5IGNA

Crystal structure of human brd9 bromodomain in complex with lp99 chemical probe
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 9
publication title Crystal structure of BRD9 bromodomain in complex with LP99 chemical probe
rcsb
source organism Homo sapiens
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ignA00
5FE2A 4XYAA 4TU6A 3D7CA 5I40A 3JVKA 4NYVA 3S91A 4MEQA 3MULA 4MEOA 5A85A 2L84A 2RNXA 5ENFA 2RO1A 3HMHA 5DFCA 5EGUA 5CQ5A 2NXBA 3MQMA 4N4FA 5F1LA 2YQDA 3Q2EA 4PS5A 4Q0OA 3Q2FA 4YBTA 4BW2A 2R10A 4CFKA 5L98A 4NQNA 5LKXA 5BT5A 5IGMA 2RNWA 4N4IA 2YEKA 5CU8A 4YH4A 3ONIA 3P1CA 4Q0NA 5CUBA 4Z1QA 4CFLA 1N72A 3DAIA 4UIYA 4O75A 4QUUA 4UYGA 4IR5A 4A9EA 4TT2A 4QEWA 5C89A 3QZTA 5CZGA 5H1VA 4TYLA 4QSSA 5AMEA 5ENJA 5D3SA 5DYAA 2R0VA 4CUPA 4ZW1A 5IGNA 5IG6A 5J0DA 5F5ZA 5EM3A 5FE6A 4F3IA 5LJ0A 4CUUA 5EA1A 4NR6A 5LVRA 1JM4B 4TT4A 4J3IA 2R0YA 4QSQA 2N9GA 2OO1A 4QZSA 5LVQA 5E9KA 2RFJA 4PCIA 5A83A 5F36A 4HBXA 4BW1A 3O34A 5H1UA 4A9HA 4QSVA 4LZSA 4YYHA 4YY4A 4LC2A 4LRGA 4O7EA 5I29A 4NR5A 1ZS5A 5DFBA 2DVSA 4TS8A 5EVAA 3UV2A 2OUOA 4HBWA 5A5SA 4XY9A 5II1A 4TTEA 5L8TA 3U5MA 5E9IA 5CUEA 4A9LA 5ENIA 3IU6A 5EWVA 4O78A 5I88A 5ETBA 5HRXA 5K29A 5F25A 5CRMA 5DKHA 5F63A 4CURA 5CY9A 4C67A 3QZSA 5HQ7A 3MXFA 3NXBA 5DLZA 5CQ3A 3UVYA 5DBMA 4YYKA 3QZVA 5EWCA 2R0SA 5DYCA 2G4AA 4HXRA 4AKNA 5EQ1A 4KV4A 5EPBA 5E73A 5CQ8A 5FE3A 5C85A 5I7XA 4WIVA 5C7NA 3SVGA 5KTUA 4HXOA 2DVRA 4A9IA 2E3KA 1E6IA 4PKLA 5CUGA 5EPSA 2D82A 5II2A 4YYGA 4PTBA 4ALGA 5D3PA 3UVWA 3JVMA 5CTLA 3MB4A 2YELA 4YBMA 5FE1A 5CQTA 4LR6A 3JVLA 3AADA 4NR7A 5L97A 5E9LA 5LKZA 5FG4A 3IU5A 4FLPA 4NXJA 5ENGA 2GRCA 5D25A 3P1FA 4HXPA 2MJVB 3U5OA 5EP7A 5FE7A 2RS9B 4UITA 2L5EA 4QC3A 5DKDA 4HXMA 2DATA 2L85A 5AMFA 4O7FA 2DWWA 5E0RA 4XY8A 4A9NA 4NR4A 5CFWA 5D3NA 4OUFA 5G4SA 4TQNA 4YATA 4X2IA 5LKTA 4ZC9A 4J0SA 5D7XA 5FFYA 4QR5A 2E7NA 4QNSA 2RI7A 4HXKA 3UV5A 5LJ1A 4NUCA 5CGPA 5I89A 5EISA 5EWHA 4NUDA 4CLBA 4YADA 5E9YA 5KU3A 4N3WA 4UIWA 4O7AA 3UW9A 4YYJA 4YH3A 3U5JA 4O72A 5D3LA 4N4GA 4HBYA 5HRVA 3P1DA 4DONA 3TLPA 5EV9A 3G0JA 1JSPB 5H85A 4QSPA 5CQ7A 5G4RA 4Z1SA 4A9JA 5H1TA 1WUGA 4BHWA 5D3HA 4QEVA 5CS8A 4QC1A 5E74A 5CPEA 5TCMA 4Y03A 1WUMA 4TT6A 3JVJA 2I8NA 3UV4A 1F68A 5LJ2A 4NRBA 4MR6A 3O35A 4QYDA 4YABA 3G0LA 4C66A 5C4QA 4NS5A 5DW1A 5IBNA 4NR8A 5DW2A 3U5NA 5E3GA 5CUCA 5COIA 3S92A 5ENEA 5A7CA 3UVDA 4O76A 4WHWA 5A5PA 4YY6A 4QSTA 5E9MA 5I86A 3I3JA 5C87A 3MB3A 3LQHA 4YAXA 5LUUA 3U5PA 5ENCA 5ENBA 3GG3A 2WP1A 5HENA 4Z93A 2DVVA 5DYXA 5F60A 5LKUA 5TB6A 4WHUA 2DVQA 4QEUA 5HFQA 3AQAA 5A82A 5ENHA 3DWYA 4LZRA 5DX4A 4N4HA 4UIUA 5IGLA 5DLXA 5F62A 5FE5A 4UYDA 5D26A 4YBSA 4QR3A 4A9FA 3K2JA 3O37A 4NQMA 5DKCA 3UVXA 5FE8A 2RNYA 4LDFA 5FB0A 3P1EA 2E7OA 4MR5A 4QYLA 4IORA 4IR3A 2F6NA 4MENA 5I1QA 4HBVA 4J0RA 5L99A 5ACYA 3SVFA 5FH6A 5D0CA 4MR4A 5E3DA 4MR3A 5FE9A 2WP2A 5D3TA 4O74A 2D9EA 4TZ2A 5A5OA 5BT3A 4A9OA 4ALHA 4QBMA 2FSAA 5E7DA 4E96A 3FKMX 5DFDA 2H60A 5EICA 5HLSA 4TZ8A 4IR4A 5HQ6A 4IOOA 5FH8A 4HXNA 2DKWA 4QSRA 5DYUA 5C8GA 5F1HA 5HELA 5FG5A 5CQ4A 4YYNA 4NR9A 4QSXA 4KCXA 4UYFB 4XUBA 5A81A 4CUTA 4LYWA 4O7CA 4BJXA 4CL9A 5CP5A 4OGIA 5L96A 5FB1A 5F61A 3LXJA 5FDZA 5KHMA 5DY7A 4NUEA 4ZQLA 5FBXA 5CUAA 2F6JA 3SVHA 5EI4A 3U5KA 4QSWA 4NRAA 4UIVA 5FG6A 5HM0A 3LQIA 4UYHA 4CUSA 5EU1A 5A5RA 4GPJA 5HJCA 5JWMA 5EWWA 5KTXA 4Z6HA 3MUKA 4A9KA 2LSPB 4LZ2A 5FE4A 5HCLA 5AD2A 4QB3A 5HEMA 4NYWA 2I7KA 4PY6A 4QR4A 4QY4A 5HQ5A 4XUAA 4UYFA 5CUDA 5A5QA 4QSUA 4BW3A 4KV1A 5KTWA 4HXLA 4BW4A 2YYNA 3O36A 3LJWA 5D3JA 5CQ6A 4YYMA 5I80A 5EPRA 3ZYUA 4O77A 5KO4A 5F3AA 5EWDA 3HMFA 5FH7A 4IR6A 4RVRA 4O7BA 4YK0A 4UIZA 5D24A 4PCEA 5EK9A 5L8UA 5A5NA 4CUQA 3LQJA 1X0JA 2YDWA 4TU4A 3RCWA 4J1PA 5FFVA 4OGJA 5IGKA 3HMEA 5ETDA 5FE0A 5FFWA 3P5OA 5AD3A 5HFRA 4IOQA 4Z6IA 5CRZA 4QUTA 4UYEA 4LYSA 4NRCA 4MEPA 5I7YA 2KTBB 2YW5A 4O70A 5E9VA 4HXSA 5BT4A 5I83A 2OSSA 2YEMA 4LYIA 4YYIA 5HRWA 4NYXA 5IIDA 3O33A 1EQFA 4A9MA 3U5LA 4UIXA 4YC9A 5F2PA 4YYDA 5JI8A 4O71A 5D3RA 5CQAA
