5JWMA

Bivalent bet bromodomain inhibition
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
110
structure length
110
Chain Sequence
VSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Bromodomain-containing protein 4
publication title Design and characterization of bivalent BET inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5jwmA00
4CUTA 2E7OA 4PKLA 4ZW1A 5E9IA 4BW4A 4HXPA 5E3DA 4HBVA 4UIWA 2DVQA 1X0JA 4C67A 5FB0A 4TTEA 4YATA 5CY9A 5HRVA 3TLPA 1N72A 4YYIA 2YDWA 4MEPA 5C8GA 5H1VA 2DKWA 4HBYA 4NR8A 3QZVA 4OGJA 4O75A 5CS8A 5JI8A 5FE0A 5LJ1A 5FE5A 4NRAA 4IR3A 4Y03A 3HMFA 4TU6A 4TT4A 5IGKA 2YEMA 1JSPB 5IGLA 4CLBA 3JVMA 3ONIA 4HXLA 4AKNA 4LZ2A 5FFYA 4MR6A 4YH3A 3Q2EA 2DATA 5LKZA 3SVGA 2I7KA 5CUDA 5F63A 2D9EA 4UIUA 5L98A 4QUUA 3U5OA 3UW9A 4HXNA 5A85A 5ENEA 4GPJA 2OUOA 5L96A 3S91A 3IU5A 4NQMA 5F1LA 5EI4A 4XUBA 3O34A 2YEKA 3UV4A 3LXJA 3HMHA 3MUKA 5ENGA 4LC2A 4YABA 5IBNA 5I1QA 4CFKA 4UIVA 2F6JA 5EP7A 5LJ0A 3JVLA 5C7NA 3FKMX 5D3TA 5HLSA 4O71A 4J0RA 4LYIA 5DY7A 5E9YA 4IR5A 5DKHA 4BJXA 5CUBA 4BHWA 5FG6A 3U5JA 3U5PA 2F6NA 5A83A 5C4QA 5DYCA 5A5QA 4KV1A 4CUPA 4LR6A 1F68A 4QSPA 3SVFA 5I40A 4TYLA 5E73A 4QR4A 4HBXA 4TT6A 3U5MA 3P1DA 4O78A 5DFBA 5CQ7A 5HJCA 5KTWA 2YYNA 5I86A 2H60A 5CQ5A 5D25A 4A9JA 1JM4B 5DYUA 1EQFA 2OO1A 5KHMA 2WP2A 4PS5A 4HBWA 2DWWA 5FDZA 4LRGA 5II1A 2RO1A 4IORA 5EISA 3D7CA 5F61A 5HENA 4ZQLA 4NXJA 4YBTA 5EA1A 4MENA 5E9LA 5CQTA 5E74A 3P1FA 4XYAA 4QEVA 4NR4A 5I89A 4BW1A 3K2JA 4LZSA 5IG6A 4ALGA 4BW2A 4NRCA 4O77A 4UITA 4UYEA 5TCMA 4A9KA 5F60A 5HQ5A 5E9MA 2RNXA 4TS8A 4QYDA 4HXMA 2YQDA 4O7AA 2DVVA 5HRWA 5KO4A 4NUDA 3UVWA 5FE8A 2L85A 4UYHA 5EGUA 3I3JA 1E6IA 5FE4A 5JWMA 4WHWA 4NYVA 3UVDA 4QEWA 5CRMA 5LVQA 4PCEA 5ETBA 5DLXA 5D3NA 5EPSA 2GRCA 5IIDA 4MR4A 4O7EA 3HMEA 5FE6A 3U5KA 5AMEA 4LYSA 4XY9A 5CUEA 5EWWA 4MR5A 5F62A 4QB3A 2E3KA 4NS5A 4TQNA 3P1CA 4NR5A 1WUGA 4N4GA 3SVHA 5CQ4A 3O35A 5EWHA 5COIA 5HRXA 5EICA 4WIVA 4ZC9A 5I7YA 5FG4A 4NR9A 2YELA 5EK9A 5E9VA 4QR3A 5I83A 3DAIA 4Z1SA 3Q2FA 4QR5A 5ETDA 5IGNA 3U5NA 2YW5A 5LKXA 4O76A 4QY4A 4ALHA 3LQIA 5DX4A 5I29A 4YYDA 4A9EA 3U5LA 5D3HA 5CPEA 4CL9A 4KCXA 4N4HA 5ENHA 4IR6A 5HFRA 4YYKA 5L8UA 3IU6A 4QC1A 4YH4A 5I80A 4C66A 4YYJA 4O7CA 5DYXA 3JVKA 4HXKA 4YYGA 4QBMA 5FG5A 5DFCA 5LKUA 4YYMA 5BT5A 5F2PA 5DFDA 5FH8A 3P1EA 5EQ1A 5FBXA 5F1HA 3G0JA 5CGPA 4YK0A 4NQNA 5L99A 4QSTA 5DKCA 4TT2A 5FE2A 3MXFA 2N9GA 5BT4A 4LDFA 5ENIA 3GG3A 5HELA 4NRBA 4QUTA 5H1TA 3LQHA 5LKTA 4F3IA 5EWCA 3AADA 5HEMA 4Z6IA 5G4RA 4J3IA 5KTUA 2R0YA 3QZSA 2G4AA 4O74A 5E0RA 4WHUA 5FB1A 3S92A 5KU3A 5CUCA 5A7CA 5D3SA 4QC3A 5I88A 4QSXA 4QEUA 3AQAA 4A9FA 4A9HA 4KV4A 4MEOA 5EPBA 5D3PA 5CTLA 5K29A 4NR6A 2R10A 4O7BA 3G0LA 5F36A 4YBMA 2KTBB 3UVXA 4QNSA 4A9NA 5A5SA 5A5RA 5HFQA 3ZYUA 5AD2A 5AD3A 5FE1A 4OUFA 5A81A 5H1UA 5CQ8A 4QYLA 4N4IA 5FFWA 2RS9B 2RI7A 5FE7A 5EV9A 5FH6A 5CQ6A 5DW2A 5HQ7A 4YYNA 5C85A 5J0DA 4Q0NA 4A9MA 3LJWA 5CRZA 4YADA 5F25A 3UV5A 4IOQA 5FFVA 4CUUA 2OSSA 4YAXA 5A5NA 4UYFB 4OGIA 4O7FA 5D3RA 2RNWA 5CQ3A 5EM3A 2DVRA 4QSRA 5DKDA 5CFWA 5TB6A 4UYFA 5HM0A 5EVAA 5LJ2A 4CFLA 2L84A 4MR3A 4PCIA 4J1PA 4PTBA 2DVSA 4HXOA 4O70A 5HCLA 3UVYA 2D82A 5C89A 4QSQA 5CP5A 4IR4A 4BW3A 4TZ8A 5G4SA 4YBSA 5BT3A 3QZTA 5FH7A 5I7XA 4QSUA 5LUUA 4QZSA 3O36A 2WP1A 5D0CA 3MB3A 4NUCA 5DLZA 3JVJA 4N3WA 4XY8A 5FE9A 4Z1QA 5A82A 5H85A 4HXRA 4NYWA 3MQMA 5DYAA 4NR7A 4LYWA 4CURA 4UYGA 5DBMA 5EPRA 4QSSA 2R0VA 5IGMA 4HXSA 5EWVA 5D7XA 4YYHA 4MEQA 3LQJA 2FSAA 5ACYA 4IOOA 1ZS5A 4LZRA 5DW1A 2E7NA 4YY4A 5AMFA 4CUSA 4NUEA 4NYXA 5ENBA 3O37A 3MULA 5CQAA 5L97A 5ENFA 3DWYA 4A9LA 4UYDA 4DONA 3UV2A 2LSPB 5EU1A 3MB4A 4Z93A 5ENCA 5CUAA 4XUAA 3P5OA 4RVRA 5D3JA 3RCWA 5F5ZA 5E9KA 4CUQA 5A5OA 5D3LA 5CZGA 3NXBA 4A9OA 2MJVB 5A5PA 4QSVA 5HQ6A 4PY6A 5EWDA 3O33A 2L5EA 4E96A 5LVRA 4A9IA 5ENJA 2RFJA 2NXBA 5FE3A 5CU8A 4QSWA 4J0SA 4UIZA 5D26A 5E3GA 4YC9A 5E7DA 5F3AA 5D24A 4Q0OA 4X2IA 2RNYA 5KTXA 4FLPA 2I8NA 4O72A 1WUMA 4TU4A 4TZ2A 4UIYA 5C87A 4YY6A 4Z6HA 4N4FA 5II2A 5L8TA 5CUGA 2R0SA 4UIXA
