5K29A

Trypanosoma brucei bromodomain bdf5 (tb427tmp.01.5000)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
97
Chain Sequence
RQLLYPREEMVSLVRSLDRPKVCPNRCDLATAADRAAKGAYGYDVQLTTLKEDIRLMVNNCILFNGAEGAYADAARTFEKFAMGKIDAYISQKVGGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein BDF5
publication title Trypanosoma brucei bromodomain BDF5 (Tb427tmp.01.5000)
rcsb
source organism Trypanosoma brucei brucei (strain 927/4 gutat10.1)
total genus 36
structure length 97
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5k29A00
3RCWA 5FH8A 2DVVA 4QBMA 4YH3A 4YYDA 5CQTA 3JVLA 2YELA 3O36A 3UVWA 4DONA 5DFBA 4UYGA 5KHMA 5AD3A 3DWYA 2R0YA 5L8TA 3U5MA 5FB0A 4CLBA 3HMFA 5DBMA 4QR5A 3ONIA 5ACYA 2OSSA 5I80A 5EWDA 5FFVA 5EWVA 4BJXA 5A83A 3UVXA 5JI8A 4UIVA 4QR4A 4BW2A 5LKUA 4UIUA 1N72A 4NR9A 5LKTA 2RS9B 2OUOA 5I29A 4NYVA 2RO1A 5IGLA 3MXFA 5DYAA 5A5RA 5FFYA 4TU4A 5E9YA 4QSVA 2DVSA 5DY7A 4O71A 2L5EA 5DYCA 5EWCA 5E9KA 4QB3A 5D24A 5FG6A 4YY4A 5IBNA 5LVRA 4UIYA 5ENBA 4YAXA 5EPSA 5L99A 5D3RA 5F2PA 5CQ6A 5LKXA 2L85A 4LZ2A 4QEUA 4C66A 5I88A 2YDWA 3G0JA 5L97A 1JM4B 4NR8A 5FE3A 5FFWA 3U5LA 4YYMA 4TTEA 4O75A 5IIDA 4O7EA 5CUEA 5LJ1A 2D82A 4NYWA 5DKDA 4ZQLA 4LRGA 5F1HA 3S91A 5FE8A 3P1EA 4QNSA 4HBXA 5D3SA 5I1QA 4LYSA 4ALGA 5D25A 5D3NA 5HRWA 4NYXA 3MULA 5DKCA 4TQNA 4PY6A 4QEVA 4NRBA 4QSTA 4O78A 4MR6A 4GPJA 4PKLA 4O72A 4QZSA 5H85A 4J3IA 3O37A 4YYJA 2RNYA 4O76A 4LZRA 4O70A 3HMHA 5HRVA 4Z1SA 3P1FA 3UVDA 5CTLA 1EQFA 4MEPA 2YW5A 4UYDA 4NRCA 4TYLA 5DLXA 2NXBA 5DW2A 3ZYUA 5I7YA 1ZS5A 4IOQA 3MB4A 5FG4A 4TU6A 4CUUA 3LQIA 5EGUA 4UIXA 5L96A 4Z6HA 4F3IA 4QUUA 5FB1A 5HRXA 5ENFA 2WP1A 5FG5A 4NR7A 5HLSA 5D3HA 3O34A 5COIA 4Q0NA 5CQAA 5D3JA 5LUUA 4HXPA 2YQDA 4TZ8A 4UITA 4CUQA 5FE5A 4TT6A 3HMEA 4ALHA 5HENA 4ZW1A 1WUGA 5KTXA 5HFQA 4HXSA 5FE7A 5E73A 4QSWA 4QSRA 4UIZA 5EU1A 4UIWA 5KTWA 4WHUA 4LC2A 5KTUA 5IGNA 3U5JA 4BW3A 1F68A 2WP2A 5CUDA 4OGJA 4A9JA 2RNWA 2I7KA 5DLZA 4IOOA 5E9MA 4PTBA 4CUPA 4UYFA 5CGPA 5CU8A 4N4HA 4QY4A 5ETDA 4WHWA 4HXMA 5E3GA 5HFRA 3AQAA 4YYKA 4MR3A 5ENIA 2F6JA 4ZC9A 5DYUA 4O7BA 5F5ZA 5CPEA 3SVFA 5FDZA 4HXNA 5A5QA 3LXJA 4KV1A 5I89A 4Q0OA 5A5NA 4N4GA 5E74A 4HBYA 5I83A 3LQJA 4PCIA 4HXKA 4BHWA 3IU5A 2H60A 2R0VA 5H1VA 4A9IA 4QC3A 4XY9A 4IORA 5J0DA 4QEWA 5CRMA 1JSPB 4UYHA 2G4AA 4YYHA 5CQ4A 3TLPA 2R10A 5A7CA 5JWMA 4TT4A 5DX4A 5F3AA 4YBTA 2OO1A 3Q2FA 4XY8A 3UVYA 5F60A 4CFKA 5K29A 2LSPB 2YEMA 4O7AA 4O7FA 3UV5A 5L8UA 5HQ7A 4TZ2A 4HBVA 5EM3A 5CQ3A 4YADA 4Z6IA 5EQ1A 2DWWA 4A9NA 5FE6A 5A81A 5FE2A 4Y03A 5CZGA 4QUTA 5H1UA 3P1DA 5C4QA 4MENA 3I3JA 3O33A 5EA1A 4N4IA 4CUSA 5L98A 5C89A 4QYDA 5HQ5A 5C7NA 4BW1A 5ENJA 5G4SA 3LJWA 5D3LA 5A5SA 5BT4A 5A5OA 4X2IA 5DYXA 5AD2A 3UW9A 5FE0A 3U5OA 4YK0A 4UYFB 5DFCA 5EWWA 4CFLA 2I8NA 2L84A 4XUBA 5F36A 5F62A 5CP5A 4A9LA 5AMEA 5EVAA 5FBXA 2R0SA 4XYAA 2N9GA 5I7XA 4Z1QA 5IGKA 2DVRA 5CS8A 2GRCA 2MJVB 4N3WA 4NQMA 5BT3A 5KO4A 5HQ6A 4PS5A 3QZTA 5CQ7A 5BT5A 5LVQA 5G4RA 2D9EA 5I86A 4MEQA 4TS8A 5ENCA 2E7NA 5F1LA 5CY9A 4C67A 5A5PA 4O74A 4AKNA 3UV2A 3Q2EA 5CQ8A 5HELA 5FE4A 2KTBB 3IU6A 4YH4A 4J1PA 4NR5A 3MB3A 3AADA 4KCXA 4YYIA 5C85A 4LR6A 4NQNA 4IR6A 4IR3A 5E9IA 5TB6A 5D26A 3JVMA 5FH7A 5HEMA 5IG6A 5E9LA 4J0SA 5ETBA 4YBMA 5CQ5A 4XUAA 3G0LA 5DW1A 5LKZA 5CRZA 4YY6A 2YYNA 5EPRA 5D3PA 4NXJA 4E96A 5CUGA 4A9EA 5II2A 4A9FA 5FE9A 5EICA 4J0RA 3NXBA 5A82A 4PCEA 5LJ2A 4QSPA 2DVQA 5CUCA 3S92A 5D0CA 4A9MA 3FKMX 3O35A 1E6IA 4A9OA 4CUTA 2E7OA 3U5PA 4FLPA 5FH6A 3U5KA 3QZSA 4A9HA 3P5OA 5LJ0A 5E3DA 3MUKA 4LZSA 4OUFA 5D7XA 4YC9A 4A9KA 5F63A 5F61A 