5KO4A

Bromodomain from trypanosoma brucei tb427.10.8150
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
101
structure length
101
Chain Sequence
TSFYKQCRSILHVVMDLDRDGIFARDPSKLPDYRMIISHPMWWDLIKARLTRYEYTSPSAFINDMRLVVQNCYDYNREESPFSTLARRIEIAMEDLFVTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Bromodomain from Trypanosoma brucei Tb427.10.8150
rcsb
source organism Trypanosoma brucei brucei (strain 927/4 gutat10.1)
total genus 41
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ko4A00
5C4QA 4IR4A 5D3NA 5EPSA 5LVRA 2RO1A 5LKUA 5A5PA 2OO1A 4BJXA 2RNWA 2E7NA 4UIZA 5D7XA 5FE9A 5LJ2A 4NR5A 4PCEA 4TS8A 4ALHA 4NRCA 3HMEA 4Z6HA 4BW3A 3MULA 4LYWA 3D7CA 4YBSA 4N4FA 5DLXA 4LZRA 3UV5A 3QZTA 4ZQLA 4PTBA 3SVFA 4IR3A 4QR5A 3JVLA 5CQ5A 4NR9A 5CQ3A 1JSPB 2G4AA 5CUGA 4CFKA 4QC1A 5II1A 4BW1A 5ACYA 4LYSA 2L84A 4QUTA 5D25A 4N4HA 4IOQA 3AADA 5ENCA 5H1TA 5CUBA 4O7CA 4CUQA 3DWYA 5E9LA 5A82A 5CU8A 2R0SA 3U5PA 4NYVA 2WP2A 5E74A 5EPRA 4ZW1A 4LYIA 4NR7A 3UVDA 5F63A 5A7CA 5D3HA 4YH4A 5JI8A 3P1DA 5AD3A 4O77A 4NQMA 4Q0NA 5A83A 3Q2FA 5ENIA 2NXBA 5E3DA 2D82A 4QSXA 5IGLA 4HXRA 3S92A 5EK9A 5A5OA 5D24A 4J3IA 4N4GA 4O72A 4O76A 4QZSA 5ETDA 4UIXA 5FBXA 4YAXA 4UIVA 4CLBA 4Z6IA 2YW5A 4QSSA 5EISA 4TZ8A 5H85A 4UYFB 5BT3A 2WP1A 5HFQA 4QEUA 5KTUA 4XUBA 5FE7A 4O74A 4XY8A 1EQFA 5D3RA 5D3TA 3UVWA 4BW4A 2FSAA 4O7BA 1N72A 5DFDA 3U5KA 3GG3A 5D3SA 5AD2A 2R10A 4IR6A 4NR4A 4O7AA 5E9YA 5IBNA 5CPEA 5F61A 5HJCA 4LR6A 3JVMA 4C67A 4OGIA 5FB1A 3ZYUA 3P1CA 5LJ0A 2RS9B 5CY9A 5C87A 3P1EA 3U5OA 2YDWA 5F5ZA 5A5NA 4E96A 3P5OA 2L85A 4QR3A 4GPJA 5FDZA 4QSRA 3IU5A 2DATA 5EICA 3U5NA 5ENGA 3MB4A 4KCXA 3UVYA 5LVQA 4NRAA 2OSSA 4UIYA 4BHWA 4NRBA 5TB6A 5HQ5A 5E73A 5L98A 5J0DA 4YC9A 5ENJA 3G0LA 4C66A 4N4IA 5FH8A 3O37A 2MJVB 4CUUA 4ZC9A 3NXBA 4AKNA 5FE2A 2OUOA 2E7OA 3FKMX 4TTEA 5HLSA 5CUAA 4CUSA 5H1UA 4QY4A 4OGJA 3LJWA 4NUEA 5DBMA 3MUKA 5I7XA 3UVXA 2DKWA 4MENA 5D0CA 2DVSA 2E3KA 2YYNA 4HXPA 5I40A 5A5SA 5L96A 5F1HA 4CFLA 4NUDA 5F25A 4YYGA 5ENBA 5FE6A 5KTXA 5CRZA 3ONIA 4NS5A 5I80A 3IU6A 5IGKA 4HBYA 5C8GA 2RFJA 4LC2A 4QYDA 4Z1QA 5EPBA 5I86A 2N9GA 3DAIA 5EGUA 3JVJA 5IGNA 3AQAA 4QSWA 5KHMA 5DYCA 4YK0A 4PKLA 5FG4A 4HXKA 5FE8A 5LUUA 2L5EA 4NXJA 5F1LA 5G4SA 5DYXA 4PCIA 4PY6A 5CQTA 2F6JA 4A9KA 3SVGA 4NYXA 1F68A 3RCWA 5A5QA 2RNYA 2I7KA 3U5MA 4WHWA 5F2PA 4XY9A 4QYLA 5EM3A 5I7YA 5CRMA 3SVHA 5FH7A 3MQMA 4KV1A 5F62A 3G0JA 4XUAA 5HFRA 4TYLA 2D9EA 5DKDA 4MR4A 5FFVA 4OUFA 5EA1A 2DVRA 4KV4A 5CFWA 4O70A 5FE1A 5E9MA 4IR5A 5C89A 2R0YA 5FE5A 4LZ2A 2YEKA 5EWHA 4Z1SA 5DYUA 5HELA 5HRWA 5I83A 4LRGA 3Q2EA 4NQNA 4FLPA 5I29A 2R0VA 4UIUA 5IIDA 4NYWA 4J0RA 4TU6A 5C7NA 4F3IA 5G4RA 4NUCA 5EWDA 4YY4A 5I1QA 5EV9A 4YYJA 4QSQA 5IG6A 4YYNA 5EWVA 2YELA 5E9KA 3U5JA 3HMFA 5DY7A 5E9VA 5D26A 4A9EA 5EWWA 4O7EA 5L8UA 4RVRA 4HBXA 5DFCA 4YYHA 4CUTA 4QEVA 4PS5A 4QSUA 5CUDA 5E7DA 2H60A 5E0RA 5CGPA 5FFWA 4MEQA 5L97A 2DVQA 2F6NA 3O36A 3LQHA 5ENHA 5CQAA 5DX4A 5FH6A 3O34A 4IORA 4Z93A 5JWMA 4A9HA 5C85A 4X2IA 4YH3A 5EWCA 4QNSA 4CURA 4MEPA 5CQ4A 4LDFA 5L99A 5FG5A 5DFBA 5A5RA 5D3PA 3LXJA 4YYIA 4QC3A 3JVKA 5DYAA 4MR5A 5TCMA 5HCLA 5KU3A 3QZVA 5H1VA 5F60A 5LKTA 5FE3A 3LQJA 4O75A 2LSPB 4O71A 5D3LA 5BT5A 4HXNA 5II2A 5FB0A 4WIVA 5HENA 5CQ6A 5CS8A 4A9JA 5EQ1A 3HMHA 5A81A 4TT6A 3QZSA 4TT2A 3UV2A 5EP7A 5CTLA 5EI4A 5EVAA 5DKHA 5COIA 3O33A 5DW1A 5DLZA 4MR3A 4A9OA 4Q0OA 4QSVA 4YATA 4YBTA 5AMFA 4A9MA 4HXOA 4CUPA 4O78A 5FG6A 4HXSA 4MEOA 3O35A 4UYGA 4UYFA 4XYAA 4QUUA 3K2JA 1JM4B 4TU4A 5E9IA 4ALGA 5HEMA 1WUMA 4QB3A 4A9IA 4A9LA 5KO4A 