7 A;  3DAI A;  5FE9 A;  3UV2 A;  1ZS5 A;  5EM3 A;  4A9J A;  4IOO A;  4AKH A;  4UYF A;  5EQ1 A;  4YYD A;  5FG4 A;  4QUU A;  5ENC A;  4BJX A;  5E9Y A;  2N9G A;  4YYJ A;  4GPJ A;  5C89 A;  5AME A;  4MR5 A;  5A7C A;  5E3G A;  4OGI A;  5A83 A;  3MB4 A;  5EI4 A;  4QEW A;  5FE1 A;  5FDZ A;  5K29 A;  2NXB A;  5LJ1 A;  5DFC A;  5F3A A;  5C7N A;  4MEP A;  4F3I A;  4BW3 A;  4LYS A;  5CS8 A;  5FB1 A;  5LKZ A;  3O36 A;  4A9N A;  5EVA A;  4QSQ A;  4O74 A;  5HRV A;  4BW1 A;  4TQN A;  4LZS A;  5CUG A;  5II1 A;  5C87 A;  5ENF A;  2DVR A;  4QR4 A;  5FBX A;  5D26 A;  4HXK A;  4AKI A;  4UIY A;  5IBN A;  5E9L A;  4YBM A;  3NXB A;  2DVQ A;  5BT3 A;  4QSU A;  5AD3 A;  2L85 A;  5HJC A;  5LJ2 A;  5EWD A;  3FKM X;  5EPR A;  1JM4 B;  2I8N A;  4PY6 A;  5DYA A;  4UIU A;  5I40 A;  5FG5 A;  5DX4 A;  5FE0 A;  2FSA A;  5AD2 A;  4J1P A;  5EIC A;  5FE2 A;  4YY6 A;  5EU1 A;  4A9O A;  4NR8 A;  4QBM A;  5D3P A;  5EWV A;  4FLP A;  4YYK A;  4XY8 A;  5HQ6 A;  4Z6I A;  4TZ8 A;  4Y03 A;  5F63 A;  4XYA A;  3O33 A;  5EIS A;  5ENJ A;  3K2J A;  3O37 A;  4J3I A;  5EPB A;  2D82 A;  5EP7 A;  4NRB A;  5JWM A;  5CQ4 A;  4TYL A;  4YH4 A;  4BW2 A;  2YQD A;  5DW1 A;  3O34 A;  4NR7 A;  3UV4 A;  4CUU A;  3UVY A;  2YDW A;  4NR5 A;  4A9M A;  5D24 A;  4CUP A;  5HRX A;  2DVS A;  3LJW A;  3IU5 A;  4IOQ A;  1JSP B;  5CQ3 A;  4NR6 A;  4N4I A;  3AAD A;  4O71 A;  5F61 A;  4TZ2 A;  5DY7 A;  5I29 A;  4HBV A;  5I83 A;  2E7O A;  5CFW A;  2H60 A;  5DYC A;  4CL9 A;  3UW9 A;  4LZR A;  5I88 A;  5D25 A;  4QYL A;  2R0S A;  5HEN A;  3MQM A;  1EQF A;  4Z93 A;  4HXO A;  5H1V A;  5L99 A;  3QZT A;  5FG6 A;  4A9F A;  5F1H A;  5DFB A;  5I7Y A;  2E7N A;  4Z1S A;  5A5Q A;  4KV1 A;  5FE8 A;  5EWH A;  2YEL A;  4N4H A;  4QUT A;  4O7A A;  3P1C A;  3SVG A;  4QNS A;  5CU8 A;  5COI A;  2D9E A;  3G0L A;  2RNY A;  3IU6 A;  4LYI A;  5LJ0 A;  4LYW A;  4A9H A;  4UIW A;  5DFD A;  5G4S A;  2WP1 A;  4IR3 A;  4IOR A;  4LC2 A;  5CUA A;  5ACY A;  5EWC A;  5CGP A;  5DBM A;  3I3J A;  5BT5 A;  3LQI A;  5ENH A;  3U5O A;  4O77 A;  2RFJ A;  3MXF A;  3UV5 A;  3SVH A;  3QZS A;  4TS8 A;  4Z1Q A;  4PCE A;  3P1E A;  5ETB A;  4E96 A;  5L96 A;  3P5O A;  2L5E A;  2DVV A;  5DYX A;  4NYV A;  5KTW A;  4YH3 A;  4YAX A;  4DON A;  4PKL A;  3DWY A;  5DLZ A;  5A5R A;  1PUO A;  5JI8 A;  3G0J A;  4CUQ A;  2KTB B;  4RVR A;  5D3L A;  4MR4 A;  5CQ7 A;  5CTL A;  5FFY A;  4QYD