5KTXA

Crebbp bromodomain in complex with cpd59 ((s)-1-(3-((2-fluoro-4-(1-methyl-1h-pyrazol-4-yl)phenyl)amino)-1-(tetrahydrofuran-3-yl)-6,7-dihydro-1h-pyrazolo[4,3-c]pyridin-5(4h)-yl)ethanone)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
114
structure length
114
Chain Sequence
AAFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CREB-binding protein
publication title Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 114
sequence length 114
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ktxA00
5KTUA 1EQFA 5EWHA 2YEKA 3IU6A 3U5NA 4QSRA 5A5PA 5F1LA 4NQMA 4QZSA 3HMHA 2KTBB 5EISA 5D3SA 4UIVA 3LQIA 2DVVA 4BJXA 5LJ1A 4YBSA 5DYCA 5CY9A 5DFDA 5CUGA 3ZYUA 5E7DA 4LR6A 4UIYA 4OGJA 4Z6HA 2L84A 5A5OA 3O34A 4QC3A 5IGMA 4CURA 4CFKA 3HMFA 3U5KA 4QSUA 2DVSA 2DVQA 4XY8A 5A5NA 5I89A 4CUUA 5LJ0A 4A9LA 5FB0A 5FB1A 3MULA 4A9MA 5EWDA 4HXMA 5DKHA 3P1CA 3LQJA 5E3GA 5CQ8A 3GG3A 5K29A 4HXRA 2E7OA 4PCEA 2YDWA 5E74A 4MEOA 4NR8A 4N4IA 4UITA 5DY7A 3O36A 4OUFA 4QEVA 5I7XA 4A9IA 5CQ3A 4YYHA 2D82A 4HBVA 5COIA 5FE9A 5FFVA 4BW4A 4IORA 5CUAA 2G4AA 5CRMA 5FH7A 5I86A 3P1DA 4PKLA 4NRCA 5EVAA 2E3KA 5II2A 3AADA 3JVMA 4TT2A 5L8UA 2R0SA 4O77A 2I7KA 4UIZA 3MB3A 4N4FA 4HXOA 5CFWA 3NXBA 3DAIA 3LQHA 4UYDA 5FE8A 4NUEA 4LYWA 4KV4A 4TT4A 4GPJA 4CUQA 3P1EA 3U5LA 5LUUA 4CUSA 4QSWA 5D0CA 5CQTA 5EM3A 1X0JA 3Q2EA 3UVYA 5TB6A 5G4SA 4C67A 5J0DA 4MENA 2YELA 2YW5A 2RS9B 5HRVA 4O7FA 2OSSA 4LDFA 5EICA 4A9NA 4LC2A 2L85A 4DONA 2F6NA 4RVRA 5HQ6A 2N9GA 4QYLA 5AD2A 5EK9A 3QZTA 3P5OA 3JVLA 5LVQA 4HXSA 2DVRA 3MXFA 2DKWA 2RFJA 5E9LA 5H85A 4QBMA 5A82A 4BHWA 3DWYA 4LYSA 5ENCA 4QYDA 5L98A 5A7CA 4KV1A 3UV5A 2YYNA 2R10A 5FE4A 5DLXA 5D3RA 4YH4A 4YYKA 4QUTA 4QB3A 5ENHA 4O76A 3UW9A 4MR3A 2WP2A 5C8GA 5KHMA 4NR5A 4NRAA 5D7XA 3O33A 4Z93A 4CFLA 2RNYA 5DKCA 4YH3A 5CTLA 4MEQA 3LJWA 2NXBA 5ENIA 5E9VA 5EV9A 5EWWA 5CS8A 4N4HA 2YQDA 5D3PA 5F5ZA 4TYLA 5FBXA 4YYJA 5CUBA 4YY6A 2RI7A 5F60A 2OUOA 3JVJA 5CUDA 5I88A 5FE0A 5E9MA 5HFRA 3U5OA 5CGPA 5DFBA 4Z1SA 5LKUA 5HRWA 5F62A 4IOQA 4YADA 5D26A 4HBWA 4A9OA 4WHWA 1ZS5A 2GRCA 4PCIA 4FLPA 5CPEA 3MQMA 2MJVB 5DYXA 5II1A 4O74A 4ZC9A 5DFCA 5FE3A 4BW3A 5CZGA 4YYIA 5EWCA 4ALHA 3RCWA 5JI8A 4N4GA 3LXJA 5FE6A 4QSXA 5DKDA 5FG5A 4KCXA 5A83A 5F61A 3ONIA 4A9KA 5AMFA 5HQ7A 4HBYA 4YYGA 5L96A 5LKTA 5DBMA 4ZW1A 5EI4A 3U5PA 4WHUA 5L97A 3QZSA 5IG6A 5JWMA 4WIVA 3Q2FA 5HFQA 4YYMA 4ZQLA 5DYUA 4Z6IA 5E9IA 4A9JA 5DW1A 5I29A 4Z1QA 5LJ2A 5EA1A 4HXNA 3UVWA 4N3WA 5KU3A 2R0YA 4YYNA 2RNXA 5AD3A 4HBXA 5HENA 4NR7A 4PS5A 3S92A 4CUPA 4Y03A 5HCLA 4QUUA 5CQ6A 3O37A 4LYIA 5FG6A 5E9KA 4QY4A 5CRZA 5CQ7A 4QSSA 4C66A 4J1PA 4BW2A 4YC9A 4NR4A 4HXLA 3UV4A 4UIUA 4PY6A 2H60A 4QEUA 3MUKA 4YBMA 5HEMA 5FG4A 5E73A 4QSVA 4CL9A 3SVFA 4QR3A 5E0RA 5FE2A 5ENJA 4QSQA 5BT5A 5HJCA 4TTEA 5IGLA 4NYVA 3TLPA 4MR5A 5BT4A 5FE5A 3JVKA 4Q0OA 5TCMA 5KTWA 4E96A 5EWVA 5IGNA 5CQAA 3UVXA 3FKMX 4O7BA 5D3NA 2I8NA 1E6IA 4NXJA 4O71A 5AMEA 4CUTA 4UYFA 1WUMA 4TZ2A 5D3HA 5EPBA 4QR5A 2R0VA 3U5JA 3G0LA 4NRBA 5IGKA 5G4RA 5H1TA 5HM0A 5IIDA 5HELA 5ACYA 4YABA 5D3LA 5L99A 4TT6A 4A9HA 5I80A 5CQ5A 4TU6A 2YEMA 5DW2A 5EP7A 5C85A 4XYAA 5CUEA 4YAXA 5BT3A 5CP5A 4QSTA 4NQNA 5I83A 5DX4A 4NR6A 4NUCA 4O7AA 5LKZA 3HMEA 5EPRA 4YK0A 5L8TA 2F6JA 4IR5A 2D9EA 3MB4A 4MEPA 5EU1A 4J0SA 4QSPA 5ENBA 5CUCA 4XUBA 5DLZA 5D24A 4O75A 4NYWA 4LZ2A 4QR4A 4UIWA 5KTXA 5E3DA 3SVHA 5D3JA 4NR9A 5DYAA 4IR6A 5F25A 1JSPB 5F1HA 4XUAA 2DATA 4YBTA 4LRGA 2RNWA 5F3AA 5F63A 5H1VA 4HXKA 5F2PA 4Q0NA 5FFWA 4HXPA 5FE1A 4A9FA 1WUGA 5IBNA 5D3TA 4QEWA 3I3JA 3G0JA 