5H1TA 4CURA 4MR4A 1WUMA 3UV4A 5CFWA 4HBWA 3P1CA 3SVGA 4O77A 3U5NA 4LDFA 4YYNA 4NRAA 5HM0A 5EV9A 5A85A 5C87A 4O7CA 3LQHA 4NS5A 5II1A 5EK9A 5ENEA 2FSAA 4NR4A 5F25A 4QSQA 5E7DA 5D3TA 4CL9A 4LYWA 2E3KA 4IR5A 4QSXA 4YYGA 4IR4A 5FE1A 4RVRA 3QZVA 4YBSA 3DAIA 5EISA 4BW4A 4NUEA 3SVHA 5C8GA 5HCLA 3D7CA 4NUDA 5E0RA 4WIVA 4MR5A 4MEOA 4UYEA 5KU3A 5I40A 4NUCA 5CUAA 3JVJA 5DFDA 4HXRA 5EPBA 2RNXA 4HXLA 2DKWA 4NR6A 5EP7A 5TCMA 5AMFA 5CUBA 5IGMA 4QSSA 2YEKA 3GG3A 3MQMA 5E9VA 5ENHA 4QYLA 4LYIA 4YABA 5ENGA 4OGIA 4QC1A 4Z93A 5EI4A 5EWHA 5HJCA 3K2JA 4KV4A 5DKHA 3JVKA 4YATA 4N4FA 2RFJA 4HXOA 2RI7A 4QSUA 2F6NA 4TT2A 2DATA 4QR3A 1X0JA
chains in the Genus database with same CATH superfamily
3RCWA 5FH8A 2DVVA 4QBMA 4YH3A 4YYDA 5CQTA 3JVLA 2YELA 3O36A 3UVWA 4DONA 5DFBA 4UYGA 5KHMA 5AD3A 3DWYA 2R0YA 5L8TA 3U5MA 5FB0A 4CLBA 3HMFA 5DBMA 4QR5A 1PUOA 3ONIA 5ACYA 2OSSA 5I80A 5EWDA 5FFVA 5EWVA 4BJXA 5A83A 3UVXA 5JI8A 4UIVA 4QR4A 4BW2A 5LKUA 4UIUA 1N72A 4NR9A 5LKTA 2RS9B 2OUOA 5I29A 4NYVA 2RO1A 5IGLA 3MXFA 5DYAA 5A5RA 5FFYA 4TU4A 5E9YA 4QSVA 2DVSA 5DY7A 4O71A 2L5EA 5DYCA 5EWCA 3D1BA 5E9KA 4QB3A 5D24A 5FG6A 4YY4A 5IBNA 5LVRA 4UIYA 5ENBA 4YAXA 5EPSA 5L99A 5D3RA 3ERRA 5F2PA 5CQ6A 5LKXA 2L85A 4LZ2A 4QEUA 4C66A 5I88A 2YDWA 3G0JA 5L97A 1JM4B 4NR8A 5FE3A 5FFWA 3U5LA 4YYMA 4TTEA 4O75A 5IIDA 4O7EA 5CUEA 5LJ1A 2D82A 4NYWA 5DKDA 4ZQLA 4LRGA 5F1HA 3S91A 5FE8A 3P1EA 4QNSA 4HBXA 5D3SA 5I1QA 4LYSA 4ALGA 5D25A 5D3NA 5HRWA 4NYXA 3MULA 5DKCA 4TQNA 4PY6A 4QEVA 4NRBA 4QSTA 3D1DA 4O78A 4MR6A 4GPJA 4PKLA 4O72A 4QZSA 5H85A 4J3IA 3O37A 4YYJA 2RNYA 4O76A 4LZRA 4O70A 3HMHA 5HRVA 4Z1SA 3P1FA 3UVDA 5CTLA 1EQFA 4MEPA 2YW5A 4UYDA 4NRCA 4TYLA 5DLXA 2NXBA 5DW2A 3ZYUA 5I7YA 1ZS5A 4IOQA 3MB4A 5FG4A 4TU6A 4CUUA 3LQIA 5EGUA 4UIXA 5L96A 4Z6HA 4F3IA 4QUUA 5FB1A 5HRXA 5ENFA 2WP1A 5FG5A 4NR7A 5HLSA 5D3HA 3O34A 5COIA 4Q0NA 5CQAA 5D3JA 5LUUA 4HXPA 2YQDA 4TZ8A 4UITA 4CUQA 5FE5A 4TT6A 3HMEA 4ALHA 5HENA 4ZW1A 1WUGA 5KTXA 5HFQA 4HXSA 5FE7A 5E73A 4QSWA 4AKGA 4QSRA 4UIZA 5EU1A 4UIWA 5KTWA 4WHUA 4LC2A 5KTUA 5IGNA 3U5JA 4BW3A 1F68A 2WP2A 5CUDA 4OGJA 4A9JA 2RNWA 2I7KA 5DLZA 4IOOA 5E9MA 4PTBA 4CUPA 4UYFA 5CGPA 5CU8A 4N4HA 4QY4A 5ETDA 4WHWA 4HXMA 5E3GA 5HFRA 3AQAA 4YYKA 4MR3A 5ENIA 2F6JA 4ZC9A 5DYUA 4O7BA 5F5ZA 3VKHA 5CPEA 3SVFA 5FDZA 4HXNA 5A5QA 3LXJA 4KV1A 5I89A 4Q0OA 5A5NA 4N4GA 5E74A 4HBYA 5I83A 3LQJA 4PCIA 4HXKA 4BHWA 3IU5A 2H60A 2R0VA 5H1VA 4A9IA 4QC3A 4XY9A 4IORA 5J0DA 4QEWA 5CRMA 1JSPB 4UYHA 2G4AA 4YYHA 3VKGA 5CQ4A 3TLPA 2R10A 5A7CA 5JWMA 4TT4A 5DX4A 5F3AA 4YBTA 2OO1A 3Q2FA 4XY8A 3UVYA 5F60A 4CFKA 5K29A 2LSPB 2YEMA 4O7AA 4O7FA 3UV5A 5L8UA 5HQ7A 4TZ2A 2EJNA 4HBVA 5CQ3A 4YADA 5EM3A 4Z6IA 5EQ1A 2DWWA 4A9NA 5FE6A 5A81A 5FE2A 4Y03A 5CZGA 4QUTA 5H1UA 3P1DA 5C4QA 4MENA 3I3JA 3O33A 5EA1A 4N4IA 4CUSA 5L98A 5C89A 4QYDA 5HQ5A 5C7NA 4BW1A 5ENJA 5G4SA 3LJWA 5D3LA 5A5SA 5BT4A 5A5OA 4X2IA 5DYXA 5AD2A 3UW9A 5FE0A 3U5OA 4YK0A 4UYFB 5DFCA 5EWWA 4CFLA 2I8NA 2L84A 4XUBA 5F36A 5F62A 5CP5A 4A9LA 5AMEA 5EVAA 5FBXA 2R0SA 4XYAA 2N9GA 5I7XA 4Z1QA 5IGKA 2DVRA 5CS8A 2GRCA 2MJVB 4N3WA 4AKHA 4NQMA 5BT3A 5KO4A 5HQ6A 4PS5A 3QZTA 5CQ7A 5BT5A 5LVQA 5G4RA 2D9EA 5I86A 4MEQA 4TS8A 5ENCA 2E7NA 5F1LA 5CY9A 4C67A 5A5PA 4O74A 4AKNA 3UV2A 3Q2EA 5CQ8A 5HELA 5FE4A 2KTBB 3IU6A 4YH4A 4J1PA 4NR5A 3MB3A 3AADA 4KCXA 4YYIA 5C85A 4LR6A 4NQNA 4IR6A 4IR3A 5E9IA 5TB6A 5D26A 3JVMA 5FH7A 5HEMA 5IG6A 5E9LA 4J0SA 5ETBA 4YBMA 5CQ5A 4XUAA 3G0LA 5DW1A 5LKZA 5CRZA 4YY6A 2YYNA 5EPRA 5D3PA 4NXJA 4E96A 5CUGA 4AKIA 4A9EA 5II2A 4A9FA 5FE9A 5EICA 