5KTWA

Crebbp bromodomain in complex with cpd 44 (3-((5-acetyl-1-(cyclopropylmethyl)-4,5,6,7-tetrahydro-1h-pyrazolo[4,3-c]pyridin-3-yl)amino)-n-isopropylbenzamide)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
AAFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CREB-binding protein
publication title Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ktwA00
5DFBA 4A9HA 4UIXA 3K2JA 4ALHA 4HBYA 4X2IA 5F36A 4YC9A 2DATA 2N9GA 4LRGA 2OUOA 5KTWA 5D24A 2RI7A 4HXKA 4YH3A 4IR6A 4IOOA 4O70A 4AKNA 5A7CA 5C87A 5H85A 4YYMA 5A5RA 4C66A 5FFWA 3AADA 4NRCA 4QC1A 5FG5A 5BT5A 4TS8A 5C4QA 4NRAA 2E7NA 5CUAA 4UIWA 5HLSA 4MEPA 4NRBA 5EI4A 3DWYA 4IORA 5D3SA 4F3IA 4ZC9A 3LXJA 5A5NA 5FG6A 4MEQA 5DKCA 5EV9A 5FH8A 3QZVA 4J0SA 4QUTA 5CRMA 5KTUA 2D9EA 3GG3A 3P5OA 5EPRA 4QEUA 5CUCA 4TTEA 5F2PA 2E7OA 4YYKA 2L5EA 4QBMA 4YBTA 3I3JA 3NXBA 5LJ1A 4OGJA 4CURA 4IOQA 5CUEA 5E9LA 5F61A 5II2A 1EQFA 3G0JA 3FKMX 4LR6A 5ACYA 3Q2EA 5COIA 5ENGA 3QZTA 4QR5A 5L98A 4ZQLA 5AD2A 4HXLA 3MULA 5ENEA 5AMFA 5IGNA 5IGLA 5HEMA 5BT3A 4HXRA 4FLPA 4NYVA 5I40A 5L8UA 3LQHA 5KTXA 5AMEA 4NR5A 4LYIA 5KHMA 4YBSA 3D7CA 4A9IA 3UVDA 5E74A 5FE2A 2RO1A 5HRVA 4YYJA 5HFQA 5A81A 5H1UA 5LKTA 5ENBA 2YW5A 4UYGA 3U5PA 5F1HA 5FE9A 5EWHA 3UW9A 5CQ8A 4QSWA 2H60A 2YDWA 4QSQA 5A83A 4QSUA 3DAIA 3S92A 5D3HA 4QB3A 4BW3A 3ONIA 4E96A 5DX4A 3JVMA 2YEKA 4TU6A 5FB1A 5ENFA 4YABA 5HELA 3MB3A 4KV1A 5K29A 5FE1A 4O77A 4QEWA 5EU1A 3MXFA 2YEMA 4IR5A 5D3JA 5AD3A 5C7NA 5EWDA 5HFRA 5D3NA 5CRZA 4HBWA 2YELA 4NR8A 5EA1A 5L8TA 4Q0OA 5CGPA 4NS5A 4KCXA 4QSSA 5D3PA 4YY4A 4YADA 3MB4A 5FE0A 4YY6A 3P1DA 4N4IA 4CL9A 5DYUA 3SVHA 5FB0A 2GRCA 4QR4A 5F3AA 1E6IA 5KO4A 5CFWA 2FSAA 4MR3A 5I89A 4MR5A 4YYDA 5CQ5A 4XYAA 5DFDA 2I7KA 4Z1QA 4LYSA 4NXJA 5CUDA 5L96A 3U5NA 4YATA 5E9KA 5ENIA 5DKHA 4A9MA 5EWCA 5F60A 4OGIA 4Z6IA 5F63A 4MR4A 5EPSA 5E9IA 4O71A 2DVRA 2G4AA 4YK0A 4XUAA 4PTBA 5EQ1A 5EVAA 4NUCA 4MEOA 5CY9A 5HJCA 5BT4A 4Q0NA 5HM0A 4LZSA 4A9EA 4HXNA 5I7XA 4O7AA 4J1PA 4KV4A 5ETDA 2R10A 4CLBA 5EISA 4N3WA 4UIUA 5DYAA 2R0YA 5FH6A 2RFJA 4Y03A 5E9MA 4O7FA 5I86A 3P1FA 3O33A 5EGUA 4LZ2A 4CUUA 5I1QA 5FE8A 4N4FA 5D3LA 5F62A 5EICA 5LVRA 5CUBA 3O36A 2F6JA 5CUGA 4O72A 3IU5A 5L97A 4QUUA 5E7DA 4HXPA 4CFLA 5L99A 4BJXA 1WUGA 5TB6A 5JWMA 4OUFA 4QZSA 5FFYA 4Z93A 5FE5A 5DLXA 2DVSA 5DW1A 4WHWA 4UIZA 3UVXA 5H1TA 5G4SA 4LZRA 2RS9B 5ENJA 4NR9A 5IGKA 5G4RA 3O34A 1X0JA 4NR7A 3P1CA 5A82A 4LC2A 5A5SA 2I8NA 4WHUA 5E9VA 5JI8A 5D26A 5E9YA 3TLPA 5C85A 4QYLA 4BW2A 4O7EA 2YYNA 1WUMA 4QEVA 5FH7A 5HQ7A 4O75A 4PCIA 4HXMA 5LJ2A 2DWWA 4O76A 5I7YA 5IGMA 2KTBB 3UV2A 5I80A 3MQMA 4CFKA 5A5QA 4MENA 4WIVA 5CP5A 4TZ2A 4UIVA 4UYEA 4O7BA 5CQ6A 5E3DA 2E3KA 5D25A 3UVWA 1JSPB 3HMEA 5DLZA 4TQNA 4IR4A 3IU6A 2YQDA 5EK9A 4YYIA 5TCMA 4BHWA 3G0LA 4UYHA 5FBXA 4J3IA 2DVQA 2D82A 5IG6A 3U5OA 2RNXA 4HBXA 4A9JA 5HRXA 5LKUA 4UYDA 3LQIA 4QSTA 5DY7A 5H1VA 3JVKA 4YH4A 5F25A 5HENA 4XY9A 3U5MA 4UYFB 3S91A 5DKDA 5EM3A 4QNSA 2NXBA 4ALGA 4O78A 5IIDA 2MJVB 2F6NA 5LKZA 4N4GA 1JM4B 5EWWA 4HXSA 5F1LA 5C89A 5CTLA 5II1A 5LKXA 4A9LA 5CQ7A 5CQ3A 4A9OA 4GPJA 5DYCA 4LYWA 5CQTA 5E3GA 3SVFA 4N4HA 5E0RA 4NYWA 4A9KA 4YYHA 3SVGA 5LUUA 5HRWA 5KU3A 3HMHA 5CQAA 3UVYA 5FDZA 5HQ5A 3O35A 5F5ZA 4QC3A 4YBMA 4IR3A 4PCEA 5CZGA 5J0DA 3AQAA 3JVLA 5A85A 4PY6A 4TZ8A 3QZSA 2R0VA 4J0RA 3RCWA 5D0CA 3UV4A 4TT4A 3HMFA 5FFVA 4NR6A 5D3TA 4UYFA 2RNYA 4TT2A 4UITA 4A9NA 5HCLA 5CU8A 4PKLA 4BW4A 4NQNA 4C67A 5I83A 4TU4A 5IBNA 5EP7A 5D3RA 4O74A 5DYXA 5ENHA 3U5LA 3O37A 5CQ4A 4CUTA 4QSRA 2L85A 4CUSA 3LJWA 4XUBA 5LJ0A 2DVVA 5HQ6A 2DKWA 4ZW1A 5D7XA 2R0SA 5A5OA 4NUEA 3LQJA 4NR4A 4QSXA 1N72A 4HBVA 2WP2A 4PS5A 4XY8A 4BW1A 5FE7A 5E73A 5FG4A 4RVRA 4Z1SA 3U5JA 4QYDA 1F68A 4MR6A 4LDFA 5FE4A 5I29A 2L84A 4CUPA 4O7CA 2OSSA 4CUQA 5EWVA 4NUDA 4YAXA 4Z6HA 4QSVA 3U5KA 4DONA 3JVJA 4QR3A 5DBMA 1ZS5A 3P1EA 2LSPB 4QSPA 4YYGA 4NYXA 2OO1A 3UV5A 5I88A 5EPBA 3Q2FA 5FE6A 2WP1A 5DFCA 4YYNA 4HXOA 4TT6A 5CS8A 3ZYUA 5DW2A 5ENCA 4NQMA 4A9FA 5A5PA 5LVQA 5C8GA 4TYLA 3MUKA 4QY4A 5FE3A 5ETBA 2RNWA 4UIYA 5CPEA