4YYDA 3D7CA 5LVRA 5A81A 4XY9A 4UYEA 1JM4B 4OGIA 4X2IA 4UIXA 5EQ1A 4O7CA 4QC1A 4ALGA 5C89A 4IR3A 5CU8A 4LZRA 4MR4A 5ENGA 5A5SA 4UYFB 5C87A 2RO1A 5FDZA 4A9EA 5I7YA 4TS8A 5ETBA 5FH6A 3S91A 4YATA 4CLBA 4J3IA 5ENEA 4TZ8A 4UYHA 5I40A 3O35A 4J0RA 5LKXA 3UVDA 3AQAA 5EGUA 4UYGA 2L5EA 2FSAA 2WP1A 5ETDA 5HRXA 4O7EA 4NS5A 5A5RA 4MR6A 5F36A 4BW1A 3IU5A 5C7NA 5HLSA 4TU4A 2OO1A 3SVGA 3U5MA 2LSPB 1N72A 4AKNA 5ENFA 2DWWA 4O70A 4O78A 1F68A 5C4QA 4IOOA 4TQNA 4NUDA 4O72A 5HQ5A 4PTBA 4LZSA 4NYXA 5E9YA 3P1FA 5CQ4A 5KO4A 5I1QA 5H1UA 4QNSA 5EPSA 4YY4A 5A5QA 2E7NA 4F3IA 5FE7A 5FH8A 3QZVA 3UV2A 4IR4A 5FFYA 3K2JA 5D25A 5A85A
chains in the Genus database with same CATH superfamily
5KTUA 1EQFA 5EWHA 2YEKA 3IU6A 3U5NA 4QSRA 5A5PA 5F1LA 4NQMA 4QZSA 3HMHA 2KTBB 5EISA 5D3SA 4UIVA 3LQIA 2DVVA 4BJXA 5LJ1A 4YBSA 5DYCA 5CY9A 5DFDA 5CUGA 3ZYUA 5E7DA 4LR6A 4UIYA 4OGJA 4Z6HA 2L84A 5A5OA 3O34A 4QC3A 5IGMA 4CURA 4CFKA 3HMFA 3U5KA 4QSUA 2DVSA 2DVQA 4XY8A 5A5NA 5I89A 4CUUA 5LJ0A 4A9LA 5FB0A 5FB1A 3MULA 4A9MA 5EWDA 4HXMA 5DKHA 3P1CA 3LQJA 5E3GA 5CQ8A 3GG3A 5K29A 4HXRA 2E7OA 4PCEA 2YDWA 5E74A 4MEOA 4NR8A 4N4IA 4UITA 5DY7A 3O36A 4OUFA 4AI6A 4QEVA 5I7XA 4A9IA 5CQ3A 4YYHA 2D82A 4HBVA 5COIA 5FE9A 5FFVA 4BW4A 2EJNA 4IORA 5CUAA 2G4AA 5CRMA 5FH7A 5I86A 3P1DA 4PKLA 4NRCA 5EVAA 2E3KA 5II2A 3AADA 3JVMA 4TT2A 5L8UA 2R0SA 4O77A 2I7KA 4UIZA 3MB3A 4N4FA 4HXOA 5CFWA 3NXBA 3DAIA 3LQHA 4UYDA 5FE8A 4NUEA 4LYWA 3D1BA 4KV4A 4TT4A 4GPJA 4CUQA 3P1EA 3U5LA 5LUUA 4CUSA 4QSWA 5D0CA 5CQTA 5EM3A 1X0JA 3Q2EA 4AKGA 3UVYA 5TB6A 5G4SA 4C67A 5J0DA 4MENA 2YELA 2YW5A 2RS9B 5HRVA 4O7FA 2OSSA 4LDFA 5EICA 4A9NA 4LC2A 2L85A 4DONA 2F6NA 4RVRA 5HQ6A 2N9GA 4QYLA 5AD2A 5EK9A 3QZTA 3P5OA 3JVLA 5LVQA 4HXSA 2DVRA 3MXFA 2DKWA 2RFJA 5E9LA 5H85A 4QBMA 5A82A 4BHWA 3DWYA 4LYSA 5ENCA 4QYDA 5L98A 5A7CA 4KV1A 3UV5A 2YYNA 2R10A 5FE4A 5DLXA 5D3RA 4YH4A 4YYKA 4QUTA 4QB3A 5ENHA 4O76A 3UW9A 4AKHA 4MR3A 2WP2A 5C8GA 5KHMA 4NR5A 4NRAA 5D7XA 3O33A 4Z93A 4CFLA 2RNYA 5DKCA 4YH3A 5CTLA 4MEQA 3LJWA 2NXBA 5ENIA 5E9VA 5EV9A 5EWWA 5CS8A 4N4HA 2YQDA 5D3PA 5F5ZA 1ZKRA 4TYLA 5FBXA 4YYJA 5CUBA 4YY6A 2RI7A 5F60A 2OUOA 1PUOA 3JVJA 5CUDA 5I88A 5FE0A 5E9MA 5HFRA 3U5OA 5CGPA 5DFBA 4Z1SA 5LKUA 5HRWA 5F62A 4IOQA 4YADA 5D26A 4AKIA 4HBWA 4A9OA 4WHWA 1ZS5A 2GRCA 4PCIA 4FLPA 5CPEA 3MQMA 2MJVB 5DYXA 5II1A 4O74A 4ZC9A 5DFCA 5FE3A 4BW3A 5CZGA 4YYIA 5EWCA 4ALHA 3RCWA 5JI8A 4N4GA 3LXJA 5FE6A 4QSXA 5DKDA 5FG5A 4KCXA 5A83A 5F61A 3ONIA 4A9KA 5AMFA 5HQ7A 4HBYA 4YYGA 5L96A 5LKTA 5DBMA 4ZW1A 5EI4A 3U5PA 4WHUA 5L97A 3QZSA 5IG6A 5JWMA 4WIVA 3Q2FA 5HFQA 4YYMA 4ZQLA 5DYUA 4Z6IA 5E9IA 4A9JA 5DW1A 5I29A 4Z1QA 5LJ2A 5EA1A 4HXNA 3UVWA 4N3WA 5KU3A 2R0YA 4YYNA 2RNXA 5AD3A 4HBXA 5HENA 4NR7A 4PS5A 3S92A 4CUPA 4Y03A 5HCLA 4QUUA 5CQ6A 3O37A 4LYIA 5FG6A 5E9KA 4QY4A 5CRZA 5CQ7A 4QSSA 4C66A 4J1PA 4BW2A 3VKHA 4YC9A 4NR4A 4HXLA 3UV4A 4UIUA 4PY6A 2H60A 4QEUA 3MUKA 4YBMA 5HEMA 5FG4A 5E73A 4QSVA 4CL9A 3SVFA 4QR3A 5E0RA 5FE2A 5ENJA 4QSQA 5BT5A 5HJCA 4TTEA 5IGLA 4NYVA 3TLPA 4MR5A 5BT4A 5FE5A 3JVKA 4Q0OA 5TCMA 5KTWA 4E96A 5EWVA 5IGNA 5CQAA 3UVXA 3FKMX 4O7BA 5D3NA 2I8NA 1E6IA 4NXJA 4O71A 5AMEA 4CUTA 4UYFA 1WUMA 4TZ2A 5D3HA 5EPBA 4QR5A 2R0VA 3U5JA 3G0LA 3VKGA 4NRBA 5IGKA 5G4RA 5H1TA 5HM0A 5IIDA 5HELA 5ACYA 4YABA 5D3LA 5L99A 4TT6A 4A9HA 5I80A 5CQ5A 4TU6A 2YEMA 5DW2A 5EP7A 5C85A 4XYAA 5CUEA 4YAXA 5BT3A 5CP5A 4QSTA 4NQNA 5I83A 5DX4A 4NR6A 4NUCA 4O7AA 5LKZA 3HMEA 5EPRA 4YK0A 5L8TA 2F6JA 4IR5A 2D9EA 3MB4A 4MEPA 5EU1A 4J0SA 4QSPA 5ENBA 5CUCA 4XUBA 5DLZA 5D24A 4O75A 4NYWA 