5KU3A

Brd4 bromodomain in complex with cpd59 ((s)-1-(3-((2-fluoro-4-(1-methyl-1h-pyrazol-4-yl)phenyl)amino)-1-(tetrahydrofuran-3-yl)-6,7-dihydro-1h-pyrazolo[4,3-c]pyridin-5(4h)-yl)ethanone)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
126
structure length
126
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Bromodomain-containing protein 4
publication title Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ku3A01
4YABA 1E6IA 4QEUA 4BW1A 4J1PA 3K2JA 4O77A 5EK9A 2RO1A 4KV1A 5TB6A 5D3NA 5HRVA 5A81A 5I1QA 5H1TA 3HMHA 1N72A 5FE3A 5G4SA 5DFDA 4XY8A 5II2A 3O33A 3P5OA 5H85A 4UYDA 5EI4A 4IOQA 4LR6A 4YYHA 4TU4A 4QR5A 3NXBA 5JWMA 3S92A 5HELA 4QC3A 3UV5A 4YYIA 5AMFA 4CUSA 5A82A 5FE6A 5AD3A 4QSTA 4NR8A 5DKDA 5E9IA 2F6JA 5EISA 5C85A 5LJ2A 4QC1A 5F63A 4Z1SA 4TYLA 5LKXA 4YY4A 5CTLA 2WP1A 3MB4A 5FG6A 4NUDA 5D3SA 3O34A 4OUFA 4NR9A 5A5RA 2R10A 5EWDA 4A9OA 4YBSA 5ENFA 5EM3A 5L97A 5A5OA 2DWWA 5ENEA 5EA1A 2YW5A 2D9EA 4QUUA 5ETDA 5DFCA 4Z1QA 5FDZA 5ENCA 3JVJA 5F5ZA 5EV9A 4O7AA 4QZSA 4CL9A 5DKCA 4DONA 5D3PA 4QB3A 5FFYA 5CQ7A 5HLSA 3LQHA 5E9VA 5I29A 4IOOA 4N4FA 4TT6A 3LQIA 5FE4A 4YYGA 2YEMA 5HENA 1WUGA 4UIYA 1JM4B 4UYGA 5EWCA 4O7FA 5DYUA 5FE2A 5CUCA 4BW3A 4IR6A 5E9YA 2G4AA 5C89A 5JI8A 4A9KA 3MUKA 5E9LA 5A83A 5CRZA 5LJ1A 2OO1A 3ONIA 4O78A 3D7CA 2RNWA 4MR3A 3SVFA 2GRCA 4UYFB 3SVGA 5FBXA 1ZS5A 4NYXA 5CQ6A 5EVAA 3MB3A 4NRAA 4E96A 5A85A 3MXFA 4NRBA 5C7NA 4A9HA 5D0CA 5COIA 2DVQA 3AQAA 2YQDA 4YK0A 5F3AA 5DW1A 4QYDA 3Q2FA 2YDWA 5D7XA 2E7OA 4LZ2A 3U5KA 5E3DA 3U5LA 4QY4A 4YYNA 5FH6A 5HQ6A 2L85A 3GG3A 4HXMA 4NR4A 5ENIA 3AADA 5A5QA 5HRWA 4HXNA 5TCMA 4O71A 2YYNA 4N3WA 4AKNA 4KV4A 5EWWA 4NR6A 5F1LA 2DVVA 5CQTA 4CUTA 5IGKA 5HCLA 5LUUA 4QBMA 4BW4A 5ENJA 5DW2A 5FFVA 4LYIA 5DYCA 4IORA 2YELA 4PS5A 4ALGA 3LJWA 4MENA 5FG5A 5EICA 1EQFA 4LYWA 4Q0OA 3JVMA 2KTBB 4XY9A 4C66A 4MEPA 5EU1A 5I83A 4YBMA 4TU6A 5DFBA 5DLXA 5E73A 5E0RA 5L8TA 2RI7A 3O36A 3U5JA 5FE9A 4A9IA 4O7CA 4QSVA 4PTBA 5F61A 3SVHA 4A9NA 5FE7A 4A9JA 4UYHA 5LKZA 4MR5A 4QSQA 4HXLA 4LYSA 3U5NA 4UIWA 4NS5A 5II1A 3U5OA 4IR4A 5DKHA 2DVRA 4Q0NA 5EP7A 5IG6A 5EPSA 5FB1A 4NQNA 4YYMA 5CUGA 3UV4A 2N9GA 4TT4A 5HQ7A 5L99A 5L96A 5K29A 4ZC9A 3S91A 5CQ3A 5CFWA 5FE0A 3Q2EA 5CU8A 5F60A 4TZ8A 5EPBA 4J0SA 4NQMA 5E74A 