5J0DA

Crystal structure of the bromodomain of human crebbp in complex with a benzoxazepine compound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
117
structure length
117
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords CREB-binding protein
publication title Development of Selective CBP/P300 Benzoxazepine Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 117
sequence length 117
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5j0dA00
3S91A 4NR4A 5DW2A 5HFRA 2GRCA 3O34A 2KTBB 4ALHA 5CUAA 2RFJA 4AKNA 3SVGA 4HBYA 4LC2A 5HM0A 5D3LA 4QR5A 3S92A 5DKHA 2R10A 5CQ8A 4QNSA 5CFWA 2YEMA 5KTUA 3LQIA 4OUFA 4A9FA 4QSVA 2OSSA 5H1VA 4PY6A 5ENIA 4CUSA 5D3NA 4NR9A 4Q0OA 4BW1A 5L99A 5FDZA 3U5JA 5CRZA 4MR5A 5E74A 2D9EA 4KCXA 4A9HA 2WP2A 4WIVA 5D3RA 4QSPA 2RNYA 4YYMA 5DKCA 5DFCA 3Q2EA 5EPRA 5HQ6A 4CURA 3IU5A 4UIYA 3UV4A 4QBMA 3FKMX 2RO1A 5EISA 5ACYA 4O76A 5IIDA 4LRGA 4O70A 5E9VA 3QZTA 4N3WA 5CQAA 4YYJA 3D7CA 4A9NA 5BT4A 5F61A 4MR3A 5CGPA 2L84A 4TT2A 4RVRA 5CQTA 5KHMA 5DFBA 5TB6A 4BJXA 3IU6A 3LXJA 5CUGA 5ENFA 5BT5A 4CUTA 4NRBA 4LZ2A 4HBWA 4IR6A 3P1CA 1EQFA 5D24A 5D26A 5HRVA 4NQNA 5FH7A 4Z1QA 4TT4A 2I7KA 4MENA 4O7EA 5IBNA 4BW3A 5C7NA 4ZC9A 5DY7A 4TZ8A 4CUUA 4Q0NA 2RS9B 5DYCA 5DYAA 5DLXA 4O77A 5H85A 5DX4A 4LYWA 4NQMA 5LUUA 2R0YA 4N4IA 4YYKA 4CUPA 5F2PA 4BW2A 4A9EA 5F1HA 2RNWA 5I1QA 3AQAA 5E9IA 3UW9A 4CL9A 5ENCA 4Z1SA 4IR5A 5EGUA 4NS5A 4QYLA 5I89A 3P5OA 5LVRA 4ALGA 2FSAA 4YABA 5FE1A 4IR4A 5E73A 5BT3A 4UITA 5JI8A 4KV4A 5FE7A 5DLZA 5HRXA 4O7AA 5G4RA 5EM3A 5AMFA 5A5SA 5EWHA 4NUCA 5I40A 4NR6A 5CQ5A 4LZSA 4QUUA 5FBXA 3JVJA 5CY9A 4QEWA 5E9LA 5LJ0A 2E3KA 5LJ2A 5HCLA 4DONA 4IOQA 4A9OA 5DFDA 1X0JA 5D3SA 4YYIA 5C85A 5HQ5A 3U5KA 2YELA 4A9IA 3HMFA 3MB4A 5HLSA 5FG5A 4NXJA 1F68A 5ENHA 5LKXA 4O7BA 4UIXA 4QSWA 4O74A 5ENGA 4LYIA 4WHUA 4MR4A 4IORA 4YATA 5IG6A 4QB3A 4A9MA 4YK0A 5CQ7A 4GPJA 4UIVA 5COIA 4J0RA 4CFKA 5EV9A 5TCMA 4YBSA 3G0LA 4J3IA 4YAXA 5I86A 4Z6IA 5EWWA 5CQ6A 5CUCA 5H1UA 3HMEA 4WHWA 5F5ZA 3UVYA 5C89A 4HXLA 5LKTA 3U5LA 5G4SA 4HXOA 5EU1A 5LJ1A 5HEMA 4MEPA 3U5PA 5DBMA 3MUKA 5FG6A 4UIWA 2R0VA 5A5RA 4XUAA 5EQ1A 3SVFA 4UIZA 3MXFA 2RI7A 4N4GA 4Y03A 4O7CA 3MB3A 4NR5A 5EWCA 5EWVA 5HQ7A 5LVQA 1WUGA 4QSQA 5D3HA 5I7XA 4J0SA 4KV1A 3U5OA 5CUEA 5CPEA 4HXRA 5DKDA 5A82A 4MEOA 5F1LA 2WP1A 3MULA 5FE6A 4YH3A 5AD3A 3O35A 5EPBA 1N72A 5E9KA 5F3AA 4PTBA 4HBVA 4Z6HA 1WUMA 5E9MA 5E9YA 4YBTA 5DYXA 2NXBA 4QR3A 3UVWA 5HJCA 5FE3A 4IOOA 4LDFA 5EVAA 5F60A 4XYAA 4TU4A 4QY4A 4YH4A 4YYDA 5AMEA 3I3JA 5CTLA 3UVXA 4NR7A 5EPSA 5C8GA 4OGIA 5D7XA 5HELA 4QR4A 4TS8A 4A9LA 4XUBA 4TTEA 4OGJA 2RNXA 5FB1A 4F3IA 4QSXA 2DWWA 1E6IA 4NUEA 4TT6A 4LYSA 5E3GA 4C67A 3LJWA 5I29A 5A7CA 3UVDA 3P1FA 4MR6A 3O36A 4YYNA 4MEQA 4QZSA 5F25A 2YEKA 3P1EA 2YQDA 5CRMA 5FE5A 4QSRA 2YDWA 5JWMA 4NYWA 3LQJA 5IGLA 5FE2A 5I88A 5I83A 5ENBA 4UYDA 4NRCA 5FE8A 5A5OA 4YC9A 3TLPA 2E7NA 4ZW1A 4X2IA 3RCWA 5CUDA 5A83A 4NYVA 4UIUA 4YADA 4A9JA 4QSSA 5EA1A 2R0SA 5LKUA 3DWYA 5F62A 4QYDA 2DVQA 5IGKA 5AD2A 3NXBA 4O75A 4Z93A 4YBMA 3HMHA 5L8UA 5E3DA 2F6NA 2N9GA 4FLPA 4TYLA 5CP5A 4QEUA 2E7OA 4O7FA 4CUQA 4YY4A 3JVMA 4UYFA 1JM4B 2DVSA 2G4AA 4QUTA 4PKLA 5FE4A 5FFVA 4BW4A 4XY9A 5F36A 4QSUA 5DW1A 5H1TA 4NUDA 5FH6A 3ZYUA 3U5MA 5I80A 5F63A 4CLBA 2MJVB 5A5PA 4NRAA 4YYHA 5EICA 5KTWA 1ZS5A 2H60A 2DKWA 3K2JA 5ETDA 4QC3A 3DAIA 2OO1A 5FE0A 4UYGA 5HRWA 3Q2FA 4ZQLA 3MQMA 4LR6A 3G0JA 4C66A 5ENJA 3LQHA 4YYGA 5D3JA 2YYNA 3UV5A 2LSPB 5E0RA 3P1DA 3O33A 5CQ4A 5A5NA 4O71A 4N4HA 5D0CA 5L96A 4N4FA 2OUOA 5L97A 4UYFB 