3LQIA 3I3JA 5FE4A 5EU1A 5I88A 4DONA 2KTBB 5CZGA 3MXFA 4J1PA 3MB3A 5DW2A 4QBMA 5CP5A 4HXMA 4MR6A 4QSTA 4HBVA 2DWWA 5ETBA 4J0SA 1X0JA 4UIWA 3UW9A 4Y03A 4YY6A 3S91A 1E6IA 2YQDA 5HRVA 3U5LA 5FFYA 5HM0A 5CQ7A 5LKZA 3TLPA 4BW2A 5CUEA 2YEMA 4NR8A 5CUCA 4LZSA 5DKCA 5HQ7A 4TZ2A 1WUGA 5I89A 1ZS5A 3P1FA 3UV4A 5BT4A 5ENFA 5F36A 5K29A 2GRCA 4UYHA 5KTWA 4CL9A 5LKXA 4QR4A 5D3JA 4QEWA 4IOOA 5E3GA 5HRXA 5HQ6A 4YYKA 5FE0A 4NR6A 4A9FA 5F3AA 4QSPA 4UITA 5CQ8A 5AMEA 5L8TA 5ENEA 4HBWA 4TQNA 4YYDA 2RNXA 4YABA 4UYDA 2DVVA 4N3WA 4YYMA 4A9NA 4WHUA 2I8NA 2RI7A 4TT4A 4YBMA 5IGMA 4HXLA 4UYEA 4YADA 4O7FA 5A85A 5LJ1A
chains in the Genus database with same CATH superfamily
5C4QA 4IR4A 5D3NA 5EPSA 5LVRA 2RO1A 5LKUA 5A5PA 2OO1A 4BJXA 2RNWA 2E7NA 4UIZA 5D7XA 5FE9A 5LJ2A 4NR5A 4PCEA 4TS8A 4ALHA 4NRCA 3HMEA 4Z6HA 4BW3A 3MULA 4LYWA 3D7CA 4YBSA 4N4FA 5DLXA 4LZRA 3UV5A 3QZTA 2EJNA 4ZQLA 4PTBA 3SVFA 4IR3A 4QR5A 3JVLA 5CQ5A 4NR9A 5CQ3A 1JSPB 2G4AA 5CUGA 4CFKA 4QC1A 5II1A 4BW1A 5ACYA 4LYSA 2L84A 4QUTA 5D25A 4N4HA 4IOQA 3AADA 5ENCA 5H1TA 5CUBA 3ERRA 4O7CA 4CUQA 3DWYA 5E9LA 5A82A 5CU8A 2R0SA 3U5PA 4NYVA 2WP2A 5E74A 5EPRA 4ZW1A 4LYIA 4NR7A 3UVDA 5F63A 5A7CA 5D3HA 4YH4A 5JI8A 3P1DA 5AD3A 4O77A 4NQMA 4Q0NA 5A83A 3Q2FA 5ENIA 2NXBA 5E3DA 2D82A 4QSXA 5IGLA 4HXRA 3S92A 5EK9A 5A5OA 5D24A 4J3IA 4N4GA 4O72A 4O76A 4QZSA 5ETDA 4UIXA 5FBXA 4YAXA 4UIVA 4CLBA 4Z6IA 2YW5A 4QSSA 5EISA 4TZ8A 5H85A 4UYFB 5BT3A 2WP1A 5HFQA 4QEUA 5KTUA 4XUBA 5FE7A 4O74A 4XY8A 1EQFA 5D3RA 5D3TA 3UVWA 4BW4A 2FSAA 4O7BA 1N72A 5DFDA 3U5KA 3GG3A 5D3SA 5AD2A 2R10A 4IR6A 4NR4A 4O7AA 5E9YA 5IBNA 5CPEA 5F61A 5HJCA 4LR6A 3JVMA 4C67A 4OGIA 5FB1A 3ZYUA 3P1CA 5LJ0A 2RS9B 5CY9A 5C87A 3P1EA 3U5OA 2YDWA 5F5ZA 5A5NA 4E96A 3P5OA 2L85A 4QR3A 4GPJA 5FDZA 4QSRA 4AKIA 3IU5A 2DATA 5EICA 3U5NA 5ENGA 3MB4A 4KCXA 3UVYA 5LVQA 4NRAA 2OSSA 4UIYA 4BHWA 4NRBA 5TB6A 5HQ5A 5E73A 5L98A 5J0DA 4YC9A 5ENJA 3G0LA 4C66A 4N4IA 5FH8A 3O37A 2MJVB 4CUUA 4ZC9A 3NXBA 4AKNA 5FE2A 2OUOA 2E7OA 3FKMX 4TTEA 5HLSA 5CUAA 4CUSA 5H1UA 4QY4A 4OGJA 3LJWA 4NUEA 5DBMA 3MUKA 5I7XA 3UVXA 2DKWA 4MENA 5D0CA 2DVSA 2E3KA 2YYNA 4HXPA 5I40A 5A5SA 5L96A 5F1HA 4CFLA 4NUDA 5F25A 4YYGA 5ENBA 5FE6A 5KTXA 5CRZA 3ONIA 4NS5A 5I80A 3IU6A 5IGKA 4HBYA 5C8GA 2RFJA 4LC2A 4QYDA 4Z1QA 5EPBA 5I86A 2N9GA 3DAIA 5EGUA 3JVJA 5IGNA 3AQAA 4QSWA 5KHMA 5DYCA 4YK0A 4PKLA 5FG4A 4HXKA 5FE8A 5LUUA 2L5EA 4NXJA 5F1LA 5G4SA 5DYXA 4PCIA 4PY6A 5CQTA 2F6JA 4A9KA 3VKGA 3SVGA 4NYXA 1F68A 3RCWA 5A5QA 2RNYA 2I7KA 3U5MA 4WHWA 5F2PA 4XY9A 4QYLA 5EM3A 5I7YA 5CRMA 3SVHA 5FH7A 3MQMA 4KV1A 3D1DA 5F62A 3G0JA 4XUAA 5HFRA 4TYLA 2D9EA 5DKDA 4MR4A 5FFVA 4OUFA 5EA1A 2DVRA 4KV4A 5CFWA 4O70A 5FE1A 5E9MA 4IR5A 5C89A 2R0YA 5FE5A 4LZ2A 2YEKA 5EWHA 4Z1SA 5DYUA 5HELA 5HRWA 5I83A 3D1BA 4LRGA 3Q2EA 4NQNA 4FLPA 5I29A 2R0VA 4UIUA 5IIDA 4NYWA 4J0RA 4TU6A 5C7NA 4F3IA 5G4RA 4NUCA 5EWDA 4AI6A 4YY4A 5I1QA 5EV9A 4YYJA 4QSQA 5IG6A 4YYNA 5EWVA 2YELA 5E9KA 3U5JA 3HMFA 5DY7A 5E9VA 5D26A 4A9EA 5EWWA 4O7EA 5L8UA 4RVRA 4HBXA 5DFCA 4YYHA 4CUTA 4QEVA 4PS5A 4QSUA 5CUDA 5E7DA 2H60A 5E0RA 5CGPA 5FFWA 4MEQA 5L97A 2DVQA 2F6NA 3O36A 3LQHA 5ENHA 5CQAA 5DX4A 5FH6A 3O34A 4IORA 4Z93A 5JWMA 4A9HA 5C85A 4X2IA 4YH3A 5EWCA 4QNSA 4CURA 4MEPA 5CQ4A 4LDFA 5L99A 5FG5A 5DFBA 5A5RA 5D3PA 3LXJA 4YYIA 4QC3A 3JVKA 5DYAA 4MR5A 5TCMA 5HCLA 5KU3A 3QZVA 5H1VA 5F60A 5LKTA 5FE3A 3LQJA 4O75A 2LSPB 4O71A 5D3LA 5BT5A 4HXNA 5II2A 5FB0A 4WIVA 5HENA 5CQ6A 5CS8A 4A9JA 5EQ1A 3HMHA 5A81A 4TT6A 3QZSA 4TT2A 3UV2A 5EP7A 5CTLA 5EI4A 5EVAA 5DKHA 5COIA 3O33A 5DW1A 