chains in the Genus database with same CATH superfamily
4CUTA 2E7OA 4PKLA 4ZW1A 5E9IA 4BW4A 4HXPA 5E3DA 4HBVA 4UIWA 2DVQA 1X0JA 4C67A 5FB0A 4TTEA 4YATA 5CY9A 5HRVA 3TLPA 1N72A 4YYIA 2YDWA 4MEPA 5C8GA 5H1VA 2DKWA 4HBYA 4NR8A 3QZVA 3D1DA 4OGJA 4O75A 5CS8A 5JI8A 5FE0A 5LJ1A 5FE5A 4NRAA 4IR3A 4Y03A 3HMFA 4TU6A 4TT4A 5IGKA 2YEMA 1JSPB 5IGLA 4CLBA 3JVMA 3ONIA 4HXLA 4AKNA 4LZ2A 5FFYA 4MR6A 4YH3A 3Q2EA 2DATA 5LKZA 3SVGA 2I7KA 5CUDA 5F63A 2D9EA 4UIUA 5L98A 4QUUA 3U5OA 3UW9A 4HXNA 5A85A 5ENEA 4GPJA 2OUOA 5L96A 3S91A 3IU5A 4NQMA 5F1LA 5EI4A 4XUBA 3O34A 2YEKA 3UV4A 3LXJA 3HMHA 3MUKA 5ENGA 4LC2A 4YABA 5IBNA 5I1QA 4CFKA 4UIVA 2F6JA 5EP7A 5LJ0A 3JVLA 5C7NA 3FKMX 5D3TA 5HLSA 4O71A 4J0RA 4LYIA 5DY7A 5E9YA 4IR5A 5DKHA 3VKHA 4BJXA 5CUBA 4BHWA 5FG6A 3U5JA 3U5PA 2F6NA 5A83A 5C4QA 4AI6A 5DYCA 5A5QA 4KV1A 4CUPA 4LR6A 1F68A 4QSPA 3SVFA 5I40A 4TYLA 5E73A 4QR4A 4HBXA 4TT6A 3U5MA 3P1DA 4O78A 5DFBA 5CQ7A 5HJCA 5KTWA 4AKIA 2YYNA 5I86A 2H60A 5CQ5A 5D25A 4A9JA 1JM4B 1PUOA 5DYUA 1EQFA 2OO1A 5KHMA 2WP2A 4PS5A 4HBWA 2DWWA 5FDZA 4LRGA 5II1A 2RO1A 4IORA 5EISA 3D7CA 5F61A 5HENA 4ZQLA 4NXJA 4YBTA 5EA1A 4MENA 5E9LA 5CQTA 5E74A 3P1FA 4XYAA 4QEVA 4NR4A 5I89A 4BW1A 3K2JA 4LZSA 5IG6A 4ALGA 4BW2A 4NRCA 4O77A 4UITA 4UYEA 5TCMA 4A9KA 5F60A 5HQ5A 5E9MA 2RNXA 4TS8A 4QYDA 4HXMA 2YQDA 4O7AA 2DVVA 5HRWA 5KO4A 4NUDA 3UVWA 4AKGA 5FE8A 2L85A 4UYHA 5EGUA 3I3JA 1E6IA 5FE4A 5JWMA 4WHWA 4NYVA 3UVDA 4QEWA 5CRMA 5LVQA 4PCEA 5ETBA 5DLXA 5D3NA 5EPSA 2GRCA 5IIDA 4MR4A 3ERRA 4O7EA 3HMEA 5FE6A 3U5KA 5AMEA 4LYSA 4XY9A 5CUEA 5EWWA 4MR5A 5F62A 4QB3A 2E3KA 4NS5A 4TQNA 3P1CA 4NR5A 1WUGA 4N4GA 3SVHA 5CQ4A 3O35A 5EWHA 5COIA 5HRXA 3VKGA 5EICA 4WIVA 4AKHA 4ZC9A 5I7YA 5FG4A 4NR9A 2YELA 5EK9A 5E9VA 4QR3A 5I83A 3DAIA 4Z1SA 3Q2FA 4QR5A 5ETDA 5IGNA 3U5NA 2YW5A 5LKXA 4O76A 4QY4A 4ALHA 3LQIA 5DX4A 5I29A 4YYDA 4A9EA 3U5LA 5D3HA 5CPEA 1ZKRA 4CL9A 4KCXA 4N4HA 5ENHA 4IR6A 5HFRA 4YYKA 5L8UA 3IU6A 4QC1A 4YH4A 5I80A 4C66A 4YYJA 4O7CA 5DYXA 3JVKA 3D1BA 4HXKA 4YYGA 4QBMA 5FG5A 5DFCA 5LKUA 4YYMA 5BT5A 5F2PA 5DFDA 5FH8A 3P1EA 5EQ1A 5FBXA 5F1HA 3G0JA 5CGPA 4YK0A 4NQNA 5L99A 4QSTA 5DKCA 4TT2A 5FE2A 3MXFA 2N9GA 5BT4A 4LDFA 5ENIA 3GG3A 5HELA 4NRBA 4QUTA 5H1TA 3LQHA 5LKTA 4F3IA 5EWCA 3AADA 5HEMA 4Z6IA 5G4RA 4J3IA 5KTUA 2R0YA 3QZSA 2G4AA 4O74A 5E0RA 4WHUA 5FB1A 3S92A 5KU3A 5CUCA 5A7CA 5D3SA 4QC3A 5I88A 4QSXA 4QEUA 3AQAA 4A9FA 4A9HA 4KV4A 4MEOA 5EPBA 5D3PA 5CTLA 5K29A 4NR6A 2R10A 4O7BA 3G0LA 5F36A 4YBMA 2KTBB 3UVXA 4QNSA 4A9NA 5A5SA 5A5RA 5HFQA 3ZYUA 5AD2A 5AD3A 5FE1A 4OUFA 5A81A 5H1UA 5CQ8A 4QYLA 4N4IA 5FFWA 2RS9B 2RI7A 5FE7A 5EV9A 5FH6A 5CQ6A 5DW2A 5HQ7A 4YYNA 5C85A 5J0DA 4Q0NA 4A9MA 3LJWA 5CRZA 4YADA 5F25A 3UV5A 4IOQA 5FFVA 4CUUA 2OSSA 4YAXA 5A5NA 4UYFB 4OGIA 4O7FA 5D3RA 2RNWA 5CQ3A 5EM3A 2DVRA 4QSRA 5DKDA 5CFWA 5TB6A 4UYFA 5HM0A 5EVAA 5LJ2A 4CFLA 2L84A 4MR3A 4PCIA 4J1PA 4PTBA 2DVSA 4HXOA 4O70A 5HCLA 3UVYA 2D82A 5C89A 4QSQA 5CP5A 4IR4A 4BW3A 4TZ8A 5G4SA 4YBSA 5BT3A 3QZTA 5FH7A 5I7XA 4QSUA 5LUUA 4QZSA 3O36A 2WP1A 5D0CA 3MB3A 