chains in the Genus database with same CATH superfamily
5FE2A 4XYAA 4TU6A 3D7CA 5I40A 3JVKA 4NYVA 3S91A 4MEQA 3MULA 4MEOA 5A85A 2L84A 2RNXA 5ENFA 2RO1A 3HMHA 5DFCA 5EGUA 5CQ5A 2NXBA 3MQMA 4N4FA 5F1LA 2YQDA 3Q2EA 4PS5A 4Q0OA 3Q2FA 4YBTA 4BW2A 2R10A 4CFKA 5L98A 4NQNA 5LKXA 5BT5A 5IGMA 2RNWA 4N4IA 2YEKA 5CU8A 4YH4A 3ONIA 3P1CA 4Q0NA 5CUBA 4Z1QA 4CFLA 3D1DA 1N72A 3DAIA 4UIYA 4O75A 4QUUA 4UYGA 4IR5A 4A9EA 4TT2A 4QEWA 5C89A 3QZTA 5CZGA 5H1VA 4TYLA 4QSSA 5AMEA 5ENJA 5D3SA 5DYAA 2R0VA 4CUPA 4ZW1A 5IGNA 5IG6A 5J0DA 5F5ZA 5EM3A 5FE6A 4F3IA 5LJ0A 4CUUA 5EA1A 4NR6A 5LVRA 1JM4B 4TT4A 4J3IA 2R0YA 4QSQA 2N9GA 2OO1A 4QZSA 3ERRA 5LVQA 5E9KA 2RFJA 4PCIA 5A83A 5F36A 4HBXA 4BW1A 2EJNA 3O34A 5H1UA 4A9HA 4QSVA 4LZSA 4YYHA 4YY4A 4LC2A 4LRGA 4O7EA 5I29A 4NR5A 1ZS5A 5DFBA 2DVSA 4TS8A 5EVAA 3UV2A 2OUOA 4HBWA 5A5SA 4XY9A 5II1A 4TTEA 5L8TA 3U5MA 5E9IA 5CUEA 4A9LA 3VKHA 5ENIA 3IU6A 5EWVA 4O78A 5I88A 5ETBA 5HRXA 5K29A 5F25A 5CRMA 5DKHA 5F63A 4CURA 5CY9A 4C67A 3QZSA 5HQ7A 3MXFA 3NXBA 5DLZA 5CQ3A 3UVYA 5DBMA 4YYKA 3QZVA 5EWCA 2R0SA 5DYCA 2G4AA 4HXRA 4AKNA 5EQ1A 4KV4A 5EPBA 5E73A 5CQ8A 5FE3A 5C85A 5I7XA 4WIVA 5C7NA 3SVGA 5KTUA 4HXOA 2DVRA 4A9IA 2E3KA 1E6IA 4PKLA 5CUGA 5EPSA 2D82A 5II2A 4YYGA 4PTBA 4ALGA 5D3PA 3UVWA 3JVMA 5CTLA 1ZKRA 3MB4A 2YELA 4YBMA 5FE1A 5CQTA 4LR6A 3JVLA 3AADA 4NR7A 5L97A 5E9LA 5LKZA 5FG4A 3IU5A 4FLPA 4NXJA 5ENGA 2GRCA 5D25A 3P1FA 4HXPA 2MJVB 3U5OA 5EP7A 5FE7A 2RS9B 4UITA 2L5EA 4QC3A 5DKDA 4HXMA 2DATA 2L85A 5AMFA 4O7FA 2DWWA 5E0RA 4XY8A 4A9NA 4NR4A 5CFWA 5D3NA 4OUFA 5G4SA 4TQNA 4YATA 4X2IA 5LKTA 4ZC9A 4J0SA 5D7XA 5FFYA 4QR5A 2E7NA 4QNSA 2RI7A 4HXKA 3UV5A 5LJ1A 4NUCA 5CGPA 5I89A 5EISA 1PUOA 5EWHA 4NUDA 4CLBA 4YADA 5E9YA 5KU3A 4N3WA 4UIWA 4O7AA 3UW9A 4YYJA 4YH3A 3U5JA 4O72A 5D3LA 4N4GA 4HBYA 5HRVA 3P1DA 4DONA 3TLPA 5EV9A 3G0JA 1JSPB 5H85A 3VKGA 4QSPA 5CQ7A 5G4RA 4Z1SA 4A9JA 5H1TA 1WUGA 4BHWA 5D3HA 4QEVA 5CS8A 4QC1A 5E74A 5CPEA 5TCMA 4Y03A 1WUMA 4TT6A 3JVJA 2I8NA 3UV4A 1F68A 5LJ2A 4NRBA 4MR6A 3O35A 4QYDA 4YABA 3G0LA 4C66A 5C4QA 4NS5A 5DW1A 5IBNA 4NR8A 5DW2A 3U5NA 5E3GA 5CUCA 5COIA 3S92A 5ENEA 5A7CA 3UVDA 4O76A 4WHWA 5A5PA 4YY6A 4QSTA 5E9MA 5I86A 3I3JA 5C87A 3MB3A 3LQHA 4YAXA 5LUUA 3U5PA 5ENCA 5ENBA 3GG3A 2WP1A 5HENA 4Z93A 2DVVA 5DYXA 5F60A 5LKUA 5TB6A 4WHUA 2DVQA 4QEUA 5HFQA 3AQAA 5A82A 5ENHA 3DWYA 4LZRA 5DX4A 4N4HA 4UIUA 5IGLA 5DLXA 5F62A 5FE5A 4UYDA 5D26A 4YBSA 4QR3A 4A9FA 3K2JA 3D1BA 3O37A 4NQMA 5DKCA 3UVXA 5FE8A 2RNYA 4LDFA 4AKIA 5FB0A 3P1EA 2E7OA 4MR5A 4QYLA 4IORA 4IR3A 2F6NA 4MENA 5I1QA 4HBVA 4J0RA 5L99A 5ACYA 3SVFA 5FH6A 5D0CA 4MR4A 5E3DA 4MR3A 5FE9A 2WP2A 5D3TA 4O74A 2D9EA 4TZ2A 5A5OA 5BT3A 4A9OA 4ALHA 4QBMA 2FSAA 5E7DA 4E96A 3FKMX 5DFDA 2H60A 5EICA 5HLSA 4TZ8A 4IR4A 5HQ6A 4IOOA 5FH8A 4HXNA 2DKWA 4QSRA 5DYUA 5C8GA 5F1HA 5HELA 5FG5A 5CQ4A 4YYNA 4NR9A 4QSXA 4KCXA 4UYFB 4XUBA 5A81A 4CUTA 4LYWA 4O7CA 4BJXA 4CL9A 5CP5A 4OGIA 5L96A 5FB1A 5F61A 3LXJA 5FDZA 5KHMA 5DY7A 4NUEA 4ZQLA 4AKGA 5FBXA 5CUAA 2F6JA 3SVHA 5EI4A 3U5KA 4QSWA 4NRAA 4UIVA 5FG6A 5HM0A 3LQIA 