5DLZA 4MR3A 4A9OA 4Q0OA 4QSVA 4YATA 4YBTA 5AMFA 4A9MA 4HXOA 4CUPA 4O78A 1ZKRA 5FG6A 4HXSA 4MEOA 3O35A 4UYGA 4UYFA 4XYAA 4QUUA 3K2JA 1JM4B 4TU4A 5E9IA 4ALGA 5HEMA 1WUMA 4QB3A 4A9IA 4A9LA 5KO4A 3LQIA 3I3JA 5FE4A 5EU1A 5I88A 4DONA 2KTBB 5CZGA 3MXFA 4J1PA 3MB3A 5DW2A 4QBMA 5CP5A 4HXMA 4MR6A 4QSTA 3VKHA 4HBVA 2DWWA 5ETBA 4J0SA 1X0JA 4UIWA 3UW9A 4Y03A 4YY6A 3S91A 1E6IA 2YQDA 5HRVA 3U5LA 5FFYA 5HM0A 5CQ7A 5LKZA 3TLPA 4BW2A 5CUEA 2YEMA 4NR8A 5CUCA 4LZSA 5DKCA 5HQ7A 4AKHA 4TZ2A 1WUGA 5I89A 1ZS5A 1PUOA 3P1FA 3UV4A 5BT4A 5ENFA 5F36A 5K29A 2GRCA 4UYHA 5KTWA 4CL9A 5LKXA 4QR4A 5D3JA 4QEWA 4IOOA 5E3GA 5HRXA 5HQ6A 4YYKA 5FE0A 4NR6A 4A9FA 5F3AA 4QSPA 4UITA 5CQ8A 5AMEA 5L8TA 5ENEA 4HBWA 4TQNA 4YYDA 2RNXA 4YABA 4UYDA 2DVVA 4N3WA 4YYMA 4A9NA 4WHUA 4AKGA 2I8NA 2RI7A 4TT4A 4YBMA 5IGMA 4HXLA 4UYEA 4YADA 4O7FA 5A85A 5LJ1A
chains in the Genus database with same CATH topology
5C4QA 4IR4A 5D3NA 5EPSA 5LVRA 2RO1A 5LKUA 5A5PA 2OO1A 4BJXA 2RNWA 2E7NA 4UIZA 5D7XA 5FE9A 5LJ2A 4NR5A 4PCEA 4TS8A 4ALHA 4NRCA 3HMEA 4Z6HA 4BW3A 3MULA 4LYWA 3D7CA 4YBSA 4N4FA 5DLXA 4LZRA 3UV5A 3QZTA 4ZQLA 4PTBA 3SVFA 4IR3A 4QR5A 3JVLA 5CQ5A 4NR9A 5CQ3A 1JSPB 2G4AA 5CUGA 4CFKA 4QC1A 5II1A 4BW1A 5ACYA 4LYSA 2L84A 4QUTA 5D25A 4N4HA 4IOQA 3AADA 5ENCA 5H1TA 5CUBA 4O7CA 4CUQA 3DWYA 5E9LA 5A82A 5CU8A 2R0SA 3U5PA 4NYVA 2WP2A 5E74A 5EPRA 4ZW1A 4LYIA 4NR7A 3UVDA 5F63A 5A7CA 5D3HA 4YH4A 5JI8A 3P1DA 5AD3A 4O77A 4NQMA 4Q0NA 5A83A 3Q2FA 5ENIA 2NXBA 5E3DA 2D82A 4QSXA 5IGLA 4HXRA 3S92A 5EK9A 5A5OA 5D24A 4J3IA 4N4GA 4O72A 4O76A 4QZSA 5ETDA 4UIXA 5FBXA 4YAXA 4UIVA 4CLBA 4Z6IA 2YW5A 4QSSA 5EISA 4TZ8A 5H85A 4UYFB 5BT3A 2WP1A 5HFQA 4QEUA 5KTUA 4XUBA 5FE7A 4O74A 4XY8A 1EQFA 5D3RA 5D3TA 3UVWA 4BW4A 2FSAA 4O7BA 1N72A 5DFDA 3U5KA 3GG3A 5D3SA 5AD2A 2R10A 4IR6A 4NR4A 4O7AA 5E9YA 5IBNA 5CPEA 5F61A 5HJCA 4LR6A 3JVMA 4C67A 4OGIA 5FB1A 3ZYUA 3P1CA 5LJ0A 2RS9B 5CY9A 5C87A 3P1EA 3U5OA 2YDWA 5F5ZA 5A5NA 4E96A 3P5OA 2L85A 4QR3A 4GPJA 5FDZA 4QSRA 3IU5A 2DATA 5EICA 3U5NA 5ENGA 3MB4A 4KCXA 3UVYA 5LVQA 4NRAA 2OSSA 4UIYA 4BHWA 4NRBA 5TB6A 5HQ5A 5E73A 5L98A 5J0DA 4YC9A 5ENJA 3G0LA 4C66A 4N4IA 5FH8A 3O37A 2MJVB 4CUUA 4ZC9A 3NXBA 4AKNA 5FE2A 2OUOA 2E7OA 3FKMX 4TTEA 5HLSA 5CUAA 4CUSA 5H1UA 4QY4A 4OGJA 3LJWA 4NUEA 5DBMA 3MUKA 5I7XA 3UVXA 2DKWA 4MENA 5D0CA 2DVSA 2E3KA 2YYNA 4HXPA 5I40A 5A5SA 5L96A 5F1HA 4CFLA 4NUDA 5F25A 4YYGA 5ENBA 5FE6A 5KTXA 5CRZA 3ONIA 4NS5A 5I80A 3IU6A 5IGKA 4HBYA 5C8GA 2RFJA 4LC2A 4QYDA 4Z1QA 5EPBA 5I86A 2N9GA 3DAIA 5EGUA 3JVJA 5IGNA 3AQAA 4QSWA 5KHMA 5DYCA 4YK0A 4PKLA 5FG4A 4HXKA 5FE8A 5LUUA 2L5EA 4NXJA 5F1LA 5G4SA 5DYXA 4PCIA 4PY6A 5CQTA 2F6JA 4A9KA 3SVGA 4NYXA 1F68A 3RCWA 5A5QA 2RNYA 2I7KA 3U5MA 4WHWA 5F2PA 4XY9A 4QYLA 5EM3A 5I7YA 5CRMA 3SVHA 5FH7A 3MQMA 4KV1A 5F62A 3G0JA 4XUAA 5HFRA 4TYLA 2D9EA 5DKDA 4MR4A 5FFVA 4OUFA 5EA1A 2DVRA 4KV4A 5CFWA 4O70A 5FE1A 5E9MA 4IR5A 5C89A 2R0YA 5FE5A 4LZ2A 2YEKA 5EWHA 4Z1SA 5DYUA 5HELA 5HRWA 5I83A 4LRGA 3Q2EA 4NQNA 4FLPA 5I29A 2R0VA 4UIUA 5IIDA 4NYWA 4J0RA 4TU6A 5C7NA 4F3IA 5G4RA 4NUCA 5EWDA 4YY4A 5I1QA 5EV9A 4YYJA 4QSQA 5IG6A 4YYNA 5EWVA 2YELA 5E9KA 3U5JA 3HMFA 5DY7A 5E9VA 5D26A 4A9EA 5EWWA 4O7EA 5L8UA 4RVRA 4HBXA 5DFCA 4YYHA 4CUTA 4QEVA 4PS5A 4QSUA 5CUDA 5E7DA 2H60A 5E0RA 5CGPA 5FFWA 4MEQA 5L97A 2DVQA 2F6NA 3O36A 3LQHA 5ENHA 5CQAA 5DX4A 5FH6A 3O34A 4IORA 4Z93A 5JWMA 4A9HA 5C85A 4X2IA 4YH3A 5EWCA 4QNSA 4CURA 4MEPA 5CQ4A 4LDFA 5L99A 5FG5A 5DFBA 5A5RA 5D3PA 3LXJA 4YYIA 4QC3A 3JVKA 5DYAA 4MR5A 5TCMA 5HCLA 5KU3A 3QZVA 5H1VA 5F60A 5LKTA 5FE3A 