4J0RA 3NXBA 5A82A 4PCEA 5LJ2A 4QSPA 2DVQA 5CUCA 3S92A 5D0CA 4A9MA 3FKMX 3O35A 1E6IA 4A9OA 4CUTA 2E7OA 3U5PA 4FLPA 5FH6A 3U5KA 3QZSA 4A9HA 3P5OA 5LJ0A 5E3DA 3MUKA 4LZSA 4OUFA 5D7XA 4YC9A 4A9KA 5F63A 5F61A 5H1TA 4CURA 4MR4A 1WUMA 3UV4A 5CFWA 4HBWA 3P1CA 3SVGA 1ZKRA 4O77A 3U5NA 4LDFA 4YYNA 4NRAA 5HM0A 5EV9A 5A85A 5C87A 4O7CA 3LQHA 4NS5A 5II1A 5EK9A 5ENEA 2FSAA 4NR4A 5F25A 4QSQA 5E7DA 5D3TA 4CL9A 4LYWA 2E3KA 4IR5A 4QSXA 4YYGA 4IR4A 5FE1A 4RVRA 3QZVA 4YBSA 3DAIA 5EISA 4BW4A 4NUEA 3SVHA 5C8GA 5HCLA 3D7CA 4NUDA 5E0RA 4WIVA 4MR5A 4MEOA 4UYEA 5KU3A 5I40A 4NUCA 5CUAA 3JVJA 5DFDA 4HXRA 5EPBA 2RNXA 4HXLA 2DKWA 4NR6A 5EP7A 5TCMA 5AMFA 5CUBA 5IGMA 4QSSA 2YEKA 4AI6A 3GG3A 3MQMA 5E9VA 5ENHA 4QYLA 4LYIA 4YABA 5ENGA 4OGIA 4QC1A 4Z93A 5EI4A 5EWHA 5HJCA 3K2JA 4KV4A 5DKHA 3JVKA 4YATA 4N4FA 2RFJA 4HXOA 2RI7A 4QSUA 2F6NA 4TT2A 2DATA 4QR3A 1X0JA
chains in the Genus database with same CATH topology
3RCWA 5FH8A 2DVVA 4QBMA 4YH3A 4YYDA 5CQTA 3JVLA 2YELA 3O36A 3UVWA 4DONA 5DFBA 4UYGA 5KHMA 5AD3A 3DWYA 2R0YA 5L8TA 3U5MA 5FB0A 4CLBA 3HMFA 5DBMA 4QR5A 3ONIA 5ACYA 2OSSA 5I80A 5EWDA 5FFVA 5EWVA 4BJXA 5A83A 3UVXA 5JI8A 4UIVA 4QR4A 4BW2A 5LKUA 4UIUA 1N72A 4NR9A 5LKTA 2RS9B 2OUOA 5I29A 4NYVA 2RO1A 5IGLA 3MXFA 5DYAA 5A5RA 5FFYA 4TU4A 5E9YA 4QSVA 2DVSA 5DY7A 4O71A 2L5EA 5DYCA 5EWCA 5E9KA 4QB3A 5D24A 5FG6A 4YY4A 5IBNA 5LVRA 4UIYA 5ENBA 4YAXA 5EPSA 5L99A 5D3RA 5F2PA 5CQ6A 5LKXA 2L85A 4LZ2A 4QEUA 4C66A 5I88A 2YDWA 3G0JA 5L97A 1JM4B 4NR8A 5FE3A 5FFWA 3U5LA 4YYMA 4TTEA 4O75A 5IIDA 4O7EA 5CUEA 5LJ1A 2D82A 4NYWA 5DKDA 4ZQLA 4LRGA 5F1HA 3S91A 5FE8A 3P1EA 4QNSA 4HBXA 5D3SA 5I1QA 4LYSA 4ALGA 5D25A 5D3NA 5HRWA 4NYXA 3MULA 5DKCA 4TQNA 4PY6A 4QEVA 4NRBA 4QSTA 4O78A 4MR6A 4GPJA 4PKLA 4O72A 4QZSA 5H85A 4J3IA 3O37A 4YYJA 2RNYA 4O76A 4LZRA 4O70A 3HMHA 5HRVA 4Z1SA 3P1FA 3UVDA 5CTLA 1EQFA 4MEPA 2YW5A 4UYDA 4NRCA 4TYLA 5DLXA 2NXBA 5DW2A 3ZYUA 5I7YA 1ZS5A 4IOQA 3MB4A 5FG4A 4TU6A 4CUUA 3LQIA 5EGUA 4UIXA 5L96A 4Z6HA 4F3IA 4QUUA 5FB1A 5HRXA 5ENFA 2WP1A 5FG5A 4NR7A 5HLSA 5D3HA 3O34A 5COIA 4Q0NA 5CQAA 5D3JA 5LUUA 4HXPA 2YQDA 4TZ8A 4UITA 4CUQA 5FE5A 4TT6A 3HMEA 4ALHA 5HENA 4ZW1A 1WUGA 5KTXA 5HFQA 4HXSA 5FE7A 5E73A 4QSWA 4QSRA 4UIZA 5EU1A 4UIWA 5KTWA 4WHUA 4LC2A 5KTUA 5IGNA 3U5JA 4BW3A 1F68A 2WP2A 5CUDA 4OGJA 4A9JA 2RNWA 2I7KA 5DLZA 4IOOA 5E9MA 4PTBA 4CUPA 4UYFA 5CGPA 5CU8A 4N4HA 4QY4A 5ETDA 4WHWA 4HXMA 5E3GA 5HFRA 3AQAA 4YYKA 4MR3A 5ENIA 2F6JA 4ZC9A 5DYUA 4O7BA 5F5ZA 5CPEA 3SVFA 5FDZA 4HXNA 5A5QA 3LXJA 4KV1A 5I89A 4Q0OA 5A5NA 4N4GA 5E74A 4HBYA 5I83A 3LQJA 4PCIA 4HXKA 4BHWA 3IU5A 2H60A 2R0VA 5H1VA 4A9IA 4QC3A 4XY9A 4IORA 5J0DA 4QEWA 5CRMA 1JSPB 4UYHA 2G4AA 4YYHA 5CQ4A 3TLPA 2R10A 5A7CA 5JWMA 4TT4A 5DX4A 5F3AA 4YBTA 2OO1A 3Q2FA 4XY8A 3UVYA 5F60A 4CFKA 5K29A 2LSPB 2YEMA 4O7AA 4O7FA 3UV5A 5L8UA 5HQ7A 4TZ2A 4HBVA 5EM3A 5CQ3A 4YADA 4Z6IA 5EQ1A 2DWWA 4A9NA 5FE6A 5A81A 5FE2A 4Y03A 5CZGA 4QUTA 5H1UA 3P1DA 5C4QA 4MENA 3I3JA 3O33A 5EA1A 4N4IA 4CUSA 5L98A 5C89A 4QYDA 5HQ5A 5C7NA 4BW1A 5ENJA 5G4SA 3LJWA 5D3LA 5A5SA 5BT4A 5A5OA 4X2IA 5DYXA 5AD2A 3UW9A 5FE0A 3U5OA 4YK0A 4UYFB 5DFCA 5EWWA 4CFLA 2I8NA 2L84A 4XUBA 5F36A 5F62A 5CP5A 4A9LA 5AMEA 5EVAA 5FBXA 2R0SA 4XYAA 2N9GA 5I7XA 4Z1QA 5IGKA 2DVRA 5CS8A 2GRCA 2MJVB 4N3WA 4NQMA 5BT3A 5KO4A 5HQ6A 4PS5A 3QZTA 5CQ7A 5BT5A 5LVQA 5G4RA 2D9EA 5I86A 4MEQA 4TS8A 5ENCA 2E7NA 5F1LA 5CY9A 4C67A 5A5PA 4O74A 4AKNA 3UV2A 3Q2EA 5CQ8A 5HELA 5FE4A 2KTBB 3IU6A 4YH4A 4J1PA 4NR5A 3MB3A 3AADA 4KCXA 4YYIA 5C85A 4LR6A 4NQNA 4IR6A 4IR3A 5E9IA 5TB6A 5D26A 3JVMA 