4NUCA 5DLZA 3JVJA 4N3WA 4XY8A 5FE9A 4Z1QA 5A82A 5H85A 4HXRA 4NYWA 3MQMA 5DYAA 4NR7A 4LYWA 4CURA 4UYGA 5DBMA 5EPRA 4QSSA 2R0VA 5IGMA 4HXSA 5EWVA 5D7XA 4YYHA 4MEQA 3LQJA 2FSAA 5ACYA 4IOOA 1ZS5A 4LZRA 5DW1A 2E7NA 4YY4A 5AMFA 4CUSA 4NUEA 4NYXA 5ENBA 3O37A 3MULA 5CQAA 5L97A 5ENFA 3DWYA 4A9LA 4UYDA 4DONA 3UV2A 2LSPB 2EJNA 5EU1A 3MB4A 4Z93A 5ENCA 5CUAA 4XUAA 3P5OA 4RVRA 5D3JA 3RCWA 5F5ZA 5E9KA 4CUQA 5A5OA 5D3LA 5CZGA 3NXBA 4A9OA 2MJVB 5A5PA 4QSVA 5HQ6A 4PY6A 5EWDA 3O33A 2L5EA 4E96A 5LVRA 4A9IA 5ENJA 2RFJA 2NXBA 5FE3A 5CU8A 4QSWA 4J0SA 4UIZA 5D26A 5E3GA 4YC9A 5E7DA 5F3AA 5D24A 4Q0OA 4X2IA 2RNYA 5KTXA 4FLPA 2I8NA 4O72A 1WUMA 4TU4A 4TZ2A 4UIYA 5C87A 4YY6A 4Z6HA 4N4FA 5II2A 5L8TA 5CUGA 2R0SA 4UIXA
chains in the Genus database with same CATH topology
4CUTA 2E7OA 4PKLA 4ZW1A 5E9IA 4BW4A 4HXPA 5E3DA 4HBVA 4UIWA 2DVQA 1X0JA 4C67A 5FB0A 4TTEA 4YATA 5CY9A 5HRVA 3TLPA 1N72A 4YYIA 2YDWA 4MEPA 5C8GA 5H1VA 2DKWA 4HBYA 4NR8A 3QZVA 4OGJA 4O75A 5CS8A 5JI8A 5FE0A 5LJ1A 5FE5A 4NRAA 4IR3A 4Y03A 3HMFA 4TU6A 4TT4A 5IGKA 2YEMA 1JSPB 5IGLA 4CLBA 3JVMA 3ONIA 4HXLA 4AKNA 4LZ2A 5FFYA 4MR6A 4YH3A 3Q2EA 2DATA 5LKZA 3SVGA 2I7KA 5CUDA 5F63A 2D9EA 4UIUA 5L98A 4QUUA 3U5OA 3UW9A 4HXNA 5A85A 5ENEA 4GPJA 2OUOA 5L96A 3S91A 3IU5A 4NQMA 5F1LA 5EI4A 4XUBA 3O34A 2YEKA 3UV4A 3LXJA 3HMHA 3MUKA 5ENGA 4LC2A 4YABA 5IBNA 5I1QA 4CFKA 4UIVA 2F6JA 5EP7A 5LJ0A 3JVLA 5C7NA 3FKMX 5D3TA 5HLSA 4O71A 4J0RA 4LYIA 5DY7A 5E9YA 4IR5A 5DKHA 4BJXA 5CUBA 4BHWA 5FG6A 3U5JA 3U5PA 2F6NA 5A83A 5C4QA 5DYCA 5A5QA 4KV1A 4CUPA 4LR6A 1F68A 4QSPA 3SVFA 5I40A 4TYLA 5E73A 4QR4A 4HBXA 4TT6A 3U5MA 3P1DA 4O78A 5DFBA 5CQ7A 5HJCA 5KTWA 2YYNA 5I86A 2H60A 5CQ5A 5D25A 4A9JA 1JM4B 5DYUA 1EQFA 2OO1A 5KHMA 2WP2A 4PS5A 4HBWA 2DWWA 5FDZA 4LRGA 5II1A 2RO1A 4IORA 5EISA 3D7CA 5F61A 5HENA 4ZQLA 4NXJA 4YBTA 5EA1A 4MENA 5E9LA 5CQTA 5E74A 3P1FA 4XYAA 4QEVA 4NR4A 5I89A 4BW1A 3K2JA 4LZSA 5IG6A 4ALGA 4BW2A 4NRCA 4O77A 4UITA 4UYEA 5TCMA 4A9KA 5F60A 5HQ5A 5E9MA 2RNXA 4TS8A 4QYDA 4HXMA 2YQDA 4O7AA 2DVVA 5HRWA 5KO4A 4NUDA 3UVWA 5FE8A 2L85A 4UYHA 5EGUA 3I3JA 1E6IA 5FE4A 5JWMA 4WHWA 4NYVA 3UVDA 4QEWA 5CRMA 5LVQA 4PCEA 5ETBA 5DLXA 5D3NA 5EPSA 2GRCA 5IIDA 4MR4A 4O7EA 3HMEA 5FE6A 3U5KA 5AMEA 4LYSA 4XY9A 5CUEA 5EWWA 4MR5A 5F62A 4QB3A 2E3KA 4NS5A 4TQNA 3P1CA 4NR5A 1WUGA 4N4GA 3SVHA 5CQ4A 3O35A 5EWHA 5COIA 5HRXA 5EICA 4WIVA 4ZC9A 5I7YA 5FG4A 4NR9A 2YELA 5EK9A 5E9VA 4QR3A 5I83A 3DAIA 4Z1SA 3Q2FA 4QR5A 5ETDA 5IGNA 3U5NA 2YW5A 5LKXA 4O76A 4QY4A 4ALHA 3LQIA 5DX4A 5I29A 4YYDA 4A9EA 3U5LA 5D3HA 5CPEA 4CL9A 4KCXA 4N4HA 5ENHA 4IR6A 5HFRA 4YYKA 5L8UA 3IU6A 4QC1A 4YH4A 5I80A 4C66A 4YYJA 4O7CA 5DYXA 3JVKA 4HXKA 4YYGA 4QBMA 5FG5A 5DFCA 5LKUA 4YYMA 5BT5A 5F2PA 5DFDA 5FH8A 3P1EA 5EQ1A 5FBXA 5F1HA 3G0JA 5CGPA 4YK0A 4NQNA 5L99A 4QSTA 5DKCA 4TT2A 5FE2A 3MXFA 2N9GA 5BT4A 4LDFA 5ENIA 3GG3A 5HELA 4NRBA 4QUTA 5H1TA 3LQHA 5LKTA 4F3IA 5EWCA 3AADA 5HEMA 4Z6IA 5G4RA 4J3IA 5KTUA 2R0YA 3QZSA 2G4AA 4O74A 5E0RA 4WHUA 5FB1A 3S92A 5KU3A 5CUCA 5A7CA 5D3SA 4QC3A 5I88A 4QSXA 4QEUA 3AQAA 4A9FA 4A9HA 4KV4A 4MEOA 5EPBA 5D3PA 5CTLA 5K29A 4NR6A 2R10A 4O7BA 3G0LA 5F36A 4YBMA 2KTBB 3UVXA 4QNSA 4A9NA 5A5SA 5A5RA 5HFQA 3ZYUA 5AD2A 5AD3A 5FE1A 4OUFA 5A81A 5H1UA 5CQ8A 4QYLA 4N4IA 5FFWA 2RS9B 2RI7A 5FE7A 5EV9A 5FH6A 5CQ6A 5DW2A 5HQ7A 4YYNA 5C85A 5J0DA 4Q0NA 4A9MA 3LJWA 5CRZA 4YADA 5F25A 3UV5A 4IOQA 5FFVA 4CUUA 2OSSA 4YAXA 5A5NA 4UYFB 4OGIA 4O7FA 5D3RA 2RNWA 5CQ3A 5EM3A 2DVRA 4QSRA 5DKDA 5CFWA 5TB6A 4UYFA 5HM0A 5EVAA 5LJ2A 4CFLA 2L84A 4MR3A 