5CZGA 5CQ3A 4UYHA 5IGNA 5CU8A 3UV2A 4E96A 4PCEA 5L8TA 3AADA 5KTXA 5I7YA 2F6JA 5K29A 4LZRA 2I8NA 5A81A 5D3PA 5EP7A 5FFWA 4UYEA 4TU6A 5II2A 4HXSA 4PCIA 4HXMA 4IR3A 3JVKA 4TQNA 4QSTA 5D25A 2D82A 5FE9A 4TZ2A 5C4QA 5C87A 5DYUA 3U5NA 4J1PA 5ENEA 3JVLA 3SVHA 5KO4A 5A85A 2DVRA 5E7DA 5A5QA 3QZVA 5II1A 3QZSA 4HXPA 4A9KA 4O72A 5FFYA 5FG4A 5CS8A 2DATA 2L5EA 5EWDA 2DVVA 5KU3A 5HENA 3GG3A 5EI4A 5EK9A 4CFLA 5LKZA 4HBXA 5CUBA 4QEVA 4XY8A 4HXNA 4HXKA 5FB0A 5IGMA 4BHWA 4NYXA 5J0DA 4QC1A 5D3TA 5ETBA 2YW5A 4YY6A 4PS5A 3O37A 5L98A 4O78A 2L85A 5FH8A 4NR8A 3ONIA 5HFQA 1JSPB
chains in the Genus database with same CATH superfamily
3S91A 4NR4A 5DW2A 5HFRA 2GRCA 3O34A 2KTBB 4ALHA 5CUAA 2RFJA 4AKNA 3SVGA 4HBYA 4LC2A 5HM0A 5D3LA 4QR5A 3S92A 5DKHA 2R10A 5CQ8A 4QNSA 5CFWA 2YEMA 5KTUA 3LQIA 4OUFA 4A9FA 4QSVA 2OSSA 5H1VA 4PY6A 5ENIA 4CUSA 5D3NA 4NR9A 4Q0OA 4BW1A 5L99A 5FDZA 3U5JA 5CRZA 4MR5A 5E74A 2D9EA 4KCXA 4A9HA 2WP2A 4WIVA 5D3RA 4QSPA 2RNYA 4YYMA 5DKCA 5DFCA 3Q2EA 5EPRA 5HQ6A 4CURA 3IU5A 4UIYA 3UV4A 4QBMA 3FKMX 2RO1A 5EISA 5ACYA 4O76A 5IIDA 4LRGA 4O70A 5E9VA 3QZTA 4N3WA 5CQAA 4YYJA 3D7CA 4A9NA 5BT4A 5F61A 4MR3A 5CGPA 2L84A 4TT2A 4RVRA 5CQTA 5KHMA 5DFBA 5TB6A 4BJXA 3IU6A 3LXJA 5CUGA 5ENFA 5BT5A 4CUTA 4NRBA 4LZ2A 4HBWA 4IR6A 3P1CA 1EQFA 5D24A 5D26A 5HRVA 4NQNA 5FH7A 4Z1QA 4TT4A 2I7KA 4MENA 4O7EA 5IBNA 4BW3A 5C7NA 4ZC9A 5DY7A 4TZ8A 4CUUA 4Q0NA 2RS9B 5DYCA 5DYAA 5DLXA 4O77A 5H85A 5DX4A 4LYWA 4NQMA 5LUUA 2R0YA 4N4IA 4YYKA 4CUPA 5F2PA 4BW2A 4A9EA 5F1HA 2RNWA 5I1QA 3AQAA 5E9IA 3UW9A 4CL9A 5ENCA 4Z1SA 4IR5A 5EGUA 4NS5A 4QYLA 5I89A 3P5OA 5LVRA 4ALGA 2FSAA 4YABA 5FE1A 4IR4A 5E73A 5BT3A 4UITA 5JI8A 4KV4A 5FE7A 5DLZA 5HRXA 4O7AA 5G4RA 5EM3A 5AMFA 5A5SA 5EWHA 4NUCA 5I40A 4NR6A 5CQ5A 4LZSA 4QUUA 5FBXA 3JVJA 5CY9A 4QEWA 5E9LA 5LJ0A 2E3KA 5LJ2A 5HCLA 4DONA 4IOQA 4A9OA 5DFDA 1X0JA 5D3SA 4YYIA 5C85A 5HQ5A 3U5KA 2YELA 4A9IA 3HMFA 3MB4A 5HLSA 5FG5A 4NXJA 1F68A 5ENHA 5LKXA 4O7BA 4UIXA 4QSWA 4O74A 5ENGA 4LYIA 4WHUA 4MR4A 4IORA 4YATA 5IG6A 4QB3A 4A9MA 4YK0A 5CQ7A 4GPJA 4UIVA 5COIA 4J0RA 4CFKA 5EV9A 5TCMA 4YBSA 3G0LA 4J3IA 4YAXA 5I86A 4Z6IA 5EWWA 5CQ6A 5CUCA 5H1UA 3HMEA 4WHWA 5F5ZA 2EJNA 3UVYA 5C89A 4HXLA 5LKTA 3U5LA 5G4SA 4HXOA 5EU1A 5LJ1A 5HEMA 4MEPA 3U5PA 5DBMA 3MUKA 5FG6A 4UIWA 2R0VA 5A5RA 4XUAA 5EQ1A 3SVFA 4UIZA 3MXFA 1ZKRA 2RI7A 4N4GA 4Y03A 4O7CA 3MB3A 4NR5A 5EWCA 5EWVA 5HQ7A 5LVQA 1WUGA 4QSQA 5D3HA 5I7XA 4J0SA 4KV1A 3U5OA 5CUEA 5CPEA 3D1DA 4HXRA 5DKDA 5A82A 4MEOA 5F1LA 2WP1A 3MULA 5FE6A 4YH3A 5AD3A 3O35A 5EPBA 1N72A 5E9KA 5F3AA 4PTBA 4HBVA 4Z6HA 1WUMA 5E9MA 5E9YA 4YBTA 5DYXA 2NXBA 4QR3A 3UVWA 5HJCA 5FE3A 4IOOA 4LDFA 5EVAA 5F60A 4XYAA 4TU4A 4QY4A 4YH4A 4YYDA 5AMEA 3I3JA 5CTLA 3UVXA 4NR7A 5EPSA 5C8GA 4OGIA 5D7XA 5HELA 4QR4A 4TS8A 4A9LA 4XUBA 4TTEA 4OGJA 2RNXA 5FB1A 4F3IA 4QSXA 2DWWA 1E6IA 4NUEA 4TT6A 4LYSA 5E3GA 4C67A 4AKHA 3LJWA 5I29A 5A7CA 3UVDA 3P1FA 4MR6A 3O36A 4YYNA 4MEQA 4QZSA 5F25A 2YEKA 3P1EA 2YQDA 5CRMA 5FE5A 4QSRA 2YDWA 5JWMA 4NYWA 4AKGA 3LQJA 5IGLA 5FE2A 5I88A 5I83A 5ENBA 4UYDA 4NRCA 5FE8A 5A5OA 4YC9A 3TLPA 2E7NA 3VKGA 4ZW1A 4X2IA 3RCWA 5CUDA 5A83A 4NYVA 4UIUA 4YADA 4A9JA 4QSSA 5EA1A 2R0SA 5LKUA 3DWYA 5F62A 4QYDA 2DVQA 5IGKA 5AD2A 3NXBA 4O75A 4Z93A 4YBMA 3HMHA 5L8UA 5E3DA 2F6NA 2N9GA 4FLPA 4TYLA 5CP5A 4QEUA 2E7OA 4O7FA 4CUQA 4YY4A 3JVMA 4UYFA 1JM4B 2DVSA 2G4AA 4QUTA 4PKLA 5FE4A 5FFVA 4BW4A 4XY9A 5F36A 4QSUA 5DW1A 5H1TA 4NUDA 5FH6A 3D1BA 3ZYUA 3U5MA 5I80A 5F63A 4CLBA 2MJVB 5A5PA 4NRAA 4YYHA 5EICA 5KTWA 1ZS5A 2H60A 2DKWA 3K2JA 5ETDA 