5FH7A 5HEMA 5IG6A 5E9LA 4J0SA 5ETBA 4YBMA 5CQ5A 4XUAA 3G0LA 5DW1A 5LKZA 5CRZA 4YY6A 2YYNA 5EPRA 5D3PA 4NXJA 4E96A 5CUGA 4A9EA 5II2A 4A9FA 5FE9A 5EICA 4J0RA 3NXBA 5A82A 4PCEA 5LJ2A 4QSPA 2DVQA 5CUCA 3S92A 5D0CA 4A9MA 3FKMX 3O35A 1E6IA 4A9OA 4CUTA 2E7OA 3U5PA 4FLPA 5FH6A 3U5KA 3QZSA 4A9HA 3P5OA 5LJ0A 5E3DA 3MUKA 4LZSA 4OUFA 5D7XA 4YC9A 4A9KA 5F63A 5F61A 5H1TA 4CURA 4MR4A 1WUMA 3UV4A 5CFWA 4HBWA 3P1CA 3SVGA 4O77A 3U5NA 4LDFA 4YYNA 4NRAA 5HM0A 5EV9A 5A85A 5C87A 4O7CA 3LQHA 4NS5A 5II1A 5EK9A 5ENEA 2FSAA 4NR4A 5F25A 4QSQA 5E7DA 5D3TA 4CL9A 4LYWA 2E3KA 4IR5A 4QSXA 4YYGA 4IR4A 5FE1A 4RVRA 3QZVA 4YBSA 3DAIA 5EISA 4BW4A 4NUEA 3SVHA 5C8GA 5HCLA 3D7CA 4NUDA 5E0RA 4WIVA 4MR5A 4MEOA 4UYEA 5KU3A 5I40A 4NUCA 5CUAA 3JVJA 5DFDA 4HXRA 5EPBA 2RNXA 4HXLA 2DKWA 4NR6A 5EP7A 5TCMA 5AMFA 5CUBA 5IGMA 4QSSA 2YEKA 3GG3A 3MQMA 5E9VA 5ENHA 4QYLA 4LYIA 4YABA 5ENGA 4OGIA 4QC1A 4Z93A 5EI4A 5EWHA 5HJCA 3K2JA 4KV4A 5DKHA 3JVKA 4YATA 4N4FA 2RFJA 4HXOA 2RI7A 4QSUA 2F6NA 4TT2A 2DATA 4QR3A 1X0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RCW A;  5FH8 A;  2DVV A;  4QBM A;  4YH3 A;  4YYD A;  5CQT A;  3JVL A;  2YEL A;  3O36 A;  3UVW A;  4DON A;  5DFB A;  4UYG A;  5KHM A;  5AD3 A;  3DWY A;  2R0Y A;  5L8T A;  3U5M A;  5FB0 A;  4CLB A;  3HMF A;  5DBM A;  4QR5 A;  3ONI A;  5ACY A;  2OSS A;  5I80 A;  5EWD A;  5FFV A;  5EWV A;  4BJX A;  5A83 A;  3UVX A;  5JI8 A;  4UIV A;  4QR4 A;  4BW2 A;  5LKU A;  4UIU A;  1N72 A;  4NR9 A;  5LKT A;  2RS9 B;  2OUO A;  5I29 A;  4NYV A;  2RO1 A;  5IGL A;  3MXF A;  5DYA A;  5A5R A;  5FFY A;  4TU4 A;  5E9Y A;  4QSV A;  2DVS A;  5DY7 A;  4O71 A;  2L5E A;  5DYC A;  5EWC A;  5E9K A;  4QB3 A;  5D24 A;  5FG6 A;  4YY4 A;  5IBN A;  5LVR A;  4UIY A;  5ENB A;  4YAX A;  5EPS A;  5L99 A;  5D3R A;  5F2P A;  5CQ6 A;  5LKX A;  2L85 A;  4LZ2 A;  4QEU A;  4C66 A;  5I88 A;  2YDW A;  3G0J A;  5L97 A;  1JM4 B;  4NR8 A;  5FE3 A;  5FFW A;  3U5L A;  4YYM A;  4TTE A;  4O75 A;  5IID A;  4O7E A;  5CUE A;  5LJ1 A;  2D82 A;  4NYW A;  5DKD A;  4ZQL A;  4LRG A;  5F1H A;  3S91 A;  5FE8 A;  3P1E A;  4QNS A;  4HBX A;  5D3S A;  5I1Q A;  4LYS A;  4ALG A;  5D25 A;  5D3N A;  5HRW A;  4NYX A;  3MUL A;  5DKC A;  4TQN A;  4PY6 A;  4QEV A;  4NRB A;  4QST A;  4O78 A;  4MR6 A;  4GPJ A;  4PKL A;  4O72 A;  4QZS A;  5H85 A;  4J3I A;  3O37 A;  4YYJ A;  2RNY A;  4O76 A;  4LZR A;  4O70 A;  3HMH A;  5HRV A;  4Z1S A;  3P1F A;  3UVD A;  5CTL A;  1EQF A;  4MEP A;  2YW5 A;  4UYD A;  4NRC A;  4TYL A;  5DLX A;  2NXB A;  5DW2 A;  3ZYU A;  5I7Y A;  1ZS5 A;  4IOQ A;  3MB4 A;  5FG4 A;  4TU6 A;  4CUU A;  3LQI A;  5EGU A;  4UIX A;  5L96 A;  4Z6H A;  4F3I A;  4QUU A;  5FB1 A;  5HRX A;  5ENF A;  2WP1 A;  5FG5 A;  4NR7 A;  5HLS A;  5D3H A;  3O34 A;  5COI A;  4Q0N A;  5CQA A;  5D3J A;  5LUU A;  4HXP A;  2YQD A;  4TZ8 A;  4UIT A;  4CUQ A;  5FE5 A;  4TT6 A;  3HME A;  4ALH A;  5HEN A;  4ZW1 A;  1WUG A;  5KTX A;  5HFQ A;  4HXS A;  5FE7 A;  5E73 A;  4QSW A;  4QSR A;  4UIZ A;  5EU1 A;  4UIW A;  5KTW A;  4WHU A;  4LC2 A;  5KTU A;  5IGN A;  3U5J A;  4BW3 A;  1F68 A;  2WP2 A;  5CUD A;  4OGJ A;  4A9J A;  2RNW A;  2I7K A;  5DLZ A;  4IOO A;  5E9M A;  4PTB A;  4CUP A;  4UYF A;  5CGP A;  5CU8 A;  4N4H A;  4QY4 A;  5ETD A;  4WHW A;  4HXM A;  5E3G A;  5HFR A;  3AQA A;  4YYK A;  4MR3 A;  5ENI A;  2F6J A;  4ZC9 A;  5DYU A;  4O7B A;  5F5Z A;  5CPE A;  3SVF A;  5FDZ A;  4HXN A;  5A5Q A;  3LXJ A;  4KV1 A;  5I89 A;  4Q0O A;  5A5N A;  4N4G A;  5E74 A;  4HBY A;  5I83 A;  3LQJ A;  4PCI A;  4HXK A;  