4PCIA 4J1PA 4PTBA 2DVSA 4HXOA 4O70A 5HCLA 3UVYA 2D82A 5C89A 4QSQA 5CP5A 4IR4A 4BW3A 4TZ8A 5G4SA 4YBSA 5BT3A 3QZTA 5FH7A 5I7XA 4QSUA 5LUUA 4QZSA 3O36A 2WP1A 5D0CA 3MB3A 4NUCA 5DLZA 3JVJA 4N3WA 4XY8A 5FE9A 4Z1QA 5A82A 5H85A 4HXRA 4NYWA 3MQMA 5DYAA 4NR7A 4LYWA 4CURA 4UYGA 5DBMA 5EPRA 4QSSA 2R0VA 5IGMA 4HXSA 5EWVA 5D7XA 4YYHA 4MEQA 3LQJA 2FSAA 5ACYA 4IOOA 1ZS5A 4LZRA 5DW1A 2E7NA 4YY4A 5AMFA 4CUSA 4NUEA 4NYXA 5ENBA 3O37A 3MULA 5CQAA 5L97A 5ENFA 3DWYA 4A9LA 4UYDA 4DONA 3UV2A 2LSPB 5EU1A 3MB4A 4Z93A 5ENCA 5CUAA 4XUAA 3P5OA 4RVRA 5D3JA 3RCWA 5F5ZA 5E9KA 4CUQA 5A5OA 5D3LA 5CZGA 3NXBA 4A9OA 2MJVB 5A5PA 4QSVA 5HQ6A 4PY6A 5EWDA 3O33A 2L5EA 4E96A 5LVRA 4A9IA 5ENJA 2RFJA 2NXBA 5FE3A 5CU8A 4QSWA 4J0SA 4UIZA 5D26A 5E3GA 4YC9A 5E7DA 5F3AA 5D24A 4Q0OA 4X2IA 2RNYA 5KTXA 4FLPA 2I8NA 4O72A 1WUMA 4TU4A 4TZ2A 4UIYA 5C87A 4YY6A 4Z6HA 4N4FA 5II2A 5L8TA 5CUGA 2R0SA 4UIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUT A;  2E7O A;  4PKL A;  4ZW1 A;  5E9I A;  4BW4 A;  4HXP A;  5E3D A;  4HBV A;  4UIW A;  2DVQ A;  1X0J A;  4C67 A;  5FB0 A;  4TTE A;  4YAT A;  5CY9 A;  5HRV A;  3TLP A;  1N72 A;  4YYI A;  2YDW A;  4MEP A;  5C8G A;  5H1V A;  2DKW A;  4HBY A;  4NR8 A;  3QZV A;  4OGJ A;  4O75 A;  5CS8 A;  5JI8 A;  5FE0 A;  5LJ1 A;  5FE5 A;  4NRA A;  4IR3 A;  4Y03 A;  3HMF A;  4TU6 A;  4TT4 A;  5IGK A;  2YEM A;  1JSP B;  5IGL A;  4CLB A;  3JVM A;  3ONI A;  4HXL A;  4AKN A;  4LZ2 A;  5FFY A;  4MR6 A;  4YH3 A;  3Q2E A;  2DAT A;  5LKZ A;  3SVG A;  2I7K A;  5CUD A;  5F63 A;  2D9E A;  4UIU A;  5L98 A;  4QUU A;  3U5O A;  3UW9 A;  4HXN A;  5A85 A;  5ENE A;  4GPJ A;  2OUO A;  5L96 A;  3S91 A;  3IU5 A;  4NQM A;  5F1L A;  5EI4 A;  4XUB A;  3O34 A;  2YEK A;  3UV4 A;  3LXJ A;  3HMH A;  3MUK A;  5ENG A;  4LC2 A;  4YAB A;  5IBN A;  5I1Q A;  4CFK A;  4UIV A;  2F6J A;  5EP7 A;  5LJ0 A;  3JVL A;  5C7N A;  3FKM X;  5D3T A;  5HLS A;  4O71 A;  4J0R A;  4LYI A;  5DY7 A;  5E9Y A;  4IR5 A;  5DKH A;  4BJX A;  5CUB A;  4BHW A;  5FG6 A;  3U5J A;  3U5P A;  2F6N A;  5A83 A;  5C4Q A;  5DYC A;  5A5Q A;  4KV1 A;  4CUP A;  4LR6 A;  1F68 A;  4QSP A;  3SVF A;  5I40 A;  4TYL A;  5E73 A;  4QR4 A;  4HBX A;  4TT6 A;  3U5M A;  3P1D A;  4O78 A;  5DFB A;  5CQ7 A;  5HJC A;  5KTW A;  2YYN A;  5I86 A;  2H60 A;  5CQ5 A;  5D25 A;  4A9J A;  1JM4 B;  5DYU A;  1EQF A;  2OO1 A;  5KHM A;  2WP2 A;  4PS5 A;  4HBW A;  2DWW A;  5FDZ A;  4LRG A;  5II1 A;  2RO1 A;  4IOR A;  5EIS A;  3D7C A;  5F61 A;  5HEN A;  4ZQL A;  4NXJ A;  4YBT A;  5EA1 A;  4MEN A;  5E9L A;  5CQT A;  5E74 A;  3P1F A;  4XYA A;  4QEV A;  4NR4 A;  5I89 A;  4BW1 A;  3K2J A;  4LZS A;  5IG6 A;  4ALG A;  4BW2 A;  4NRC A;  4O77 A;  4UIT A;  4UYE A;  5TCM A;  4A9K A;  5F60 A;  5HQ5 A;  5E9M A;  2RNX A;  4TS8 A;  4QYD A;  4HXM A;  2YQD A;  4O7A A;  2DVV A;  5HRW A;  5KO4 A;  4NUD A;  3UVW A;  5FE8 A;  2L85 A;  4UYH A;  5EGU A;  3I3J A;  1E6I A;  5FE4 A;  5JWM A;  4WHW A;  4NYV A;  3UVD A;  4QEW A;  5CRM A;  5LVQ A;  4PCE A;  5ETB A;  5DLX A;  5D3N A;  5EPS A;  2GRC A;  5IID A;  4MR4 A;  4O7E A;  3HME A;  5FE6 A;  3U5K A;  5AME A;  4LYS A;  4XY9 A;  5CUE A;  5EWW A;  4MR5 A;  5F62 A;  4QB3 A;  2E3K A;  4NS5 A;  4TQN A;  3P1C A;  4NR5 A;  1WUG A;  4N4G A;  3SVH A;  5CQ4 A;  3O35 A;  5EWH A;  5COI A;  5HRX A;  5EIC A;  4WIV A;  4ZC9 A;  5I7Y A;  5FG4 A;  4NR9 A;  2YEL A;  5EK9 A;  5E9V A;  4QR3 A;  5I83 A;  3DAI A;  4Z1S A;  3Q2F A;  4QR5 A;  5ETD A;  5IGN A;  3U5N A;  2YW5 A;  5LKX A;  4O76 A;  4QY4 A;  