chains in the Genus database with same CATH superfamily
5DFBA 4A9HA 4UIXA 3K2JA 4ALHA 4HBYA 4X2IA 5F36A 4YC9A 1PUOA 2DATA 2N9GA 4LRGA 2OUOA 5KTWA 5D24A 2RI7A 4HXKA 4YH3A 4IR6A 4IOOA 4O70A 4AKNA 5A7CA 5C87A 5H85A 4YYMA 5A5RA 4C66A 5FFWA 3AADA 4NRCA 4QC1A 5FG5A 5BT5A 4TS8A 5C4QA 4NRAA 2E7NA 5CUAA 4UIWA 5HLSA 4MEPA 4NRBA 5EI4A 3DWYA 4IORA 5D3SA 4F3IA 4ZC9A 3LXJA 5A5NA 5FG6A 4MEQA 5DKCA 5EV9A 5FH8A 3QZVA 4J0SA 4QUTA 5CRMA 5KTUA 2D9EA 3GG3A 3P5OA 3D1DA 5EPRA 4QEUA 5CUCA 4TTEA 5F2PA 2E7OA 4YYKA 2L5EA 4QBMA 4YBTA 3I3JA 3NXBA 5LJ1A 4OGJA 4CURA 4IOQA 5CUEA 5E9LA 5F61A 5II2A 1EQFA 3G0JA 3FKMX 4LR6A 5ACYA 3Q2EA 5COIA 5ENGA 3QZTA 4QR5A 5L98A 4ZQLA 5AD2A 4AKIA 4HXLA 3MULA 5ENEA 5AMFA 5IGNA 5IGLA 5HEMA 5BT3A 4HXRA 3D1BA 4FLPA 4NYVA 5I40A 5L8UA 3LQHA 5KTXA 5AMEA 4NR5A 4LYIA 5KHMA 4YBSA 3D7CA 4A9IA 3UVDA 5E74A 5FE2A 2RO1A 5HRVA 4YYJA 5HFQA 5A81A 5H1UA 5LKTA 5ENBA 2YW5A 4UYGA 3U5PA 5F1HA 5FE9A 5EWHA 3UW9A 5CQ8A 4QSWA 2H60A 2YDWA 4QSQA 5A83A 4QSUA 3DAIA 3S92A 5D3HA 4QB3A 4BW3A 3ONIA 4E96A 5DX4A 3JVMA 2YEKA 4TU6A 5FB1A 5ENFA 4YABA 5HELA 3MB3A 4KV1A 5K29A 5FE1A 4O77A 4QEWA 5EU1A 3MXFA 2YEMA 4IR5A 5D3JA 5AD3A 5C7NA 5EWDA 5HFRA 5D3NA 5CRZA 4HBWA 2YELA 4NR8A 5EA1A 5L8TA 4Q0OA 5CGPA 4NS5A 4KCXA 4QSSA 5D3PA 4YY4A 4YADA 3MB4A 5FE0A 4YY6A 3P1DA 4N4IA 4CL9A 5DYUA 3SVHA 5FB0A 2GRCA 4QR4A 5F3AA 1E6IA 5KO4A 5CFWA 2FSAA 4MR3A 5I89A 4MR5A 4YYDA 5CQ5A 4XYAA 5DFDA 2I7KA 4Z1QA 4LYSA 4NXJA 5CUDA 4AKHA 5L96A 3U5NA 4YATA 5E9KA 5ENIA 5DKHA 4A9MA 5EWCA 5F60A 4OGIA 4Z6IA 5F63A 4MR4A 5EPSA 5E9IA 4O71A 2DVRA 2G4AA 4YK0A 4XUAA 4PTBA 5EQ1A 5EVAA 4NUCA 4MEOA 5CY9A 5HJCA 5BT4A 4Q0NA 5HM0A 4LZSA 4A9EA 4HXNA 5I7XA 4O7AA 4J1PA 4KV4A 5ETDA 2R10A 4CLBA 5EISA 4N3WA 4UIUA 5DYAA 2R0YA 5FH6A 2RFJA 4Y03A 5E9MA 4O7FA 5I86A 3P1FA 3O33A 5EGUA 4LZ2A 4CUUA 5I1QA 5FE8A 4N4FA 5D3LA 5F62A 5EICA 5LVRA 5CUBA 3O36A 2F6JA 5CUGA 4O72A 3IU5A 5L97A 4QUUA 5E7DA 4HXPA 4CFLA 5L99A 4BJXA 1WUGA 5TB6A 5JWMA 4OUFA 4QZSA 5FFYA 4Z93A 5FE5A 5DLXA 2DVSA 5DW1A 4WHWA 4UIZA 3UVXA 5H1TA 5G4SA 4LZRA 2RS9B 5ENJA 4NR9A 5IGKA 5G4RA 3O34A 1X0JA 4NR7A 3P1CA 5A82A 4LC2A 5A5SA 2I8NA 4WHUA 5E9VA 5JI8A 5D26A 5E9YA 3TLPA 5C85A 4QYLA 4BW2A 4O7EA 2YYNA 1WUMA 4QEVA 5FH7A 5HQ7A 4O75A 4PCIA 4HXMA 5LJ2A 3ERRA 2DWWA 4O76A 5I7YA 5IGMA 2KTBB 3UV2A 5I80A 3MQMA 4CFKA 5A5QA 4MENA 4WIVA 5CP5A 4TZ2A 4UIVA 4UYEA 4O7BA 5CQ6A 1ZKRA 5E3DA 2E3KA 5D25A 3UVWA 1JSPB 3HMEA 5DLZA 4TQNA 4IR4A 3IU6A 2YQDA 5EK9A 4YYIA 5TCMA 4BHWA 3G0LA 4UYHA 5FBXA 4J3IA 4AKGA 2DVQA 2D82A 5IG6A 3U5OA 2RNXA 4HBXA 4A9JA 5HRXA 5LKUA 4UYDA 3LQIA 4QSTA 5DY7A 5H1VA 3JVKA 4YH4A 5F25A 5HENA 4XY9A 3U5MA 4UYFB 3S91A 5DKDA 5EM3A 4QNSA 2NXBA 4ALGA 4O78A 5IIDA 2MJVB 2F6NA 5LKZA 4N4GA 1JM4B 5EWWA 4HXSA 5F1LA 2EJNA 5C89A 5CTLA 5II1A 5LKXA 4A9LA 5CQ7A 5CQ3A 4A9OA 4GPJA 5DYCA 4LYWA 5CQTA 5E3GA 3SVFA 4N4HA 5E0RA 4NYWA 4A9KA 4YYHA 3SVGA 5LUUA 5HRWA 5KU3A 3HMHA 5CQAA 3UVYA 5FDZA 5HQ5A 3O35A 5F5ZA 4QC3A 4YBMA 4IR3A 4PCEA 5CZGA 5J0DA 3AQAA 3JVLA 5A85A 4PY6A 4TZ8A 3QZSA 3VKHA 