4YH4A 5ENBA 5F62A 4C67A 4QR3A 5A5NA 5KTWA 4CUUA 4O7BA 3LXJA 4NRCA 5H1VA 5E9KA 5ETBA 3DAIA 5I7YA 5D3HA 3QZSA 4TQNA 2H60A 4MR4A 4N4GA 2DVSA 5L98A 4OGJA 2D82A 4HXSA 5EGUA 5LVRA 4HXRA 5CS8A 3QZVA 4A9MA 2YEKA 3HMEA 5C87A 4OGIA 4YYJA 5BT5A 5J0DA 5AMEA 5FB0A 4HXKA 5LJ0A 4ALHA 5CUAA 5CQ5A 1JSPB 2R0YA 4UIXA 4UIUA 3LQJA 4BHWA 4CUQA 5DLZA 2I7KA 5DBMA 5F2PA 5HFQA 5FFWA 4IR3A 4TS8A 2RFJA 4XYAA 3P1EA 3IU6A 2DKWA 3HMFA 5H1UA 5E7DA 4YYDA 5I89A 4YYKA 3IU5A 2L84A 2I8NA 4NR5A 4WHUA 3UW9A 3ZYUA 5CP5A 4O76A 3JVKA 5CUBA 4A9LA 1F68A 4XUBA 5IGNA 5HJCA 4QEVA 5EWHA 5HEMA 4LZRA 5HM0A 4NUEA 4UITA 4ZW1A 5FG4A 5AD2A 4QSRA 3UVDA 4O70A 4QSPA 4O72A 3JVLA 4N4HA 4FLPA 4A9EA 4BW2A 5CQ4A 5C4QA 5KHMA 3P1FA 3DWYA 5DYXA 5E3GA 5C8GA 3O35A 4QUTA 5DY7A 5D24A 4LZSA 5I88A 3TLPA 4LRGA 4N4IA 4TT2A 4ZQLA 5KTXA 3P1DA 3O37A 5A5SA 4HBXA 4QEWA 5I7XA 5ACYA 4WHWA 5L8UA 4QYLA 4HXPA 2R0VA 3QZTA 3UVWA 4QSWA 3UV2A 5HQ5A 4TTEA 4LC2A 5D3RA 2WP2A 4NR7A 5LKTA 4WIVA 5D3LA 2E3KA 3U5MA 4QSUA 5E9MA 5KO4A 5D25A 5LVQA 4J0RA 2RNYA 3FKMX 4Z93A 4O7EA 4YC9A 2E7NA 5FH8A 5ENGA 5G4RA 4UIVA 4O74A 4CLBA 4NXJA 3I3JA 4UIZA 4J3IA 5D26A 5D3TA 4O75A 3MULA 4UYFA 5F25A 4QNSA 2RNXA 5A7CA 4YADA 4YAXA 3RCWA 4NYVA 5CY9A 5EPRA 2MJVB 5IGMA 4Y03A 4Z6IA 4LDFA 4RVRA 4PCIA 5CUEA 2R0SA 4YBTA 3UVXA 4BJXA 4PKLA 5CZGA 1WUMA 4CUPA 5CQAA 5F36A 5EWVA 5KU3A 5CGPA 3G0JA 4HXOA 3G0LA 3U5PA 2OSSA 4MR6A 4QSXA 5BT3A 3P1CA 5F1HA 5HRXA 5DYAA 5IIDA 3MQMA 5BT4A 5KTUA 4MEQA 4PCEA 4CFLA 1X0JA 2LSPB 5D3JA 4PY6A 2NXBA 4CFKA 5IGLA 2RS9B 4A9FA 4MEOA 4KCXA 5I40A 5FE5A 4HBWA 4YY6A 5I86A 5LKUA 4X2IA 4CURA 4GPJA 4HBVA 5CUDA 2F6NA 4YATA 4F3IA 5DX4A 5I80A 5FH7A 4NYWA 2L5EA 5CQ8A 4TZ2A 5HFRA 5FE8A 5CRMA 4UYEA 4XUAA 5A5PA 4IR5A 2OUOA 5CPEA 5EQ1A 2DATA 5IBNA 3UVYA 4QSSA 5FE1A 4HBYA 4NUCA 5ENHA 4YH3A 4QR4A 4Z6HA 2FSAA
chains in the Genus database with same CATH superfamily
4YABA 1E6IA 4QEUA 4BW1A 4J1PA 3K2JA 4O77A 5EK9A 2RO1A 4KV1A 5TB6A 5D3NA 5HRVA 5A81A 5I1QA 5H1TA 3HMHA 1N72A 5FE3A 5G4SA 5DFDA 4XY8A 5II2A 3O33A 3P5OA 5H85A 4UYDA 5EI4A 4IOQA 4LR6A 4YYHA 4TU4A 4QR5A 3NXBA 5JWMA 3S92A 5HELA 4QC3A 3UV5A 4YYIA 5AMFA 4CUSA 5A82A 5FE6A 5AD3A 4QSTA 4NR8A 5DKDA 5E9IA 2F6JA 5EISA 5C85A 5LJ2A 4QC1A 5F63A 4Z1SA 4TYLA 5LKXA 4YY4A 5CTLA 2WP1A 3MB4A 5FG6A 