4ALH A;  3LQI A;  5DX4 A;  5I29 A;  4YYD A;  4A9E A;  3U5L A;  5D3H A;  5CPE A;  4CL9 A;  4KCX A;  4N4H A;  5ENH A;  4IR6 A;  5HFR A;  4YYK A;  5L8U A;  3IU6 A;  4QC1 A;  4YH4 A;  5I80 A;  4C66 A;  4YYJ A;  4O7C A;  5DYX A;  3JVK A;  4HXK A;  4YYG A;  4QBM A;  5FG5 A;  5DFC A;  5LKU A;  4YYM A;  5BT5 A;  5F2P A;  5DFD A;  5FH8 A;  3P1E A;  5EQ1 A;  5FBX A;  5F1H A;  3G0J A;  5CGP A;  4YK0 A;  4NQN A;  5L99 A;  4QST A;  5DKC A;  4TT2 A;  5FE2 A;  3MXF A;  2N9G A;  5BT4 A;  4LDF A;  5ENI A;  3GG3 A;  5HEL A;  4NRB A;  4QUT A;  5H1T A;  3LQH A;  5LKT A;  4F3I A;  5EWC A;  3AAD A;  5HEM A;  4Z6I A;  5G4R A;  4J3I A;  5KTU A;  2R0Y A;  3QZS A;  2G4A A;  4O74 A;  5E0R A;  4WHU A;  5FB1 A;  3S92 A;  5KU3 A;  5CUC A;  5A7C A;  5D3S A;  4QC3 A;  5I88 A;  4QSX A;  4QEU A;  3AQA A;  4A9F A;  4A9H A;  4KV4 A;  4MEO A;  5EPB A;  5D3P A;  5CTL A;  5K29 A;  4NR6 A;  2R10 A;  4O7B A;  3G0L A;  5F36 A;  4YBM A;  2KTB B;  3UVX A;  4QNS A;  4A9N A;  5A5S A;  5A5R A;  5HFQ A;  3ZYU A;  5AD2 A;  5AD3 A;  5FE1 A;  4OUF A;  5A81 A;  5H1U A;  5CQ8 A;  4QYL A;  4N4I A;  5FFW A;  2RS9 B;  2RI7 A;  5FE7 A;  5EV9 A;  5FH6 A;  5CQ6 A;  5DW2 A;  5HQ7 A;  4YYN A;  5C85 A;  5J0D A;  4Q0N A;  4A9M A;  3LJW A;  5CRZ A;  4YAD A;  5F25 A;  3UV5 A;  4IOQ A;  5FFV A;  4CUU A;  2OSS A;  4YAX A;  5A5N A;  4UYF B;  4OGI A;  4O7F A;  5D3R A;  2RNW A;  5CQ3 A;  5EM3 A;  2DVR A;  4QSR A;  5DKD A;  5CFW A;  5TB6 A;  4UYF A;  5HM0 A;  5EVA A;  5LJ2 A;  4CFL A;  2L84 A;  4MR3 A;  4PCI A;  4J1P A;  4PTB A;  2DVS A;  4HXO A;  4O70 A;  5HCL A;  3UVY A;  2D82 A;  5C89 A;  4QSQ A;  5CP5 A;  4IR4 A;  4BW3 A;  4TZ8 A;  5G4S A;  4YBS A;  5BT3 A;  3QZT A;  5FH7 A;  5I7X A;  4QSU A;  5LUU A;  4QZS A;  3O36 A;  2WP1 A;  5D0C A;  3MB3 A;  4NUC A;  5DLZ A;  3JVJ A;  4N3W A;  4XY8 A;  5FE9 A;  4Z1Q A;  5A82 A;  5H85 A;  4HXR A;  4NYW A;  3MQM A;  5DYA A;  4NR7 A;  4LYW A;  4CUR A;  4UYG A;  5DBM A;  5EPR A;  4QSS A;  2R0V A;  5IGM A;  4HXS A;  5EWV A;  5D7X A;  4YYH A;  4MEQ A;  3LQJ A;  2FSA A;  5ACY A;  4IOO A;  1ZS5 A;  4LZR A;  5DW1 A;  2E7N A;  4YY4 A;  5AMF A;  4CUS A;  4NUE A;  4NYX A;  5ENB A;  3O37 A;  3MUL A;  5CQA A;  5L97 A;  5ENF A;  3DWY A;  4A9L A;  4UYD A;  4DON A;  3UV2 A;  2LSP B;  5EU1 A;  3MB4 A;  4Z93 A;  5ENC A;  5CUA A;  4XUA A;  3P5O A;  4RVR A;  5D3J A;  3RCW A;  5F5Z A;  5E9K A;  4CUQ A;  5A5O A;  5D3L A;  5CZG A;  3NXB A;  4A9O A;  2MJV B;  5A5P A;  4QSV A;  5HQ6 A;  4PY6 A;  5EWD A;  3O33 A;  2L5E A;  4E96 A;  5LVR A;  4A9I A;  5ENJ A;  2RFJ A;  2NXB A;  5FE3 A;  5CU8 A;  4QSW A;  4J0S A;  4UIZ A;  5D26 A;  5E3G A;  4YC9 A;  5E7D A;  5F3A A;  5D24 A;  4Q0O A;  4X2I A;  2RNY A;  5KTX A;  4FLP A;  2I8N A;  4O72 A;  1WUM A;  4TU4 A;  4TZ2 A;  4UIY A;  5C87 A;  4YY6 A;  4Z6H A;  4N4F A;  5II2 A;  5L8T A;  5CUG A;  2R0S A;  4UIX A; 
#chains in the Genus database with same CATH topology
 4CUT A;  2E7O A;  4PKL A;  4ZW1 A;  5E9I A;  4BW4 A;  4HXP A;  5E3D A;  4HBV A;  4UIW A;  2DVQ A;  1X0J A;  4C67 A;  5FB0 A;  4TTE A;  4YAT A;  5CY9 A;  5HRV A;  3TLP A;  1N72 A;  4YYI A;  2YDW A;  4MEP A;  5C8G A;  5H1V A;  2DKW A;  4HBY A;  4NR8 A;  3QZV A;  3D1D A;  4OGJ A;  4O75 A;  5CS8 A;  5JI8 A;  5FE0 A;  5LJ1 A;  5FE5 A;  4NRA A;  4IR3 A;  4Y03 A;  3HMF A;  4TU6 A;  4TT4 A;  5IGK A;  2YEM A;  1JSP B;  5IGL A;  4CLB A;  3JVM A;  3ONI A;  4HXL A;  4AKN A;  4LZ2 A;  5FFY A;  4MR6 A;  4YH3 A;  3Q2E A;  2DAT A;  5LKZ A;  3SVG A;  