2R0VA 4J0RA 3RCWA 5D0CA 3UV4A 4TT4A 3HMFA 5FFVA 4NR6A 5D3TA 4UYFA 2RNYA 4TT2A 4UITA 4A9NA 5HCLA 5CU8A 4PKLA 4BW4A 4NQNA 4C67A 5I83A 4TU4A 5IBNA 5EP7A 5D3RA 4O74A 5DYXA 5ENHA 3U5LA 3O37A 5CQ4A 4CUTA 4QSRA 2L85A 4CUSA 3LJWA 4XUBA 5LJ0A 2DVVA 5HQ6A 2DKWA 4ZW1A 5D7XA 2R0SA 5A5OA 4NUEA 3LQJA 4NR4A 4QSXA 1N72A 4HBVA 2WP2A 4PS5A 4XY8A 4BW1A 5FE7A 5E73A 5FG4A 4RVRA 4Z1SA 3U5JA 4QYDA 1F68A 3VKGA 4MR6A 4LDFA 5FE4A 5I29A 2L84A 4CUPA 4O7CA 2OSSA 4CUQA 5EWVA 4NUDA 4YAXA 4Z6HA 4QSVA 3U5KA 4DONA 3JVJA 4QR3A 5DBMA 1ZS5A 3P1EA 2LSPB 4QSPA 4YYGA 4NYXA 2OO1A 3UV5A 5I88A 5EPBA 3Q2FA 5FE6A 2WP1A 5DFCA 4YYNA 4HXOA 4TT6A 5CS8A 3ZYUA 5DW2A 5ENCA 4NQMA 4A9FA 5A5PA 5LVQA 5C8GA 4AI6A 4TYLA 3MUKA 4QY4A 5FE3A 5ETBA 2RNWA 4UIYA 5CPEA
chains in the Genus database with same CATH topology
5DFBA 4A9HA 4UIXA 3K2JA 4ALHA 4HBYA 4X2IA 5F36A 4YC9A 2DATA 2N9GA 4LRGA 2OUOA 5KTWA 5D24A 2RI7A 4HXKA 4YH3A 4IR6A 4IOOA 4O70A 4AKNA 5A7CA 5C87A 5H85A 4YYMA 5A5RA 4C66A 5FFWA 3AADA 4NRCA 4QC1A 5FG5A 5BT5A 4TS8A 5C4QA 4NRAA 2E7NA 5CUAA 4UIWA 5HLSA 4MEPA 4NRBA 5EI4A 3DWYA 4IORA 5D3SA 4F3IA 4ZC9A 3LXJA 5A5NA 5FG6A 4MEQA 5DKCA 5EV9A 5FH8A 3QZVA 4J0SA 4QUTA 5CRMA 5KTUA 2D9EA 3GG3A 3P5OA 5EPRA 4QEUA 5CUCA 4TTEA 5F2PA 2E7OA 4YYKA 2L5EA 4QBMA 4YBTA 3I3JA 3NXBA 5LJ1A 4OGJA 4CURA 4IOQA 5CUEA 5E9LA 5F61A 5II2A 1EQFA 3G0JA 3FKMX 4LR6A 5ACYA 3Q2EA 5COIA 5ENGA 3QZTA 4QR5A 5L98A 4ZQLA 5AD2A 4HXLA 3MULA 5ENEA 5AMFA 5IGNA 5IGLA 5HEMA 5BT3A 4HXRA 4FLPA 4NYVA 5I40A 5L8UA 3LQHA 5KTXA 5AMEA 4NR5A 4LYIA 5KHMA 4YBSA 3D7CA 4A9IA 3UVDA 5E74A 5FE2A 2RO1A 5HRVA 4YYJA 5HFQA 5A81A 5H1UA 5LKTA 5ENBA 2YW5A 4UYGA 3U5PA 5F1HA 5FE9A 5EWHA 3UW9A 5CQ8A 4QSWA 2H60A 2YDWA 4QSQA 5A83A 4QSUA 3DAIA 3S92A 5D3HA 4QB3A 4BW3A 3ONIA 4E96A 5DX4A 3JVMA 2YEKA 4TU6A 5FB1A 5ENFA 4YABA 5HELA 3MB3A 4KV1A 5K29A 5FE1A 4O77A 4QEWA 5EU1A 3MXFA 2YEMA 4IR5A 5D3JA 5AD3A 5C7NA 5EWDA 5HFRA 5D3NA 5CRZA 4HBWA 2YELA 4NR8A 5EA1A 5L8TA 4Q0OA 5CGPA 4NS5A 4KCXA 4QSSA 5D3PA 4YY4A 4YADA 3MB4A 5FE0A 4YY6A 3P1DA 4N4IA 4CL9A 5DYUA 3SVHA 5FB0A 2GRCA 4QR4A 5F3AA 1E6IA 5KO4A 5CFWA 2FSAA 4MR3A 5I89A 4MR5A 4YYDA 5CQ5A 4XYAA 5DFDA 2I7KA 4Z1QA 4LYSA 4NXJA 5CUDA 5L96A 3U5NA 4YATA 5E9KA 5ENIA 5DKHA 4A9MA 5EWCA 5F60A 4OGIA 4Z6IA 5F63A 4MR4A 5EPSA 5E9IA 4O71A 2DVRA 2G4AA 4YK0A 4XUAA 4PTBA 5EQ1A 5EVAA 4NUCA 4MEOA 5CY9A 5HJCA 5BT4A 4Q0NA 5HM0A 4LZSA 4A9EA 4HXNA 5I7XA 4O7AA 4J1PA 4KV4A 5ETDA 2R10A 4CLBA 5EISA 4N3WA 4UIUA 5DYAA 2R0YA 5FH6A 2RFJA 4Y03A 5E9MA 4O7FA 5I86A 3P1FA 3O33A 5EGUA 4LZ2A 4CUUA 5I1QA 5FE8A 4N4FA 5D3LA 5F62A 5EICA 5LVRA 5CUBA 3O36A 2F6JA 5CUGA 4O72A 3IU5A 5L97A 4QUUA 5E7DA 4HXPA 4CFLA 5L99A 4BJXA 1WUGA 5TB6A 5JWMA 4OUFA 4QZSA 5FFYA 4Z93A 5FE5A 5DLXA 2DVSA 5DW1A 4WHWA 4UIZA 3UVXA 5H1TA 5G4SA 4LZRA 2RS9B 5ENJA 4NR9A 5IGKA 5G4RA 3O34A 1X0JA 4NR7A 3P1CA 5A82A 4LC2A 5A5SA 2I8NA 4WHUA 5E9VA 5JI8A 5D26A 5E9YA 3TLPA 5C85A 4QYLA 4BW2A 4O7EA 2YYNA 1WUMA 4QEVA 5FH7A 5HQ7A 4O75A 4PCIA 4HXMA 5LJ2A 2DWWA 4O76A 5I7YA 5IGMA 2KTBB 3UV2A 5I80A 3MQMA 4CFKA 5A5QA 4MENA 4WIVA 5CP5A 4TZ2A 4UIVA 4UYEA 4O7BA 5CQ6A 5E3DA 2E3KA 5D25A 3UVWA 1JSPB 3HMEA 5DLZA 4TQNA 4IR4A 3IU6A 2YQDA 5EK9A 4YYIA 5TCMA 4BHWA 3G0LA 4UYHA 5FBXA 4J3IA 2DVQA 2D82A 5IG6A 3U5OA 2RNXA 4HBXA 4A9JA 5HRXA 5LKUA 4UYDA 3LQIA 4QSTA 5DY7A 5H1VA 3JVKA 4YH4A 5F25A 5HENA 4XY9A 3U5MA 4UYFB 3S91A 5DKDA 5EM3A 4QNSA 2NXBA 4ALGA 4O78A 5IIDA 2MJVB 2F6NA 5LKZA 4N4GA 1JM4B 5EWWA 4HXSA 5F1LA 5C89A 5CTLA 5II1A 5LKXA 4A9LA 5CQ7A 5CQ3A 4A9OA 4GPJA 5DYCA 4LYWA 5CQTA 5E3GA 