4LZ2A 4QR4A 4UIWA 5KTXA 5E3DA 3SVHA 5D3JA 4NR9A 5DYAA 4IR6A 5F25A 1JSPB 5F1HA 4XUAA 2DATA 4YBTA 4LRGA 2RNWA 5F3AA 5F63A 5H1VA 4HXKA 5F2PA 4Q0NA 5FFWA 4HXPA 5FE1A 4A9FA 1WUGA 5IBNA 5D3TA 4QEWA 3I3JA 3G0JA 4YYDA 3D7CA 5LVRA 5A81A 4XY9A 4UYEA 1JM4B 4OGIA 4X2IA 4UIXA 5EQ1A 4O7CA 4QC1A 4ALGA 5C89A 4IR3A 5CU8A 4LZRA 4MR4A 5ENGA 5A5SA 4UYFB 5C87A 2RO1A 5FDZA 4A9EA 5I7YA 4TS8A 5ETBA 5FH6A 3S91A 4YATA 4CLBA 4J3IA 5ENEA 4TZ8A 4UYHA 3ERRA 5I40A 3O35A 4J0RA 5LKXA 3UVDA 3AQAA 5EGUA 4UYGA 2L5EA 2FSAA 2WP1A 5ETDA 5HRXA 4O7EA 4NS5A 5A5RA 4MR6A 5F36A 4BW1A 3IU5A 5C7NA 5HLSA 4TU4A 2OO1A 3SVGA 3U5MA 2LSPB 1N72A 4AKNA 5ENFA 2DWWA 4O70A 4O78A 1F68A 5C4QA 4IOOA 4TQNA 4NUDA 4O72A 5HQ5A 4PTBA 4LZSA 4NYXA 5E9YA 3P1FA 5CQ4A 5KO4A 5I1QA 5H1UA 4QNSA 5EPSA 4YY4A 5A5QA 2E7NA 4F3IA 5FE7A 5FH8A 3QZVA 3UV2A 4IR4A 3D1DA 5FFYA 3K2JA 5D25A 5A85A
chains in the Genus database with same CATH topology
5KTUA 1EQFA 5EWHA 2YEKA 3IU6A 3U5NA 4QSRA 5A5PA 5F1LA 4NQMA 4QZSA 3HMHA 2KTBB 5EISA 5D3SA 4UIVA 3LQIA 2DVVA 4BJXA 5LJ1A 4YBSA 5DYCA 5CY9A 5DFDA 5CUGA 3ZYUA 5E7DA 4LR6A 4UIYA 4OGJA 4Z6HA 2L84A 5A5OA 3O34A 4QC3A 5IGMA 4CURA 4CFKA 3HMFA 3U5KA 4QSUA 2DVSA 2DVQA 4XY8A 5A5NA 5I89A 4CUUA 5LJ0A 4A9LA 5FB0A 5FB1A 3MULA 4A9MA 5EWDA 4HXMA 5DKHA 3P1CA 3LQJA 5E3GA 5CQ8A 3GG3A 5K29A 4HXRA 2E7OA 4PCEA 2YDWA 5E74A 4MEOA 4NR8A 4N4IA 4UITA 5DY7A 3O36A 4OUFA 4QEVA 5I7XA 4A9IA 5CQ3A 4YYHA 2D82A 4HBVA 5COIA 5FE9A 5FFVA 4BW4A 4IORA 5CUAA 2G4AA 5CRMA 5FH7A 5I86A 3P1DA 4PKLA 4NRCA 5EVAA 2E3KA 5II2A 3AADA 3JVMA 4TT2A 5L8UA 2R0SA 4O77A 2I7KA 4UIZA 3MB3A 4N4FA 4HXOA 5CFWA 3NXBA 3DAIA 3LQHA 4UYDA 5FE8A 4NUEA 4LYWA 4KV4A 4TT4A 4GPJA 4CUQA 3P1EA 3U5LA 5LUUA 4CUSA 4QSWA 5D0CA 5CQTA 5EM3A 1X0JA 3Q2EA 3UVYA 5TB6A 5G4SA 4C67A 5J0DA 4MENA 2YELA 2YW5A 2RS9B 5HRVA 4O7FA 2OSSA 4LDFA 5EICA 4A9NA 4LC2A 2L85A 4DONA 2F6NA 4RVRA 5HQ6A 2N9GA 4QYLA 5AD2A 5EK9A 3QZTA 3P5OA 3JVLA 5LVQA 4HXSA 2DVRA 3MXFA 2DKWA 2RFJA 5E9LA 5H85A 4QBMA 5A82A 4BHWA 3DWYA 4LYSA 5ENCA 4QYDA 5L98A 5A7CA 4KV1A 3UV5A 2YYNA 2R10A 5FE4A 5DLXA 5D3RA 4YH4A 4YYKA 4QUTA 4QB3A 5ENHA 4O76A 3UW9A 4MR3A 2WP2A 5C8GA 5KHMA 4NR5A 4NRAA 5D7XA 3O33A 4Z93A 4CFLA 2RNYA 5DKCA 4YH3A 5CTLA 4MEQA 3LJWA 2NXBA 5ENIA 5E9VA 5EV9A 5EWWA 5CS8A 4N4HA 2YQDA 5D3PA 5F5ZA 4TYLA 5FBXA 4YYJA 5CUBA 4YY6A 2RI7A 5F60A 2OUOA 3JVJA 5CUDA 5I88A 5FE0A 5E9MA 5HFRA 3U5OA 5CGPA 5DFBA 4Z1SA 5LKUA 5HRWA 5F62A 4IOQA 4YADA 5D26A 4HBWA 4A9OA 4WHWA 1ZS5A 2GRCA 4PCIA 4FLPA 5CPEA 3MQMA 2MJVB 5DYXA 5II1A 4O74A 4ZC9A 5DFCA 5FE3A 4BW3A 5CZGA 4YYIA 5EWCA 4ALHA 3RCWA 5JI8A 4N4GA 3LXJA 5FE6A 4QSXA 5DKDA 5FG5A 4KCXA 5A83A 5F61A 3ONIA 4A9KA 5AMFA 5HQ7A 4HBYA 4YYGA 5L96A 5LKTA 5DBMA 4ZW1A 5EI4A 3U5PA 4WHUA 5L97A 3QZSA 5IG6A 5JWMA 4WIVA 3Q2FA 5HFQA 4YYMA 4ZQLA 5DYUA 4Z6IA 5E9IA 4A9JA 5DW1A 5I29A 4Z1QA 5LJ2A 5EA1A 4HXNA 3UVWA 4N3WA 5KU3A 2R0YA 4YYNA 2RNXA 5AD3A 4HBXA 5HENA 4NR7A 4PS5A 3S92A 4CUPA 4Y03A 5HCLA 4QUUA 5CQ6A 3O37A 4LYIA 5FG6A 5E9KA 4QY4A 5CRZA 5CQ7A 4QSSA 4C66A 4J1PA 4BW2A 4YC9A 4NR4A 4HXLA 3UV4A 4UIUA 4PY6A 2H60A 4QEUA 3MUKA 4YBMA 5HEMA 5FG4A 5E73A 4QSVA 4CL9A 3SVFA 4QR3A 5E0RA 5FE2A 5ENJA 4QSQA 5BT5A 5HJCA 4TTEA 5IGLA 4NYVA 3TLPA 4MR5A 5BT4A 5FE5A 3JVKA 4Q0OA 5TCMA 5KTWA 4E96A 5EWVA 5IGNA 5CQAA 3UVXA 3FKMX 4O7BA 5D3NA 2I8NA 1E6IA 4NXJA 4O71A 5AMEA 4CUTA 4UYFA 1WUMA 4TZ2A 5D3HA 5EPBA 4QR5A 2R0VA 3U5JA 3G0LA 4NRBA 5IGKA 5G4RA 5H1TA 5HM0A 5IIDA 5HELA 5ACYA 4YABA 5D3LA 5L99A 4TT6A 4A9HA 5I80A 5CQ5A 4TU6A 2YEMA 5DW2A 5EP7A 5C85A 4XYAA 5CUEA 4YAXA 5BT3A 5CP5A 4QSTA 