4QC3A 3DAIA 2OO1A 5FE0A 4UYGA 5HRWA 3Q2FA 4ZQLA 3MQMA 4LR6A 3G0JA 4C66A 5ENJA 3LQHA 4YYGA 5D3JA 2YYNA 3UV5A 2LSPB 5E0RA 3P1DA 3O33A 5CQ4A 5A5NA 4O71A 4N4HA 5D0CA 5L96A 4N4FA 2OUOA 5L97A 4UYFB 5CZGA 5CQ3A 4UYHA 5IGNA 5CU8A 3UV2A 4E96A 4PCEA 5L8TA 3AADA 5KTXA 5I7YA 2F6JA 5K29A 4AKIA 4LZRA 2I8NA 5A81A 5D3PA 3ERRA 5EP7A 5FFWA 4UYEA 4TU6A 5II2A 4HXSA 4PCIA 4HXMA 4IR3A 3JVKA 4TQNA 4QSTA 5D25A 2D82A 5FE9A 4TZ2A 5C4QA 5C87A 5DYUA 3U5NA 4AI6A 4J1PA 5ENEA 3JVLA 3SVHA 5KO4A 5A85A 2DVRA 5E7DA 5A5QA 3QZVA 5II1A 3QZSA 4HXPA 4A9KA 3VKHA 4O72A 5FFYA 5FG4A 5CS8A 2DATA 2L5EA 5EWDA 2DVVA 5KU3A 5HENA 3GG3A 5EI4A 5EK9A 4CFLA 5LKZA 4HBXA 5CUBA 4QEVA 4XY8A 1PUOA 4HXNA 4HXKA 5FB0A 5IGMA 4BHWA 4NYXA 5J0DA 4QC1A 5D3TA 5ETBA 2YW5A 4YY6A 4PS5A 3O37A 5L98A 4O78A 2L85A 5FH8A 4NR8A 3ONIA 5HFQA 1JSPB
chains in the Genus database with same CATH topology
3S91A 4NR4A 5DW2A 5HFRA 2GRCA 3O34A 2KTBB 4ALHA 5CUAA 2RFJA 4AKNA 3SVGA 4HBYA 4LC2A 5HM0A 5D3LA 4QR5A 3S92A 5DKHA 2R10A 5CQ8A 4QNSA 5CFWA 2YEMA 5KTUA 3LQIA 4OUFA 4A9FA 4QSVA 2OSSA 5H1VA 4PY6A 5ENIA 4CUSA 5D3NA 4NR9A 4Q0OA 4BW1A 5L99A 5FDZA 3U5JA 5CRZA 4MR5A 5E74A 2D9EA 4KCXA 4A9HA 2WP2A 4WIVA 5D3RA 4QSPA 2RNYA 4YYMA 5DKCA 5DFCA 3Q2EA 5EPRA 5HQ6A 4CURA 3IU5A 4UIYA 3UV4A 4QBMA 3FKMX 2RO1A 5EISA 5ACYA 4O76A 5IIDA 4LRGA 4O70A 5E9VA 3QZTA 4N3WA 5CQAA 4YYJA 3D7CA 4A9NA 5BT4A 5F61A 4MR3A 5CGPA 2L84A 4TT2A 4RVRA 5CQTA 5KHMA 5DFBA 5TB6A 4BJXA 3IU6A 3LXJA 5CUGA 5ENFA 5BT5A 4CUTA 4NRBA 4LZ2A 4HBWA 4IR6A 3P1CA 1EQFA 5D24A 5D26A 5HRVA 4NQNA 5FH7A 4Z1QA 4TT4A 2I7KA 4MENA 4O7EA 5IBNA 4BW3A 5C7NA 4ZC9A 5DY7A 4TZ8A 4CUUA 4Q0NA 2RS9B 5DYCA 5DYAA 5DLXA 4O77A 5H85A 5DX4A 4LYWA 4NQMA 5LUUA 2R0YA 4N4IA 4YYKA 4CUPA 5F2PA 4BW2A 4A9EA 5F1HA 2RNWA 5I1QA 3AQAA 5E9IA 3UW9A 4CL9A 5ENCA 4Z1SA 4IR5A 5EGUA 4NS5A 4QYLA 5I89A 3P5OA 5LVRA 4ALGA 2FSAA 4YABA 5FE1A 4IR4A 5E73A 5BT3A 4UITA 5JI8A 4KV4A 5FE7A 5DLZA 5HRXA 4O7AA 5G4RA 5EM3A 5AMFA 5A5SA 5EWHA 4NUCA 5I40A 4NR6A 5CQ5A 4LZSA 4QUUA 5FBXA 3JVJA 5CY9A 4QEWA 5E9LA 5LJ0A 2E3KA 5LJ2A 5HCLA 4DONA 4IOQA 4A9OA 5DFDA 1X0JA 5D3SA 4YYIA 5C85A 5HQ5A 3U5KA 2YELA 4A9IA 3HMFA 3MB4A 5HLSA 5FG5A 4NXJA 1F68A 5ENHA 5LKXA 4O7BA 4UIXA 4QSWA 4O74A 5ENGA 4LYIA 4WHUA 4MR4A 4IORA 4YATA 5IG6A 4QB3A 4A9MA 4YK0A 5CQ7A 4GPJA 4UIVA 5COIA 4J0RA 4CFKA 5EV9A 5TCMA 4YBSA 3G0LA 4J3IA 4YAXA 5I86A 4Z6IA 5EWWA 5CQ6A 5CUCA 5H1UA 3HMEA 4WHWA 5F5ZA 3UVYA 5C89A 4HXLA 5LKTA 3U5LA 5G4SA 4HXOA 5EU1A 5LJ1A 5HEMA 4MEPA 3U5PA 5DBMA 3MUKA 5FG6A 4UIWA 2R0VA 5A5RA 4XUAA 5EQ1A 3SVFA 4UIZA 3MXFA 2RI7A 4N4GA 4Y03A 4O7CA 3MB3A 4NR5A 5EWCA 5EWVA 5HQ7A 5LVQA 1WUGA 4QSQA 5D3HA 5I7XA 4J0SA 4KV1A 3U5OA 5CUEA 5CPEA 4HXRA 5DKDA 5A82A 4MEOA 5F1LA 2WP1A 3MULA 5FE6A 4YH3A 5AD3A 3O35A 5EPBA 1N72A 5E9KA 5F3AA 4PTBA 4HBVA 4Z6HA 1WUMA 5E9MA 5E9YA 4YBTA 5DYXA 2NXBA 4QR3A 3UVWA 5HJCA 5FE3A 4IOOA 4LDFA 5EVAA 5F60A 4XYAA 4TU4A 4QY4A 4YH4A 4YYDA 5AMEA 3I3JA 5CTLA 3UVXA 4NR7A 5EPSA 5C8GA 4OGIA 5D7XA 5HELA 4QR4A 4TS8A 4A9LA 4XUBA 4TTEA 4OGJA 2RNXA 5FB1A 4F3IA 4QSXA 2DWWA 1E6IA 4NUEA 4TT6A 4LYSA 5E3GA 4C67A 3LJWA 5I29A 5A7CA 3UVDA 3P1FA 4MR6A 3O36A 4YYNA 4MEQA 4QZSA 5F25A 2YEKA 3P1EA 2YQDA 5CRMA 5FE5A 4QSRA 2YDWA 5JWMA 4NYWA 3LQJA 5IGLA 5FE2A 5I88A 5I83A 5ENBA 4UYDA 4NRCA 5FE8A 5A5OA 4YC9A 3TLPA 2E7NA 4ZW1A 4X2IA 3RCWA 5CUDA 5A83A 4NYVA 4UIUA 4YADA 4A9JA 4QSSA 5EA1A 2R0SA 5LKUA 3DWYA 5F62A 4QYDA 2DVQA 5IGKA 5AD2A 3NXBA 4O75A 4Z93A 4YBMA 3HMHA 5L8UA 5E3DA 2F6NA 2N9GA 4FLPA 4TYLA 5CP5A 4QEUA 2E7OA 4O7FA 4CUQA 4YY4A 3JVMA 4UYFA 1JM4B 