2I7K A;  5CUD A;  5F63 A;  2D9E A;  4UIU A;  5L98 A;  4QUU A;  3U5O A;  3UW9 A;  4HXN A;  5A85 A;  5ENE A;  4GPJ A;  2OUO A;  5L96 A;  3S91 A;  3IU5 A;  4NQM A;  5F1L A;  5EI4 A;  4XUB A;  3O34 A;  2YEK A;  3UV4 A;  3LXJ A;  3HMH A;  3MUK A;  5ENG A;  4LC2 A;  4YAB A;  5IBN A;  5I1Q A;  4CFK A;  4UIV A;  2F6J A;  5EP7 A;  5LJ0 A;  3JVL A;  5C7N A;  3FKM X;  5D3T A;  5HLS A;  4O71 A;  4J0R A;  4LYI A;  5DY7 A;  5E9Y A;  4IR5 A;  5DKH A;  3VKH A;  4BJX A;  5CUB A;  4BHW A;  5FG6 A;  3U5J A;  3U5P A;  2F6N A;  5A83 A;  5C4Q A;  4AI6 A;  5DYC A;  5A5Q A;  4KV1 A;  4CUP A;  4LR6 A;  1F68 A;  4QSP A;  3SVF A;  5I40 A;  4TYL A;  5E73 A;  4QR4 A;  4HBX A;  4TT6 A;  3U5M A;  3P1D A;  4O78 A;  5DFB A;  5CQ7 A;  5HJC A;  5KTW A;  4AKI A;  2YYN A;  5I86 A;  2H60 A;  5CQ5 A;  5D25 A;  4A9J A;  1JM4 B;  1PUO A;  5DYU A;  1EQF A;  2OO1 A;  5KHM A;  2WP2 A;  4PS5 A;  4HBW A;  2DWW A;  5FDZ A;  4LRG A;  5II1 A;  2RO1 A;  4IOR A;  5EIS A;  3D7C A;  5F61 A;  5HEN A;  4ZQL A;  4NXJ A;  4YBT A;  5EA1 A;  4MEN A;  5E9L A;  5CQT A;  5E74 A;  3P1F A;  4XYA A;  4QEV A;  4NR4 A;  5I89 A;  4BW1 A;  3K2J A;  4LZS A;  5IG6 A;  4ALG A;  4BW2 A;  4NRC A;  4O77 A;  4UIT A;  4UYE A;  5TCM A;  4A9K A;  5F60 A;  5HQ5 A;  5E9M A;  2RNX A;  4TS8 A;  4QYD A;  4HXM A;  2YQD A;  4O7A A;  2DVV A;  5HRW A;  5KO4 A;  4NUD A;  3UVW A;  4AKG A;  5FE8 A;  2L85 A;  4UYH A;  5EGU A;  3I3J A;  1E6I A;  5FE4 A;  5JWM A;  4WHW A;  4NYV A;  3UVD A;  4QEW A;  5CRM A;  5LVQ A;  4PCE A;  5ETB A;  5DLX A;  5D3N A;  5EPS A;  2GRC A;  5IID A;  4MR4 A;  3ERR A;  4O7E A;  3HME A;  5FE6 A;  3U5K A;  5AME A;  4LYS A;  4XY9 A;  5CUE A;  5EWW A;  4MR5 A;  5F62 A;  4QB3 A;  2E3K A;  4NS5 A;  4TQN A;  3P1C A;  4NR5 A;  1WUG A;  4N4G A;  3SVH A;  5CQ4 A;  3O35 A;  5EWH A;  5COI A;  5HRX A;  3VKG A;  5EIC A;  4WIV A;  4AKH A;  4ZC9 A;  5I7Y A;  5FG4 A;  4NR9 A;  2YEL A;  5EK9 A;  5E9V A;  4QR3 A;  5I83 A;  3DAI A;  4Z1S A;  3Q2F A;  4QR5 A;  5ETD A;  5IGN A;  3U5N A;  2YW5 A;  5LKX A;  4O76 A;  4QY4 A;  4ALH A;  3LQI A;  5DX4 A;  5I29 A;  4YYD A;  4A9E A;  3U5L A;  5D3H A;  5CPE A;  1ZKR A;  4CL9 A;  4KCX A;  4N4H A;  5ENH A;  4IR6 A;  5HFR A;  4YYK A;  5L8U A;  3IU6 A;  4QC1 A;  4YH4 A;  5I80 A;  4C66 A;  4YYJ A;  4O7C A;  5DYX A;  3JVK A;  3D1B A;  4HXK A;  4YYG A;  4QBM A;  5FG5 A;  5DFC A;  5LKU A;  4YYM A;  5BT5 A;  5F2P A;  5DFD A;  5FH8 A;  3P1E A;  5EQ1 A;  5FBX A;  5F1H A;  3G0J A;  5CGP A;  4YK0 A;  4NQN A;  5L99 A;  4QST A;  5DKC A;  4TT2 A;  5FE2 A;  3MXF A;  2N9G A;  5BT4 A;  4LDF A;  5ENI A;  3GG3 A;  5HEL A;  4NRB A;  4QUT A;  5H1T A;  3LQH A;  5LKT A;  4F3I A;  5EWC A;  3AAD A;  5HEM A;  4Z6I A;  5G4R A;  4J3I A;  5KTU A;  2R0Y A;  3QZS A;  2G4A A;  4O74 A;  5E0R A;  4WHU A;  5FB1 A;  3S92 A;  5KU3 A;  5CUC A;  5A7C A;  5D3S A;  4QC3 A;  5I88 A;  4QSX A;  4QEU A;  3AQA A;  4A9F A;  4A9H A;  4KV4 A;  4MEO A;  5EPB A;  5D3P A;  5CTL A;  5K29 A;  4NR6 A;  2R10 A;  4O7B A;  3G0L A;  5F36 A;  4YBM A;  2KTB B;  3UVX A;  4QNS A;  4A9N A;  5A5S A;  5A5R A;  5HFQ A;  3ZYU A;  5AD2 A;  5AD3 A;  5FE1 A;  4OUF A;  5A81 A;  5H1U A;  5CQ8 A;  4QYL A;  4N4I A;  5FFW A;  2RS9 B;  2RI7 A;  5FE7 A;  5EV9 A;  5FH6 A;  5CQ6 A;  5DW2 A;  5HQ7 A;  4YYN A;  5C85 A;  5J0D A;  4Q0N A;  4A9M A;  3LJW A;  5CRZ A;  4YAD A;  5F25 A;  3UV5 A;  4IOQ A;  5FFV A;  4CUU A;  2OSS A;  4YAX A;  5A5N A;  4UYF B;  4OGI A;  4O7F A;  5D3R A;  2RNW A;  5CQ3 A;  5EM3 A;  2DVR