A;  4O7C A;  5EPS A;  2RO1 A;  5DKH A;  3U5N A;  4CUS A;  4BHW A;  4YBS A;  5J0D A;  5I7X A;  5ENG A;  5ENI A;  3MB3 A;  3U5M A;  5HFQ A;  4CFK A;  4PCI A;  5KHM A;  1WUG A;  4YAD A;  3UVD A;  4NR9 A;  3U5P A;  4AKG A;  2DKW A;  2YW5 A;  4QB3 A;  4LDF A;  4O70 A;  2WP2 A;  4QSX A;  4LRG A;  3TLP A;  4YYI A;  5I86 A;  5CUC A;  5LVR A;  5HEM A;  5H1T A;  4UYF B;  5CQ8 A;  3LXJ A;  1F68 A;  3D1D A;  5E9M A;  1E6I A;  4XY9 A;  3HMF A;  5A81 A;  5FE7 A;  4ZC9 A;  2R0Y A;  4NS5 A;  4ZQL A;  4YYM A;  4BW4 A;  3HME A;  5ENE A;  4MR6 A;  3UVX A;  5LVQ A;  3MUK A;  2E3K A;  3JVM A;  5CQA A;  5L8T A;  5IGK A;  3Q2E A;  5G4R A;  5IG6 A;  4AKN A;  4J0S A;  4O7F A;  5C85 A;  4UYE A;  5EK9 A;  4TU4 A;  5CRM A;  4O7E A;  5C4Q A;  5LKU A;  5H85 A;  4MEO A;  4YYN A;  4UYD A;  4UYH A;  2GRC A;  5CUE A;  2F6N A;  4O76 A;  5D0C A;  5CY9 A;  4UIZ A;  5D3S A;  4NR4 A;  4NQM A;  5A5S A;  5IGN A;  5I89 A;  4IR4 A;  4MEQ A;  5CQ6 A;  5HM0 A;  4HXR A;  5CUD A;  5FFV A;  4TTE A;  4YAB A;  5LKX A;  5E73 A;  4YC9 A;  4NQN A;  5TB6 A;  3Q2F A;  4IR5 A;  4QSS A;  4QSV A;  4ALH A;  2G4A A;  2R10 A;  2LSP B;  4QR5 A;  4NXJ A;  1N72 A;  4TT2 A;  4QC3 A;  5CQ5 A;  4A9K A;  4UIT A;  3S92 A;  4LR6 A;  4PS5 A;  2OUO A;  4LZ2 A;  5E9V A;  5D3J A;  5E0R A;  4PTB A;  4HBY A;  5IGM A;  4YYH A;  4NYX A;  3AQA A;  4TT4 A;  2F6J A;  4O78 A;  5I80 A;  5F36 A;  4NRA A;  4AI6 A;  4MR3 A;  4J0R A;  3P1D A;  3D7C A;  5L98 A;  5CUB A;  5LKT A;  3MUL A;  5CQT A;  3O35 A;  4HXP A;  4O72 A;  4Q0N A;  3VKG A;  4WIV A;  5LUU A;  3JVJ A;  4N4F A;  1ZKR A;  5EWW A;  3RCW A;  5A85 A;  5A5P A;  4WHW A;  4XUA A;  3JVL A; 
#chains in the Genus database with same CATH homology
 5CP5 A;  5KO4 A;  5C8G A;  5IID A;  5CPE A;  2RS9 B;  4KV4 A;  5FH8 A;  5AMF A;  4HXM A;  5FE4 A;  5F25 A;  4QEV A;  5DYU A;  5HQ5 A;  4QY4 A;  5DKD A;  5HFR A;  5FE6 A;  3ZYU A;  5KU3 A;  5F62 A;  4QEU A;  5D3N A;  5E74 A;  3UVW A;  4XUB A;  4QST A;  4NUE A;  4UIX A;  2MJV B;  4A9E A;  4CLB A;  5HRW A;  4YYG A;  4UIV A;  4CUR A;  5A5N A;  3LQH A;  4QC1 A;  4YAT A;  2YEK A;  5TCM A;  4O75 A;  5EA1 A;  5F60 A;  2YEM A;  3LQJ A;  4Z6H A;  5IGL A;  5A5O A;  5L97 A;  3QZV A;  3JVK A;  4CFL A;  5FE5 A;  5DLX A;  2YYN A;  5E9I A;  1WUM A;  5FH7 A;  4OGJ A;  4O7B A;  4IR6 A;  5CZG A;  5FFW A;  2RI7 A;  5CRZ A;  3U5K A;  5F2P A;  4C66 A;  2I7K A;  