2DVSA 2G4AA 4QUTA 4PKLA 5FE4A 5FFVA 4BW4A 4XY9A 5F36A 4QSUA 5DW1A 5H1TA 4NUDA 5FH6A 3ZYUA 3U5MA 5I80A 5F63A 4CLBA 2MJVB 5A5PA 4NRAA 4YYHA 5EICA 5KTWA 1ZS5A 2H60A 2DKWA 3K2JA 5ETDA 4QC3A 3DAIA 2OO1A 5FE0A 4UYGA 5HRWA 3Q2FA 4ZQLA 3MQMA 4LR6A 3G0JA 4C66A 5ENJA 3LQHA 4YYGA 5D3JA 2YYNA 3UV5A 2LSPB 5E0RA 3P1DA 3O33A 5CQ4A 5A5NA 4O71A 4N4HA 5D0CA 5L96A 4N4FA 2OUOA 5L97A 4UYFB 5CZGA 5CQ3A 4UYHA 5IGNA 5CU8A 3UV2A 4E96A 4PCEA 5L8TA 3AADA 5KTXA 5I7YA 2F6JA 5K29A 4LZRA 2I8NA 5A81A 5D3PA 5EP7A 5FFWA 4UYEA 4TU6A 5II2A 4HXSA 4PCIA 4HXMA 4IR3A 3JVKA 4TQNA 4QSTA 5D25A 2D82A 5FE9A 4TZ2A 5C4QA 5C87A 5DYUA 3U5NA 4J1PA 5ENEA 3JVLA 3SVHA 5KO4A 5A85A 2DVRA 5E7DA 5A5QA 3QZVA 5II1A 3QZSA 4HXPA 4A9KA 4O72A 5FFYA 5FG4A 5CS8A 2DATA 2L5EA 5EWDA 2DVVA 5KU3A 5HENA 3GG3A 5EI4A 5EK9A 4CFLA 5LKZA 4HBXA 5CUBA 4QEVA 4XY8A 4HXNA 4HXKA 5FB0A 5IGMA 4BHWA 4NYXA 5J0DA 4QC1A 5D3TA 5ETBA 2YW5A 4YY6A 4PS5A 3O37A 5L98A 4O78A 2L85A 5FH8A 4NR8A 3ONIA 5HFQA 1JSPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S91 A;  4NR4 A;  5DW2 A;  5HFR A;  2GRC A;  3O34 A;  2KTB B;  4ALH A;  5CUA A;  2RFJ A;  4AKN A;  3SVG A;  4HBY A;  4LC2 A;  5HM0 A;  5D3L A;  4QR5 A;  3S92 A;  5DKH A;  2R10 A;  5CQ8 A;  4QNS A;  5CFW A;  2YEM A;  5KTU A;  3LQI A;  4OUF A;  4A9F A;  4QSV A;  2OSS A;  5H1V A;  4PY6 A;  5ENI A;  4CUS A;  5D3N A;  4NR9 A;  4Q0O A;  4BW1 A;  5L99 A;  5FDZ A;  3U5J A;  5CRZ A;  4MR5 A;  5E74 A;  2D9E A;  4KCX A;  4A9H A;  2WP2 A;  4WIV A;  5D3R A;  4QSP A;  2RNY A;  4YYM A;  5DKC A;  5DFC A;  3Q2E A;  5EPR A;  5HQ6 A;  4CUR A;  3IU5 A;  4UIY A;  3UV4 A;  4QBM A;  3FKM X;  2RO1 A;  5EIS A;  5ACY A;  4O76 A;  5IID A;  4LRG A;  4O70 A;  5E9V A;  3QZT A;  4N3W A;  5CQA A;  4YYJ A;  3D7C A;  4A9N A;  5BT4 A;  5F61 A;  4MR3 A;  5CGP A;  2L84 A;  4TT2 A;  4RVR A;  5CQT A;  5KHM A;  5DFB A;  5TB6 A;  4BJX A;  3IU6 A;  3LXJ A;  5CUG A;  5ENF A;  5BT5 A;  4CUT A;  4NRB A;  4LZ2 A;  4HBW A;  4IR6 A;  3P1C A;  1EQF A;  5D24 A;  5D26 A;  5HRV A;  4NQN A;  5FH7 A;  4Z1Q A;  4TT4 A;  2I7K A;  4MEN A;  4O7E A;  5IBN A;  4BW3 A;  5C7N A;  4ZC9 A;  5DY7 A;  4TZ8 A;  4CUU A;  4Q0N A;  2RS9 B;  5DYC A;  5DYA A;  5DLX A;  4O77 A;  5H85 A;  5DX4 A;  4LYW A;  4NQM A;  5LUU A;  2R0Y A;  4N4I A;  4YYK A;  4CUP A;  5F2P A;  4BW2 A;  4A9E A;  5F1H A;  2RNW A;  5I1Q A;  3AQA A;  5E9I A;  3UW9 A;  4CL9 A;  5ENC A;  4Z1S A;  4IR5 A;  5EGU A;  4NS5 A;  4QYL A;  5I89 A;  3P5O A;  5LVR A;  4ALG A;  2FSA A;  4YAB A;  5FE1 A;  4IR4 A;  5E73 A;  5BT3 A;  4UIT A;  5JI8 A;  4KV4 A;  5FE7 A;  5DLZ A;  5HRX A;  4O7A A;  5G4R A;  5EM3 A;  5AMF A;  5A5S A;  5EWH A;  4NUC A;  5I40 A;  4NR6 A;  5CQ5 A;  4LZS A;  4QUU A;  5FBX A;  3JVJ A;  5CY9 A;  4QEW A;  5E9L A;  5LJ0 A;  2E3K A;  5LJ2 A;  5HCL A;  4DON A;  4IOQ A;  4A9O A;  5DFD A;  1X0J A;  5D3S A;  4YYI A;  5C85 A;  5HQ5 A;  3U5K A;  2YEL A;  4A9I A;  3HMF A;  3MB4 A;  5HLS A;  5FG5 A;  4NXJ A;  1F68 A;  5ENH A;  5LKX A;  4O7B A;  4UIX A;  4QSW A;  4O74 A;  5ENG A;  4LYI A;  4WHU A;  4MR4 A;  4IOR A;  4YAT A;  5IG6 A;  4QB3 A;  4A9M A;  4YK0 A;  5CQ7 A;  4GPJ A;  4UIV A;  5COI A;  4J0R A;  4CFK A;  5EV9 A;  5TCM A;  4YBS A;  3G0L A;  4J3I A;  4YAX A;  5I86 A;  4Z6I A;  5EWW A;  5CQ6 A;  5CUC A;  5H1U A;  3HME A;  4WHW A;  5F5Z A;  3UVY A;  5C89 A;  4HXL A;  5LKT A;  3U5L A;  5G4S A;  4HXO A;  5EU1 A;  5LJ1 A;  5HEM A;  4MEP A;  3U5P A;  5DBM A;  3MUK A;  5FG6 A;  4UIW A;  2R0V A;  5A5R A;  4XUA A;  5EQ1 A;  3SVF A;  4UIZ A;  