4BHW A;  3IU5 A;  2H60 A;  2R0V A;  5H1V A;  4A9I A;  4QC3 A;  4XY9 A;  4IOR A;  5J0D A;  4QEW A;  5CRM A;  1JSP B;  4UYH A;  2G4A A;  4YYH A;  5CQ4 A;  3TLP A;  2R10 A;  5A7C A;  5JWM A;  4TT4 A;  5DX4 A;  5F3A A;  4YBT A;  2OO1 A;  3Q2F A;  4XY8 A;  3UVY A;  5F60 A;  4CFK A;  5K29 A;  2LSP B;  2YEM A;  4O7A A;  4O7F A;  3UV5 A;  5L8U A;  5HQ7 A;  4TZ2 A;  4HBV A;  5EM3 A;  5CQ3 A;  4YAD A;  4Z6I A;  5EQ1 A;  2DWW A;  4A9N A;  5FE6 A;  5A81 A;  5FE2 A;  4Y03 A;  5CZG A;  4QUT A;  5H1U A;  3P1D A;  5C4Q A;  4MEN A;  3I3J A;  3O33 A;  5EA1 A;  4N4I A;  4CUS A;  5L98 A;  5C89 A;  4QYD A;  5HQ5 A;  5C7N A;  4BW1 A;  5ENJ A;  5G4S A;  3LJW A;  5D3L A;  5A5S A;  5BT4 A;  5A5O A;  4X2I A;  5DYX A;  5AD2 A;  3UW9 A;  5FE0 A;  3U5O A;  4YK0 A;  4UYF B;  5DFC A;  5EWW A;  4CFL A;  2I8N A;  2L84 A;  4XUB A;  5F36 A;  5F62 A;  5CP5 A;  4A9L A;  5AME A;  5EVA A;  5FBX A;  2R0S A;  4XYA A;  2N9G A;  5I7X A;  4Z1Q A;  5IGK A;  2DVR A;  5CS8 A;  2GRC A;  2MJV B;  4N3W A;  4NQM A;  5BT3 A;  5KO4 A;  5HQ6 A;  4PS5 A;  3QZT A;  5CQ7 A;  5BT5 A;  5LVQ A;  5G4R A;  2D9E A;  5I86 A;  4MEQ A;  4TS8 A;  5ENC A;  2E7N A;  5F1L A;  5CY9 A;  4C67 A;  5A5P A;  4O74 A;  4AKN A;  3UV2 A;  3Q2E A;  5CQ8 A;  5HEL A;  5FE4 A;  2KTB B;  3IU6 A;  4YH4 A;  4J1P A;  4NR5 A;  3MB3 A;  3AAD A;  4KCX A;  4YYI A;  5C85 A;  4LR6 A;  4NQN A;  4IR6 A;  4IR3 A;  5E9I A;  5TB6 A;  5D26 A;  3JVM A;  5FH7 A;  5HEM A;  5IG6 A;  5E9L A;  4J0S A;  5ETB A;  4YBM A;  5CQ5 A;  4XUA A;  3G0L A;  5DW1 A;  5LKZ A;  5CRZ A;  4YY6 A;  2YYN A;  5EPR A;  5D3P A;  4NXJ A;  4E96 A;  5CUG A;  4A9E A;  5II2 A;  4A9F A;  5FE9 A;  5EIC A;  4J0R A;  3NXB A;  5A82 A;  4PCE A;  5LJ2 A;  4QSP A;  2DVQ A;  5CUC A;  3S92 A;  5D0C A;  4A9M A;  3FKM X;  3O35 A;  1E6I A;  4A9O A;  4CUT A;  2E7O A;  3U5P A;  4FLP A;  5FH6 A;  3U5K A;  3QZS A;  4A9H A;  3P5O A;  5LJ0 A;  5E3D A;  3MUK A;  4LZS A;  4OUF A;  5D7X A;  4YC9 A;  4A9K A;  5F63 A;  5F61 A;  5H1T A;  4CUR A;  4MR4 A;  1WUM A;  3UV4 A;  5CFW A;  4HBW A;  3P1C A;  3SVG A;  4O77 A;  3U5N A;  4LDF A;  4YYN A;  4NRA A;  5HM0 A;  5EV9 A;  5A85 A;  5C87 A;  4O7C A;  3LQH A;  4NS5 A;  5II1 A;  5EK9 A;  5ENE A;  2FSA A;  4NR4 A;  5F25 A;  4QSQ A;  5E7D A;  5D3T A;  4CL9 A;  4LYW A;  2E3K A;  4IR5 A;  4QSX A;  4YYG A;  4IR4 A;  5FE1 A;  4RVR A;  3QZV A;  4YBS A;  3DAI A;  5EIS A;  4BW4 A;  4NUE A;  3SVH A;  5C8G A;  5HCL A;  3D7C A;  4NUD A;  5E0R A;  4WIV A;  4MR5 A;  4MEO A;  4UYE A;  5KU3 A;  5I40 A;  4NUC A;  5CUA A;  3JVJ A;  5DFD A;  4HXR A;  5EPB A;  2RNX A;  4HXL A;  2DKW A;  4NR6 A;  5EP7 A;  5TCM A;  5AMF A;  5CUB A;  5IGM A;  4QSS A;  2YEK A;  3GG3 A;  3MQM A;  5E9V A;  5ENH A;  4QYL A;  4LYI A;  4YAB A;  5ENG A;  4OGI A;  4QC1 A;  4Z93 A;  5EI4 A;  5EWH A;  5HJC A;  3K2J A;  4KV4 A;  5DKH A;  3JVK A;  4YAT A;  4N4F A;  2RFJ A;  4HXO A;  2RI7 A;  4QSU A;  2F6N A;  4TT2 A;  2DAT A;  4QR3 A;  1X0J A; 
#chains in the Genus database with same CATH topology