4QSW A;  5A82 A;  3P1F A;  4NUC A;  5KTU A;  5HEL A;  5ENB A;  2RNW A;  2RNX A;  5DW2 A;  5FE3 A;  5BT4 A;  4ALG A;  4C67 A;  4KCX A;  2DWW A;  4TU6 A;  4N3W A;  4QSP A;  5E9K A;  5I1Q A;  5KTX A;  5D3R A;  5L8U A;  1X0J A;  5HLS A;  3U5L A;  4HXN A;  4HXL A;  4UYG A;  3ONI A;  5ETD A;  5FB0 A;  4YBT A;  4TT6 A;  3S91 A;  4A9I A;  4ZW1 A;  4NUD A;  4YK0 A;  5F1L A;  4A9L A;  5D3H A;  2OO1 A;  2DAT A;  4HBX A;  4QZS A;  5EGU A;  4OUF A;  2L84 A;  4YY4 A;  5FH6 A;  5II2 A;  5HCL A;  4NYW A;  4QSR A;  5E7D A;  2R0V A;  4NRC A;  5DKC A;  5D3T A;  2OSS A;  3GG3 A;  4N4G A;  4MEN A;  4WHU A;  4CUT A;  5H1U A;  5E3D A;  3SVF A;  4HXS A;  3HMH A;  5EV9 A;  4X2I A;  5D7X A;  4Q0O A;  4QR3 A;  3U5J A;  5F5Z A;  4HBW A;  5HQ7 A;  3DAI A;  5FE9 A;  3UV2 A;  1ZS5 A;  5EM3 A;  4A9J A;  4IOO A;  4UYF A;  5EQ1 A;  4YYD A;  5FG4 A;  4QUU A;  5ENC A;  4BJX A;  5E9Y A;  2N9G A;  4YYJ A;  4GPJ A;  5C89 A;  5AME A;  4MR5 A;  5A7C A;  5E3G A;  4OGI A;  5A83 A;  3MB4 A;  5EI4 A;  4QEW A;  5FE1 A;  5FDZ A;  5K29 A;  2NXB A;  5LJ1 A;  5DFC A;  5F3A A;  5C7N A;  4MEP A;  4F3I A;  4BW3 A;  4LYS A;  5CS8 A;  5FB1 A;  5LKZ A;  3O36 A;  4A9N A;  5EVA A;  4QSQ A;  4O74 A;  5HRV A;  4BW1 A;  4TQN A;  4LZS A;  5CUG A;  5II1 A;  5C87 A;  5ENF A;  2DVR A;  4QR4 A;  5FBX A;  5D26 A;  4HXK A;  4UIY A;  5IBN A;  5E9L A;  4YBM A;  3NXB A;  2DVQ A;  5BT3 A;  4QSU A;  5AD3 A;  2L85 A;  5HJC A;  5LJ2 A;  5EWD A;  3FKM X;  5EPR A;  1JM4 B;  2I8N A;  4PY6 A;  5DYA A;  4UIU A;  5I40 A;  5FG5 A;  5DX4 A;  5FE0 A;  2FSA A;  5AD2 A;  4J1P A;  5EIC A;  5FE2 A;  4YY6 A;  5EU1 A;  4A9O A;  4NR8 A;  4QBM A;  5D3P A;  5EWV A;  4FLP A;  4YYK A;  4XY8 A;  5HQ6 A;  4Z6I A;  4TZ8 A;  4Y03 A;  5F63 A;  4XYA A;  3O33 A;  5EIS A;  5ENJ A;  3K2J A;  3O37 A;  4J3I A;  5EPB A;  2D82 A;  5EP7 A;  4NRB A;  5JWM A;  5CQ4 A;  4TYL A;  4YH4 A;  4BW2 A;  2YQD A;  5DW1 A;  3O34 A;  4NR7 A;  3UV4 A;  4CUU A;  3UVY A;  2YDW A;  4NR5 A;  4A9M A;  5D24 A;  4CUP A;  5HRX A;  2DVS A;  3LJW A;  3IU5 A;  4IOQ A;  1JSP B;  5CQ3 A;  4NR6 A;  4N4I A;  3AAD A;  4O71 A;  5F61 A;  4TZ2 A;  5DY7 A;  5I29 A;  4HBV A;  5I83 A;  2E7O A;  5CFW A;  2H60 A;  5DYC A;  4CL9 A;  3UW9 A;  4LZR A;  5I88 A;  5D25 A;  4QYL A;  2R0S A;  5HEN A;  3MQM A;  1EQF A;  4Z93 A;  4HXO A;  5H1V A;  5L99 A;  3QZT A;  5FG6 A;  4A9F A;  5F1H A;  5DFB A;  