3LQJA 4O75A 2LSPB 4O71A 5D3LA 5BT5A 4HXNA 5II2A 5FB0A 4WIVA 5HENA 5CQ6A 5CS8A 4A9JA 5EQ1A 3HMHA 5A81A 4TT6A 3QZSA 4TT2A 3UV2A 5EP7A 5CTLA 5EI4A 5EVAA 5DKHA 5COIA 3O33A 5DW1A 5DLZA 4MR3A 4A9OA 4Q0OA 4QSVA 4YATA 4YBTA 5AMFA 4A9MA 4HXOA 4CUPA 4O78A 5FG6A 4HXSA 4MEOA 3O35A 4UYGA 4UYFA 4XYAA 4QUUA 3K2JA 1JM4B 4TU4A 5E9IA 4ALGA 5HEMA 1WUMA 4QB3A 4A9IA 4A9LA 5KO4A 3LQIA 3I3JA 5FE4A 5EU1A 5I88A 4DONA 2KTBB 5CZGA 3MXFA 4J1PA 3MB3A 5DW2A 4QBMA 5CP5A 4HXMA 4MR6A 4QSTA 4HBVA 2DWWA 5ETBA 4J0SA 1X0JA 4UIWA 3UW9A 4Y03A 4YY6A 3S91A 1E6IA 2YQDA 5HRVA 3U5LA 5FFYA 5HM0A 5CQ7A 5LKZA 3TLPA 4BW2A 5CUEA 2YEMA 4NR8A 5CUCA 4LZSA 5DKCA 5HQ7A 4TZ2A 1WUGA 5I89A 1ZS5A 3P1FA 3UV4A 5BT4A 5ENFA 5F36A 5K29A 2GRCA 4UYHA 5KTWA 4CL9A 5LKXA 4QR4A 5D3JA 4QEWA 4IOOA 5E3GA 5HRXA 5HQ6A 4YYKA 5FE0A 4NR6A 4A9FA 5F3AA 4QSPA 4UITA 5CQ8A 5AMEA 5L8TA 5ENEA 4HBWA 4TQNA 4YYDA 2RNXA 4YABA 4UYDA 2DVVA 4N3WA 4YYMA 4A9NA 4WHUA 2I8NA 2RI7A 4TT4A 4YBMA 5IGMA 4HXLA 4UYEA 4YADA 4O7FA 5A85A 5LJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4Q A;  4IR4 A;  5D3N A;  5EPS A;  5LVR A;  2RO1 A;  5LKU A;  5A5P A;  2OO1 A;  4BJX A;  2RNW A;  2E7N A;  4UIZ A;  5D7X A;  5FE9 A;  5LJ2 A;  4NR5 A;  4PCE A;  4TS8 A;  4ALH A;  4NRC A;  3HME A;  4Z6H A;  4BW3 A;  3MUL A;  4LYW A;  3D7C A;  4YBS A;  4N4F A;  5DLX A;  4LZR A;  3UV5 A;  3QZT A;  4ZQL A;  4PTB A;  3SVF A;  4IR3 A;  4QR5 A;  3JVL A;  5CQ5 A;  4NR9 A;  5CQ3 A;  1JSP B;  2G4A A;  5CUG A;  4CFK A;  4QC1 A;  5II1 A;  4BW1 A;  5ACY A;  4LYS A;  2L84 A;  4QUT A;  5D25 A;  4N4H A;  4IOQ A;  3AAD A;  5ENC A;  5H1T A;  5CUB A;  4O7C A;  4CUQ A;  3DWY A;  5E9L A;  5A82 A;  5CU8 A;  2R0S A;  3U5P A;  4NYV A;  2WP2 A;  5E74 A;  5EPR A;  4ZW1 A;  4LYI A;  4NR7 A;  3UVD A;  5F63 A;  5A7C A;  5D3H A;  4YH4 A;  5JI8 A;  3P1D A;  5AD3 A;  4O77 A;  4NQM A;  4Q0N A;  5A83 A;  3Q2F A;  5ENI A;  2NXB A;  5E3D A;  2D82 A;  4QSX A;  5IGL A;  4HXR A;  3S92 A;  5EK9 A;  5A5O A;  5D24 A;  4J3I A;  4N4G A;  4O72 A;  4O76 A;  4QZS A;  5ETD A;  4UIX A;  5FBX A;  4YAX A;  4UIV A;  4CLB A;  4Z6I A;  2YW5 A;  4QSS A;  5EIS A;  4TZ8 A;  5H85 A;  4UYF B;  5BT3 A;  2WP1 A;  5HFQ A;  4QEU A;  5KTU A;  4XUB A;  5FE7 A;  4O74 A;  4XY8 A;  1EQF A;  5D3R A;  5D3T A;  3UVW A;  4BW4 A;  2FSA A;  4O7B A;  1N72 A;  5DFD A;  3U5K A;  3GG3 A;  5D3S A;  5AD2 A;  2R10 A;  4IR6 A;  4NR4 A;  4O7A A;  5E9Y A;  5IBN A;  5CPE A;  5F61 A;  5HJC A;  4LR6 A;  3JVM A;  4C67 A;  4OGI A;  5FB1 A;  3ZYU A;  3P1C A;  5LJ0 A;  2RS9 B;  5CY9 A;  5C87 A;  3P1E A;  3U5O A;  2YDW A;  5F5Z A;  5A5N A;  4E96 A;  3P5O A;  2L85 A;  4QR3 A;  4GPJ A;  5FDZ A;  4QSR A;  3IU5 A;  2DAT A;  5EIC A;  3U5N A;  5ENG A;  3MB4 A;  4KCX A;  3UVY A;  5LVQ A;  4NRA A;  2OSS A;  4UIY A;  4BHW A;  4NRB A;  5TB6 A;  5HQ5 A;  5E73 A;  5L98 A;  5J0D A;  4YC9 A;  5ENJ A;  3G0L A;  4C66 A;  4N4I A;  5FH8 A;  3O37 A;  2MJV B;  4CUU A;  4ZC9 A;  3NXB A;  4AKN A;  5FE2 A;  2OUO A;  2E7O A;  3FKM X;  4TTE A;  5HLS A;  5CUA A;  4CUS A;  5H1U A;  4QY4 A;  4OGJ A;  3LJW A;  4NUE A;  5DBM A;  3MUK A;  5I7X A;  3UVX A;  2DKW A;  4MEN A;  5D0C A;  2DVS A;  2E3K A;  2YYN A;  4HXP A;  5I40 A;  5A5S A;  5L96 A;  5F1H A;  4CFL A;  4NUD A;  5F25 A;  4YYG A;  5ENB A;  5FE6 A;  5KTX A;  5CRZ A;  3ONI A;  4NS5 A;  5I80 A;  3IU6 A;  5IGK A;  4HBY A;  5C8G A;  2RFJ A;  4LC2 A;  4QYD A;  4Z1Q A;  5EPB A;  5I86 A;  2N9G A;  3DAI A;  5EGU A;  3JVJ A;  5IGN A;  3AQA A;  4QSW A;  5KHM A;  5DYC A;  4YK0 A;  4PKL A;  