4UYHA 4CUSA 5EU1A 5A5RA 4GPJA 5HJCA 5JWMA 5EWWA 5KTXA 4Z6HA 4AKHA 3MUKA 4A9KA 2LSPB 4LZ2A 5FE4A 5HCLA 5AD2A 4QB3A 5HEMA 4NYWA 2I7KA 4PY6A 4QR4A 4QY4A 5HQ5A 4XUAA 4UYFA 5CUDA 5A5QA 4QSUA 4BW3A 4KV1A 5KTWA 4HXLA 4BW4A 4AI6A 2YYNA 3O36A 3LJWA 5D3JA 5CQ6A 4YYMA 5I80A 5EPRA 3ZYUA 4O77A 5KO4A 5F3AA 5EWDA 3HMFA 5FH7A 4IR6A 4RVRA 4O7BA 4YK0A 4UIZA 5D24A 4PCEA 5EK9A 5L8UA 5A5NA 4CUQA 3LQJA 1X0JA 2YDWA 4TU4A 3RCWA 4J1PA 5FFVA 4OGJA 5IGKA 3HMEA 5ETDA 5FE0A 5FFWA 3P5OA 5AD3A 5HFRA 4IOQA 4Z6IA 5CRZA 4QUTA 4UYEA 4LYSA 4NRCA 4MEPA 5I7YA 2KTBB 2YW5A 4O70A 5E9VA 4HXSA 5BT4A 5I83A 2OSSA 2YEMA 4LYIA 4YYIA 5HRWA 4NYXA 5IIDA 3O33A 1EQFA 4A9MA 3U5LA 4UIXA 4YC9A 5F2PA 4YYDA 5JI8A 4O71A 5D3RA 5CQAA
chains in the Genus database with same CATH topology
5FE2A 4XYAA 4TU6A 3D7CA 5I40A 3JVKA 4NYVA 3S91A 4MEQA 3MULA 4MEOA 5A85A 2L84A 2RNXA 5ENFA 2RO1A 3HMHA 5DFCA 5EGUA 5CQ5A 2NXBA 3MQMA 4N4FA 5F1LA 2YQDA 3Q2EA 4PS5A 4Q0OA 3Q2FA 4YBTA 4BW2A 2R10A 4CFKA 5L98A 4NQNA 5LKXA 5BT5A 5IGMA 2RNWA 4N4IA 2YEKA 5CU8A 4YH4A 3ONIA 3P1CA 4Q0NA 5CUBA 4Z1QA 4CFLA 1N72A 3DAIA 4UIYA 4O75A 4QUUA 4UYGA 4IR5A 4A9EA 4TT2A 4QEWA 5C89A 3QZTA 5CZGA 5H1VA 4TYLA 4QSSA 5AMEA 5ENJA 5D3SA 5DYAA 2R0VA 4CUPA 4ZW1A 5IGNA 5IG6A 5J0DA 5F5ZA 5EM3A 5FE6A 4F3IA 5LJ0A 4CUUA 5EA1A 4NR6A 5LVRA 1JM4B 4TT4A 4J3IA 2R0YA 4QSQA 2N9GA 2OO1A 4QZSA 5LVQA 5E9KA 2RFJA 4PCIA 5A83A 5F36A 4HBXA 4BW1A 3O34A 5H1UA 4A9HA 4QSVA 4LZSA 4YYHA 4YY4A 4LC2A 4LRGA 4O7EA 5I29A 4NR5A 1ZS5A 5DFBA 2DVSA 4TS8A 5EVAA 3UV2A 2OUOA 4HBWA 5A5SA 4XY9A 5II1A 4TTEA 5L8TA 3U5MA 5E9IA 5CUEA 4A9LA 5ENIA 3IU6A 5EWVA 4O78A 5I88A 5ETBA 5HRXA 5K29A 5F25A 5CRMA 5DKHA 5F63A 4CURA 5CY9A 4C67A 3QZSA 5HQ7A 3MXFA 3NXBA 5DLZA 5CQ3A 3UVYA 5DBMA 4YYKA 3QZVA 5EWCA 2R0SA 5DYCA 2G4AA 4HXRA 4AKNA 5EQ1A 4KV4A 5EPBA 5E73A 5CQ8A 5FE3A 5C85A 5I7XA 4WIVA 5C7NA 3SVGA 5KTUA 4HXOA 2DVRA 4A9IA 2E3KA 1E6IA 4PKLA 5CUGA 5EPSA 2D82A 5II2A 4YYGA 4PTBA 4ALGA 5D3PA 3UVWA 3JVMA 5CTLA 3MB4A 2YELA 4YBMA 5FE1A 5CQTA 4LR6A 3JVLA 3AADA 4NR7A 5L97A 5E9LA 5LKZA 5FG4A 3IU5A 4FLPA 4NXJA 5ENGA 2GRCA 5D25A 3P1FA 4HXPA 2MJVB 3U5OA 5EP7A 5FE7A 2RS9B 4UITA 2L5EA 4QC3A 5DKDA 4HXMA 2DATA 2L85A 5AMFA 4O7FA 2DWWA 5E0RA 4XY8A 4A9NA 4NR4A 5CFWA 5D3NA 4OUFA 5G4SA 4TQNA 4YATA 4X2IA 5LKTA 4ZC9A 4J0SA 5D7XA 5FFYA 4QR5A 2E7NA 4QNSA 2RI7A 4HXKA 3UV5A 5LJ1A 4NUCA 5CGPA 5I89A 5EISA 5EWHA 4NUDA 4CLBA 4YADA 5E9YA 5KU3A 4N3WA 4UIWA 4O7AA 3UW9A 4YYJA 4YH3A 3U5JA 4O72A 5D3LA 4N4GA 4HBYA 5HRVA 3P1DA 4DONA 3TLPA 5EV9A 3G0JA 1JSPB 5H85A 4QSPA 5CQ7A 5G4RA 4Z1SA 4A9JA 5H1TA 1WUGA 4BHWA 5D3HA 4QEVA 5CS8A 4QC1A 5E74A 5CPEA 5TCMA 4Y03A 1WUMA 4TT6A 3JVJA 2I8NA 3UV4A 1F68A 5LJ2A 4NRBA 4MR6A 3O35A 4QYDA 4YABA 3G0LA 4C66A 5C4QA 4NS5A 5DW1A 5IBNA 4NR8A 5DW2A 3U5NA 5E3GA 5CUCA 5COIA 3S92A 5ENEA 5A7CA 3UVDA 4O76A 4WHWA 5A5PA 4YY6A 4QSTA 5E9MA 5I86A 3I3JA 5C87A 3MB3A 3LQHA 4YAXA 5LUUA 3U5PA 5ENCA 5ENBA 3GG3A 2WP1A 5HENA 4Z93A 2DVVA 5DYXA 5F60A 5LKUA 5TB6A 4WHUA 2DVQA 4QEUA 5HFQA 3AQAA 5A82A 5ENHA 3DWYA 4LZRA 5DX4A 4N4HA 4UIUA 5IGLA 5DLXA 5F62A 5FE5A 4UYDA 5D26A 4YBSA 4QR3A 4A9FA 3K2JA 3O37A 4NQMA 5DKCA 3UVXA 5FE8A 2RNYA 4LDFA 5FB0A 3P1EA 2E7OA 4MR5A 4QYLA 4IORA 4IR3A 2F6NA 4MENA 5I1QA 4HBVA 4J0RA 5L99A 5ACYA 3SVFA 5FH6A 5D0CA 4MR4A 5E3DA 4MR3A 5FE9A 2WP2A 5D3TA 4O74A 2D9EA 4TZ2A 5A5OA 5BT3A 4A9OA 4ALHA 4QBMA 2FSAA 5E7DA 4E96A 3FKMX 5DFDA 2H60A 5EICA 5HLSA 4TZ8A 4IR4A 5HQ6A 4IOOA 5FH8A 4HXNA 2DKWA 4QSRA 5DYUA 5C8GA 5F1HA 5HELA 5FG5A 5CQ4A 4YYNA 4NR9A 4QSXA 4KCXA 4UYFB 4XUBA 