3SVFA 4N4HA 5E0RA 4NYWA 4A9KA 4YYHA 3SVGA 5LUUA 5HRWA 5KU3A 3HMHA 5CQAA 3UVYA 5FDZA 5HQ5A 3O35A 5F5ZA 4QC3A 4YBMA 4IR3A 4PCEA 5CZGA 5J0DA 3AQAA 3JVLA 5A85A 4PY6A 4TZ8A 3QZSA 2R0VA 4J0RA 3RCWA 5D0CA 3UV4A 4TT4A 3HMFA 5FFVA 4NR6A 5D3TA 4UYFA 2RNYA 4TT2A 4UITA 4A9NA 5HCLA 5CU8A 4PKLA 4BW4A 4NQNA 4C67A 5I83A 4TU4A 5IBNA 5EP7A 5D3RA 4O74A 5DYXA 5ENHA 3U5LA 3O37A 5CQ4A 4CUTA 4QSRA 2L85A 4CUSA 3LJWA 4XUBA 5LJ0A 2DVVA 5HQ6A 2DKWA 4ZW1A 5D7XA 2R0SA 5A5OA 4NUEA 3LQJA 4NR4A 4QSXA 1N72A 4HBVA 2WP2A 4PS5A 4XY8A 4BW1A 5FE7A 5E73A 5FG4A 4RVRA 4Z1SA 3U5JA 4QYDA 1F68A 4MR6A 4LDFA 5FE4A 5I29A 2L84A 4CUPA 4O7CA 2OSSA 4CUQA 5EWVA 4NUDA 4YAXA 4Z6HA 4QSVA 3U5KA 4DONA 3JVJA 4QR3A 5DBMA 1ZS5A 3P1EA 2LSPB 4QSPA 4YYGA 4NYXA 2OO1A 3UV5A 5I88A 5EPBA 3Q2FA 5FE6A 2WP1A 5DFCA 4YYNA 4HXOA 4TT6A 5CS8A 3ZYUA 5DW2A 5ENCA 4NQMA 4A9FA 5A5PA 5LVQA 5C8GA 4TYLA 3MUKA 4QY4A 5FE3A 5ETBA 2RNWA 4UIYA 5CPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DFB A;  4A9H A;  4UIX A;  3K2J A;  4ALH A;  4HBY A;  4X2I A;  5F36 A;  4YC9 A;  2DAT A;  2N9G A;  4LRG A;  2OUO A;  5KTW A;  5D24 A;  2RI7 A;  4HXK A;  4YH3 A;  4IR6 A;  4IOO A;  4O70 A;  4AKN A;  5A7C A;  5C87 A;  5H85 A;  4YYM A;  5A5R A;  4C66 A;  5FFW A;  3AAD A;  4NRC A;  4QC1 A;  5FG5 A;  5BT5 A;  4TS8 A;  5C4Q A;  4NRA A;  2E7N A;  5CUA A;  4UIW A;  5HLS A;  4MEP A;  4NRB A;  5EI4 A;  3DWY A;  4IOR A;  5D3S A;  4F3I A;  4ZC9 A;  3LXJ A;  5A5N A;  5FG6 A;  4MEQ A;  5DKC A;  5EV9 A;  5FH8 A;  3QZV A;  4J0S A;  4QUT A;  5CRM A;  5KTU A;  2D9E A;  3GG3 A;  3P5O A;  5EPR A;  4QEU A;  5CUC A;  4TTE A;  5F2P A;  2E7O A;  4YYK A;  2L5E A;  4QBM A;  4YBT A;  3I3J A;  3NXB A;  5LJ1 A;  4OGJ A;  4CUR A;  4IOQ A;  5CUE A;  5E9L A;  5F61 A;  5II2 A;  1EQF A;  3G0J A;  3FKM X;  4LR6 A;  5ACY A;  3Q2E A;  5COI A;  5ENG A;  3QZT A;  4QR5 A;  5L98 A;  4ZQL A;  5AD2 A;  4HXL A;  3MUL A;  5ENE A;  5AMF A;  5IGN A;  5IGL A;  5HEM A;  5BT3 A;  4HXR A;  4FLP A;  4NYV A;  5I40 A;  5L8U A;  3LQH A;  5KTX A;  5AME A;  4NR5 A;  4LYI A;  5KHM A;  4YBS A;  3D7C A;  4A9I A;  3UVD A;  5E74 A;  5FE2 A;  2RO1 A;  5HRV A;  4YYJ A;  5HFQ A;  5A81 A;  5H1U A;  5LKT A;  5ENB A;  2YW5 A;  4UYG A;  3U5P A;  5F1H A;  5FE9 A;  5EWH A;  3UW9 A;  5CQ8 A;  4QSW A;  2H60 A;  2YDW A;  4QSQ A;  5A83 A;  4QSU A;  3DAI A;  3S92 A;  5D3H A;  4QB3 A;  4BW3 A;  3ONI A;  4E96 A;  5DX4 A;  3JVM A;  2YEK A;  4TU6 A;  5FB1 A;  5ENF A;  4YAB A;  5HEL A;  3MB3 A;  4KV1 A;  5K29 A;  5FE1 A;  4O77 A;  4QEW A;  5EU1 A;  3MXF A;  2YEM A;  4IR5 A;  5D3J A;  5AD3 A;  5C7N A;  5EWD A;  5HFR A;  5D3N A;  5CRZ A;  4HBW A;  2YEL A;  4NR8 A;  5EA1 A;  5L8T A;  4Q0O A;  5CGP A;  4NS5 A;  4KCX A;  4QSS A;  5D3P A;  4YY4 A;  4YAD A;  3MB4 A;  5FE0 A;  4YY6 A;  3P1D A;  4N4I A;  4CL9 A;  5DYU A;  3SVH A;  5FB0 A;  2GRC A;  4QR4 A;  5F3A A;  1E6I A;  5KO4 A;  5CFW A;  2FSA A;  4MR3 A;  5I89 A;  4MR5 A;  4YYD A;  5CQ5 A;  4XYA A;  5DFD A;  2I7K A;  4Z1Q A;  4LYS A;  4NXJ A;  5CUD A;  5L96 A;  3U5N A;  4YAT A;  5E9K A;  5ENI A;  5DKH A;  4A9M A;  5EWC A;  5F60 A;  4OGI A;  4Z6I A;  5F63 A;  4MR4 A;  5EPS A;  5E9I A;  4O71 A;  2DVR A;  2G4A A;  4YK0 A;  4XUA A;  4PTB A;  5EQ1 A;  5EVA A;  4NUC A;  4MEO A;  5CY9 A;  5HJC A;  5BT4 A;  4Q0N A;  5HM0 A;  4LZS A;  4A9E A;  4HXN A;  5I7X A;  4O7A A;  4J1P A;  4KV4 A;  5ETD A;  2R10 A;  4CLB A;  5EIS A;  4N3W A;  4UIU A;  5DYA A;  2R0Y A;  5FH6 A;  2RFJ A;  4Y03 A;  5E9M A;  4O7F A;  5I86 A;  3P1F A;  