5FG4 A;  4HXK A;  5FE8 A;  5LUU A;  2L5E A;  4NXJ A;  5F1L A;  5G4S A;  5DYX A;  4PCI A;  4PY6 A;  5CQT A;  2F6J A;  4A9K A;  3SVG A;  4NYX A;  1F68 A;  3RCW A;  5A5Q A;  2RNY A;  2I7K A;  3U5M A;  4WHW A;  5F2P A;  4XY9 A;  4QYL A;  5EM3 A;  5I7Y A;  5CRM A;  3SVH A;  5FH7 A;  3MQM A;  4KV1 A;  5F62 A;  3G0J A;  4XUA A;  5HFR A;  4TYL A;  2D9E A;  5DKD A;  4MR4 A;  5FFV A;  4OUF A;  5EA1 A;  2DVR A;  4KV4 A;  5CFW A;  4O70 A;  5FE1 A;  5E9M A;  4IR5 A;  5C89 A;  2R0Y A;  5FE5 A;  4LZ2 A;  2YEK A;  5EWH A;  4Z1S A;  5DYU A;  5HEL A;  5HRW A;  5I83 A;  4LRG A;  3Q2E A;  4NQN A;  4FLP A;  5I29 A;  2R0V A;  4UIU A;  5IID A;  4NYW A;  4J0R A;  4TU6 A;  5C7N A;  4F3I A;  5G4R A;  4NUC A;  5EWD A;  4YY4 A;  5I1Q A;  5EV9 A;  4YYJ A;  4QSQ A;  5IG6 A;  4YYN A;  5EWV A;  2YEL A;  5E9K A;  3U5J A;  3HMF A;  5DY7 A;  5E9V A;  5D26 A;  4A9E A;  5EWW A;  4O7E A;  5L8U A;  4RVR A;  4HBX A;  5DFC A;  4YYH A;  4CUT A;  4QEV A;  4PS5 A;  4QSU A;  5CUD A;  5E7D A;  2H60 A;  5E0R A;  5CGP A;  5FFW A;  4MEQ A;  5L97 A;  2DVQ A;  2F6N A;  3O36 A;  3LQH A;  5ENH A;  5CQA A;  5DX4 A;  5FH6 A;  3O34 A;  4IOR A;  4Z93 A;  5JWM A;  4A9H A;  5C85 A;  4X2I A;  4YH3 A;  5EWC A;  4QNS A;  4CUR A;  4MEP A;  5CQ4 A;  4LDF A;  5L99 A;  5FG5 A;  5DFB A;  5A5R A;  5D3P A;  3LXJ A;  4YYI A;  4QC3 A;  3JVK A;  5DYA A;  4MR5 A;  5TCM A;  5HCL A;  5KU3 A;  3QZV A;  5H1V A;  5F60 A;  5LKT A;  5FE3 A;  3LQJ A;  4O75 A;  2LSP B;  4O71 A;  5D3L A;  5BT5 A;  4HXN A;  5II2 A;  5FB0 A;  4WIV A;  5HEN A;  5CQ6 A;  5CS8 A;  4A9J A;  5EQ1 A;  3HMH A;  5A81 A;  4TT6 A;  3QZS A;  4TT2 A;  3UV2 A;  5EP7 A;  5CTL A;  5EI4 A;  5EVA A;  5DKH A;  5COI A;  3O33 A;  5DW1 A;  5DLZ A;  4MR3 A;  4A9O A;  4Q0O A;  4QSV A;  4YAT A;  4YBT A;  5AMF A;  4A9M A;  4HXO A;  4CUP A;  4O78 A;  5FG6 A;  4HXS A;  4MEO A;  3O35 A;  4UYG A;  4UYF A;  4XYA A;  4QUU A;  3K2J A;  1JM4 B;  4TU4 A;  5E9I A;  4ALG A;  5HEM A;  1WUM A;  4QB3 A;  4A9I A;  4A9L A;  5KO4 A;  3LQI A;  3I3J A;  5FE4 A;  5EU1 A;  5I88 A;  4DON A;  2KTB B;  5CZG A;  3MXF A;  4J1P A;  3MB3 A;  5DW2 A;  4QBM A;  5CP5 A;  4HXM A;  4MR6 A;  4QST A;  4HBV A;  2DWW A;  5ETB A;  4J0S A;  1X0J A;  4UIW A;  3UW9 A;  4Y03 A;  4YY6 A;  3S91 A;  1E6I A;  2YQD A;  5HRV A;  3U5L A;  5FFY A;  5HM0 A;  5CQ7 A;  5LKZ A;  3TLP A;  4BW2 A;  5CUE A;  2YEM A;  4NR8 A;  5CUC A;  4LZS A;  5DKC A;  5HQ7 A;  4TZ2 A;  1WUG A;  5I89 A;  1ZS5 A;  3P1F A;  3UV4 A;  5BT4 A;  5ENF A;  5F36 A;  5K29 A;  2GRC A;  4UYH A;  5KTW A;  4CL9 A;  5LKX A;  4QR4 A;  5D3J A;  4QEW A;  4IOO A;  5E3G A;  5HRX A;  5HQ6 A;  4YYK A;  5FE0 A;  4NR6 A;  4A9F A;  5F3A A;  4QSP A;  4UIT A;  5CQ8 A;  5AME A;  5L8T A;  5ENE A;  4HBW A;  4TQN A;  4YYD A;  2RNX A;  4YAB A;  4UYD A;  2DVV A;  4N3W A;  4YYM A;  4A9N A;  4WHU A;  2I8N A;  2RI7 A;  4TT4 A;  4YBM A;  5IGM A;  4HXL A;  4UYE A;  4YAD A;  4O7F A;  5A85 A;  5LJ1 A; 
#chains in the Genus database with same CATH topology