3MXF A;  2RI7 A;  4N4G A;  4Y03 A;  4O7C A;  3MB3 A;  4NR5 A;  5EWC A;  5EWV A;  5HQ7 A;  5LVQ A;  1WUG A;  4QSQ A;  5D3H A;  5I7X A;  4J0S A;  4KV1 A;  3U5O A;  5CUE A;  5CPE A;  4HXR A;  5DKD A;  5A82 A;  4MEO A;  5F1L A;  2WP1 A;  3MUL A;  5FE6 A;  4YH3 A;  5AD3 A;  3O35 A;  5EPB A;  1N72 A;  5E9K A;  5F3A A;  4PTB A;  4HBV A;  4Z6H A;  1WUM A;  5E9M A;  5E9Y A;  4YBT A;  5DYX A;  2NXB A;  4QR3 A;  3UVW A;  5HJC A;  5FE3 A;  4IOO A;  4LDF A;  5EVA A;  5F60 A;  4XYA A;  4TU4 A;  4QY4 A;  4YH4 A;  4YYD A;  5AME A;  3I3J A;  5CTL A;  3UVX A;  4NR7 A;  5EPS A;  5C8G A;  4OGI A;  5D7X A;  5HEL A;  4QR4 A;  4TS8 A;  4A9L A;  4XUB A;  4TTE A;  4OGJ A;  2RNX A;  5FB1 A;  4F3I A;  4QSX A;  2DWW A;  1E6I A;  4NUE A;  4TT6 A;  4LYS A;  5E3G A;  4C67 A;  3LJW A;  5I29 A;  5A7C A;  3UVD A;  3P1F A;  4MR6 A;  3O36 A;  4YYN A;  4MEQ A;  4QZS A;  5F25 A;  2YEK A;  3P1E A;  2YQD A;  5CRM A;  5FE5 A;  4QSR A;  2YDW A;  5JWM A;  4NYW A;  3LQJ A;  5IGL A;  5FE2 A;  5I88 A;  5I83 A;  5ENB A;  4UYD A;  4NRC A;  5FE8 A;  5A5O A;  4YC9 A;  3TLP A;  2E7N A;  4ZW1 A;  4X2I A;  3RCW A;  5CUD A;  5A83 A;  4NYV A;  4UIU A;  4YAD A;  4A9J A;  4QSS A;  5EA1 A;  2R0S A;  5LKU A;  3DWY A;  5F62 A;  4QYD A;  2DVQ A;  5IGK A;  5AD2 A;  3NXB A;  4O75 A;  4Z93 A;  4YBM A;  3HMH A;  5L8U A;  5E3D A;  2F6N A;  2N9G A;  4FLP A;  4TYL A;  5CP5 A;  4QEU A;  2E7O A;  4O7F A;  4CUQ A;  4YY4 A;  3JVM A;  4UYF A;  1JM4 B;  2DVS A;  2G4A A;  4QUT A;  4PKL A;  5FE4 A;  5FFV A;  4BW4 A;  4XY9 A;  5F36 A;  4QSU A;  5DW1 A;  5H1T A;  4NUD A;  5FH6 A;  3ZYU A;  3U5M A;  5I80 A;  5F63 A;  4CLB A;  2MJV B;  5A5P A;  4NRA A;  4YYH A;  5EIC A;  5KTW A;  1ZS5 A;  2H60 A;  2DKW A;  3K2J A;  5ETD A;  4QC3 A;  3DAI A;  2OO1 A;  5FE0 A;  4UYG A;  5HRW A;  3Q2F A;  4ZQL A;  3MQM A;  4LR6 A;  3G0J A;  4C66 A;  5ENJ A;  3LQH A;  4YYG A;  5D3J A;  2YYN A;  3UV5 A;  2LSP B;  5E0R A;  3P1D A;  3O33 A;  5CQ4 A;  5A5N A;  4O71 A;  4N4H A;  5D0C A;  5L96 A;  4N4F A;  2OUO A;  5L97 A;  4UYF B;  5CZG A;  5CQ3 A;  4UYH A;  5IGN A;  5CU8 A;  3UV2 A;  4E96 A;  4PCE A;  5L8T A;  3AAD A;  5KTX A;  5I7Y A;  2F6J A;  5K29 A;  4LZR A;  2I8N A;  5A81 A;  5D3P A;  5EP7 A;  5FFW A;  4UYE A;  4TU6 A;  5II2 A;  4HXS A;  4PCI A;  4HXM A;  4IR3 A;  3JVK A;  4TQN A;  4QST A;  5D25 A;  2D82 A;  5FE9 A;  4TZ2 A;  5C4Q A;  5C87 A;  5DYU A;  3U5N A;  4J1P A;  5ENE A;  3JVL A;  3SVH A;  5KO4 A;  5A85 A;  2DVR A;  5E7D A;  5A5Q A;  3QZV A;  5II1 A;  3QZS A;  4HXP A;  4A9K A;  4O72 A;  5FFY A;  5FG4 A;  5CS8 A;  2DAT A;  2L5E A;  5EWD A;  2DVV A;  5KU3 A;  5HEN A;  3GG3 A;  5EI4 A;  5EK9 A;  4CFL A;  5LKZ A;  4HBX A;  5CUB A;  4QEV A;  4XY8 A;  4HXN A;  4HXK A;  5FB0 A;  5IGM A;  4BHW A;  4NYX A;  5J0D A;  4QC1 A;  5D3T A;  5ETB A;  2YW5 A;  4YY6 A;  4PS5 A;  3O37 A;  5L98 A;  4O78 A;  2L85 A;  5FH8 A;  4NR8 A;  3ONI A;  5HFQ A;  1JSP B; 
#chains in the Genus database with same CATH topology