4NQNA 5I83A 5DX4A 4NR6A 4NUCA 4O7AA 5LKZA 3HMEA 5EPRA 4YK0A 5L8TA 2F6JA 4IR5A 2D9EA 3MB4A 4MEPA 5EU1A 4J0SA 4QSPA 5ENBA 5CUCA 4XUBA 5DLZA 5D24A 4O75A 4NYWA 4LZ2A 4QR4A 4UIWA 5KTXA 5E3DA 3SVHA 5D3JA 4NR9A 5DYAA 4IR6A 5F25A 1JSPB 5F1HA 4XUAA 2DATA 4YBTA 4LRGA 2RNWA 5F3AA 5F63A 5H1VA 4HXKA 5F2PA 4Q0NA 5FFWA 4HXPA 5FE1A 4A9FA 1WUGA 5IBNA 5D3TA 4QEWA 3I3JA 3G0JA 4YYDA 3D7CA 5LVRA 5A81A 4XY9A 4UYEA 1JM4B 4OGIA 4X2IA 4UIXA 5EQ1A 4O7CA 4QC1A 4ALGA 5C89A 4IR3A 5CU8A 4LZRA 4MR4A 5ENGA 5A5SA 4UYFB 5C87A 2RO1A 5FDZA 4A9EA 5I7YA 4TS8A 5ETBA 5FH6A 3S91A 4YATA 4CLBA 4J3IA 5ENEA 4TZ8A 4UYHA 5I40A 3O35A 4J0RA 5LKXA 3UVDA 3AQAA 5EGUA 4UYGA 2L5EA 2FSAA 2WP1A 5ETDA 5HRXA 4O7EA 4NS5A 5A5RA 4MR6A 5F36A 4BW1A 3IU5A 5C7NA 5HLSA 4TU4A 2OO1A 3SVGA 3U5MA 2LSPB 1N72A 4AKNA 5ENFA 2DWWA 4O70A 4O78A 1F68A 5C4QA 4IOOA 4TQNA 4NUDA 4O72A 5HQ5A 4PTBA 4LZSA 4NYXA 5E9YA 3P1FA 5CQ4A 5KO4A 5I1QA 5H1UA 4QNSA 5EPSA 4YY4A 5A5QA 2E7NA 4F3IA 5FE7A 5FH8A 3QZVA 3UV2A 4IR4A 5FFYA 3K2JA 5D25A 5A85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTU A;  1EQF A;  5EWH A;  2YEK A;  3IU6 A;  3U5N A;  4QSR A;  5A5P A;  5F1L A;  4NQM A;  4QZS A;  3HMH A;  2KTB B;  5EIS A;  5D3S A;  4UIV A;  3LQI A;  2DVV A;  4BJX A;  5LJ1 A;  4YBS A;  5DYC A;  5CY9 A;  5DFD A;  5CUG A;  3ZYU A;  5E7D A;  4LR6 A;  4UIY A;  4OGJ A;  4Z6H A;  2L84 A;  5A5O A;  3O34 A;  4QC3 A;  5IGM A;  4CUR A;  4CFK A;  3HMF A;  3U5K A;  4QSU A;  2DVS A;  2DVQ A;  4XY8 A;  5A5N A;  5I89 A;  4CUU A;  5LJ0 A;  4A9L A;  5FB0 A;  5FB1 A;  3MUL A;  4A9M A;  5EWD A;  4HXM A;  5DKH A;  3P1C A;  3LQJ A;  5E3G A;  5CQ8 A;  3GG3 A;  5K29 A;  4HXR A;  2E7O A;  4PCE A;  2YDW A;  5E74 A;  4MEO A;  4NR8 A;  4N4I A;  4UIT A;  5DY7 A;  3O36 A;  4OUF A;  4QEV A;  5I7X A;  4A9I A;  5CQ3 A;  4YYH A;  2D82 A;  4HBV A;  5COI A;  5FE9 A;  5FFV A;  4BW4 A;  4IOR A;  5CUA A;  2G4A A;  5CRM A;  5FH7 A;  5I86 A;  3P1D A;  4PKL A;  4NRC A;  5EVA A;  2E3K A;  5II2 A;  3AAD A;  3JVM A;  4TT2 A;  5L8U A;  2R0S A;  4O77 A;  2I7K A;  4UIZ A;  3MB3 A;  4N4F A;  4HXO A;  5CFW A;  3NXB A;  3DAI A;  3LQH A;  4UYD A;  5FE8 A;  4NUE A;  4LYW A;  4KV4 A;  4TT4 A;  4GPJ A;  4CUQ A;  3P1E A;  3U5L A;  5LUU A;  4CUS A;  4QSW A;  5D0C A;  5CQT A;  5EM3 A;  1X0J A;  3Q2E A;  3UVY A;  5TB6 A;  5G4S A;  4C67 A;  5J0D A;  4MEN A;  2YEL A;  2YW5 A;  2RS9 B;  5HRV A;  4O7F A;  2OSS A;  4LDF A;  5EIC A;  4A9N A;  4LC2 A;  2L85 A;  4DON A;  2F6N A;  4RVR A;  5HQ6 A;  2N9G A;  4QYL A;  5AD2 A;  5EK9 A;  3QZT A;  3P5O A;  3JVL A;  5LVQ A;  4HXS A;  2DVR A;  3MXF A;  2DKW A;  2RFJ A;  5E9L A;  5H85 A;  4QBM A;  5A82 A;  4BHW A;  3DWY A;  4LYS A;  5ENC A;  4QYD A;  5L98 A;  5A7C A;  4KV1 A;  3UV5 A;  2YYN A;  2R10 A;  5FE4 A;  5DLX A;  5D3R A;  4YH4 A;  4YYK A;  4QUT A;  4QB3 A;  5ENH A;  4O76 A;  3UW9 A;  4MR3 A;  2WP2 A;  5C8G A;  5KHM A;  4NR5 A;  4NRA A;  5D7X A;  3O33 A;  4Z93 A;  4CFL A;  2RNY A;  5DKC A;  4YH3 A;  5CTL A;  4MEQ A;  3LJW A;  2NXB A;  5ENI A;  5E9V A;  5EV9 A;  5EWW A;  5CS8 A;  4N4H A;  2YQD A;  5D3P A;  5F5Z A;  4TYL A;  5FBX A;  4YYJ A;  5CUB A;  4YY6 A;  2RI7 A;  5F60 A;  2OUO A;  3JVJ A;  5CUD A;  5I88 A;  5FE0 A;  5E9M A;  5HFR A;  3U5O A;  5CGP A;  5DFB A;  4Z1S A;  5LKU A;  5HRW A;  5F62 A;  4IOQ A;  4YAD A;  5D26 A;  4HBW A;  4A9O A;  4WHW A;  1ZS5 A;  2GRC A;  4PCI A;  4FLP A;  5CPE A;  3MQM A;  2MJV B;  5DYX A;  5II1 A;  4O74 A;  4ZC9 A;  5DFC A;  5FE3 A;  4BW3 A;  5CZG A;  4YYI A;  5EWC A;  4ALH A;  3RCW A;  