 5C4Q A;  4IR4 A;  5D3N A;  5EPS A;  5LVR A;  2RO1 A;  5LKU A;  5A5P A;  2OO1 A;  4BJX A;  2RNW A;  2E7N A;  4UIZ A;  5D7X A;  5FE9 A;  5LJ2 A;  4NR5 A;  4PCE A;  4TS8 A;  4ALH A;  4NRC A;  3HME A;  4Z6H A;  4BW3 A;  3MUL A;  4LYW A;  3D7C A;  4YBS A;  4N4F A;  5DLX A;  4LZR A;  3UV5 A;  3QZT A;  2EJN A;  4ZQL A;  4PTB A;  3SVF A;  4IR3 A;  4QR5 A;  3JVL A;  5CQ5 A;  4NR9 A;  5CQ3 A;  1JSP B;  2G4A A;  5CUG A;  4CFK A;  4QC1 A;  5II1 A;  4BW1 A;  5ACY A;  4LYS A;  2L84 A;  4QUT A;  5D25 A;  4N4H A;  4IOQ A;  3AAD A;  5ENC A;  5H1T A;  5CUB A;  3ERR A;  4O7C A;  4CUQ A;  3DWY A;  5E9L A;  5A82 A;  5CU8 A;  2R0S A;  3U5P A;  4NYV A;  2WP2 A;  5E74 A;  5EPR A;  4ZW1 A;  4LYI A;  4NR7 A;  3UVD A;  5F63 A;  5A7C A;  5D3H A;  4YH4 A;  5JI8 A;  3P1D A;  5AD3 A;  4O77 A;  4NQM A;  4Q0N A;  5A83 A;  3Q2F A;  5ENI A;  2NXB A;  5E3D A;  2D82 A;  4QSX A;  5IGL A;  4HXR A;  3S92 A;  5EK9 A;  5A5O A;  5D24 A;  4J3I A;  4N4G A;  4O72 A;  4O76 A;  4QZS A;  5ETD A;  4UIX A;  5FBX A;  4YAX A;  4UIV A;  4CLB A;  4Z6I A;  2YW5 A;  4QSS A;  5EIS A;  4TZ8 A;  5H85 A;  4UYF B;  5BT3 A;  2WP1 A;  5HFQ A;  4QEU A;  5KTU A;  4XUB A;  5FE7 A;  4O74 A;  4XY8 A;  1EQF A;  5D3R A;  5D3T A;  3UVW A;  4BW4 A;  2FSA A;  4O7B A;  1N72 A;  5DFD A;  3U5K A;  3GG3 A;  5D3S A;  5AD2 A;  2R10 A;  4IR6 A;  4NR4 A;  4O7A A;  5E9Y A;  5IBN A;  5CPE A;  5F61 A;  5HJC A;  4LR6 A;  3JVM A;  4C67 A;  4OGI A;  5FB1 A;  3ZYU A;  3P1C A;  5LJ0 A;  2RS9 B;  5CY9 A;  5C87 A;  3P1E A;  3U5O A;  2YDW A;  5F5Z A;  5A5N A;  4E96 A;  3P5O A;  2L85 A;  4QR3 A;  4GPJ A;  5FDZ A;  4QSR A;  4AKI A;  3IU5 A;  2DAT A;  5EIC A;  3U5N A;  5ENG A;  3MB4 A;  4KCX A;  3UVY A;  5LVQ A;  4NRA A;  2OSS A;  4UIY A;  4BHW A;  4NRB A;  5TB6 A;  5HQ5 A;  5E73 A;  5L98 A;  5J0D A;  4YC9 A;  5ENJ A;  3G0L A;  4C66 A;  4N4I A;  5FH8 A;  3O37 A;  2MJV B;  4CUU A;  4ZC9 A;  3NXB A;  4AKN A;  5FE2 A;  2OUO A;  2E7O A;  3FKM X;  4TTE A;  5HLS A;  5CUA A;  4CUS A;  5H1U A;  4QY4 A;  4OGJ A;  3LJW A;  4NUE A;  5DBM A;  3MUK A;  5I7X A;  3UVX A;  2DKW A;  4MEN A;  5D0C A;  2DVS A;  2E3K A;  2YYN A;  4HXP A;  5I40 A;  5A5S A;  5L96 A;  5F1H A;  4CFL A;  4NUD A;  5F25 A;  4YYG A;  5ENB A;  5FE6 A;  5KTX A;  5CRZ A;  3ONI A;  4NS5 A;  5I80 A;  3IU6 A;  5IGK A;  4HBY A;  5C8G A;  2RFJ A;  4LC2 A;  4QYD A;  4Z1Q A;  5EPB A;  5I86 A;  2N9G A;  3DAI A;  5EGU A;  3JVJ A;  5IGN A;  3AQA A;  4QSW A;  5KHM A;  5DYC A;  4YK0 A;  4PKL A;  5FG4 A;  4HXK A;  5FE8 A;  5LUU A;  2L5E A;  4NXJ A;  5F1L A;  5G4S A;  5DYX A;  4PCI A;  4PY6 A;  5CQT A;  2F6J A;  4A9K A;  3VKG A;  3SVG A;  4NYX A;  1F68 A;  3RCW A;  5A5Q A;  2RNY A;  2I7K A;  3U5M A;  4WHW A;  5F2P A;  4XY9 A;  4QYL A;  5EM3 A;  5I7Y A;  5CRM A;  3SVH A;  5FH7 A;  3MQM A;  4KV1 A;  3D1D A;  5F62 A;  3G0J A;  4XUA A;  5HFR A;  4TYL A;  2D9E A;  5DKD A;  4MR4 A;  5FFV A;  4OUF A;  5EA1 A;  2DVR A;  4KV4 A;  5CFW A;  4O70 A;  5FE1 A;  5E9M A;  4IR5 A;  5C89 A;  2R0Y A;  5FE5 A;  4LZ2 A;  2YEK A;  5EWH A;  4Z1S A;  5DYU A;  5HEL A;  5HRW A;  5I83 A;  3D1B A;  4LRG A;  3Q2E A;  4NQN A;  4FLP A;  5I29 A;  2R0V A;  4UIU A;  5IID A;  4NYW A;  4J0R A;  4TU6 A;  5C7N A;  4F3I A;  5G4R A;  4NUC A;  5EWD A;  4AI6 A;  4YY4 A;  5I1Q A;  5EV9 A;  4YYJ A;  4QSQ A;  5IG6 A;  4YYN A;  5EWV A;  2YEL A;  5E9K A;  3U5J A;  3HMF A;  5DY7 A;  5E9V A;  5D26 A;  4A9E A;  5EWW A;  4O7E A;  5L8U A;  4RVR A;  4HBX A;  5DFC A;  4YYH A;  4CUT A;  4QEV A;  4PS5 A;  4QSU A;  5CUD A;  5E7D A;  2H60 A;  5E0R A;  5CGP A;  5FFW A;  4MEQ A;  5L97 A;  2DVQ A;  2F6N A;  3O36 A;  3LQH A;  5ENH A;  5CQA A;  5DX4 A;  5FH6 A;  3O34 A;  4IOR A;  4Z93 A;  5JWM A;  4A9H A;  5C85 A;  4X2I A;  4YH3 A;  5EWC A;  4QNS A;  4CUR A;  4MEP A;  5CQ4 A;  4LDF A;  5L99 A;  5FG5 A;  5DFB A;  5A5R A;  5D3P A;  3LXJ A;  4YYI A;  4QC3 A;  3JVK A;  5DYA A;  4MR5 A;  5TCM A;  5HCL A;  5KU3 A;  3QZV A;  5H1V A;  5F60 A;  5LKT A;  5FE3 A;  3LQJ A;  4O75 A;  2LSP B;  4O71 A;  