 3S91 A;  4NR4 A;  5DW2 A;  5HFR A;  2GRC A;  3O34 A;  2KTB B;  4ALH A;  5CUA A;  2RFJ A;  4AKN A;  3SVG A;  4HBY A;  4LC2 A;  5HM0 A;  5D3L A;  4QR5 A;  3S92 A;  5DKH A;  2R10 A;  5CQ8 A;  4QNS A;  5CFW A;  2YEM A;  5KTU A;  3LQI A;  4OUF A;  4A9F A;  4QSV A;  2OSS A;  5H1V A;  4PY6 A;  5ENI A;  4CUS A;  5D3N A;  4NR9 A;  4Q0O A;  4BW1 A;  5L99 A;  5FDZ A;  3U5J A;  5CRZ A;  4MR5 A;  5E74 A;  2D9E A;  4KCX A;  4A9H A;  2WP2 A;  4WIV A;  5D3R A;  4QSP A;  2RNY A;  4YYM A;  5DKC A;  5DFC A;  3Q2E A;  5EPR A;  5HQ6 A;  4CUR A;  3IU5 A;  4UIY A;  3UV4 A;  4QBM A;  3FKM X;  2RO1 A;  5EIS A;  5ACY A;  4O76 A;  5IID A;  4LRG A;  4O70 A;  5E9V A;  3QZT A;  4N3W A;  5CQA A;  4YYJ A;  3D7C A;  4A9N A;  5BT4 A;  5F61 A;  4MR3 A;  5CGP A;  2L84 A;  4TT2 A;  4RVR A;  5CQT A;  5KHM A;  5DFB A;  5TB6 A;  4BJX A;  3IU6 A;  3LXJ A;  5CUG A;  5ENF A;  5BT5 A;  4CUT A;  4NRB A;  4LZ2 A;  4HBW A;  4IR6 A;  3P1C A;  1EQF A;  5D24 A;  5D26 A;  5HRV A;  4NQN A;  5FH7 A;  4Z1Q A;  4TT4 A;  2I7K A;  4MEN A;  4O7E A;  5IBN A;  4BW3 A;  5C7N A;  4ZC9 A;  5DY7 A;  4TZ8 A;  4CUU A;  4Q0N A;  2RS9 B;  5DYC A;  5DYA A;  5DLX A;  4O77 A;  5H85 A;  5DX4 A;  4LYW A;  4NQM A;  5LUU A;  2R0Y A;  4N4I A;  4YYK A;  4CUP A;  5F2P A;  4BW2 A;  4A9E A;  5F1H A;  2RNW A;  5I1Q A;  3AQA A;  5E9I A;  3UW9 A;  4CL9 A;  5ENC A;  4Z1S A;  4IR5 A;  5EGU A;  4NS5 A;  4QYL A;  5I89 A;  3P5O A;  5LVR A;  4ALG A;  2FSA A;  4YAB A;  5FE1 A;  4IR4 A;  5E73 A;  5BT3 A;  4UIT A;  5JI8 A;  4KV4 A;  5FE7 A;  5DLZ A;  5HRX A;  4O7A A;  5G4R A;  5EM3 A;  5AMF A;  5A5S A;  5EWH A;  4NUC A;  5I40 A;  4NR6 A;  5CQ5 A;  4LZS A;  4QUU A;  5FBX A;  3JVJ A;  5CY9 A;  4QEW A;  5E9L A;  5LJ0 A;  2E3K A;  5LJ2 A;  5HCL A;  4DON A;  4IOQ A;  4A9O A;  5DFD A;  1X0J A;  5D3S A;  4YYI A;  5C85 A;  5HQ5 A;  3U5K A;  2YEL A;  4A9I A;  3HMF A;  3MB4 A;  5HLS A;  5FG5 A;  4NXJ A;  1F68 A;  5ENH A;  5LKX A;  4O7B A;  4UIX A;  4QSW A;  4O74 A;  5ENG A;  4LYI A;  4WHU A;  4MR4 A;  4IOR A;  4YAT A;  5IG6 A;  4QB3 A;  4A9M A;  4YK0 A;  5CQ7 A;  4GPJ A;  4UIV A;  5COI A;  4J0R A;  4CFK A;  5EV9 A;  5TCM A;  4YBS A;  3G0L A;  4J3I A;  4YAX A;  5I86 A;  4Z6I A;  5EWW A;  5CQ6 A;  5CUC A;  5H1U A;  3HME A;  4WHW A;  5F5Z A;  2EJN A;  3UVY A;  5C89 A;  4HXL A;  5LKT A;  3U5L A;  5G4S A;  4HXO A;  5EU1 A;  5LJ1 A;  5HEM A;  4MEP A;  3U5P A;  5DBM A;  3MUK A;  5FG6 A;  4UIW A;  2R0V A;  5A5R A;  4XUA A;  5EQ1 A;  3SVF A;  4UIZ A;  3MXF A;  1ZKR A;  2RI7 A;  4N4G A;  4Y03 A;  4O7C A;  3MB3 A;  4NR5 A;  5EWC A;  5EWV A;  5HQ7 A;  5LVQ A;  1WUG A;  4QSQ A;  5D3H A;  5I7X A;  4J0S A;  4KV1 A;  3U5O A;  5CUE A;  5CPE A;  3D1D A;  4HXR A;  5DKD A;  5A82 A;  4MEO A;  5F1L A;  2WP1 A;  3MUL A;  5FE6 A;  4YH3 A;  5AD3 A;  3O35 A;  5EPB A;  1N72 A;  5E9K A;  5F3A A;  4PTB A;  4HBV A;  4Z6H A;  1WUM A;  5E9M A;  5E9Y A;  4YBT A;  5DYX A;  2NXB A;  4QR3 A;  3UVW A;  5HJC A;  5FE3 A;  4IOO A;  4LDF A;  5EVA A;  5F60 A;  4XYA A;  4TU4 A;  4QY4 A;  4YH4 A;  4YYD A;  5AME A;  3I3J A;  5CTL A;  3UVX A;  4NR7 A;  5EPS A;  5C8G A;  4OGI A;  5D7X A;  5HEL A;  4QR4 A;  4TS8 A;  4A9L A;  4XUB A;  4TTE A;  4OGJ A;  2RNX A;  5FB1 A;  4F3I A;  4QSX A;  2DWW A;  1E6I A;  4NUE A;  4TT6 A;  4LYS A;  5E3G A;  4C67 A;  4AKH A;  3LJW A;  5I29 A;  5A7C A;  3UVD A;  3P1F A;  4MR6 A;  3O36 A;  4YYN A;  4MEQ A;  4QZS A;  5F25 A;  2YEK A;  3P1E A;  2YQD A;  5CRM A;  5FE5 A;  4QSR A;  2YDW A;  5JWM A;  4NYW A;  4AKG A;  3LQJ A;  5IGL A;  5FE2 A;  5I88 A;  5I83 A;  5ENB A;  4UYD A;  4NRC A;  5FE8 A;  5A5O A;  4YC9 A;  3TLP A;  2E7N A;  3VKG A;  4ZW1 A;  4X2I A;  3RCW A;  5CUD A;  5A83 A;  4NYV A;  4UIU A;  4YAD A;  4A9J A;  4QSS A;  5EA1 A;  2R0S A;  5LKU A;  3DWY A;  5F62 A;  4QYD A;  2DVQ A;  5IGK A;  5AD2 A;  3NXB A;  4O75 A;  4Z93 A;  4YBM A;  3HMH A;  5L8U A;  5E3D A;  2F6N A;  2N9G A;  4FLP A;  4TYL A;  5CP5 A;  4QEU A;  2E7O A;  4O7F A;  4CUQ A;  4YY4 A;  3JVM A;  4UYF A;  1JM4 B;  2DVS A;  2G4A A;  4QUT