5JI8 A;  4N4G A;  3LXJ A;  5FE6 A;  4QSX A;  5DKD A;  5FG5 A;  4KCX A;  5A83 A;  5F61 A;  3ONI A;  4A9K A;  5AMF A;  5HQ7 A;  4HBY A;  4YYG A;  5L96 A;  5LKT A;  5DBM A;  4ZW1 A;  5EI4 A;  3U5P A;  4WHU A;  5L97 A;  3QZS A;  5IG6 A;  5JWM A;  4WIV A;  3Q2F A;  5HFQ A;  4YYM A;  4ZQL A;  5DYU A;  4Z6I A;  5E9I A;  4A9J A;  5DW1 A;  5I29 A;  4Z1Q A;  5LJ2 A;  5EA1 A;  4HXN A;  3UVW A;  4N3W A;  5KU3 A;  2R0Y A;  4YYN A;  2RNX A;  5AD3 A;  4HBX A;  5HEN A;  4NR7 A;  4PS5 A;  3S92 A;  4CUP A;  4Y03 A;  5HCL A;  4QUU A;  5CQ6 A;  3O37 A;  4LYI A;  5FG6 A;  5E9K A;  4QY4 A;  5CRZ A;  5CQ7 A;  4QSS A;  4C66 A;  4J1P A;  4BW2 A;  4YC9 A;  4NR4 A;  4HXL A;  3UV4 A;  4UIU A;  4PY6 A;  2H60 A;  4QEU A;  3MUK A;  4YBM A;  5HEM A;  5FG4 A;  5E73 A;  4QSV A;  4CL9 A;  3SVF A;  4QR3 A;  5E0R A;  5FE2 A;  5ENJ A;  4QSQ A;  5BT5 A;  5HJC A;  4TTE A;  5IGL A;  4NYV A;  3TLP A;  4MR5 A;  5BT4 A;  5FE5 A;  3JVK A;  4Q0O A;  5TCM A;  5KTW A;  4E96 A;  5EWV A;  5IGN A;  5CQA A;  3UVX A;  3FKM X;  4O7B A;  5D3N A;  2I8N A;  1E6I A;  4NXJ A;  4O71 A;  5AME A;  4CUT A;  4UYF A;  1WUM A;  4TZ2 A;  5D3H A;  5EPB A;  4QR5 A;  2R0V A;  3U5J A;  3G0L A;  4NRB A;  5IGK A;  5G4R A;  5H1T A;  5HM0 A;  5IID A;  5HEL A;  5ACY A;  4YAB A;  5D3L A;  5L99 A;  4TT6 A;  4A9H A;  5I80 A;  5CQ5 A;  4TU6 A;  2YEM A;  5DW2 A;  5EP7 A;  5C85 A;  4XYA A;  5CUE A;  4YAX A;  5BT3 A;  5CP5 A;  4QST A;  4NQN A;  5I83 A;  5DX4 A;  4NR6 A;  4NUC A;  4O7A A;  5LKZ A;  3HME A;  5EPR A;  4YK0 A;  5L8T A;  2F6J A;  4IR5 A;  2D9E A;  3MB4 A;  4MEP A;  5EU1 A;  4J0S A;  4QSP A;  5ENB A;  5CUC A;  4XUB A;  5DLZ A;  5D24 A;  4O75 A;  4NYW A;  4LZ2 A;  4QR4 A;  4UIW A;  5KTX A;  5E3D A;  3SVH A;  5D3J A;  4NR9 A;  5DYA A;  4IR6 A;  5F25 A;  1JSP B;  5F1H A;  4XUA A;  2DAT A;  4YBT A;  4LRG A;  2RNW A;  5F3A A;  5F63 A;  5H1V A;  4HXK A;  5F2P A;  4Q0N A;  5FFW A;  4HXP A;  5FE1 A;  4A9F A;  1WUG A;  5IBN A;  5D3T A;  4QEW A;  3I3J A;  3G0J A;  4YYD A;  3D7C A;  5LVR A;  5A81 A;  4XY9 A;  4UYE A;  1JM4 B;  4OGI A;  4X2I A;  4UIX A;  5EQ1 A;  4O7C A;  4QC1 A;  4ALG A;  5C89 A;  4IR3 A;  5CU8 A;  4LZR A;  4MR4 A;  5ENG A;  5A5S A;  4UYF B;  5C87 A;  2RO1 A;  5FDZ A;  4A9E A;  5I7Y A;  4TS8 A;  5ETB A;  5FH6 A;  3S91 A;  4YAT A;  4CLB A;  4J3I A;  5ENE A;  4TZ8 A;  4UYH A;  5I40 A;  3O35 A;  4J0R A;  5LKX A;  3UVD A;  3AQA A;  5EGU A;  4UYG A;  2L5E A;  2FSA A;  2WP1 A;  5ETD A;  5HRX A;  4O7E A;  4NS5 A;  5A5R A;  4MR6 A;  5F36 A;  4BW1 A;  3IU5 A;  5C7N A;  5HLS A;  4TU4 A;  2OO1 A;  3SVG A;  3U5M A;  2LSP B;  1N72 A;  4AKN A;  5ENF A;  2DWW A;  4O70 A;  4O78 A;  1F68 A;  5C4Q A;  4IOO A;  4TQN A;  4NUD A;  4O72 A;  5HQ5 A;  4PTB A;  4LZS A;  4NYX A;  5E9Y A;  3P1F A;  5CQ4 A;  5KO4 A;  5I1Q A;  5H1U A;  4QNS A;  5EPS A;  4YY4 A;  5A5Q A;  2E7N A;  4F3I A;  5FE7 A;  5FH8 A;  3QZV A;  3UV2 A;  4IR4 A;  5FFY A;  3K2J A;  5D25 A;  5A85 A; 
#chains in the Genus database with same CATH topology