3O33 A;  5EGU A;  4LZ2 A;  4CUU A;  5I1Q A;  5FE8 A;  4N4F A;  5D3L A;  5F62 A;  5EIC A;  5LVR A;  5CUB A;  3O36 A;  2F6J A;  5CUG A;  4O72 A;  3IU5 A;  5L97 A;  4QUU A;  5E7D A;  4HXP A;  4CFL A;  5L99 A;  4BJX A;  1WUG A;  5TB6 A;  5JWM A;  4OUF A;  4QZS A;  5FFY A;  4Z93 A;  5FE5 A;  5DLX A;  2DVS A;  5DW1 A;  4WHW A;  4UIZ A;  3UVX A;  5H1T A;  5G4S A;  4LZR A;  2RS9 B;  5ENJ A;  4NR9 A;  5IGK A;  5G4R A;  3O34 A;  1X0J A;  4NR7 A;  3P1C A;  5A82 A;  4LC2 A;  5A5S A;  2I8N A;  4WHU A;  5E9V A;  5JI8 A;  5D26 A;  5E9Y A;  3TLP A;  5C85 A;  4QYL A;  4BW2 A;  4O7E A;  2YYN A;  1WUM A;  4QEV A;  5FH7 A;  5HQ7 A;  4O75 A;  4PCI A;  4HXM A;  5LJ2 A;  2DWW A;  4O76 A;  5I7Y A;  5IGM A;  2KTB B;  3UV2 A;  5I80 A;  3MQM A;  4CFK A;  5A5Q A;  4MEN A;  4WIV A;  5CP5 A;  4TZ2 A;  4UIV A;  4UYE A;  4O7B A;  5CQ6 A;  5E3D A;  2E3K A;  5D25 A;  3UVW A;  1JSP B;  3HME A;  5DLZ A;  4TQN A;  4IR4 A;  3IU6 A;  2YQD A;  5EK9 A;  4YYI A;  5TCM A;  4BHW A;  3G0L A;  4UYH A;  5FBX A;  4J3I A;  2DVQ A;  2D82 A;  5IG6 A;  3U5O A;  2RNX A;  4HBX A;  4A9J A;  5HRX A;  5LKU A;  4UYD A;  3LQI A;  4QST A;  5DY7 A;  5H1V A;  3JVK A;  4YH4 A;  5F25 A;  5HEN A;  4XY9 A;  3U5M A;  4UYF B;  3S91 A;  5DKD A;  5EM3 A;  4QNS A;  2NXB A;  4ALG A;  4O78 A;  5IID A;  2MJV B;  2F6N A;  5LKZ A;  4N4G A;  1JM4 B;  5EWW A;  4HXS A;  5F1L A;  5C89 A;  5CTL A;  5II1 A;  5LKX A;  4A9L A;  5CQ7 A;  5CQ3 A;  4A9O A;  4GPJ A;  5DYC A;  4LYW A;  5CQT A;  5E3G A;  3SVF A;  4N4H A;  5E0R A;  4NYW A;  4A9K A;  4YYH A;  3SVG A;  5LUU A;  5HRW A;  5KU3 A;  3HMH A;  5CQA A;  3UVY A;  5FDZ A;  5HQ5 A;  3O35 A;  5F5Z A;  4QC3 A;  4YBM A;  4IR3 A;  4PCE A;  5CZG A;  5J0D A;  3AQA A;  3JVL A;  5A85 A;  4PY6 A;  4TZ8 A;  3QZS A;  2R0V A;  4J0R A;  3RCW A;  5D0C A;  3UV4 A;  4TT4 A;  3HMF A;  5FFV A;  4NR6 A;  5D3T A;  4UYF A;  2RNY A;  4TT2 A;  4UIT A;  4A9N A;  5HCL A;  5CU8 A;  4PKL A;  4BW4 A;  4NQN A;  4C67 A;  5I83 A;  4TU4 A;  5IBN A;  5EP7 A;  5D3R A;  4O74 A;  5DYX A;  5ENH A;  3U5L A;  3O37 A;  5CQ4 A;  4CUT A;  4QSR A;  2L85 A;  4CUS A;  3LJW A;  4XUB A;  5LJ0 A;  2DVV A;  5HQ6 A;  2DKW A;  4ZW1 A;  5D7X A;  2R0S A;  5A5O A;  4NUE A;  3LQJ A;  4NR4 A;  4QSX A;  1N72 A;  4HBV A;  2WP2 A;  4PS5 A;  4XY8 A;  4BW1 A;  5FE7 A;  5E73 A;  5FG4 A;  4RVR A;  4Z1S A;  3U5J A;  4QYD A;  1F68 A;  4MR6 A;  4LDF A;  5FE4 A;  5I29 A;  2L84 A;  4CUP A;  4O7C A;  2OSS A;  4CUQ A;  5EWV A;  4NUD A;  4YAX A;  4Z6H A;  4QSV A;  3U5K A;  4DON A;  3JVJ A;  4QR3 A;  5DBM A;  1ZS5 A;  3P1E A;  2LSP B;  4QSP A;  4YYG A;  4NYX A;  2OO1 A;  3UV5 A;  5I88 A;  5EPB A;  3Q2F A;  5FE6 A;  2WP1 A;  5DFC A;  4YYN A;  4HXO A;  4TT6 A;  5CS8 A;  3ZYU A;  5DW2 A;  5ENC A;  4NQM A;  4A9F A;  5A5P A;  5LVQ A;  5C8G A;  4TYL A;  3MUK A;  4QY4 A;  5FE3 A;  5ETB A;  2RNW A;  4UIY A;  5CPE A; 
#chains in the Genus database with same CATH topology
 5DFB A;  4A9H A;  4UIX A;  3K2J A;  4ALH A;  4HBY A;  4X2I A;  5F36 A;  4YC9 A;  1PUO A;  2DAT A;  2N9G A;  4LRG A;  2OUO A;  5KTW A;  5D24 A;  2RI7 A;  4HXK A;  4YH3 A;  4IR6 A;  4IOO A;  4O70 A;  4AKN A;  5A7C A;  5C87 A;  5H85 A;  4YYM A;  5A5R A;  4C66 A;  5FFW A;  3AAD A;  4NRC A;  4QC1 A;  5FG5 A;  5BT5 A;  4TS8 A;  5C4Q A;  4NRA A;  2E7N A;  5CUA A;  4UIW A;  5HLS A;  4MEP A;  4NRB A;  5EI4 A;  3DWY A;  4IOR A;  5D3S A;  4F3I A;  4ZC9 A;  3LXJ A;  5A5N A;  5FG6 A;  4MEQ A;  5DKC A;  5EV9 A;  5FH8 A;  3QZV A;  4J0S A;  4QUT