A;  4PKL A;  5FE4 A;  5FFV A;  4BW4 A;  4XY9 A;  5F36 A;  4QSU A;  5DW1 A;  5H1T A;  4NUD A;  5FH6 A;  3D1B A;  3ZYU A;  3U5M A;  5I80 A;  5F63 A;  4CLB A;  2MJV B;  5A5P A;  4NRA A;  4YYH A;  5EIC A;  5KTW A;  1ZS5 A;  2H60 A;  2DKW A;  3K2J A;  5ETD A;  4QC3 A;  3DAI A;  2OO1 A;  5FE0 A;  4UYG A;  5HRW A;  3Q2F A;  4ZQL A;  3MQM A;  4LR6 A;  3G0J A;  4C66 A;  5ENJ A;  3LQH A;  4YYG A;  5D3J A;  2YYN A;  3UV5 A;  2LSP B;  5E0R A;  3P1D A;  3O33 A;  5CQ4 A;  5A5N A;  4O71 A;  4N4H A;  5D0C A;  5L96 A;  4N4F A;  2OUO A;  5L97 A;  4UYF B;  5CZG A;  5CQ3 A;  4UYH A;  5IGN A;  5CU8 A;  3UV2 A;  4E96 A;  4PCE A;  5L8T A;  3AAD A;  5KTX A;  5I7Y A;  2F6J A;  5K29 A;  4AKI A;  4LZR A;  2I8N A;  5A81 A;  5D3P A;  3ERR A;  5EP7 A;  5FFW A;  4UYE A;  4TU6 A;  5II2 A;  4HXS A;  4PCI A;  4HXM A;  4IR3 A;  3JVK A;  4TQN A;  4QST A;  5D25 A;  2D82 A;  5FE9 A;  4TZ2 A;  5C4Q A;  5C87 A;  5DYU A;  3U5N A;  4AI6 A;  4J1P A;  5ENE A;  3JVL A;  3SVH A;  5KO4 A;  5A85 A;  2DVR A;  5E7D A;  5A5Q A;  3QZV A;  5II1 A;  3QZS A;  4HXP A;  4A9K A;  3VKH A;  4O72 A;  5FFY A;  5FG4 A;  5CS8 A;  2DAT A;  2L5E A;  5EWD A;  2DVV A;  5KU3 A;  5HEN A;  3GG3 A;  5EI4 A;  5EK9 A;  4CFL A;  5LKZ A;  4HBX A;  5CUB A;  4QEV A;  4XY8 A;  1PUO A;  4HXN A;  4HXK A;  5FB0 A;  5IGM A;  4BHW A;  4NYX A;  5J0D A;  4QC1 A;  5D3T A;  5ETB A;  2YW5 A;  4YY6 A;  4PS5 A;  3O37 A;  5L98 A;  4O78 A;  2L85 A;  5FH8 A;  4NR8 A;  3ONI A;  5HFQ A;  1JSP B; 
#chains in the Genus database with same CATH homology
 3S91 A;  4NR4 A;  5DW2 A;  5HFR A;  2GRC A;  3O34 A;  2KTB B;  4ALH A;  5CUA A;  2RFJ A;  4AKN A;  3SVG A;  4HBY A;  4LC2 A;  5HM0 A;  5D3L A;  4QR5 A;  3S92 A;  5DKH A;  2R10 A;  5CQ8 A;  4QNS A;  5CFW A;  2YEM A;  5KTU A;  3LQI A;  4OUF A;  4A9F A;  4QSV A;  2OSS A;  5H1V A;  4PY6 A;  5ENI A;  4CUS A;  5D3N A;  4NR9 A;  4Q0O A;  4BW1 A;  5L99 A;  5FDZ A;  3U5J A;  5CRZ A;  4MR5 A;  5E74 A;  2D9E A;  4KCX A;  4A9H A;  2WP2 A;  4WIV A;  5D3R A;  4QSP A;  2RNY A;  4YYM A;  5DKC A;  5DFC A;  3Q2E A;  5EPR A;  5HQ6 A;  4CUR A;  3IU5 A;  4UIY A;  3UV4 A;  4QBM A;  3FKM X;  2RO1 A;  5EIS A;  5ACY A;  4O76 A;  5IID A;  4LRG A;  4O70 A;  5E9V A;  3QZT A;  4N3W A;  5CQA A;  4YYJ A;  3D7C A;  4A9N A;  5BT4 A;  5F61 A;  4MR3 A;  5CGP A;  2L84 A;  4TT2 A;  4RVR A;  5CQT A;  5KHM A;  5DFB A;  5TB6 A;  4BJX A;  3IU6 A;  3LXJ A;  5CUG A;  5ENF A;  5BT5 A;  4CUT A;  4NRB A;  4LZ2 A;  4HBW A;  4IR6 A;  3P1C A;  1EQF A;  5D24 A;  5D26 A;  5HRV A;  4NQN A;  5FH7 A;  4Z1Q A;  4TT4 A;  2I7K A;  4MEN A;  4O7E A;  5IBN A;  4BW3 A;  5C7N A;  4ZC9 A;  5DY7 A;  4TZ8 A;  4CUU A;  4Q0N A;  2RS9 B;  5DYC A;  5DYA A;  5DLX A;  4O77 A;  5H85 A;  5DX4 A;  4LYW A;  4NQM A;  5LUU A;  2R0Y A;  4N4I A;  4YYK A;  4CUP A;  5F2P A;  4BW2 A;  4A9E A;  5F1H A;  2RNW A;  5I1Q A;  3AQA A;  5E9I A;  3UW9 A;  4CL9 A;  5ENC A;  4Z1S A;  4IR5 A;  5EGU A;  4NS5 A;  4QYL A;  5I89 A;  3P5O A;  5LVR A;  4ALG A;  2FSA A;  4YAB A;  5FE1 A;  4IR4 A;  5E73 A;  5BT3 A;  4UIT A;  5JI8 A;  4KV4 A;  5FE7 A;  5DLZ A;  5HRX A;  4O7A A;  5G4R A;  5EM3 A;  5AMF A;  5A5S A;  5EWH A;  4NUC A;  5I40 A;  4NR6 A;  5CQ5 A;  4LZS A;  4QUU A;  5FBX A;  3JVJ A;  5CY9 A;  4QEW A;  5E9L A;  5LJ0 A;  2E3K A;  5LJ2 A;  5HCL A;  4DON A;  4IOQ A;  4A9O A;  5DFD A;  1X0J A;  5D3S A;  4YYI A;  5C85 A;  5HQ5 A;  3U5K A;  2YEL A;  4A9I A;  3HMF A;  3MB4 A;  5HLS A;  5FG5 A;  4NXJ A;  1F68 A;  5ENH A;  5LKX A;  4O7B A;  