 3RCW A;  5FH8 A;  2DVV A;  4QBM A;  4YH3 A;  4YYD A;  5CQT A;  3JVL A;  2YEL A;  3O36 A;  3UVW A;  4DON A;  5DFB A;  4UYG A;  5KHM A;  5AD3 A;  3DWY A;  2R0Y A;  5L8T A;  3U5M A;  5FB0 A;  4CLB A;  3HMF A;  5DBM A;  4QR5 A;  1PUO A;  3ONI A;  5ACY A;  2OSS A;  5I80 A;  5EWD A;  5FFV A;  5EWV A;  4BJX A;  5A83 A;  3UVX A;  5JI8 A;  4UIV A;  4QR4 A;  4BW2 A;  5LKU A;  4UIU A;  1N72 A;  4NR9 A;  5LKT A;  2RS9 B;  2OUO A;  5I29 A;  4NYV A;  2RO1 A;  5IGL A;  3MXF A;  5DYA A;  5A5R A;  5FFY A;  4TU4 A;  5E9Y A;  4QSV A;  2DVS A;  5DY7 A;  4O71 A;  2L5E A;  5DYC A;  5EWC A;  3D1B A;  5E9K A;  4QB3 A;  5D24 A;  5FG6 A;  4YY4 A;  5IBN A;  5LVR A;  4UIY A;  5ENB A;  4YAX A;  5EPS A;  5L99 A;  5D3R A;  3ERR A;  5F2P A;  5CQ6 A;  5LKX A;  2L85 A;  4LZ2 A;  4QEU A;  4C66 A;  5I88 A;  2YDW A;  3G0J A;  5L97 A;  1JM4 B;  4NR8 A;  5FE3 A;  5FFW A;  3U5L A;  4YYM A;  4TTE A;  4O75 A;  5IID A;  4O7E A;  5CUE A;  5LJ1 A;  2D82 A;  4NYW A;  5DKD A;  4ZQL A;  4LRG A;  5F1H A;  3S91 A;  5FE8 A;  3P1E A;  4QNS A;  4HBX A;  5D3S A;  5I1Q A;  4LYS A;  4ALG A;  5D25 A;  5D3N A;  5HRW A;  4NYX A;  3MUL A;  5DKC A;  4TQN A;  4PY6 A;  4QEV A;  4NRB A;  4QST A;  3D1D A;  4O78 A;  4MR6 A;  4GPJ A;  4PKL A;  4O72 A;  4QZS A;  5H85 A;  4J3I A;  3O37 A;  4YYJ A;  2RNY A;  4O76 A;  4LZR A;  4O70 A;  3HMH A;  5HRV A;  4Z1S A;  3P1F A;  3UVD A;  5CTL A;  1EQF A;  4MEP A;  2YW5 A;  4UYD A;  4NRC A;  4TYL A;  5DLX A;  2NXB A;  5DW2 A;  3ZYU A;  5I7Y A;  1ZS5 A;  4IOQ A;  3MB4 A;  5FG4 A;  4TU6 A;  4CUU A;  3LQI A;  5EGU A;  4UIX A;  5L96 A;  4Z6H A;  4F3I A;  4QUU A;  5FB1 A;  5HRX A;  5ENF A;  2WP1 A;  5FG5 A;  4NR7 A;  5HLS A;  5D3H A;  3O34 A;  5COI A;  4Q0N A;  5CQA A;  5D3J A;  5LUU A;  4HXP A;  2YQD A;  4TZ8 A;  4UIT A;  4CUQ A;  5FE5 A;  4TT6 A;  3HME A;  4ALH A;  5HEN A;  4ZW1 A;  1WUG A;  5KTX A;  5HFQ A;  4HXS A;  5FE7 A;  5E73 A;  4QSW A;  4AKG A;  4QSR A;  4UIZ A;  5EU1 A;  4UIW A;  5KTW A;  4WHU A;  4LC2 A;  5KTU A;  5IGN A;  3U5J A;  4BW3 A;  1F68 A;  2WP2 A;  5CUD A;  4OGJ A;  4A9J A;  2RNW A;  2I7K A;  5DLZ A;  4IOO A;  5E9M A;  4PTB A;  4CUP A;  4UYF A;  5CGP A;  5CU8 A;  4N4H A;  4QY4 A;  5ETD A;  4WHW A;  4HXM A;  5E3G A;  5HFR A;  3AQA A;  4YYK A;  4MR3 A;  5ENI A;  2F6J A;  4ZC9 A;  5DYU A;  4O7B A;  5F5Z A;  3VKH A;  5CPE A;  3SVF A;  5FDZ A;  4HXN A;  5A5Q A;  3LXJ A;  4KV1 A;  5I89 A;  4Q0O A;  5A5N A;  4N4G A;  5E74 A;  4HBY A;  5I83 A;  3LQJ A;  4PCI A;  4HXK A;  4BHW A;  3IU5 A;  2H60 A;  2R0V A;  5H1V A;  4A9I A;  4QC3 A;  4XY9 A;  4IOR A;  5J0D A;  4QEW A;  5CRM A;  1JSP B;  4UYH A;  2G4A A;  4YYH A;  3VKG A;  5CQ4 A;  3TLP A;  2R10 A;  5A7C A;  5JWM A;  4TT4 A;  5DX4 A;  5F3A A;  4YBT A;  2OO1 A;  3Q2F A;  4XY8 A;  3UVY A;  5F60 A;  4CFK A;  5K29 A;  2LSP B;  2YEM A;  4O7A A;  4O7F A;  3UV5 A;  5L8U A;  5HQ7 A;  4TZ2 A;  2EJN A;  4HBV A;  5CQ3 A;  4YAD A;  5EM3 A;  4Z6I A;  5EQ1 A;  2DWW A;  4A9N A;  5FE6 A;  5A81 A;  5FE2 A;  4Y03 A;  5CZG A;  4QUT A;  5H1U A;  3P1D A;  5C4Q A;  4MEN A;  3I3J A;  3O33 A;  5EA1 A;  4N4I A;  4CUS A;  5L98 A;  5C89 A;  4QYD A;  5HQ5 A;  5C7N A;  4BW1 A;  5ENJ A;  5G4S A;  3LJW A;  5D3L A;  5A5S A;  5BT4 A;  5A5O A;  4X2I A;  5DYX A;  5AD2 A;  3UW9 A;  5FE0 A;  3U5O A;  4YK0 A;  4UYF B;  5DFC A;  5EWW A;  4CFL A;  2I8N A;  2L84 A;  4XUB A;  5F36 A;  5F62 A;  5CP5 A;  4A9L A;  5AME A;  5EVA A;  5FBX A;  2R0S A;  4XYA A;  2N9G A;  5I7X A;  4Z1Q A;  5IGK A;  2DVR A;  5CS8 A;  2GRC A;  2MJV B;  4N3W A;  4AKH A;  4NQM A;  5BT3 A;  5KO4 A;  5HQ6 A;  4PS5 A;  3QZT A;  5CQ7 A;  5BT5 A;  5LVQ A;  5G4R A;  2D9E A;  5I86 A;  4MEQ A;  4TS8 A;  5ENC A;  2E7N A;  5F1L A;  5CY9 A;  4C67 A;  5A5P A;  4O74 A;  4AKN A;  3UV2 A;  3Q2E A;  5CQ8 A;  5HEL A;  5FE4 A;  2KTB B;  3IU6 A;  4YH4 A;  4J1P A;  4NR5 A;  3MB3 A;  3AAD A;  4KCX A;  4YYI A;  5C85 A;  4LR6 A;  4NQN A;  4IR6 A;  4IR3 A;  5E9I A;  5TB6 A;  5D26 A;  3JVM A;  5FH7 A;  5HEM A;  5IG6 A;  5E9L A;  4J0S