A;  5CRM A;  5KTU A;  2D9E A;  3GG3 A;  3P5O A;  3D1D A;  5EPR A;  4QEU A;  5CUC A;  4TTE A;  5F2P A;  2E7O A;  4YYK A;  2L5E A;  4QBM A;  4YBT A;  3I3J A;  3NXB A;  5LJ1 A;  4OGJ A;  4CUR A;  4IOQ A;  5CUE A;  5E9L A;  5F61 A;  5II2 A;  1EQF A;  3G0J A;  3FKM X;  4LR6 A;  5ACY A;  3Q2E A;  5COI A;  5ENG A;  3QZT A;  4QR5 A;  5L98 A;  4ZQL A;  5AD2 A;  4AKI A;  4HXL A;  3MUL A;  5ENE A;  5AMF A;  5IGN A;  5IGL A;  5HEM A;  5BT3 A;  4HXR A;  3D1B A;  4FLP A;  4NYV A;  5I40 A;  5L8U A;  3LQH A;  5KTX A;  5AME A;  4NR5 A;  4LYI A;  5KHM A;  4YBS A;  3D7C A;  4A9I A;  3UVD A;  5E74 A;  5FE2 A;  2RO1 A;  5HRV A;  4YYJ A;  5HFQ A;  5A81 A;  5H1U A;  5LKT A;  5ENB A;  2YW5 A;  4UYG A;  3U5P A;  5F1H A;  5FE9 A;  5EWH A;  3UW9 A;  5CQ8 A;  4QSW A;  2H60 A;  2YDW A;  4QSQ A;  5A83 A;  4QSU A;  3DAI A;  3S92 A;  5D3H A;  4QB3 A;  4BW3 A;  3ONI A;  4E96 A;  5DX4 A;  3JVM A;  2YEK A;  4TU6 A;  5FB1 A;  5ENF A;  4YAB A;  5HEL A;  3MB3 A;  4KV1 A;  5K29 A;  5FE1 A;  4O77 A;  4QEW A;  5EU1 A;  3MXF A;  2YEM A;  4IR5 A;  5D3J A;  5AD3 A;  5C7N A;  5EWD A;  5HFR A;  5D3N A;  5CRZ A;  4HBW A;  2YEL A;  4NR8 A;  5EA1 A;  5L8T A;  4Q0O A;  5CGP A;  4NS5 A;  4KCX A;  4QSS A;  5D3P A;  4YY4 A;  4YAD A;  3MB4 A;  5FE0 A;  4YY6 A;  3P1D A;  4N4I A;  4CL9 A;  5DYU A;  3SVH A;  5FB0 A;  2GRC A;  4QR4 A;  5F3A A;  1E6I A;  5KO4 A;  5CFW A;  2FSA A;  4MR3 A;  5I89 A;  4MR5 A;  4YYD A;  5CQ5 A;  4XYA A;  5DFD A;  2I7K A;  4Z1Q A;  4LYS A;  4NXJ A;  5CUD A;  4AKH A;  5L96 A;  3U5N A;  4YAT A;  5E9K A;  5ENI A;  5DKH A;  4A9M A;  5EWC A;  5F60 A;  4OGI A;  4Z6I A;  5F63 A;  4MR4 A;  5EPS A;  5E9I A;  4O71 A;  2DVR A;  2G4A A;  4YK0 A;  4XUA A;  4PTB A;  5EQ1 A;  5EVA A;  4NUC A;  4MEO A;  5CY9 A;  5HJC A;  5BT4 A;  4Q0N A;  5HM0 A;  4LZS A;  4A9E A;  4HXN A;  5I7X A;  4O7A A;  4J1P A;  4KV4 A;  5ETD A;  2R10 A;  4CLB A;  5EIS A;  4N3W A;  4UIU A;  5DYA A;  2R0Y A;  5FH6 A;  2RFJ A;  4Y03 A;  5E9M A;  4O7F A;  5I86 A;  3P1F A;  3O33 A;  5EGU A;  4LZ2 A;  4CUU A;  5I1Q A;  5FE8 A;  4N4F A;  5D3L A;  5F62 A;  5EIC A;  5LVR A;  5CUB A;  3O36 A;  2F6J A;  5CUG A;  4O72 A;  3IU5 A;  5L97 A;  4QUU A;  5E7D A;  4HXP A;  4CFL A;  5L99 A;  4BJX A;  1WUG A;  5TB6 A;  5JWM A;  4OUF A;  4QZS A;  5FFY A;  4Z93 A;  5FE5 A;  5DLX A;  2DVS A;  5DW1 A;  4WHW A;  4UIZ A;  3UVX A;  5H1T A;  5G4S A;  4LZR A;  2RS9 B;  5ENJ A;  4NR9 A;  5IGK A;  5G4R A;  3O34 A;  1X0J A;  4NR7 A;  3P1C A;  5A82 A;  4LC2 A;  5A5S A;  2I8N A;  4WHU A;  5E9V A;  5JI8 A;  5D26 A;  5E9Y A;  3TLP A;  5C85 A;  4QYL A;  4BW2 A;  4O7E A;  2YYN A;  1WUM A;  4QEV A;  5FH7 A;  5HQ7 A;  4O75 A;  4PCI A;  4HXM A;  5LJ2 A;  3ERR A;  2DWW A;  4O76 A;  5I7Y A;  5IGM A;  2KTB B;  3UV2 A;  5I80 A;  3MQM A;  4CFK A;  5A5Q A;  4MEN A;  4WIV A;  5CP5 A;  4TZ2 A;  4UIV A;  4UYE A;  4O7B A;  5CQ6 A;  1ZKR A;  5E3D A;  2E3K A;  5D25 A;  3UVW A;  1JSP B;  3HME A;  5DLZ A;  4TQN A;  4IR4 A;  3IU6 A;  2YQD A;  5EK9 A;  4YYI A;  5TCM A;  4BHW A;  3G0L A;  4UYH A;  5FBX A;  4J3I A;  4AKG A;  2DVQ A;  2D82 A;  5IG6 A;  3U5O A;  2RNX A;  4HBX A;  4A9J A;  5HRX A;  5LKU A;  4UYD A;  3LQI A;  4QST A;  5DY7 A;  5H1V A;  3JVK A;  4YH4 A;  5F25 A;  5HEN A;  4XY9 A;  3U5M A;  4UYF B;  3S91 A;  5DKD A;  5EM3 A;  4QNS A;  2NXB A;  4ALG A;  4O78 A;  5IID A;  2MJV B;  2F6N A;  5LKZ A;  4N4G A;  1JM4 B;  5EWW A;  4HXS A;  5F1L A;  2EJN A;  5C89 A;  5CTL A;  5II1 A;  5LKX A;  4A9L A;  5CQ7 