4UIX A;  4QSW A;  4O74 A;  5ENG A;  4LYI A;  4WHU A;  4MR4 A;  4IOR A;  4YAT A;  5IG6 A;  4QB3 A;  4A9M A;  4YK0 A;  5CQ7 A;  4GPJ A;  4UIV A;  5COI A;  4J0R A;  4CFK A;  5EV9 A;  5TCM A;  4YBS A;  3G0L A;  4J3I A;  4YAX A;  5I86 A;  4Z6I A;  5EWW A;  5CQ6 A;  5CUC A;  5H1U A;  3HME A;  4WHW A;  5F5Z A;  3UVY A;  5C89 A;  4HXL A;  5LKT A;  3U5L A;  5G4S A;  4HXO A;  5EU1 A;  5LJ1 A;  5HEM A;  4MEP A;  3U5P A;  5DBM A;  3MUK A;  5FG6 A;  4UIW A;  2R0V A;  5A5R A;  4XUA A;  5EQ1 A;  3SVF A;  4UIZ A;  3MXF A;  2RI7 A;  4N4G A;  4Y03 A;  4O7C A;  3MB3 A;  4NR5 A;  5EWC A;  5EWV A;  5HQ7 A;  5LVQ A;  1WUG A;  4QSQ A;  5D3H A;  5I7X A;  4J0S A;  4KV1 A;  3U5O A;  5CUE A;  5CPE A;  4HXR A;  5DKD A;  5A82 A;  4MEO A;  5F1L A;  2WP1 A;  3MUL A;  5FE6 A;  4YH3 A;  5AD3 A;  3O35 A;  5EPB A;  1N72 A;  5E9K A;  5F3A A;  4PTB A;  4HBV A;  4Z6H A;  1WUM A;  5E9M A;  5E9Y A;  4YBT A;  5DYX A;  2NXB A;  4QR3 A;  3UVW A;  5HJC A;  5FE3 A;  4IOO A;  4LDF A;  5EVA A;  5F60 A;  4XYA A;  4TU4 A;  4QY4 A;  4YH4 A;  4YYD A;  5AME A;  3I3J A;  5CTL A;  3UVX A;  4NR7 A;  5EPS A;  5C8G A;  4OGI A;  5D7X A;  5HEL A;  4QR4 A;  4TS8 A;  4A9L A;  4XUB A;  4TTE A;  4OGJ A;  2RNX A;  5FB1 A;  4F3I A;  4QSX A;  2DWW A;  1E6I A;  4NUE A;  4TT6 A;  4LYS A;  5E3G A;  4C67 A;  3LJW A;  5I29 A;  5A7C A;  3UVD A;  3P1F A;  4MR6 A;  3O36 A;  4YYN A;  4MEQ A;  4QZS A;  5F25 A;  2YEK A;  3P1E A;  2YQD A;  5CRM A;  5FE5 A;  4QSR A;  2YDW A;  5JWM A;  4NYW A;  3LQJ A;  5IGL A;  5FE2 A;  5I88 A;  5I83 A;  5ENB A;  4UYD A;  4NRC A;  5FE8 A;  5A5O A;  4YC9 A;  3TLP A;  2E7N A;  4ZW1 A;  4X2I A;  3RCW A;  5CUD A;  5A83 A;  4NYV A;  4UIU A;  4YAD A;  4A9J A;  4QSS A;  5EA1 A;  2R0S A;  5LKU A;  3DWY A;  5F62 A;  4QYD A;  2DVQ A;  5IGK A;  5AD2 A;  3NXB A;  4O75 A;  4Z93 A;  4YBM A;  3HMH A;  5L8U A;  5E3D A;  2F6N A;  2N9G A;  4FLP A;  4TYL A;  5CP5 A;  4QEU A;  2E7O A;  4O7F A;  4CUQ A;  4YY4 A;  3JVM A;  4UYF A;  1JM4 B;  2DVS A;  2G4A A;  4QUT A;  4PKL A;  5FE4 A;  5FFV A;  4BW4 A;  4XY9 A;  5F36 A;  4QSU A;  5DW1 A;  5H1T A;  4NUD A;  5FH6 A;  3ZYU A;  3U5M A;  5I80 A;  5F63 A;  4CLB A;  2MJV B;  5A5P A;  4NRA A;  4YYH A;  5EIC A;  5KTW A;  1ZS5 A;  2H60 A;  2DKW A;  3K2J A;  5ETD A;  4QC3 A;  3DAI A;  2OO1 A;  5FE0 A;  4UYG A;  5HRW A;  3Q2F A;  4ZQL A;  3MQM A;  4LR6 A;  3G0J A;  4C66 A;  5ENJ A;  3LQH A;  4YYG A;  5D3J A;  2YYN A;  3UV5 A;  2LSP B;  5E0R A;  3P1D A;  3O33 A;  5CQ4 A;  5A5N A;  4O71 A;  4N4H A;  5D0C A;  5L96 A;  4N4F A;  2OUO A;  5L97 A;  4UYF B;  5CZG A;  5CQ3 A;  4UYH A;  5IGN A;  5CU8 A;  3UV2 A;  4E96 A;  4PCE A;  5L8T A;  3AAD A;  5KTX A;  5I7Y A;  2F6J A;  5K29 A;  4LZR A;  2I8N A;  5A81 A;  5D3P A;  5EP7 A;  5FFW A;  4UYE A;  4TU6 A;  5II2 A;  4HXS A;  4PCI A;  4HXM A;  4IR3 A;  3JVK A;  4TQN A;  4QST A;  5D25 A;  2D82 A;  5FE9 A;  4TZ2 A;  5C4Q A;  5C87 A;  5DYU A;  3U5N A;  4J1P A;  5ENE A;  3JVL A;  3SVH A;  5KO4 A;  5A85 A;  2DVR A;  5E7D A;  5A5Q A;  3QZV A;  5II1 A;  3QZS A;  4HXP A;  4A9K A;  4O72 A;  5FFY A;  5FG4 A;  5CS8 A;  2DAT A;  2L5E A;  5EWD A;  2DVV A;  5KU3 A;  5HEN A;  3GG3 A;  5EI4 A;  5EK9 A;  4CFL A;  5LKZ A;  4HBX A;  5CUB A;  4QEV A;  4XY8 A;  4HXN A;  4HXK A;  5FB0 A;  5IGM A;  4BHW A;  4NYX A;  5J0D A;  4QC1 A;  5D3T A;  5ETB A;  2YW5 A;  4YY6 A;  4PS5 A;  3O37 A;  5L98 A;  4O78 A;  2L85 A;  5FH8 A;  4NR8 A;  3ONI A;  5HFQ A;  1JSP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...