A;  5ETB A;  4YBM A;  5CQ5 A;  4XUA A;  3G0L A;  5DW1 A;  5LKZ A;  5CRZ A;  4YY6 A;  2YYN A;  5EPR A;  5D3P A;  4NXJ A;  4E96 A;  5CUG A;  4AKI A;  4A9E A;  5II2 A;  4A9F A;  5FE9 A;  5EIC A;  4J0R A;  3NXB A;  5A82 A;  4PCE A;  5LJ2 A;  4QSP A;  2DVQ A;  5CUC A;  3S92 A;  5D0C A;  4A9M A;  3FKM X;  3O35 A;  1E6I A;  4A9O A;  4CUT A;  2E7O A;  3U5P A;  4FLP A;  5FH6 A;  3U5K A;  3QZS A;  4A9H A;  3P5O A;  5LJ0 A;  5E3D A;  3MUK A;  4LZS A;  4OUF A;  5D7X A;  4YC9 A;  4A9K A;  5F63 A;  5F61 A;  5H1T A;  4CUR A;  4MR4 A;  1WUM A;  3UV4 A;  5CFW A;  4HBW A;  3P1C A;  3SVG A;  1ZKR A;  4O77 A;  3U5N A;  4LDF A;  4YYN A;  4NRA A;  5HM0 A;  5EV9 A;  5A85 A;  5C87 A;  4O7C A;  3LQH A;  4NS5 A;  5II1 A;  5EK9 A;  5ENE A;  2FSA A;  4NR4 A;  5F25 A;  4QSQ A;  5E7D A;  5D3T A;  4CL9 A;  4LYW A;  2E3K A;  4IR5 A;  4QSX A;  4YYG A;  4IR4 A;  5FE1 A;  4RVR A;  3QZV A;  4YBS A;  3DAI A;  5EIS A;  4BW4 A;  4NUE A;  3SVH A;  5C8G A;  5HCL A;  3D7C A;  4NUD A;  5E0R A;  4WIV A;  4MR5 A;  4MEO A;  4UYE A;  5KU3 A;  5I40 A;  4NUC A;  5CUA A;  3JVJ A;  5DFD A;  4HXR A;  5EPB A;  2RNX A;  4HXL A;  2DKW A;  4NR6 A;  5EP7 A;  5TCM A;  5AMF A;  5CUB A;  5IGM A;  4QSS A;  2YEK A;  4AI6 A;  3GG3 A;  3MQM A;  5E9V A;  5ENH A;  4QYL A;  4LYI A;  4YAB A;  5ENG A;  4OGI A;  4QC1 A;  4Z93 A;  5EI4 A;  5EWH A;  5HJC A;  3K2J A;  4KV4 A;  5DKH A;  3JVK A;  4YAT A;  4N4F A;  2RFJ A;  4HXO A;  2RI7 A;  4QSU A;  2F6N A;  4TT2 A;  2DAT A;  4QR3 A;  1X0J A; 
#chains in the Genus database with same CATH homology
 3RCW A;  5FH8 A;  2DVV A;  4QBM A;  4YH3 A;  4YYD A;  5CQT A;  3JVL A;  2YEL A;  3O36 A;  3UVW A;  4DON A;  5DFB A;  4UYG A;  5KHM A;  5AD3 A;  3DWY A;  2R0Y A;  5L8T A;  3U5M A;  5FB0 A;  4CLB A;  3HMF A;  5DBM A;  4QR5 A;  3ONI A;  5ACY A;  2OSS A;  5I80 A;  5EWD A;  5FFV A;  5EWV A;  4BJX A;  5A83 A;  3UVX A;  5JI8 A;  4UIV A;  4QR4 A;  4BW2 A;  5LKU A;  4UIU A;  1N72 A;  4NR9 A;  5LKT A;  2RS9 B;  2OUO A;  5I29 A;  4NYV A;  2RO1 A;  5IGL A;  3MXF A;  5DYA A;  5A5R A;  5FFY A;  4TU4 A;  5E9Y A;  4QSV A;  2DVS A;  5DY7 A;  4O71 A;  2L5E A;  5DYC A;  5EWC A;  5E9K A;  4QB3 A;  5D24 A;  5FG6 A;  4YY4 A;  5IBN A;  5LVR A;  4UIY A;  5ENB A;  4YAX A;  5EPS A;  5L99 A;  5D3R A;  5F2P A;  5CQ6 A;  5LKX A;  2L85 A;  4LZ2 A;  4QEU A;  4C66 A;  5I88 A;  2YDW A;  3G0J A;  5L97 A;  1JM4 B;  4NR8 A;  5FE3 A;  5FFW A;  3U5L A;  4YYM A;  4TTE A;  4O75 A;  5IID A;  4O7E A;  5CUE A;  5LJ1 A;  2D82 A;  4NYW A;  5DKD A;  4ZQL A;  4LRG A;  5F1H A;  3S91 A;  5FE8 A;  3P1E A;  4QNS A;  4HBX A;  5D3S A;  5I1Q A;  4LYS A;  4ALG A;  5D25 A;  5D3N A;  5HRW A;  4NYX A;  3MUL A;  5DKC A;  4TQN A;  4PY6 A;  4QEV A;  4NRB A;  4QST A;  4O78 A;  4MR6 A;  4GPJ A;  4PKL A;  4O72 A;  4QZS A;  5H85 A;  4J3I A;  3O37 A;  4YYJ A;  2RNY A;  4O76 A;  4LZR A;  4O70 A;  3HMH A;  5HRV A;  4Z1S A;  3P1F A;  3UVD A;  5CTL A;  1EQF A;  4MEP A;  2YW5 A;  4UYD A;  4NRC A;  4TYL A;  5DLX A;  2NXB A;  5DW2 A;  3ZYU A;  5I7Y A;  1ZS5 A;  4IOQ A;  3MB4 A;  5FG4 A;  4TU6 A;  4CUU A;  3LQI A;  5EGU A;  4UIX A;  5L96 A;  4Z6H A;  4F3I A;  4QUU A;  5FB1 A;  5HRX A;  5ENF A;  2WP1 A;  5FG5 A;  4NR7 A;  5HLS A;  5D3H A;  3O34 A;  5COI A;  4Q0N A;  5CQA A;  5D3J A;  5LUU A;  4HXP A;  2YQD A;  4TZ8 A;  4UIT A;  4CUQ A;  5FE5 A;  4TT6 A;  3HME A;  4ALH A;  5HEN A;  4ZW1 A;  1WUG A;  5KTX A;  5HFQ A;  4HXS A;  5FE7 A;  5E73 A;  4QSW A;  4QSR A;  4UIZ A;  5EU1 A;  4UIW A;  5KTW A;  4WHU A;  