A;  5CQ3 A;  4A9O A;  4GPJ A;  5DYC A;  4LYW A;  5CQT A;  5E3G A;  3SVF A;  4N4H A;  5E0R A;  4NYW A;  4A9K A;  4YYH A;  3SVG A;  5LUU A;  5HRW A;  5KU3 A;  3HMH A;  5CQA A;  3UVY A;  5FDZ A;  5HQ5 A;  3O35 A;  5F5Z A;  4QC3 A;  4YBM A;  4IR3 A;  4PCE A;  5CZG A;  5J0D A;  3AQA A;  3JVL A;  5A85 A;  4PY6 A;  4TZ8 A;  3QZS A;  3VKH A;  2R0V A;  4J0R A;  3RCW A;  5D0C A;  3UV4 A;  4TT4 A;  3HMF A;  5FFV A;  4NR6 A;  5D3T A;  4UYF A;  2RNY A;  4TT2 A;  4UIT A;  4A9N A;  5HCL A;  5CU8 A;  4PKL A;  4BW4 A;  4NQN A;  4C67 A;  5I83 A;  4TU4 A;  5IBN A;  5EP7 A;  5D3R A;  4O74 A;  5DYX A;  5ENH A;  3U5L A;  3O37 A;  5CQ4 A;  4CUT A;  4QSR A;  2L85 A;  4CUS A;  3LJW A;  4XUB A;  5LJ0 A;  2DVV A;  5HQ6 A;  2DKW A;  4ZW1 A;  5D7X A;  2R0S A;  5A5O A;  4NUE A;  3LQJ A;  4NR4 A;  4QSX A;  1N72 A;  4HBV A;  2WP2 A;  4PS5 A;  4XY8 A;  4BW1 A;  5FE7 A;  5E73 A;  5FG4 A;  4RVR A;  4Z1S A;  3U5J A;  4QYD A;  1F68 A;  3VKG A;  4MR6 A;  4LDF A;  5FE4 A;  5I29 A;  2L84 A;  4CUP A;  4O7C A;  2OSS A;  4CUQ A;  5EWV A;  4NUD A;  4YAX A;  4Z6H A;  4QSV A;  3U5K A;  4DON A;  3JVJ A;  4QR3 A;  5DBM A;  1ZS5 A;  3P1E A;  2LSP B;  4QSP A;  4YYG A;  4NYX A;  2OO1 A;  3UV5 A;  5I88 A;  5EPB A;  3Q2F A;  5FE6 A;  2WP1 A;  5DFC A;  4YYN A;  4HXO A;  4TT6 A;  5CS8 A;  3ZYU A;  5DW2 A;  5ENC A;  4NQM A;  4A9F A;  5A5P A;  5LVQ A;  5C8G A;  4AI6 A;  4TYL A;  3MUK A;  4QY4 A;  5FE3 A;  5ETB A;  2RNW A;  4UIY A;  5CPE A; 
#chains in the Genus database with same CATH homology
 5DFB A;  4A9H A;  4UIX A;  3K2J A;  4ALH A;  4HBY A;  4X2I A;  5F36 A;  4YC9 A;  2DAT A;  2N9G A;  4LRG A;  2OUO A;  5KTW A;  5D24 A;  2RI7 A;  4HXK A;  4YH3 A;  4IR6 A;  4IOO A;  4O70 A;  4AKN A;  5A7C A;  5C87 A;  5H85 A;  4YYM A;  5A5R A;  4C66 A;  5FFW A;  3AAD A;  4NRC A;  4QC1 A;  5FG5 A;  5BT5 A;  4TS8 A;  5C4Q A;  4NRA A;  2E7N A;  5CUA A;  4UIW A;  5HLS A;  4MEP A;  4NRB A;  5EI4 A;  3DWY A;  4IOR A;  5D3S A;  4F3I A;  4ZC9 A;  3LXJ A;  5A5N A;  5FG6 A;  4MEQ A;  5DKC A;  5EV9 A;  5FH8 A;  3QZV A;  4J0S A;  4QUT A;  5CRM A;  5KTU A;  2D9E A;  3GG3 A;  3P5O A;  5EPR A;  4QEU A;  5CUC A;  4TTE A;  5F2P A;  2E7O A;  4YYK A;  2L5E A;  4QBM A;  4YBT A;  3I3J A;  3NXB A;  5LJ1 A;  4OGJ A;  4CUR A;  4IOQ A;  5CUE A;  5E9L A;  5F61 A;  5II2 A;  1EQF A;  3G0J A;  3FKM X;  4LR6 A;  5ACY A;  3Q2E A;  5COI A;  5ENG A;  3QZT A;  4QR5 A;  5L98 A;  4ZQL A;  5AD2 A;  4HXL A;  3MUL A;  5ENE A;  5AMF A;  5IGN A;  5IGL A;  5HEM A;  5BT3 A;  4HXR A;  4FLP A;  4NYV A;  5I40 A;  5L8U A;  3LQH A;  5KTX A;  5AME A;  4NR5 A;  4LYI A;  5KHM A;  4YBS A;  3D7C A;  4A9I A;  3UVD A;  5E74 A;  5FE2 A;  2RO1 A;  5HRV A;  4YYJ A;  5HFQ A;  5A81 A;  5H1U A;  5LKT A;  5ENB A;  2YW5 A;  4UYG A;  3U5P A;  5F1H A;  5FE9 A;  5EWH A;  3UW9 A;  5CQ8 A;  4QSW A;  2H60 A;  2YDW A;  4QSQ A;  5A83 A;  4QSU A;  3DAI A;  3S92 A;  5D3H A;  4QB3 A;  4BW3 A;  3ONI A;  4E96 A;  5DX4 A;  3JVM A;  2YEK A;  4TU6 A;  5FB1 A;  5ENF A;  4YAB A;  5HEL A;  3MB3 A;  4KV1 A;  5K29 A;  5FE1 A;  4O77 A;  4QEW A;  5EU1 A;  3MXF A;  2YEM A;  4IR5 A;  5D3J A;  5AD3 A;  5C7N A;  5EWD A;  5HFR A;  5D3N A;  5CRZ A;  4HBW A;  2YEL A;  4NR8 A;  5EA1 A;  5L8T A;  4Q0O A;  5CGP A;  4NS5 A;  4KCX A;  4QSS A;  5D3P A;  4YY4 A;  4YAD A;  3MB4 A;  5FE0 A;  4YY6 A;  3P1D A;  4N4I A;  4CL9 A;  5DYU A;  3SVH A;  5FB0 A;  2GRC A;  4QR4 A;  5F3A A;  1E6I A;  5KO4 A;  5CFW A;  2FSA A;  4MR3 A;  5I89 A;  4MR5 A;  4YYD A;  