5I7Y A;  2E7N A;  4Z1S A;  5A5Q A;  4KV1 A;  5FE8 A;  5EWH A;  2YEL A;  4N4H A;  4QUT A;  4O7A A;  3P1C A;  3SVG A;  4QNS A;  5CU8 A;  5COI A;  2D9E A;  3G0L A;  2RNY A;  3IU6 A;  4LYI A;  5LJ0 A;  4LYW A;  4A9H A;  4UIW A;  5DFD A;  5G4S A;  2WP1 A;  4IR3 A;  4IOR A;  4LC2 A;  5CUA A;  5ACY A;  5EWC A;  5CGP A;  5DBM A;  3I3J A;  5BT5 A;  3LQI A;  5ENH A;  3U5O A;  4O77 A;  2RFJ A;  3MXF A;  3UV5 A;  3SVH A;  3QZS A;  4TS8 A;  4Z1Q A;  4PCE A;  3P1E A;  5ETB A;  4E96 A;  5L96 A;  3P5O A;  2L5E A;  2DVV A;  5DYX A;  4NYV A;  5KTW A;  4YH3 A;  4YAX A;  4DON A;  4PKL A;  3DWY A;  5DLZ A;  5A5R A;  5JI8 A;  3G0J A;  4CUQ A;  2KTB B;  4RVR A;  5D3L A;  4MR4 A;  5CQ7 A;  5CTL A;  5FFY A;  4QYD A;  4O7C A;  5EPS A;  2RO1 A;  5DKH A;  3U5N A;  4CUS A;  4BHW A;  4YBS A;  5J0D A;  5I7X A;  5ENG A;  5ENI A;  3MB3 A;  3U5M A;  5HFQ A;  4CFK A;  4PCI A;  5KHM A;  1WUG A;  4YAD A;  3UVD A;  4NR9 A;  3U5P A;  2DKW A;  2YW5 A;  4QB3 A;  4LDF A;  4O70 A;  2WP2 A;  4QSX A;  4LRG A;  3TLP A;  4YYI A;  5I86 A;  5CUC A;  5LVR A;  5HEM A;  5H1T A;  4UYF B;  5CQ8 A;  3LXJ A;  1F68 A;  5E9M A;  1E6I A;  4XY9 A;  3HMF A;  5A81 A;  5FE7 A;  4ZC9 A;  2R0Y A;  4NS5 A;  4ZQL A;  4YYM A;  4BW4 A;  3HME A;  5ENE A;  4MR6 A;  3UVX A;  5LVQ A;  3MUK A;  2E3K A;  3JVM A;  5CQA A;  5L8T A;  5IGK A;  3Q2E A;  5G4R A;  5IG6 A;  4AKN A;  4J0S A;  4O7F A;  5C85 A;  4UYE A;  5EK9 A;  4TU4 A;  5CRM A;  4O7E A;  5C4Q A;  5LKU A;  5H85 A;  4MEO A;  4YYN A;  4UYD A;  4UYH A;  2GRC A;  5CUE A;  2F6N A;  4O76 A;  5D0C A;  5CY9 A;  4UIZ A;  5D3S A;  4NR4 A;  4NQM A;  5A5S A;  5IGN A;  5I89 A;  4IR4 A;  4MEQ A;  5CQ6 A;  5HM0 A;  4HXR A;  5CUD A;  5FFV A;  4TTE A;  4YAB A;  5LKX A;  5E73 A;  4YC9 A;  4NQN A;  5TB6 A;  3Q2F A;  4IR5 A;  4QSS A;  4QSV A;  4ALH A;  2G4A A;  2R10 A;  2LSP B;  4QR5 A;  4NXJ A;  1N72 A;  4TT2 A;  4QC3 A;  5CQ5 A;  4A9K A;  4UIT A;  3S92 A;  4LR6 A;  4PS5 A;  2OUO A;  4LZ2 A;  5E9V A;  5D3J A;  5E0R A;  4PTB A;  4HBY A;  5IGM A;  4YYH A;  4NYX A;  3AQA A;  4TT4 A;  2F6J A;  4O78 A;  5I80 A;  5F36 A;  4NRA A;  4MR3 A;  4J0R A;  3P1D A;  3D7C A;  5L98 A;  5CUB A;  5LKT A;  3MUL A;  5CQT A;  3O35 A;  4HXP A;  4O72 A;  4Q0N A;  4WIV A;  5LUU A;  3JVJ A;  4N4F A;  5EWW A;  3RCW A;  5A85 A;  5A5P A;  4WHW A;  4XUA A;  3JVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...