5A81A 4CUTA 4LYWA 4O7CA 4BJXA 4CL9A 5CP5A 4OGIA 5L96A 5FB1A 5F61A 3LXJA 5FDZA 5KHMA 5DY7A 4NUEA 4ZQLA 5FBXA 5CUAA 2F6JA 3SVHA 5EI4A 3U5KA 4QSWA 4NRAA 4UIVA 5FG6A 5HM0A 3LQIA 4UYHA 4CUSA 5EU1A 5A5RA 4GPJA 5HJCA 5JWMA 5EWWA 5KTXA 4Z6HA 3MUKA 4A9KA 2LSPB 4LZ2A 5FE4A 5HCLA 5AD2A 4QB3A 5HEMA 4NYWA 2I7KA 4PY6A 4QR4A 4QY4A 5HQ5A 4XUAA 4UYFA 5CUDA 5A5QA 4QSUA 4BW3A 4KV1A 5KTWA 4HXLA 4BW4A 2YYNA 3O36A 3LJWA 5D3JA 5CQ6A 4YYMA 5I80A 5EPRA 3ZYUA 4O77A 5KO4A 5F3AA 5EWDA 3HMFA 5FH7A 4IR6A 4RVRA 4O7BA 4YK0A 4UIZA 5D24A 4PCEA 5EK9A 5L8UA 5A5NA 4CUQA 3LQJA 1X0JA 2YDWA 4TU4A 3RCWA 4J1PA 5FFVA 4OGJA 5IGKA 3HMEA 5ETDA 5FE0A 5FFWA 3P5OA 5AD3A 5HFRA 4IOQA 4Z6IA 5CRZA 4QUTA 4UYEA 4LYSA 4NRCA 4MEPA 5I7YA 2KTBB 2YW5A 4O70A 5E9VA 4HXSA 5BT4A 5I83A 2OSSA 2YEMA 4LYIA 4YYIA 5HRWA 4NYXA 5IIDA 3O33A 1EQFA 4A9MA 3U5LA 4UIXA 4YC9A 5F2PA 4YYDA 5JI8A 4O71A 5D3RA 5CQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FE2 A;  4XYA A;  4TU6 A;  3D7C A;  5I40 A;  3JVK A;  4NYV A;  3S91 A;  4MEQ A;  3MUL A;  4MEO A;  5A85 A;  2L84 A;  2RNX A;  5ENF A;  2RO1 A;  3HMH A;  5DFC A;  5EGU A;  5CQ5 A;  2NXB A;  3MQM A;  4N4F A;  5F1L A;  2YQD A;  3Q2E A;  4PS5 A;  4Q0O A;  3Q2F A;  4YBT A;  4BW2 A;  2R10 A;  4CFK A;  5L98 A;  4NQN A;  5LKX A;  5BT5 A;  5IGM A;  2RNW A;  4N4I A;  2YEK A;  5CU8 A;  4YH4 A;  3ONI A;  3P1C A;  4Q0N A;  5CUB A;  4Z1Q A;  4CFL A;  1N72 A;  3DAI A;  4UIY A;  4O75 A;  4QUU A;  4UYG A;  4IR5 A;  4A9E A;  4TT2 A;  4QEW A;  5C89 A;  3QZT A;  5CZG A;  5H1V A;  4TYL A;  4QSS A;  5AME A;  5ENJ A;  5D3S A;  5DYA A;  2R0V A;  4CUP A;  4ZW1 A;  5IGN A;  5IG6 A;  5J0D A;  5F5Z A;  5EM3 A;  5FE6 A;  4F3I A;  5LJ0 A;  4CUU A;  5EA1 A;  4NR6 A;  5LVR A;  1JM4 B;  4TT4 A;  4J3I A;  2R0Y A;  4QSQ A;  2N9G A;  2OO1 A;  4QZS A;  5LVQ A;  5E9K A;  2RFJ A;  4PCI A;  5A83 A;  5F36 A;  4HBX A;  4BW1 A;  3O34 A;  5H1U A;  4A9H A;  4QSV A;  4LZS A;  4YYH A;  4YY4 A;  4LC2 A;  4LRG A;  4O7E A;  5I29 A;  4NR5 A;  1ZS5 A;  5DFB A;  2DVS A;  4TS8 A;  5EVA A;  3UV2 A;  2OUO A;  4HBW A;  5A5S A;  4XY9 A;  5II1 A;  4TTE A;  5L8T A;  3U5M A;  5E9I A;  5CUE A;  4A9L A;  5ENI A;  3IU6 A;  5EWV A;  4O78 A;  5I88 A;  5ETB A;  5HRX A;  5K29 A;  5F25 A;  5CRM A;  5DKH A;  5F63 A;  4CUR A;  5CY9 A;  4C67 A;  3QZS A;  5HQ7 A;  3MXF A;  3NXB A;  5DLZ A;  5CQ3 A;  3UVY A;  5DBM A;  4YYK A;  3QZV A;  5EWC A;  2R0S A;  5DYC A;  2G4A A;  4HXR A;  4AKN A;  5EQ1 A;  4KV4 A;  5EPB A;  5E73 A;  5CQ8 A;  5FE3 A;  5C85 A;  5I7X A;  4WIV A;  5C7N A;  3SVG A;  5KTU A;  4HXO A;  2DVR A;  4A9I A;  2E3K A;  1E6I A;  4PKL A;  5CUG A;  5EPS A;  2D82 A;  5II2 A;  4YYG A;  4PTB A;  4ALG A;  5D3P A;  3UVW A;  3JVM A;  5CTL A;  3MB4 A;  2YEL A;  4YBM A;  5FE1 A;  5CQT A;  4LR6 A;  3JVL A;  3AAD A;  4NR7 A;  5L97 A;  5E9L A;  5LKZ A;  5FG4 A;  3IU5 A;  4FLP A;  4NXJ A;  5ENG A;  2GRC A;  5D25 A;  3P1F A;  4HXP A;  2MJV B;  3U5O A;  5EP7 A;  5FE7 A;  2RS9 B;  4UIT A;  2L5E A;  4QC3 A;  5DKD A;  4HXM A;  2DAT A;  2L85 A;  5AMF A;  4O7F A;  2DWW A;  5E0R A;  4XY8 A;  4A9N A;  4NR4 A;  5CFW A;  5D3N A;  4OUF A;  5G4S A;  4TQN A;  4YAT A;  4X2I A;  5LKT A;  4ZC9 A;  4J0S A;  5D7X A;  5FFY A;  4QR5 A;  2E7N A;  4QNS A;  2RI7 A;  4HXK A;  3UV5 A;  5LJ1 A;  4NUC A;  5CGP A;  5I89 A;  5EIS A;  5EWH A;  4NUD A;  4CLB A;  4YAD A;  5E9Y A;  5KU3 A;  4N3W A;  4UIW A;  4O7A A;  3UW9 A;  4YYJ A;  4YH3 A;  3U5J A;  4O72 A;  5D3L A;  4N4G A;  4HBY A;  5HRV A;  3P1D A;  4DON