 5KTU A;  1EQF A;  5EWH A;  2YEK A;  3IU6 A;  3U5N A;  4QSR A;  5A5P A;  5F1L A;  4NQM A;  4QZS A;  3HMH A;  2KTB B;  5EIS A;  5D3S A;  4UIV A;  3LQI A;  2DVV A;  4BJX A;  5LJ1 A;  4YBS A;  5DYC A;  5CY9 A;  5DFD A;  5CUG A;  3ZYU A;  5E7D A;  4LR6 A;  4UIY A;  4OGJ A;  4Z6H A;  2L84 A;  5A5O A;  3O34 A;  4QC3 A;  5IGM A;  4CUR A;  4CFK A;  3HMF A;  3U5K A;  4QSU A;  2DVS A;  2DVQ A;  4XY8 A;  5A5N A;  5I89 A;  4CUU A;  5LJ0 A;  4A9L A;  5FB0 A;  5FB1 A;  3MUL A;  4A9M A;  5EWD A;  4HXM A;  5DKH A;  3P1C A;  3LQJ A;  5E3G A;  5CQ8 A;  3GG3 A;  5K29 A;  4HXR A;  2E7O A;  4PCE A;  2YDW A;  5E74 A;  4MEO A;  4NR8 A;  4N4I A;  4UIT A;  5DY7 A;  3O36 A;  4OUF A;  4AI6 A;  4QEV A;  5I7X A;  4A9I A;  5CQ3 A;  4YYH A;  2D82 A;  4HBV A;  5COI A;  5FE9 A;  5FFV A;  4BW4 A;  2EJN A;  4IOR A;  5CUA A;  2G4A A;  5CRM A;  5FH7 A;  5I86 A;  3P1D A;  4PKL A;  4NRC A;  5EVA A;  2E3K A;  5II2 A;  3AAD A;  3JVM A;  4TT2 A;  5L8U A;  2R0S A;  4O77 A;  2I7K A;  4UIZ A;  3MB3 A;  4N4F A;  4HXO A;  5CFW A;  3NXB A;  3DAI A;  3LQH A;  4UYD A;  5FE8 A;  4NUE A;  4LYW A;  3D1B A;  4KV4 A;  4TT4 A;  4GPJ A;  4CUQ A;  3P1E A;  3U5L A;  5LUU A;  4CUS A;  4QSW A;  5D0C A;  5CQT A;  5EM3 A;  1X0J A;  3Q2E A;  4AKG A;  3UVY A;  5TB6 A;  5G4S A;  4C67 A;  5J0D A;  4MEN A;  2YEL A;  2YW5 A;  2RS9 B;  5HRV A;  4O7F A;  2OSS A;  4LDF A;  5EIC A;  4A9N A;  4LC2 A;  2L85 A;  4DON A;  2F6N A;  4RVR A;  5HQ6 A;  2N9G A;  4QYL A;  5AD2 A;  5EK9 A;  3QZT A;  3P5O A;  3JVL A;  5LVQ A;  4HXS A;  2DVR A;  3MXF A;  2DKW A;  2RFJ A;  5E9L A;  5H85 A;  4QBM A;  5A82 A;  4BHW A;  3DWY A;  4LYS A;  5ENC A;  4QYD A;  5L98 A;  5A7C A;  4KV1 A;  3UV5 A;  2YYN A;  2R10 A;  5FE4 A;  5DLX A;  5D3R A;  4YH4 A;  4YYK A;  4QUT A;  4QB3 A;  5ENH A;  4O76 A;  3UW9 A;  4AKH A;  4MR3 A;  2WP2 A;  5C8G A;  5KHM A;  4NR5 A;  4NRA A;  5D7X A;  3O33 A;  4Z93 A;  4CFL A;  2RNY A;  5DKC A;  4YH3 A;  5CTL A;  4MEQ A;  3LJW A;  2NXB A;  5ENI A;  5E9V A;  5EV9 A;  5EWW A;  5CS8 A;  4N4H A;  2YQD A;  5D3P A;  5F5Z A;  1ZKR A;  4TYL A;  5FBX A;  4YYJ A;  5CUB A;  4YY6 A;  2RI7 A;  5F60 A;  2OUO A;  1PUO A;  3JVJ A;  5CUD A;  5I88 A;  5FE0 A;  5E9M A;  5HFR A;  3U5O A;  5CGP A;  5DFB A;  4Z1S A;  5LKU A;  5HRW A;  5F62 A;  4IOQ A;  4YAD A;  5D26 A;  4AKI A;  4HBW A;  4A9O A;  4WHW A;  1ZS5 A;  2GRC A;  4PCI A;  4FLP A;  5CPE A;  3MQM A;  2MJV B;  5DYX A;  5II1 A;  4O74 A;  4ZC9 A;  5DFC A;  5FE3 A;  4BW3 A;  5CZG A;  4YYI A;  5EWC A;  4ALH A;  3RCW A;  5JI8 A;  4N4G A;  3LXJ A;  5FE6 A;  4QSX A;  5DKD A;  5FG5 A;  4KCX A;  5A83 A;  5F61 A;  3ONI A;  4A9K A;  5AMF A;  5HQ7 A;  4HBY A;  4YYG A;  5L96 A;  5LKT A;  5DBM A;  4ZW1 A;  5EI4 A;  3U5P A;  4WHU A;  5L97 A;  3QZS A;  5IG6 A;  5JWM A;  4WIV A;  3Q2F A;  5HFQ A;  4YYM A;  4ZQL A;  5DYU A;  4Z6I A;  5E9I A;  4A9J A;  5DW1 A;  5I29 A;  4Z1Q A;  5LJ2 A;  5EA1 A;  4HXN A;  3UVW A;  4N3W A;  5KU3 A;  2R0Y A;  4YYN A;  2RNX A;  5AD3 A;  4HBX A;  5HEN A;  4NR7 A;  4PS5 A;  3S92 A;  4CUP A;  4Y03 A;  5HCL A;  4QUU A;  5CQ6 A;  3O37 A;  4LYI A;  5FG6 A;  5E9K A;  4QY4 A;  5CRZ A;  5CQ7 A;  4QSS A;  4C66 A;  4J1P A;  4BW2 A;  3VKH A;  4YC9 A;  4NR4 A;  4HXL A;  3UV4 A;  4UIU A;  4PY6 A;  2H60 A;  4QEU A;  3MUK A;  4YBM A;  5HEM A;  5FG4 A;  5E73 A;  4QSV A;  4CL9 A;  3SVF A;  4QR3 A;  5E0R A;  5FE2 A;  5ENJ A;  4QSQ A;  5BT5 A;  5HJC A;  4TTE A;  5IGL A;  4NYV A;  3TLP A;  4MR5 A;  5BT4 A;  5FE5 A;  3JVK A;  4Q0O A;  5TCM A;  5KTW A;  4E96 A;  5EWV A;  5IGN A;  5CQA A;  3UVX A;  3FKM X;  4O7B A;  5D3N A;  2I8N A;  1E6I A;  4NXJ A;  4O71 A;  5AME A;  4CUT A;  4UYF A;  1WUM A;  4TZ2 A;  5D3H A;  5EPB A;  4QR5 A;  2R0V A;  3U5J A;  3G0L A;  3VKG A;  4NRB A;  5IGK A;  5G4R A;  5H1T A;  5HM0 A;  5IID A;  5HEL A;  5ACY A;  4YAB A;  5D3L A;  5L99 A;  4TT6 A;  4A9H A;  5I80 A;  5CQ5 A;  4TU6 A;  2YEM A;  5DW2 A;  5EP7 A;  5C85 A;  4XYA A;  5CUE A;  4YAX A;  5BT3 A;  5CP5 A;  4QST A;  4NQN A;  5I83 A;  5DX4 