A;  4QSR A;  5DKD A;  5CFW A;  5TB6 A;  4UYF A;  5HM0 A;  5EVA A;  5LJ2 A;  4CFL A;  2L84 A;  4MR3 A;  4PCI A;  4J1P A;  4PTB A;  2DVS A;  4HXO A;  4O70 A;  5HCL A;  3UVY A;  2D82 A;  5C89 A;  4QSQ A;  5CP5 A;  4IR4 A;  4BW3 A;  4TZ8 A;  5G4S A;  4YBS A;  5BT3 A;  3QZT A;  5FH7 A;  5I7X A;  4QSU A;  5LUU A;  4QZS A;  3O36 A;  2WP1 A;  5D0C A;  3MB3 A;  4NUC A;  5DLZ A;  3JVJ A;  4N3W A;  4XY8 A;  5FE9 A;  4Z1Q A;  5A82 A;  5H85 A;  4HXR A;  4NYW A;  3MQM A;  5DYA A;  4NR7 A;  4LYW A;  4CUR A;  4UYG A;  5DBM A;  5EPR A;  4QSS A;  2R0V A;  5IGM A;  4HXS A;  5EWV A;  5D7X A;  4YYH A;  4MEQ A;  3LQJ A;  2FSA A;  5ACY A;  4IOO A;  1ZS5 A;  4LZR A;  5DW1 A;  2E7N A;  4YY4 A;  5AMF A;  4CUS A;  4NUE A;  4NYX A;  5ENB A;  3O37 A;  3MUL A;  5CQA A;  5L97 A;  5ENF A;  3DWY A;  4A9L A;  4UYD A;  4DON A;  3UV2 A;  2LSP B;  2EJN A;  5EU1 A;  3MB4 A;  4Z93 A;  5ENC A;  5CUA A;  4XUA A;  3P5O A;  4RVR A;  5D3J A;  3RCW A;  5F5Z A;  5E9K A;  4CUQ A;  5A5O A;  5D3L A;  5CZG A;  3NXB A;  4A9O A;  2MJV B;  5A5P A;  4QSV A;  5HQ6 A;  4PY6 A;  5EWD A;  3O33 A;  2L5E A;  4E96 A;  5LVR A;  4A9I A;  5ENJ A;  2RFJ A;  2NXB A;  5FE3 A;  5CU8 A;  4QSW A;  4J0S A;  4UIZ A;  5D26 A;  5E3G A;  4YC9 A;  5E7D A;  5F3A A;  5D24 A;  4Q0O A;  4X2I A;  2RNY A;  5KTX A;  4FLP A;  2I8N A;  4O72 A;  1WUM A;  4TU4 A;  4TZ2 A;  4UIY A;  5C87 A;  4YY6 A;  4Z6H A;  4N4F A;  5II2 A;  5L8T A;  5CUG A;  2R0S A;  4UIX A; 
#chains in the Genus database with same CATH homology
 4CUT A;  2E7O A;  4PKL A;  4ZW1 A;  5E9I A;  4BW4 A;  4HXP A;  5E3D A;  4HBV A;  4UIW A;  2DVQ A;  1X0J A;  4C67 A;  5FB0 A;  4TTE A;  4YAT A;  5CY9 A;  5HRV A;  3TLP A;  1N72 A;  4YYI A;  2YDW A;  4MEP A;  5C8G A;  5H1V A;  2DKW A;  4HBY A;  4NR8 A;  3QZV A;  4OGJ A;  4O75 A;  5CS8 A;  5JI8 A;  5FE0 A;  5LJ1 A;  5FE5 A;  4NRA A;  4IR3 A;  4Y03 A;  3HMF A;  4TU6 A;  4TT4 A;  5IGK A;  2YEM A;  1JSP B;  5IGL A;  4CLB A;  3JVM A;  3ONI A;  4HXL A;  4AKN A;  4LZ2 A;  5FFY A;  4MR6 A;  4YH3 A;  3Q2E A;  2DAT A;  5LKZ A;  3SVG A;  2I7K A;  5CUD A;  5F63 A;  2D9E A;  4UIU A;  5L98 A;  4QUU A;  3U5O A;  3UW9 A;  4HXN A;  5A85 A;  5ENE A;  4GPJ A;  2OUO A;  5L96 A;  3S91 A;  3IU5 A;  4NQM A;  5F1L A;  5EI4 A;  4XUB A;  3O34 A;  2YEK A;  3UV4 A;  3LXJ A;  3HMH A;  3MUK A;  5ENG A;  4LC2 A;  4YAB A;  5IBN A;  5I1Q A;  4CFK A;  4UIV A;  2F6J A;  5EP7 A;  5LJ0 A;  3JVL A;  5C7N A;  3FKM X;  5D3T A;  5HLS A;  4O71 A;  4J0R A;  4LYI A;  5DY7 A;  5E9Y A;  4IR5 A;  5DKH A;  4BJX A;  5CUB A;  4BHW A;  5FG6 A;  3U5J A;  3U5P A;  2F6N A;  5A83 A;  5C4Q A;  5DYC A;  5A5Q A;  4KV1 A;  4CUP A;  4LR6 A;  1F68 A;  4QSP A;  3SVF A;  5I40 A;  4TYL A;  5E73 A;  4QR4 A;  4HBX A;  4TT6 A;  3U5M A;  3P1D A;  4O78 A;  5DFB A;  5CQ7 A;  5HJC A;  5KTW A;  2YYN A;  5I86 A;  2H60 A;  5CQ5 A;  5D25 A;  4A9J A;  1JM4 B;  5DYU A;  1EQF A;  2OO1 A;  5KHM A;  2WP2 A;  4PS5 A;  4HBW A;  2DWW A;  5FDZ A;  4LRG A;  5II1 A;  2RO1 A;  4IOR A;  5EIS A;  3D7C A;  5F61 A;  5HEN A;  4ZQL A;  4NXJ A;  4YBT A;  5EA1 A;  4MEN A;  5E9L A;  5CQT A;  5E74 A;  3P1F A;  4XYA A;  4QEV A;  4NR4 A;  5I89 A;  4BW1 A;  3K2J A;  4LZS A;  5IG6 A;  4ALG A;  4BW2 A;  4NRC A;  4O77 A;  4UIT A;  4UYE A;  5TCM A;  4A9K A;  5F60 A;  5HQ5 A;  5E9M A;  2RNX A;  4TS8 A;  4QYD A;  4HXM A;  2YQD A;  4O7A A;  2DVV A;  5HRW A;  5KO4 A;  4NUD A;  3UVW A;  5FE8 A;  2L85 A;  4UYH A;  5EGU A;  3I3J A;  1E6I A;  5FE4 A;  5JWM A;  4WHW