A;  3TLP A;  5EV9 A;  3G0J A;  1JSP B;  5H85 A;  4QSP A;  5CQ7 A;  5G4R A;  4Z1S A;  4A9J A;  5H1T A;  1WUG A;  4BHW A;  5D3H A;  4QEV A;  5CS8 A;  4QC1 A;  5E74 A;  5CPE A;  5TCM A;  4Y03 A;  1WUM A;  4TT6 A;  3JVJ A;  2I8N A;  3UV4 A;  1F68 A;  5LJ2 A;  4NRB A;  4MR6 A;  3O35 A;  4QYD A;  4YAB A;  3G0L A;  4C66 A;  5C4Q A;  4NS5 A;  5DW1 A;  5IBN A;  4NR8 A;  5DW2 A;  3U5N A;  5E3G A;  5CUC A;  5COI A;  3S92 A;  5ENE A;  5A7C A;  3UVD A;  4O76 A;  4WHW A;  5A5P A;  4YY6 A;  4QST A;  5E9M A;  5I86 A;  3I3J A;  5C87 A;  3MB3 A;  3LQH A;  4YAX A;  5LUU A;  3U5P A;  5ENC A;  5ENB A;  3GG3 A;  2WP1 A;  5HEN A;  4Z93 A;  2DVV A;  5DYX A;  5F60 A;  5LKU A;  5TB6 A;  4WHU A;  2DVQ A;  4QEU A;  5HFQ A;  3AQA A;  5A82 A;  5ENH A;  3DWY A;  4LZR A;  5DX4 A;  4N4H A;  4UIU A;  5IGL A;  5DLX A;  5F62 A;  5FE5 A;  4UYD A;  5D26 A;  4YBS A;  4QR3 A;  4A9F A;  3K2J A;  3O37 A;  4NQM A;  5DKC A;  3UVX A;  5FE8 A;  2RNY A;  4LDF A;  5FB0 A;  3P1E A;  2E7O A;  4MR5 A;  4QYL A;  4IOR A;  4IR3 A;  2F6N A;  4MEN A;  5I1Q A;  4HBV A;  4J0R A;  5L99 A;  5ACY A;  3SVF A;  5FH6 A;  5D0C A;  4MR4 A;  5E3D A;  4MR3 A;  5FE9 A;  2WP2 A;  5D3T A;  4O74 A;  2D9E A;  4TZ2 A;  5A5O A;  5BT3 A;  4A9O A;  4ALH A;  4QBM A;  2FSA A;  5E7D A;  4E96 A;  3FKM X;  5DFD A;  2H60 A;  5EIC A;  5HLS A;  4TZ8 A;  4IR4 A;  5HQ6 A;  4IOO A;  5FH8 A;  4HXN A;  2DKW A;  4QSR A;  5DYU A;  5C8G A;  5F1H A;  5HEL A;  5FG5 A;  5CQ4 A;  4YYN A;  4NR9 A;  4QSX A;  4KCX A;  4UYF B;  4XUB A;  5A81 A;  4CUT A;  4LYW A;  4O7C A;  4BJX A;  4CL9 A;  5CP5 A;  4OGI A;  5L96 A;  5FB1 A;  5F61 A;  3LXJ A;  5FDZ A;  5KHM A;  5DY7 A;  4NUE A;  4ZQL A;  5FBX A;  5CUA A;  2F6J A;  3SVH A;  5EI4 A;  3U5K A;  4QSW A;  4NRA A;  4UIV A;  5FG6 A;  5HM0 A;  3LQI A;  4UYH A;  4CUS A;  5EU1 A;  5A5R A;  4GPJ A;  5HJC A;  5JWM A;  5EWW A;  5KTX A;  4Z6H A;  3MUK A;  4A9K A;  2LSP B;  4LZ2 A;  5FE4 A;  5HCL A;  5AD2 A;  4QB3 A;  5HEM A;  4NYW A;  2I7K A;  4PY6 A;  4QR4 A;  4QY4 A;  5HQ5 A;  4XUA A;  4UYF A;  5CUD A;  5A5Q A;  4QSU A;  4BW3 A;  4KV1 A;  5KTW A;  4HXL A;  4BW4 A;  2YYN A;  3O36 A;  3LJW A;  5D3J A;  5CQ6 A;  4YYM A;  5I80 A;  5EPR A;  3ZYU A;  4O77 A;  5KO4 A;  5F3A A;  5EWD A;  3HMF A;  5FH7 A;  4IR6 A;  4RVR A;  4O7B A;  4YK0 A;  4UIZ A;  5D24 A;  4PCE A;  5EK9 A;  5L8U A;  5A5N A;  4CUQ A;  3LQJ A;  1X0J A;  2YDW A;  4TU4 A;  3RCW A;  4J1P A;  5FFV A;  4OGJ A;  5IGK A;  3HME A;  5ETD A;  5FE0 A;  5FFW A;  3P5O A;  5AD3 A;  5HFR A;  4IOQ A;  4Z6I A;  5CRZ A;  4QUT A;  4UYE A;  4LYS A;  4NRC A;  4MEP A;  5I7Y A;  2KTB B;  2YW5 A;  4O70 A;  5E9V A;  4HXS A;  5BT4 A;  5I83 A;  2OSS A;  2YEM A;  4LYI A;  4YYI A;  5HRW A;  4NYX A;  5IID A;  3O33 A;  1EQF A;  4A9M A;  3U5L A;  4UIX A;  4YC9 A;  5F2P A;  4YYD A;  5JI8 A;  4O71 A;  5D3R A;  5CQA A; 
#chains in the Genus database with same CATH topology
 5FE2 A;  4XYA A;  4TU6 A;  3D7C A;  5I40 A;  3JVK A;  4NYV A;  3S91 A;  4MEQ A;  3MUL A;  4MEO A;  5A85 A;  2L84 A;  2RNX A;  5ENF A;  2RO1 A;  3HMH A;  5DFC A;  5EGU A;  5CQ5 A;  2NXB A;  3MQM A;  4N4F A;  5F1L A;  2YQD A;  3Q2E A;  4PS5 A;  4Q0O A;  3Q2F A;  4YBT A;  4BW2 A;  2R10 A;  4CFK A;  5L98 A;  4NQN A;  5LKX A;  5BT5 A;  5IGM A;  2RNW A;  4N4I A;  2YEK A;  5CU8 A;  4YH4 A;  3ONI A;  3P1C A;  4Q0N A;  5CUB A;  4Z1Q A;  4CFL A;  3D1D A;  1N72 A;  3DAI A;  4UIY A;  4O75 A;  4QUU A;  4UYG A;  4IR5 A;  4A9E A;  4TT2 A;  4QEW A;  5C89 A;  