4LC2 A;  5KTU A;  5IGN A;  3U5J A;  4BW3 A;  1F68 A;  2WP2 A;  5CUD A;  4OGJ A;  4A9J A;  2RNW A;  2I7K A;  5DLZ A;  4IOO A;  5E9M A;  4PTB A;  4CUP A;  4UYF A;  5CGP A;  5CU8 A;  4N4H A;  4QY4 A;  5ETD A;  4WHW A;  4HXM A;  5E3G A;  5HFR A;  3AQA A;  4YYK A;  4MR3 A;  5ENI A;  2F6J A;  4ZC9 A;  5DYU A;  4O7B A;  5F5Z A;  5CPE A;  3SVF A;  5FDZ A;  4HXN A;  5A5Q A;  3LXJ A;  4KV1 A;  5I89 A;  4Q0O A;  5A5N A;  4N4G A;  5E74 A;  4HBY A;  5I83 A;  3LQJ A;  4PCI A;  4HXK A;  4BHW A;  3IU5 A;  2H60 A;  2R0V A;  5H1V A;  4A9I A;  4QC3 A;  4XY9 A;  4IOR A;  5J0D A;  4QEW A;  5CRM A;  1JSP B;  4UYH A;  2G4A A;  4YYH A;  5CQ4 A;  3TLP A;  2R10 A;  5A7C A;  5JWM A;  4TT4 A;  5DX4 A;  5F3A A;  4YBT A;  2OO1 A;  3Q2F A;  4XY8 A;  3UVY A;  5F60 A;  4CFK A;  5K29 A;  2LSP B;  2YEM A;  4O7A A;  4O7F A;  3UV5 A;  5L8U A;  5HQ7 A;  4TZ2 A;  4HBV A;  5EM3 A;  5CQ3 A;  4YAD A;  4Z6I A;  5EQ1 A;  2DWW A;  4A9N A;  5FE6 A;  5A81 A;  5FE2 A;  4Y03 A;  5CZG A;  4QUT A;  5H1U A;  3P1D A;  5C4Q A;  4MEN A;  3I3J A;  3O33 A;  5EA1 A;  4N4I A;  4CUS A;  5L98 A;  5C89 A;  4QYD A;  5HQ5 A;  5C7N A;  4BW1 A;  5ENJ A;  5G4S A;  3LJW A;  5D3L A;  5A5S A;  5BT4 A;  5A5O A;  4X2I A;  5DYX A;  5AD2 A;  3UW9 A;  5FE0 A;  3U5O A;  4YK0 A;  4UYF B;  5DFC A;  5EWW A;  4CFL A;  2I8N A;  2L84 A;  4XUB A;  5F36 A;  5F62 A;  5CP5 A;  4A9L A;  5AME A;  5EVA A;  5FBX A;  2R0S A;  4XYA A;  2N9G A;  5I7X A;  4Z1Q A;  5IGK A;  2DVR A;  5CS8 A;  2GRC A;  2MJV B;  4N3W A;  4NQM A;  5BT3 A;  5KO4 A;  5HQ6 A;  4PS5 A;  3QZT A;  5CQ7 A;  5BT5 A;  5LVQ A;  5G4R A;  2D9E A;  5I86 A;  4MEQ A;  4TS8 A;  5ENC A;  2E7N A;  5F1L A;  5CY9 A;  4C67 A;  5A5P A;  4O74 A;  4AKN A;  3UV2 A;  3Q2E A;  5CQ8 A;  5HEL A;  5FE4 A;  2KTB B;  3IU6 A;  4YH4 A;  4J1P A;  4NR5 A;  3MB3 A;  3AAD A;  4KCX A;  4YYI A;  5C85 A;  4LR6 A;  4NQN A;  4IR6 A;  4IR3 A;  5E9I A;  5TB6 A;  5D26 A;  3JVM A;  5FH7 A;  5HEM A;  5IG6 A;  5E9L A;  4J0S A;  5ETB A;  4YBM A;  5CQ5 A;  4XUA A;  3G0L A;  5DW1 A;  5LKZ A;  5CRZ A;  4YY6 A;  2YYN A;  5EPR A;  5D3P A;  4NXJ A;  4E96 A;  5CUG A;  4A9E A;  5II2 A;  4A9F A;  5FE9 A;  5EIC A;  4J0R A;  3NXB A;  5A82 A;  4PCE A;  5LJ2 A;  4QSP A;  2DVQ A;  5CUC A;  3S92 A;  5D0C A;  4A9M A;  3FKM X;  3O35 A;  1E6I A;  4A9O A;  4CUT A;  2E7O A;  3U5P A;  4FLP A;  5FH6 A;  3U5K A;  3QZS A;  4A9H A;  3P5O A;  5LJ0 A;  5E3D A;  3MUK A;  4LZS A;  4OUF A;  5D7X A;  4YC9 A;  4A9K A;  5F63 A;  5F61 A;  5H1T A;  4CUR A;  4MR4 A;  1WUM A;  3UV4 A;  5CFW A;  4HBW A;  3P1C A;  3SVG A;  4O77 A;  3U5N A;  4LDF A;  4YYN A;  4NRA A;  5HM0 A;  5EV9 A;  5A85 A;  5C87 A;  4O7C A;  3LQH A;  4NS5 A;  5II1 A;  5EK9 A;  5ENE A;  2FSA A;  4NR4 A;  5F25 A;  4QSQ A;  5E7D A;  5D3T A;  4CL9 A;  4LYW A;  2E3K A;  4IR5 A;  4QSX A;  4YYG A;  4IR4 A;  5FE1 A;  4RVR A;  3QZV A;  4YBS A;  3DAI A;  5EIS A;  4BW4 A;  4NUE A;  3SVH A;  5C8G A;  5HCL A;  3D7C A;  4NUD A;  5E0R A;  4WIV A;  4MR5 A;  4MEO A;  4UYE A;  5KU3 A;  5I40 A;  4NUC A;  5CUA A;  3JVJ A;  5DFD A;  4HXR A;  5EPB A;  2RNX A;  4HXL A;  2DKW A;  4NR6 A;  5EP7 A;  5TCM A;  5AMF A;  5CUB A;  5IGM A;  4QSS A;  2YEK A;  3GG3 A;  3MQM A;  5E9V A;  5ENH A;  4QYL A;  4LYI A;  4YAB A;  5ENG A;  4OGI A;  4QC1 A;  4Z93 A;  5EI4 A;  5EWH A;  5HJC A;  3K2J A;  4KV4 A;  5DKH A;  3JVK A;  4YAT A;  4N4F A;  2RFJ A;  4HXO A;  2RI7 A;  4QSU A;  2F6N A;  4TT2 A;  2DAT A;  4QR3 A;  1X0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...