A;  4NYV A;  3UVD A;  4QEW A;  5CRM A;  5LVQ A;  4PCE A;  5ETB A;  5DLX A;  5D3N A;  5EPS A;  2GRC A;  5IID A;  4MR4 A;  4O7E A;  3HME A;  5FE6 A;  3U5K A;  5AME A;  4LYS A;  4XY9 A;  5CUE A;  5EWW A;  4MR5 A;  5F62 A;  4QB3 A;  2E3K A;  4NS5 A;  4TQN A;  3P1C A;  4NR5 A;  1WUG A;  4N4G A;  3SVH A;  5CQ4 A;  3O35 A;  5EWH A;  5COI A;  5HRX A;  5EIC A;  4WIV A;  4ZC9 A;  5I7Y A;  5FG4 A;  4NR9 A;  2YEL A;  5EK9 A;  5E9V A;  4QR3 A;  5I83 A;  3DAI A;  4Z1S A;  3Q2F A;  4QR5 A;  5ETD A;  5IGN A;  3U5N A;  2YW5 A;  5LKX A;  4O76 A;  4QY4 A;  4ALH A;  3LQI A;  5DX4 A;  5I29 A;  4YYD A;  4A9E A;  3U5L A;  5D3H A;  5CPE A;  4CL9 A;  4KCX A;  4N4H A;  5ENH A;  4IR6 A;  5HFR A;  4YYK A;  5L8U A;  3IU6 A;  4QC1 A;  4YH4 A;  5I80 A;  4C66 A;  4YYJ A;  4O7C A;  5DYX A;  3JVK A;  4HXK A;  4YYG A;  4QBM A;  5FG5 A;  5DFC A;  5LKU A;  4YYM A;  5BT5 A;  5F2P A;  5DFD A;  5FH8 A;  3P1E A;  5EQ1 A;  5FBX A;  5F1H A;  3G0J A;  5CGP A;  4YK0 A;  4NQN A;  5L99 A;  4QST A;  5DKC A;  4TT2 A;  5FE2 A;  3MXF A;  2N9G A;  5BT4 A;  4LDF A;  5ENI A;  3GG3 A;  5HEL A;  4NRB A;  4QUT A;  5H1T A;  3LQH A;  5LKT A;  4F3I A;  5EWC A;  3AAD A;  5HEM A;  4Z6I A;  5G4R A;  4J3I A;  5KTU A;  2R0Y A;  3QZS A;  2G4A A;  4O74 A;  5E0R A;  4WHU A;  5FB1 A;  3S92 A;  5KU3 A;  5CUC A;  5A7C A;  5D3S A;  4QC3 A;  5I88 A;  4QSX A;  4QEU A;  3AQA A;  4A9F A;  4A9H A;  4KV4 A;  4MEO A;  5EPB A;  5D3P A;  5CTL A;  5K29 A;  4NR6 A;  2R10 A;  4O7B A;  3G0L A;  5F36 A;  4YBM A;  2KTB B;  3UVX A;  4QNS A;  4A9N A;  5A5S A;  5A5R A;  5HFQ A;  3ZYU A;  5AD2 A;  5AD3 A;  5FE1 A;  4OUF A;  5A81 A;  5H1U A;  5CQ8 A;  4QYL A;  4N4I A;  5FFW A;  2RS9 B;  2RI7 A;  5FE7 A;  5EV9 A;  5FH6 A;  5CQ6 A;  5DW2 A;  5HQ7 A;  4YYN A;  5C85 A;  5J0D A;  4Q0N A;  4A9M A;  3LJW A;  5CRZ A;  4YAD A;  5F25 A;  3UV5 A;  4IOQ A;  5FFV A;  4CUU A;  2OSS A;  4YAX A;  5A5N A;  4UYF B;  4OGI A;  4O7F A;  5D3R A;  2RNW A;  5CQ3 A;  5EM3 A;  2DVR A;  4QSR A;  5DKD A;  5CFW A;  5TB6 A;  4UYF A;  5HM0 A;  5EVA A;  5LJ2 A;  4CFL A;  2L84 A;  4MR3 A;  4PCI A;  4J1P A;  4PTB A;  2DVS A;  4HXO A;  4O70 A;  5HCL A;  3UVY A;  2D82 A;  5C89 A;  4QSQ A;  5CP5 A;  4IR4 A;  4BW3 A;  4TZ8 A;  5G4S A;  4YBS A;  5BT3 A;  3QZT A;  5FH7 A;  5I7X A;  4QSU A;  5LUU A;  4QZS A;  3O36 A;  2WP1 A;  5D0C A;  3MB3 A;  4NUC A;  5DLZ A;  3JVJ A;  4N3W A;  4XY8 A;  5FE9 A;  4Z1Q A;  5A82 A;  5H85 A;  4HXR A;  4NYW A;  3MQM A;  5DYA A;  4NR7 A;  4LYW A;  4CUR A;  4UYG A;  5DBM A;  5EPR A;  4QSS A;  2R0V A;  5IGM A;  4HXS A;  5EWV A;  5D7X A;  4YYH A;  4MEQ A;  3LQJ A;  2FSA A;  5ACY A;  4IOO A;  1ZS5 A;  4LZR A;  5DW1 A;  2E7N A;  4YY4 A;  5AMF A;  4CUS A;  4NUE A;  4NYX A;  5ENB A;  3O37 A;  3MUL A;  5CQA A;  5L97 A;  5ENF A;  3DWY A;  4A9L A;  4UYD A;  4DON A;  3UV2 A;  2LSP B;  5EU1 A;  3MB4 A;  4Z93 A;  5ENC A;  5CUA A;  4XUA A;  3P5O A;  4RVR A;  5D3J A;  3RCW A;  5F5Z A;  5E9K A;  4CUQ A;  5A5O A;  5D3L A;  5CZG A;  3NXB A;  4A9O A;  2MJV B;  5A5P A;  4QSV A;  5HQ6 A;  4PY6 A;  5EWD A;  3O33 A;  2L5E A;  4E96 A;  5LVR A;  4A9I A;  5ENJ A;  2RFJ A;  2NXB A;  5FE3 A;  5CU8 A;  4QSW A;  4J0S A;  4UIZ A;  5D26 A;  5E3G A;  4YC9 A;  5E7D A;  5F3A A;  5D24 A;  4Q0O A;  4X2I A;  2RNY A;  5KTX A;  4FLP A;  2I8N A;  4O72 A;  1WUM A;  4TU4 A;  4TZ2 A;  4UIY A;  5C87 A;  4YY6 A;  4Z6H A;  4N4F A;  5II2 A;  5L8T A;  5CUG A;  2R0S A;  4UIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...