3QZT A;  5CZG A;  5H1V A;  4TYL A;  4QSS A;  5AME A;  5ENJ A;  5D3S A;  5DYA A;  2R0V A;  4CUP A;  4ZW1 A;  5IGN A;  5IG6 A;  5J0D A;  5F5Z A;  5EM3 A;  5FE6 A;  4F3I A;  5LJ0 A;  4CUU A;  5EA1 A;  4NR6 A;  5LVR A;  1JM4 B;  4TT4 A;  4J3I A;  2R0Y A;  4QSQ A;  2N9G A;  2OO1 A;  4QZS A;  3ERR A;  5LVQ A;  5E9K A;  2RFJ A;  4PCI A;  5A83 A;  5F36 A;  4HBX A;  4BW1 A;  2EJN A;  3O34 A;  5H1U A;  4A9H A;  4QSV A;  4LZS A;  4YYH A;  4YY4 A;  4LC2 A;  4LRG A;  4O7E A;  5I29 A;  4NR5 A;  1ZS5 A;  5DFB A;  2DVS A;  4TS8 A;  5EVA A;  3UV2 A;  2OUO A;  4HBW A;  5A5S A;  4XY9 A;  5II1 A;  4TTE A;  5L8T A;  3U5M A;  5E9I A;  5CUE A;  4A9L A;  3VKH A;  5ENI A;  3IU6 A;  5EWV A;  4O78 A;  5I88 A;  5ETB A;  5HRX A;  5K29 A;  5F25 A;  5CRM A;  5DKH A;  5F63 A;  4CUR A;  5CY9 A;  4C67 A;  3QZS A;  5HQ7 A;  3MXF A;  3NXB A;  5DLZ A;  5CQ3 A;  3UVY A;  5DBM A;  4YYK A;  3QZV A;  5EWC A;  2R0S A;  5DYC A;  2G4A A;  4HXR A;  4AKN A;  5EQ1 A;  4KV4 A;  5EPB A;  5E73 A;  5CQ8 A;  5FE3 A;  5C85 A;  5I7X A;  4WIV A;  5C7N A;  3SVG A;  5KTU A;  4HXO A;  2DVR A;  4A9I A;  2E3K A;  1E6I A;  4PKL A;  5CUG A;  5EPS A;  2D82 A;  5II2 A;  4YYG A;  4PTB A;  4ALG A;  5D3P A;  3UVW A;  3JVM A;  5CTL A;  1ZKR A;  3MB4 A;  2YEL A;  4YBM A;  5FE1 A;  5CQT A;  4LR6 A;  3JVL A;  3AAD A;  4NR7 A;  5L97 A;  5E9L A;  5LKZ A;  5FG4 A;  3IU5 A;  4FLP A;  4NXJ A;  5ENG A;  2GRC A;  5D25 A;  3P1F A;  4HXP A;  2MJV B;  3U5O A;  5EP7 A;  5FE7 A;  2RS9 B;  4UIT A;  2L5E A;  4QC3 A;  5DKD A;  4HXM A;  2DAT A;  2L85 A;  5AMF A;  4O7F A;  2DWW A;  5E0R A;  4XY8 A;  4A9N A;  4NR4 A;  5CFW A;  5D3N A;  4OUF A;  5G4S A;  4TQN A;  4YAT A;  4X2I A;  5LKT A;  4ZC9 A;  4J0S A;  5D7X A;  5FFY A;  4QR5 A;  2E7N A;  4QNS A;  2RI7 A;  4HXK A;  3UV5 A;  5LJ1 A;  4NUC A;  5CGP A;  5I89 A;  5EIS A;  1PUO A;  5EWH A;  4NUD A;  4CLB A;  4YAD A;  5E9Y A;  5KU3 A;  4N3W A;  4UIW A;  4O7A A;  3UW9 A;  4YYJ A;  4YH3 A;  3U5J A;  4O72 A;  5D3L A;  4N4G A;  4HBY A;  5HRV A;  3P1D A;  4DON A;  3TLP A;  5EV9 A;  3G0J A;  1JSP B;  5H85 A;  3VKG A;  4QSP A;  5CQ7 A;  5G4R A;  4Z1S A;  4A9J A;  5H1T A;  1WUG A;  4BHW A;  5D3H A;  4QEV A;  5CS8 A;  4QC1 A;  5E74 A;  5CPE A;  5TCM A;  4Y03 A;  1WUM A;  4TT6 A;  3JVJ A;  2I8N A;  3UV4 A;  1F68 A;  5LJ2 A;  4NRB A;  4MR6 A;  3O35 A;  4QYD A;  4YAB A;  3G0L A;  4C66 A;  5C4Q A;  4NS5 A;  5DW1 A;  5IBN A;  4NR8 A;  5DW2 A;  3U5N A;  5E3G A;  5CUC A;  5COI A;  3S92 A;  5ENE A;  5A7C A;  3UVD A;  4O76 A;  4WHW A;  5A5P A;  4YY6 A;  4QST A;  5E9M A;  5I86 A;  3I3J A;  5C87 A;  3MB3 A;  3LQH A;  4YAX A;  5LUU A;  3U5P A;  5ENC A;  5ENB A;  3GG3 A;  2WP1 A;  5HEN A;  4Z93 A;  2DVV A;  5DYX A;  5F60 A;  5LKU A;  5TB6 A;  4WHU A;  2DVQ A;  4QEU A;  5HFQ A;  3AQA A;  5A82 A;  5ENH A;  3DWY A;  4LZR A;  5DX4 A;  4N4H A;  4UIU A;  5IGL A;  5DLX A;  5F62 A;  5FE5 A;  4UYD A;  5D26 A;  4YBS A;  4QR3 A;  4A9F A;  3K2J A;  3D1B A;  3O37 A;  4NQM A;  5DKC A;  3UVX A;  5FE8 A;  2RNY A;  4LDF A;  4AKI A;  5FB0 A;  3P1E A;  2E7O A;  4MR5 A;  4QYL A;  4IOR A;  4IR3 A;  2F6N A;  4MEN A;  5I1Q A;  4HBV A;  4J0R A;  5L99 A;  5ACY A;  3SVF A;  5FH6 A;  5D0C A;  4MR4 A;  5E3D A;  4MR3 A;  5FE9 A;  2WP2 A;  5D3T A;  4O74 A;  2D9E A;  4TZ2 A;  5A5O A;  5BT3 A;  4A9O A;  4ALH A;  4QBM A;  2FSA A;  5E7D A;  4E96 A;  3FKM X;  5DFD A;  2H60 A;  5EIC A;  5HLS A;  4TZ8 A;  4IR4 A;  5HQ6 A;  4IOO A;  5FH8 A;  4HXN A;  2DKW A;  4QSR A;  5DYU A;  