A;  4NR6 A;  4NUC A;  4O7A A;  5LKZ A;  3HME A;  5EPR A;  4YK0 A;  5L8T A;  2F6J A;  4IR5 A;  2D9E A;  3MB4 A;  4MEP A;  5EU1 A;  4J0S A;  4QSP A;  5ENB A;  5CUC A;  4XUB A;  5DLZ A;  5D24 A;  4O75 A;  4NYW A;  4LZ2 A;  4QR4 A;  4UIW A;  5KTX A;  5E3D A;  3SVH A;  5D3J A;  4NR9 A;  5DYA A;  4IR6 A;  5F25 A;  1JSP B;  5F1H A;  4XUA A;  2DAT A;  4YBT A;  4LRG A;  2RNW A;  5F3A A;  5F63 A;  5H1V A;  4HXK A;  5F2P A;  4Q0N A;  5FFW A;  4HXP A;  5FE1 A;  4A9F A;  1WUG A;  5IBN A;  5D3T A;  4QEW A;  3I3J A;  3G0J A;  4YYD A;  3D7C A;  5LVR A;  5A81 A;  4XY9 A;  4UYE A;  1JM4 B;  4OGI A;  4X2I A;  4UIX A;  5EQ1 A;  4O7C A;  4QC1 A;  4ALG A;  5C89 A;  4IR3 A;  5CU8 A;  4LZR A;  4MR4 A;  5ENG A;  5A5S A;  4UYF B;  5C87 A;  2RO1 A;  5FDZ A;  4A9E A;  5I7Y A;  4TS8 A;  5ETB A;  5FH6 A;  3S91 A;  4YAT A;  4CLB A;  4J3I A;  5ENE A;  4TZ8 A;  4UYH A;  3ERR A;  5I40 A;  3O35 A;  4J0R A;  5LKX A;  3UVD A;  3AQA A;  5EGU A;  4UYG A;  2L5E A;  2FSA A;  2WP1 A;  5ETD A;  5HRX A;  4O7E A;  4NS5 A;  5A5R A;  4MR6 A;  5F36 A;  4BW1 A;  3IU5 A;  5C7N A;  5HLS A;  4TU4 A;  2OO1 A;  3SVG A;  3U5M A;  2LSP B;  1N72 A;  4AKN A;  5ENF A;  2DWW A;  4O70 A;  4O78 A;  1F68 A;  5C4Q A;  4IOO A;  4TQN A;  4NUD A;  4O72 A;  5HQ5 A;  4PTB A;  4LZS A;  4NYX A;  5E9Y A;  3P1F A;  5CQ4 A;  5KO4 A;  5I1Q A;  5H1U A;  4QNS A;  5EPS A;  4YY4 A;  5A5Q A;  2E7N A;  4F3I A;  5FE7 A;  5FH8 A;  3QZV A;  3UV2 A;  4IR4 A;  3D1D A;  5FFY A;  3K2J A;  5D25 A;  5A85 A; 
#chains in the Genus database with same CATH homology
 5KTU A;  1EQF A;  5EWH A;  2YEK A;  3IU6 A;  3U5N A;  4QSR A;  5A5P A;  5F1L A;  4NQM A;  4QZS A;  3HMH A;  2KTB B;  5EIS A;  5D3S A;  4UIV A;  3LQI A;  2DVV A;  4BJX A;  5LJ1 A;  4YBS A;  5DYC A;  5CY9 A;  5DFD A;  5CUG A;  3ZYU A;  5E7D A;  4LR6 A;  4UIY A;  4OGJ A;  4Z6H A;  2L84 A;  5A5O A;  3O34 A;  4QC3 A;  5IGM A;  4CUR A;  4CFK A;  3HMF A;  3U5K A;  4QSU A;  2DVS A;  2DVQ A;  4XY8 A;  5A5N A;  5I89 A;  4CUU A;  5LJ0 A;  4A9L A;  5FB0 A;  5FB1 A;  3MUL A;  4A9M A;  5EWD A;  4HXM A;  5DKH A;  3P1C A;  3LQJ A;  5E3G A;  5CQ8 A;  3GG3 A;  5K29 A;  4HXR A;  2E7O A;  4PCE A;  2YDW A;  5E74 A;  4MEO A;  4NR8 A;  4N4I A;  4UIT A;  5DY7 A;  3O36 A;  4OUF A;  4QEV A;  5I7X A;  4A9I A;  5CQ3 A;  4YYH A;  2D82 A;  4HBV A;  5COI A;  5FE9 A;  5FFV A;  4BW4 A;  4IOR A;  5CUA A;  2G4A A;  5CRM A;  5FH7 A;  5I86 A;  3P1D A;  4PKL A;  4NRC A;  5EVA A;  2E3K A;  5II2 A;  3AAD A;  3JVM A;  4TT2 A;  5L8U A;  2R0S A;  4O77 A;  2I7K A;  4UIZ A;  3MB3 A;  4N4F A;  4HXO A;  5CFW A;  3NXB A;  3DAI A;  3LQH A;  4UYD A;  5FE8 A;  4NUE A;  4LYW A;  4KV4 A;  4TT4 A;  4GPJ A;  4CUQ A;  3P1E A;  3U5L A;  5LUU A;  4CUS A;  4QSW A;  5D0C A;  5CQT A;  5EM3 A;  1X0J A;  3Q2E A;  3UVY A;  5TB6 A;  5G4S A;  4C67 A;  5J0D A;  4MEN A;  2YEL A;  2YW5 A;  2RS9 B;  5HRV A;  4O7F A;  2OSS A;  4LDF A;  5EIC A;  4A9N A;  4LC2 A;  2L85 A;  4DON A;  2F6N A;  4RVR A;  5HQ6 A;  2N9G A;  4QYL A;  5AD2 A;  5EK9 A;  3QZT A;  3P5O A;  3JVL A;  5LVQ A;  4HXS A;  2DVR A;  3MXF A;  2DKW A;  2RFJ A;  5E9L A;  5H85 A;  4QBM A;  5A82 A;  4BHW A;  3DWY A;  4LYS A;  5ENC A;  4QYD A;  5L98 A;  5A7C A;  4KV1 A;  3UV5 A;  2YYN A;  2R10 A;  5FE4 A;  5DLX A;  5D3R A;  4YH4 A;  4YYK A;  4QUT A;  4QB3 A;  5ENH A;  4O76 A;  3UW9 A;  4MR3 A;  2WP2 A;  5C8G A;  5KHM A;  4NR5 A;  4NRA A;  5D7X A;  3O33 A;  4Z93 A;  4CFL A;  2RNY A;  5DKC A;  4YH3 A;  5CTL A;  4MEQ A;  3LJW A;  2NXB A;  5ENI A;  