5D3L A;  5BT5 A;  4HXN A;  5II2 A;  5FB0 A;  4WIV A;  5HEN A;  5CQ6 A;  5CS8 A;  4A9J A;  5EQ1 A;  3HMH A;  5A81 A;  4TT6 A;  3QZS A;  4TT2 A;  3UV2 A;  5EP7 A;  5CTL A;  5EI4 A;  5EVA A;  5DKH A;  5COI A;  3O33 A;  5DW1 A;  5DLZ A;  4MR3 A;  4A9O A;  4Q0O A;  4QSV A;  4YAT A;  4YBT A;  5AMF A;  4A9M A;  4HXO A;  4CUP A;  4O78 A;  1ZKR A;  5FG6 A;  4HXS A;  4MEO A;  3O35 A;  4UYG A;  4UYF A;  4XYA A;  4QUU A;  3K2J A;  1JM4 B;  4TU4 A;  5E9I A;  4ALG A;  5HEM A;  1WUM A;  4QB3 A;  4A9I A;  4A9L A;  5KO4 A;  3LQI A;  3I3J A;  5FE4 A;  5EU1 A;  5I88 A;  4DON A;  2KTB B;  5CZG A;  3MXF A;  4J1P A;  3MB3 A;  5DW2 A;  4QBM A;  5CP5 A;  4HXM A;  4MR6 A;  4QST A;  3VKH A;  4HBV A;  2DWW A;  5ETB A;  4J0S A;  1X0J A;  4UIW A;  3UW9 A;  4Y03 A;  4YY6 A;  3S91 A;  1E6I A;  2YQD A;  5HRV A;  3U5L A;  5FFY A;  5HM0 A;  5CQ7 A;  5LKZ A;  3TLP A;  4BW2 A;  5CUE A;  2YEM A;  4NR8 A;  5CUC A;  4LZS A;  5DKC A;  5HQ7 A;  4AKH A;  4TZ2 A;  1WUG A;  5I89 A;  1ZS5 A;  1PUO A;  3P1F A;  3UV4 A;  5BT4 A;  5ENF A;  5F36 A;  5K29 A;  2GRC A;  4UYH A;  5KTW A;  4CL9 A;  5LKX A;  4QR4 A;  5D3J A;  4QEW A;  4IOO A;  5E3G A;  5HRX A;  5HQ6 A;  4YYK A;  5FE0 A;  4NR6 A;  4A9F A;  5F3A A;  4QSP A;  4UIT A;  5CQ8 A;  5AME A;  5L8T A;  5ENE A;  4HBW A;  4TQN A;  4YYD A;  2RNX A;  4YAB A;  4UYD A;  2DVV A;  4N3W A;  4YYM A;  4A9N A;  4WHU A;  4AKG A;  2I8N A;  2RI7 A;  4TT4 A;  4YBM A;  5IGM A;  4HXL A;  4UYE A;  4YAD A;  4O7F A;  5A85 A;  5LJ1 A; 
#chains in the Genus database with same CATH homology
 5C4Q A;  4IR4 A;  5D3N A;  5EPS A;  5LVR A;  2RO1 A;  5LKU A;  5A5P A;  2OO1 A;  4BJX A;  2RNW A;  2E7N A;  4UIZ A;  5D7X A;  5FE9 A;  5LJ2 A;  4NR5 A;  4PCE A;  4TS8 A;  4ALH A;  4NRC A;  3HME A;  4Z6H A;  4BW3 A;  3MUL A;  4LYW A;  3D7C A;  4YBS A;  4N4F A;  5DLX A;  4LZR A;  3UV5 A;  3QZT A;  4ZQL A;  4PTB A;  3SVF A;  4IR3 A;  4QR5 A;  3JVL A;  5CQ5 A;  4NR9 A;  5CQ3 A;  1JSP B;  2G4A A;  5CUG A;  4CFK A;  4QC1 A;  5II1 A;  4BW1 A;  5ACY A;  4LYS A;  2L84 A;  4QUT A;  5D25 A;  4N4H A;  4IOQ A;  3AAD A;  5ENC A;  5H1T A;  5CUB A;  4O7C A;  4CUQ A;  3DWY A;  5E9L A;  5A82 A;  5CU8 A;  2R0S A;  3U5P A;  4NYV A;  2WP2 A;  5E74 A;  5EPR A;  4ZW1 A;  4LYI A;  4NR7 A;  3UVD A;  5F63 A;  5A7C A;  5D3H A;  4YH4 A;  5JI8 A;  3P1D A;  5AD3 A;  4O77 A;  4NQM A;  4Q0N A;  5A83 A;  3Q2F A;  5ENI A;  2NXB A;  5E3D A;  2D82 A;  4QSX A;  5IGL A;  4HXR A;  3S92 A;  5EK9 A;  5A5O A;  5D24 A;  4J3I A;  4N4G A;  4O72 A;  4O76 A;  4QZS A;  5ETD A;  4UIX A;  5FBX A;  4YAX A;  4UIV A;  4CLB A;  4Z6I A;  2YW5 A;  4QSS A;  5EIS A;  4TZ8 A;  5H85 A;  4UYF B;  5BT3 A;  2WP1 A;  5HFQ A;  4QEU A;  5KTU A;  4XUB A;  5FE7 A;  4O74 A;  4XY8 A;  1EQF A;  5D3R A;  5D3T A;  3UVW A;  4BW4 A;  2FSA A;  4O7B A;  1N72 A;  5DFD A;  3U5K A;  3GG3 A;  5D3S A;  5AD2 A;  2R10 A;  4IR6 A;  4NR4 A;  4O7A A;  5E9Y A;  5IBN A;  5CPE A;  5F61 A;  5HJC A;  4LR6 A;  3JVM A;  4C67 A;  4OGI A;  5FB1 A;  3ZYU A;  3P1C A;  5LJ0 A;  2RS9 B;  5CY9 A;  5C87 A;  3P1E A;  3U5O A;  2YDW A;  5F5Z A;  5A5N A;  4E96 A;  3P5O A;  2L85 A;  4QR3 A;  4GPJ A;  5FDZ A;  4QSR A;  3IU5 A;  2DAT A;  5EIC A;  3U5N A;  5ENG A;  3MB4 A;  4KCX A;  3UVY A;  5LVQ A;  4NRA A;  2OSS A;  4UIY A;  4BHW A;  4NRB A;  5TB6 A;  5HQ5 A;  5E73 A;  5L98 A;  5J0D A;  4YC9 A;  5ENJ A;  3G0L A;  4C66 A;  4N4I A;  5FH8 A;  3O37 A;  2MJV B;  4CUU A;  4ZC9 A;  3NXB A;  4AKN A;  5FE2 A;  2OUO A;  2E7O A;  3FKM X;  4TTE A;  5HLS