5C8G A;  5F1H A;  5HEL A;  5FG5 A;  5CQ4 A;  4YYN A;  4NR9 A;  4QSX A;  4KCX A;  4UYF B;  4XUB A;  5A81 A;  4CUT A;  4LYW A;  4O7C A;  4BJX A;  4CL9 A;  5CP5 A;  4OGI A;  5L96 A;  5FB1 A;  5F61 A;  3LXJ A;  5FDZ A;  5KHM A;  5DY7 A;  4NUE A;  4ZQL A;  4AKG A;  5FBX A;  5CUA A;  2F6J A;  3SVH A;  5EI4 A;  3U5K A;  4QSW A;  4NRA A;  4UIV A;  5FG6 A;  5HM0 A;  3LQI A;  4UYH A;  4CUS A;  5EU1 A;  5A5R A;  4GPJ A;  5HJC A;  5JWM A;  5EWW A;  5KTX A;  4Z6H A;  4AKH A;  3MUK A;  4A9K A;  2LSP B;  4LZ2 A;  5FE4 A;  5HCL A;  5AD2 A;  4QB3 A;  5HEM A;  4NYW A;  2I7K A;  4PY6 A;  4QR4 A;  4QY4 A;  5HQ5 A;  4XUA A;  4UYF A;  5CUD A;  5A5Q A;  4QSU A;  4BW3 A;  4KV1 A;  5KTW A;  4HXL A;  4BW4 A;  4AI6 A;  2YYN A;  3O36 A;  3LJW A;  5D3J A;  5CQ6 A;  4YYM A;  5I80 A;  5EPR A;  3ZYU A;  4O77 A;  5KO4 A;  5F3A A;  5EWD A;  3HMF A;  5FH7 A;  4IR6 A;  4RVR A;  4O7B A;  4YK0 A;  4UIZ A;  5D24 A;  4PCE A;  5EK9 A;  5L8U A;  5A5N A;  4CUQ A;  3LQJ A;  1X0J A;  2YDW A;  4TU4 A;  3RCW A;  4J1P A;  5FFV A;  4OGJ A;  5IGK A;  3HME A;  5ETD A;  5FE0 A;  5FFW A;  3P5O A;  5AD3 A;  5HFR A;  4IOQ A;  4Z6I A;  5CRZ A;  4QUT A;  4UYE A;  4LYS A;  4NRC A;  4MEP A;  5I7Y A;  2KTB B;  2YW5 A;  4O70 A;  5E9V A;  4HXS A;  5BT4 A;  5I83 A;  2OSS A;  2YEM A;  4LYI A;  4YYI A;  5HRW A;  4NYX A;  5IID A;  3O33 A;  1EQF A;  4A9M A;  3U5L A;  4UIX A;  4YC9 A;  5F2P A;  4YYD A;  5JI8 A;  4O71 A;  5D3R A;  5CQA A; 
#chains in the Genus database with same CATH homology
 5FE2 A;  4XYA A;  4TU6 A;  3D7C A;  5I40 A;  3JVK A;  4NYV A;  3S91 A;  4MEQ A;  3MUL A;  4MEO A;  5A85 A;  2L84 A;  2RNX A;  5ENF A;  2RO1 A;  3HMH A;  5DFC A;  5EGU A;  5CQ5 A;  2NXB A;  3MQM A;  4N4F A;  5F1L A;  2YQD A;  3Q2E A;  4PS5 A;  4Q0O A;  3Q2F A;  4YBT A;  4BW2 A;  2R10 A;  4CFK A;  5L98 A;  4NQN A;  5LKX A;  5BT5 A;  5IGM A;  2RNW A;  4N4I A;  2YEK A;  5CU8 A;  4YH4 A;  3ONI A;  3P1C A;  4Q0N A;  5CUB A;  4Z1Q A;  4CFL A;  1N72 A;  3DAI A;  4UIY A;  4O75 A;  4QUU A;  4UYG A;  4IR5 A;  4A9E A;  4TT2 A;  4QEW A;  5C89 A;  3QZT A;  5CZG A;  5H1V A;  4TYL A;  4QSS A;  5AME A;  5ENJ A;  5D3S A;  5DYA A;  2R0V A;  4CUP A;  4ZW1 A;  5IGN A;  5IG6 A;  5J0D A;  5F5Z A;  5EM3 A;  5FE6 A;  4F3I A;  5LJ0 A;  4CUU A;  5EA1 A;  4NR6 A;  5LVR A;  1JM4 B;  4TT4 A;  4J3I A;  2R0Y A;  4QSQ A;  2N9G A;  2OO1 A;  4QZS A;  5LVQ A;  5E9K A;  2RFJ A;  4PCI A;  5A83 A;  5F36 A;  4HBX A;  4BW1 A;  3O34 A;  5H1U A;  4A9H A;  4QSV A;  4LZS A;  4YYH A;  4YY4 A;  4LC2 A;  4LRG A;  4O7E A;  5I29 A;  4NR5 A;  1ZS5 A;  5DFB A;  2DVS A;  4TS8 A;  5EVA A;  3UV2 A;  2OUO A;  4HBW A;  5A5S A;  4XY9 A;  5II1 A;  4TTE A;  5L8T A;  3U5M A;  5E9I A;  5CUE A;  4A9L A;  5ENI A;  3IU6 A;  5EWV A;  4O78 A;  5I88 A;  5ETB A;  5HRX A;  5K29 A;  5F25 A;  5CRM A;  5DKH A;  5F63 A;  4CUR A;  5CY9 A;  4C67 A;  3QZS A;  5HQ7 A;  3MXF A;  3NXB A;  5DLZ A;  5CQ3 A;  3UVY A;  5DBM A;  4YYK A;  3QZV A;  5EWC A;  2R0S A;  5DYC A;  2G4A A;  4HXR A;  4AKN A;  5EQ1 A;  4KV4 A;  5EPB A;  5E73 A;  5CQ8 A;  5FE3 A;  5C85 A;  5I7X A;  4WIV A;  5C7N A;  3SVG A;  5KTU A;  4HXO A;  2DVR A;  4A9I A;  2E3K A;  1E6I A;  4PKL A;  5CUG A;  5EPS A;  2D82 A;  5II2 A;  4YYG A;  4PTB A;  4ALG A;  5D3P A;  3UVW A;  3JVM A;  5CTL A;  3MB4 A;  2YEL A;  4YBM A;  5FE1 A;  5CQT A;  4LR6 A;  3JVL A;  3AAD A;  4NR7 A;  5L97 A;  5E9L A;  5LKZ A;  5FG4 A;  3IU5 A;  4FLP A;  4NXJ A;  5ENG A;  2GRC A;  5D25 A;  3P1F A;  4HXP