5E9V A;  5EV9 A;  5EWW A;  5CS8 A;  4N4H A;  2YQD A;  5D3P A;  5F5Z A;  4TYL A;  5FBX A;  4YYJ A;  5CUB A;  4YY6 A;  2RI7 A;  5F60 A;  2OUO A;  3JVJ A;  5CUD A;  5I88 A;  5FE0 A;  5E9M A;  5HFR A;  3U5O A;  5CGP A;  5DFB A;  4Z1S A;  5LKU A;  5HRW A;  5F62 A;  4IOQ A;  4YAD A;  5D26 A;  4HBW A;  4A9O A;  4WHW A;  1ZS5 A;  2GRC A;  4PCI A;  4FLP A;  5CPE A;  3MQM A;  2MJV B;  5DYX A;  5II1 A;  4O74 A;  4ZC9 A;  5DFC A;  5FE3 A;  4BW3 A;  5CZG A;  4YYI A;  5EWC A;  4ALH A;  3RCW A;  5JI8 A;  4N4G A;  3LXJ A;  5FE6 A;  4QSX A;  5DKD A;  5FG5 A;  4KCX A;  5A83 A;  5F61 A;  3ONI A;  4A9K A;  5AMF A;  5HQ7 A;  4HBY A;  4YYG A;  5L96 A;  5LKT A;  5DBM A;  4ZW1 A;  5EI4 A;  3U5P A;  4WHU A;  5L97 A;  3QZS A;  5IG6 A;  5JWM A;  4WIV A;  3Q2F A;  5HFQ A;  4YYM A;  4ZQL A;  5DYU A;  4Z6I A;  5E9I A;  4A9J A;  5DW1 A;  5I29 A;  4Z1Q A;  5LJ2 A;  5EA1 A;  4HXN A;  3UVW A;  4N3W A;  5KU3 A;  2R0Y A;  4YYN A;  2RNX A;  5AD3 A;  4HBX A;  5HEN A;  4NR7 A;  4PS5 A;  3S92 A;  4CUP A;  4Y03 A;  5HCL A;  4QUU A;  5CQ6 A;  3O37 A;  4LYI A;  5FG6 A;  5E9K A;  4QY4 A;  5CRZ A;  5CQ7 A;  4QSS A;  4C66 A;  4J1P A;  4BW2 A;  4YC9 A;  4NR4 A;  4HXL A;  3UV4 A;  4UIU A;  4PY6 A;  2H60 A;  4QEU A;  3MUK A;  4YBM A;  5HEM A;  5FG4 A;  5E73 A;  4QSV A;  4CL9 A;  3SVF A;  4QR3 A;  5E0R A;  5FE2 A;  5ENJ A;  4QSQ A;  5BT5 A;  5HJC A;  4TTE A;  5IGL A;  4NYV A;  3TLP A;  4MR5 A;  5BT4 A;  5FE5 A;  3JVK A;  4Q0O A;  5TCM A;  5KTW A;  4E96 A;  5EWV A;  5IGN A;  5CQA A;  3UVX A;  3FKM X;  4O7B A;  5D3N A;  2I8N A;  1E6I A;  4NXJ A;  4O71 A;  5AME A;  4CUT A;  4UYF A;  1WUM A;  4TZ2 A;  5D3H A;  5EPB A;  4QR5 A;  2R0V A;  3U5J A;  3G0L A;  4NRB A;  5IGK A;  5G4R A;  5H1T A;  5HM0 A;  5IID A;  5HEL A;  5ACY A;  4YAB A;  5D3L A;  5L99 A;  4TT6 A;  4A9H A;  5I80 A;  5CQ5 A;  4TU6 A;  2YEM A;  5DW2 A;  5EP7 A;  5C85 A;  4XYA A;  5CUE A;  4YAX A;  5BT3 A;  5CP5 A;  4QST A;  4NQN A;  5I83 A;  5DX4 A;  4NR6 A;  4NUC A;  4O7A A;  5LKZ A;  3HME A;  5EPR A;  4YK0 A;  5L8T A;  2F6J A;  4IR5 A;  2D9E A;  3MB4 A;  4MEP A;  5EU1 A;  4J0S A;  4QSP A;  5ENB A;  5CUC A;  4XUB A;  5DLZ A;  5D24 A;  4O75 A;  4NYW A;  4LZ2 A;  4QR4 A;  4UIW A;  5KTX A;  5E3D A;  3SVH A;  5D3J A;  4NR9 A;  5DYA A;  4IR6 A;  5F25 A;  1JSP B;  5F1H A;  4XUA A;  2DAT A;  4YBT A;  4LRG A;  2RNW A;  5F3A A;  5F63 A;  5H1V A;  4HXK A;  5F2P A;  4Q0N A;  5FFW A;  4HXP A;  5FE1 A;  4A9F A;  1WUG A;  5IBN A;  5D3T A;  4QEW A;  3I3J A;  3G0J A;  4YYD A;  3D7C A;  5LVR A;  5A81 A;  4XY9 A;  4UYE A;  1JM4 B;  4OGI A;  4X2I A;  4UIX A;  5EQ1 A;  4O7C A;  4QC1 A;  4ALG A;  5C89 A;  4IR3 A;  5CU8 A;  4LZR A;  4MR4 A;  5ENG A;  5A5S A;  4UYF B;  5C87 A;  2RO1 A;  5FDZ A;  4A9E A;  5I7Y A;  4TS8 A;  5ETB A;  5FH6 A;  3S91 A;  4YAT A;  4CLB A;  4J3I A;  5ENE A;  4TZ8 A;  4UYH A;  5I40 A;  3O35 A;  4J0R A;  5LKX A;  3UVD A;  3AQA A;  5EGU A;  4UYG A;  2L5E A;  2FSA A;  2WP1 A;  5ETD A;  5HRX A;  4O7E A;  4NS5 A;  5A5R A;  4MR6 A;  5F36 A;  4BW1 A;  3IU5 A;  5C7N A;  5HLS A;  4TU4 A;  2OO1 A;  3SVG A;  3U5M A;  2LSP B;  1N72 A;  4AKN A;  5ENF A;  2DWW A;  4O70 A;  4O78 A;  1F68 A;  5C4Q A;  4IOO A;  4TQN A;  4NUD A;  4O72 A;  5HQ5 A;  4PTB A;  4LZS A;  4NYX A;  5E9Y A;  3P1F A;  5CQ4 A;  5KO4 A;  5I1Q A;  5H1U A;  4QNS A;  5EPS A;  4YY4 A;  5A5Q A;  2E7N A;  4F3I A;  5FE7 A;  5FH8 A;  3QZV A;  3UV2 A;  4IR4 A;  5FFY A;  3K2J A;  5D25 A;  5A85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...