A;  5CUA A;  4CUS A;  5H1U A;  4QY4 A;  4OGJ A;  3LJW A;  4NUE A;  5DBM A;  3MUK A;  5I7X A;  3UVX A;  2DKW A;  4MEN A;  5D0C A;  2DVS A;  2E3K A;  2YYN A;  4HXP A;  5I40 A;  5A5S A;  5L96 A;  5F1H A;  4CFL A;  4NUD A;  5F25 A;  4YYG A;  5ENB A;  5FE6 A;  5KTX A;  5CRZ A;  3ONI A;  4NS5 A;  5I80 A;  3IU6 A;  5IGK A;  4HBY A;  5C8G A;  2RFJ A;  4LC2 A;  4QYD A;  4Z1Q A;  5EPB A;  5I86 A;  2N9G A;  3DAI A;  5EGU A;  3JVJ A;  5IGN A;  3AQA A;  4QSW A;  5KHM A;  5DYC A;  4YK0 A;  4PKL A;  5FG4 A;  4HXK A;  5FE8 A;  5LUU A;  2L5E A;  4NXJ A;  5F1L A;  5G4S A;  5DYX A;  4PCI A;  4PY6 A;  5CQT A;  2F6J A;  4A9K A;  3SVG A;  4NYX A;  1F68 A;  3RCW A;  5A5Q A;  2RNY A;  2I7K A;  3U5M A;  4WHW A;  5F2P A;  4XY9 A;  4QYL A;  5EM3 A;  5I7Y A;  5CRM A;  3SVH A;  5FH7 A;  3MQM A;  4KV1 A;  5F62 A;  3G0J A;  4XUA A;  5HFR A;  4TYL A;  2D9E A;  5DKD A;  4MR4 A;  5FFV A;  4OUF A;  5EA1 A;  2DVR A;  4KV4 A;  5CFW A;  4O70 A;  5FE1 A;  5E9M A;  4IR5 A;  5C89 A;  2R0Y A;  5FE5 A;  4LZ2 A;  2YEK A;  5EWH A;  4Z1S A;  5DYU A;  5HEL A;  5HRW A;  5I83 A;  4LRG A;  3Q2E A;  4NQN A;  4FLP A;  5I29 A;  2R0V A;  4UIU A;  5IID A;  4NYW A;  4J0R A;  4TU6 A;  5C7N A;  4F3I A;  5G4R A;  4NUC A;  5EWD A;  4YY4 A;  5I1Q A;  5EV9 A;  4YYJ A;  4QSQ A;  5IG6 A;  4YYN A;  5EWV A;  2YEL A;  5E9K A;  3U5J A;  3HMF A;  5DY7 A;  5E9V A;  5D26 A;  4A9E A;  5EWW A;  4O7E A;  5L8U A;  4RVR A;  4HBX A;  5DFC A;  4YYH A;  4CUT A;  4QEV A;  4PS5 A;  4QSU A;  5CUD A;  5E7D A;  2H60 A;  5E0R A;  5CGP A;  5FFW A;  4MEQ A;  5L97 A;  2DVQ A;  2F6N A;  3O36 A;  3LQH A;  5ENH A;  5CQA A;  5DX4 A;  5FH6 A;  3O34 A;  4IOR A;  4Z93 A;  5JWM A;  4A9H A;  5C85 A;  4X2I A;  4YH3 A;  5EWC A;  4QNS A;  4CUR A;  4MEP A;  5CQ4 A;  4LDF A;  5L99 A;  5FG5 A;  5DFB A;  5A5R A;  5D3P A;  3LXJ A;  4YYI A;  4QC3 A;  3JVK A;  5DYA A;  4MR5 A;  5TCM A;  5HCL A;  5KU3 A;  3QZV A;  5H1V A;  5F60 A;  5LKT A;  5FE3 A;  3LQJ A;  4O75 A;  2LSP B;  4O71 A;  5D3L A;  5BT5 A;  4HXN A;  5II2 A;  5FB0 A;  4WIV A;  5HEN A;  5CQ6 A;  5CS8 A;  4A9J A;  5EQ1 A;  3HMH A;  5A81 A;  4TT6 A;  3QZS A;  4TT2 A;  3UV2 A;  5EP7 A;  5CTL A;  5EI4 A;  5EVA A;  5DKH A;  5COI A;  3O33 A;  5DW1 A;  5DLZ A;  4MR3 A;  4A9O A;  4Q0O A;  4QSV A;  4YAT A;  4YBT A;  5AMF A;  4A9M A;  4HXO A;  4CUP A;  4O78 A;  5FG6 A;  4HXS A;  4MEO A;  3O35 A;  4UYG A;  4UYF A;  4XYA A;  4QUU A;  3K2J A;  1JM4 B;  4TU4 A;  5E9I A;  4ALG A;  5HEM A;  1WUM A;  4QB3 A;  4A9I A;  4A9L A;  5KO4 A;  3LQI A;  3I3J A;  5FE4 A;  5EU1 A;  5I88 A;  4DON A;  2KTB B;  5CZG A;  3MXF A;  4J1P A;  3MB3 A;  5DW2 A;  4QBM A;  5CP5 A;  4HXM A;  4MR6 A;  4QST A;  4HBV A;  2DWW A;  5ETB A;  4J0S A;  1X0J A;  4UIW A;  3UW9 A;  4Y03 A;  4YY6 A;  3S91 A;  1E6I A;  2YQD A;  5HRV A;  3U5L A;  5FFY A;  5HM0 A;  5CQ7 A;  5LKZ A;  3TLP A;  4BW2 A;  5CUE A;  2YEM A;  4NR8 A;  5CUC A;  4LZS A;  5DKC A;  5HQ7 A;  4TZ2 A;  1WUG A;  5I89 A;  1ZS5 A;  3P1F A;  3UV4 A;  5BT4 A;  5ENF A;  5F36 A;  5K29 A;  2GRC A;  4UYH A;  5KTW A;  4CL9 A;  5LKX A;  4QR4 A;  5D3J A;  4QEW A;  4IOO A;  5E3G A;  5HRX A;  5HQ6 A;  4YYK A;  5FE0 A;  4NR6 A;  4A9F A;  5F3A A;  4QSP A;  4UIT A;  5CQ8 A;  5AME A;  5L8T A;  5ENE A;  4HBW A;  4TQN A;  4YYD A;  2RNX A;  4YAB A;  4UYD A;  2DVV A;  4N3W A;  4YYM A;  4A9N A;  4WHU A;  2I8N A;  2RI7 A;  4TT4 A;  4YBM A;  5IGM A;  4HXL A;  4UYE A;  4YAD A;  4O7F A;  5A85 A;  5LJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...