A;  2MJV B;  3U5O A;  5EP7 A;  5FE7 A;  2RS9 B;  4UIT A;  2L5E A;  4QC3 A;  5DKD A;  4HXM A;  2DAT A;  2L85 A;  5AMF A;  4O7F A;  2DWW A;  5E0R A;  4XY8 A;  4A9N A;  4NR4 A;  5CFW A;  5D3N A;  4OUF A;  5G4S A;  4TQN A;  4YAT A;  4X2I A;  5LKT A;  4ZC9 A;  4J0S A;  5D7X A;  5FFY A;  4QR5 A;  2E7N A;  4QNS A;  2RI7 A;  4HXK A;  3UV5 A;  5LJ1 A;  4NUC A;  5CGP A;  5I89 A;  5EIS A;  5EWH A;  4NUD A;  4CLB A;  4YAD A;  5E9Y A;  5KU3 A;  4N3W A;  4UIW A;  4O7A A;  3UW9 A;  4YYJ A;  4YH3 A;  3U5J A;  4O72 A;  5D3L A;  4N4G A;  4HBY A;  5HRV A;  3P1D A;  4DON A;  3TLP A;  5EV9 A;  3G0J A;  1JSP B;  5H85 A;  4QSP A;  5CQ7 A;  5G4R A;  4Z1S A;  4A9J A;  5H1T A;  1WUG A;  4BHW A;  5D3H A;  4QEV A;  5CS8 A;  4QC1 A;  5E74 A;  5CPE A;  5TCM A;  4Y03 A;  1WUM A;  4TT6 A;  3JVJ A;  2I8N A;  3UV4 A;  1F68 A;  5LJ2 A;  4NRB A;  4MR6 A;  3O35 A;  4QYD A;  4YAB A;  3G0L A;  4C66 A;  5C4Q A;  4NS5 A;  5DW1 A;  5IBN A;  4NR8 A;  5DW2 A;  3U5N A;  5E3G A;  5CUC A;  5COI A;  3S92 A;  5ENE A;  5A7C A;  3UVD A;  4O76 A;  4WHW A;  5A5P A;  4YY6 A;  4QST A;  5E9M A;  5I86 A;  3I3J A;  5C87 A;  3MB3 A;  3LQH A;  4YAX A;  5LUU A;  3U5P A;  5ENC A;  5ENB A;  3GG3 A;  2WP1 A;  5HEN A;  4Z93 A;  2DVV A;  5DYX A;  5F60 A;  5LKU A;  5TB6 A;  4WHU A;  2DVQ A;  4QEU A;  5HFQ A;  3AQA A;  5A82 A;  5ENH A;  3DWY A;  4LZR A;  5DX4 A;  4N4H A;  4UIU A;  5IGL A;  5DLX A;  5F62 A;  5FE5 A;  4UYD A;  5D26 A;  4YBS A;  4QR3 A;  4A9F A;  3K2J A;  3O37 A;  4NQM A;  5DKC A;  3UVX A;  5FE8 A;  2RNY A;  4LDF A;  5FB0 A;  3P1E A;  2E7O A;  4MR5 A;  4QYL A;  4IOR A;  4IR3 A;  2F6N A;  4MEN A;  5I1Q A;  4HBV A;  4J0R A;  5L99 A;  5ACY A;  3SVF A;  5FH6 A;  5D0C A;  4MR4 A;  5E3D A;  4MR3 A;  5FE9 A;  2WP2 A;  5D3T A;  4O74 A;  2D9E A;  4TZ2 A;  5A5O A;  5BT3 A;  4A9O A;  4ALH A;  4QBM A;  2FSA A;  5E7D A;  4E96 A;  3FKM X;  5DFD A;  2H60 A;  5EIC A;  5HLS A;  4TZ8 A;  4IR4 A;  5HQ6 A;  4IOO A;  5FH8 A;  4HXN A;  2DKW A;  4QSR A;  5DYU A;  5C8G A;  5F1H A;  5HEL A;  5FG5 A;  5CQ4 A;  4YYN A;  4NR9 A;  4QSX A;  4KCX A;  4UYF B;  4XUB A;  5A81 A;  4CUT A;  4LYW A;  4O7C A;  4BJX A;  4CL9 A;  5CP5 A;  4OGI A;  5L96 A;  5FB1 A;  5F61 A;  3LXJ A;  5FDZ A;  5KHM A;  5DY7 A;  4NUE A;  4ZQL A;  5FBX A;  5CUA A;  2F6J A;  3SVH A;  5EI4 A;  3U5K A;  4QSW A;  4NRA A;  4UIV A;  5FG6 A;  5HM0 A;  3LQI A;  4UYH A;  4CUS A;  5EU1 A;  5A5R A;  4GPJ A;  5HJC A;  5JWM A;  5EWW A;  5KTX A;  4Z6H A;  3MUK A;  4A9K A;  2LSP B;  4LZ2 A;  5FE4 A;  5HCL A;  5AD2 A;  4QB3 A;  5HEM A;  4NYW A;  2I7K A;  4PY6 A;  4QR4 A;  4QY4 A;  5HQ5 A;  4XUA A;  4UYF A;  5CUD A;  5A5Q A;  4QSU A;  4BW3 A;  4KV1 A;  5KTW A;  4HXL A;  4BW4 A;  2YYN A;  3O36 A;  3LJW A;  5D3J A;  5CQ6 A;  4YYM A;  5I80 A;  5EPR A;  3ZYU A;  4O77 A;  5KO4 A;  5F3A A;  5EWD A;  3HMF A;  5FH7 A;  4IR6 A;  4RVR A;  4O7B A;  4YK0 A;  4UIZ A;  5D24 A;  4PCE A;  5EK9 A;  5L8U A;  5A5N A;  4CUQ A;  3LQJ A;  1X0J A;  2YDW A;  4TU4 A;  3RCW A;  4J1P A;  5FFV A;  4OGJ A;  5IGK A;  3HME A;  5ETD A;  5FE0 A;  5FFW A;  3P5O A;  5AD3 A;  5HFR A;  4IOQ A;  4Z6I A;  5CRZ A;  4QUT A;  4UYE A;  4LYS A;  4NRC A;  4MEP A;  5I7Y A;  2KTB B;  2YW5 A;  4O70 A;  5E9V A;  4HXS A;  5BT4 A;  5I83 A;  2OSS A;  2YEM A;  4LYI A;  4YYI A;  5HRW A;  4NYX A;  5IID A;  3O33 A;  1EQF A;  4A9M A;  3U5L A;  4UIX A;  4YC9 A;  5F2P A;  4YYD A;  5JI8 A;  4O71 A;  5D3R A;  5CQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...