5CQ5 A;  4XYA A;  5DFD A;  2I7K A;  4Z1Q A;  4LYS A;  4NXJ A;  5CUD A;  5L96 A;  3U5N A;  4YAT A;  5E9K A;  5ENI A;  5DKH A;  4A9M A;  5EWC A;  5F60 A;  4OGI A;  4Z6I A;  5F63 A;  4MR4 A;  5EPS A;  5E9I A;  4O71 A;  2DVR A;  2G4A A;  4YK0 A;  4XUA A;  4PTB A;  5EQ1 A;  5EVA A;  4NUC A;  4MEO A;  5CY9 A;  5HJC A;  5BT4 A;  4Q0N A;  5HM0 A;  4LZS A;  4A9E A;  4HXN A;  5I7X A;  4O7A A;  4J1P A;  4KV4 A;  5ETD A;  2R10 A;  4CLB A;  5EIS A;  4N3W A;  4UIU A;  5DYA A;  2R0Y A;  5FH6 A;  2RFJ A;  4Y03 A;  5E9M A;  4O7F A;  5I86 A;  3P1F A;  3O33 A;  5EGU A;  4LZ2 A;  4CUU A;  5I1Q A;  5FE8 A;  4N4F A;  5D3L A;  5F62 A;  5EIC A;  5LVR A;  5CUB A;  3O36 A;  2F6J A;  5CUG A;  4O72 A;  3IU5 A;  5L97 A;  4QUU A;  5E7D A;  4HXP A;  4CFL A;  5L99 A;  4BJX A;  1WUG A;  5TB6 A;  5JWM A;  4OUF A;  4QZS A;  5FFY A;  4Z93 A;  5FE5 A;  5DLX A;  2DVS A;  5DW1 A;  4WHW A;  4UIZ A;  3UVX A;  5H1T A;  5G4S A;  4LZR A;  2RS9 B;  5ENJ A;  4NR9 A;  5IGK A;  5G4R A;  3O34 A;  1X0J A;  4NR7 A;  3P1C A;  5A82 A;  4LC2 A;  5A5S A;  2I8N A;  4WHU A;  5E9V A;  5JI8 A;  5D26 A;  5E9Y A;  3TLP A;  5C85 A;  4QYL A;  4BW2 A;  4O7E A;  2YYN A;  1WUM A;  4QEV A;  5FH7 A;  5HQ7 A;  4O75 A;  4PCI A;  4HXM A;  5LJ2 A;  2DWW A;  4O76 A;  5I7Y A;  5IGM A;  2KTB B;  3UV2 A;  5I80 A;  3MQM A;  4CFK A;  5A5Q A;  4MEN A;  4WIV A;  5CP5 A;  4TZ2 A;  4UIV A;  4UYE A;  4O7B A;  5CQ6 A;  5E3D A;  2E3K A;  5D25 A;  3UVW A;  1JSP B;  3HME A;  5DLZ A;  4TQN A;  4IR4 A;  3IU6 A;  2YQD A;  5EK9 A;  4YYI A;  5TCM A;  4BHW A;  3G0L A;  4UYH A;  5FBX A;  4J3I A;  2DVQ A;  2D82 A;  5IG6 A;  3U5O A;  2RNX A;  4HBX A;  4A9J A;  5HRX A;  5LKU A;  4UYD A;  3LQI A;  4QST A;  5DY7 A;  5H1V A;  3JVK A;  4YH4 A;  5F25 A;  5HEN A;  4XY9 A;  3U5M A;  4UYF B;  3S91 A;  5DKD A;  5EM3 A;  4QNS A;  2NXB A;  4ALG A;  4O78 A;  5IID A;  2MJV B;  2F6N A;  5LKZ A;  4N4G A;  1JM4 B;  5EWW A;  4HXS A;  5F1L A;  5C89 A;  5CTL A;  5II1 A;  5LKX A;  4A9L A;  5CQ7 A;  5CQ3 A;  4A9O A;  4GPJ A;  5DYC A;  4LYW A;  5CQT A;  5E3G A;  3SVF A;  4N4H A;  5E0R A;  4NYW A;  4A9K A;  4YYH A;  3SVG A;  5LUU A;  5HRW A;  5KU3 A;  3HMH A;  5CQA A;  3UVY A;  5FDZ A;  5HQ5 A;  3O35 A;  5F5Z A;  4QC3 A;  4YBM A;  4IR3 A;  4PCE A;  5CZG A;  5J0D A;  3AQA A;  3JVL A;  5A85 A;  4PY6 A;  4TZ8 A;  3QZS A;  2R0V A;  4J0R A;  3RCW A;  5D0C A;  3UV4 A;  4TT4 A;  3HMF A;  5FFV A;  4NR6 A;  5D3T A;  4UYF A;  2RNY A;  4TT2 A;  4UIT A;  4A9N A;  5HCL A;  5CU8 A;  4PKL A;  4BW4 A;  4NQN A;  4C67 A;  5I83 A;  4TU4 A;  5IBN A;  5EP7 A;  5D3R A;  4O74 A;  5DYX A;  5ENH A;  3U5L A;  3O37 A;  5CQ4 A;  4CUT A;  4QSR A;  2L85 A;  4CUS A;  3LJW A;  4XUB A;  5LJ0 A;  2DVV A;  5HQ6 A;  2DKW A;  4ZW1 A;  5D7X A;  2R0S A;  5A5O A;  4NUE A;  3LQJ A;  4NR4 A;  4QSX A;  1N72 A;  4HBV A;  2WP2 A;  4PS5 A;  4XY8 A;  4BW1 A;  5FE7 A;  5E73 A;  5FG4 A;  4RVR A;  4Z1S A;  3U5J A;  4QYD A;  1F68 A;  4MR6 A;  4LDF A;  5FE4 A;  5I29 A;  2L84 A;  4CUP A;  4O7C A;  2OSS A;  4CUQ A;  5EWV A;  4NUD A;  4YAX A;  4Z6H A;  4QSV A;  3U5K A;  4DON A;  3JVJ A;  4QR3 A;  5DBM A;  1ZS5 A;  3P1E A;  2LSP B;  4QSP A;  4YYG A;  4NYX A;  2OO1 A;  3UV5 A;  5I88 A;  5EPB A;  3Q2F A;  5FE6 A;  2WP1 A;  5DFC A;  4YYN A;  4HXO A;  4TT6 A;  5CS8 A;  3ZYU A;  5DW2 A;  5ENC A;  4NQM A;  4A9F A;  5A5P A;  5LVQ A;  5C8G A;  4TYL A;  3MUK A;  4QY4 A;  5FE3 A;  5ETB A;  2RNW A;  4UIY A;  5CPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...