4NUDA 5D3SA 3O34A 4OUFA 4NR9A 5A5RA 2R10A 5EWDA 4A9OA 4YBSA 5ENFA 5EM3A 5L97A 5A5OA 2DWWA 5ENEA 5EA1A 2YW5A 2D9EA 4QUUA 5ETDA 4AKHA 5DFCA 4Z1QA 5FDZA 2EJNA 5ENCA 3JVJA 5F5ZA 5EV9A 4O7AA 4QZSA 4CL9A 5DKCA 4DONA 5D3PA 4QB3A 5FFYA 5CQ7A 5HLSA 3LQHA 5E9VA 5I29A 4IOOA 4N4FA 4TT6A 3LQIA 5FE4A 4YYGA 2YEMA 5HENA 1WUGA 4UIYA 1JM4B 4UYGA 5EWCA 4O7FA 5DYUA 5FE2A 5CUCA 4BW3A 4IR6A 5E9YA 2G4AA 5C89A 5JI8A 4A9KA 3MUKA 5E9LA 5A83A 5CRZA 5LJ1A 2OO1A 3ONIA 4O78A 3D7CA 2RNWA 4MR3A 3SVFA 2GRCA 4UYFB 3SVGA 5FBXA 1ZS5A 4NYXA 5CQ6A 5EVAA 3MB3A 4NRAA 4E96A 5A85A 3MXFA 4NRBA 5C7NA 4A9HA 5D0CA 5COIA 1PUOA 2DVQA 3AQAA 2YQDA 4YK0A 5F3AA 5DW1A 4QYDA 3Q2FA 2YDWA 5D7XA 2E7OA 4LZ2A 3U5KA 5E3DA 3U5LA 4QY4A 4YYNA 5FH6A 5HQ6A 2L85A 3GG3A 4HXMA 4NR4A 5ENIA 3AADA 5A5QA 5HRWA 4HXNA 5TCMA 4O71A 2YYNA 4N3WA 4AKNA 4KV4A 5EWWA 4NR6A 5F1LA 2DVVA 5CQTA 4CUTA 5IGKA 5HCLA 5LUUA 4QBMA 4BW4A 5ENJA 5DW2A 5FFVA 4LYIA 5DYCA 4IORA 2YELA 4PS5A 4ALGA 3LJWA 4MENA 5FG5A 5EICA 1EQFA 4LYWA 4Q0OA 3JVMA 2KTBB 4XY9A 4C66A 4MEPA 5EU1A 5I83A 4YBMA 4TU6A 5DFBA 5DLXA 5E73A 5E0RA 5L8TA 2RI7A 3O36A 3U5JA 5FE9A 4A9IA 4O7CA 4QSVA 4PTBA 5F61A 3SVHA 4A9NA 5FE7A 4A9JA 4UYHA 5LKZA 4MR5A 4QSQA 4HXLA 4LYSA 3U5NA 4UIWA 4NS5A 5II1A 3U5OA 4IR4A 5DKHA 2DVRA 4Q0NA 5EP7A 5IG6A 5EPSA 5FB1A 4NQNA 4YYMA 5CUGA 3UV4A 2N9GA 4TT4A 5HQ7A 5L99A 5L96A 5K29A 4ZC9A 3S91A 5CQ3A 5CFWA 5FE0A 3Q2EA 5CU8A 5F60A 4TZ8A 5EPBA 4J0SA 4NQMA 5E74A 4YH4A 5ENBA 5F62A 4C67A 4QR3A 5A5NA 5KTWA 4CUUA 4O7BA 3LXJA 4NRCA 5H1VA 5E9KA 5ETBA 3DAIA 5I7YA 5D3HA 3QZSA 4TQNA 2H60A 4MR4A 4N4GA 2DVSA 5L98A 4OGJA 2D82A 4HXSA 5EGUA 4AKIA 5LVRA 4HXRA 5CS8A 1ZKRA 3QZVA 4A9MA 3VKGA 2YEKA 3HMEA 5C87A 4OGIA 4YYJA 5BT5A 5J0DA 5AMEA 5FB0A 4HXKA 5LJ0A 4ALHA 5CUAA 5CQ5A 1JSPB 2R0YA 4UIXA 4UIUA 3VKHA 3LQJA 4BHWA 4CUQA 5DLZA 2I7KA 5DBMA 5F2PA 5HFQA 5FFWA 4IR3A 4TS8A 2RFJA 4XYAA 3P1EA 3IU6A 2DKWA 3HMFA 5H1UA 5E7DA 4YYDA 5I89A 4YYKA 3IU5A 2L84A 2I8NA 4NR5A 4WHUA 3UW9A 3ZYUA 5CP5A 4O76A 3JVKA 5CUBA 4A9LA 1F68A 4XUBA 5IGNA 5HJCA 4QEVA 5EWHA 5HEMA 4LZRA 5HM0A 4NUEA 4UITA 4ZW1A 5FG4A 5AD2A 4QSRA 3UVDA 4O70A 4QSPA 4O72A 3JVLA 4N4HA 4FLPA 4A9EA 4BW2A 3ERRA 5CQ4A 5C4QA 5KHMA 3P1FA 3DWYA 4AKGA 5DYXA 5E3GA 5C8GA 3O35A 3D1DA 4QUTA 5DY7A 5D24A 4LZSA 5I88A 3TLPA 4LRGA 4N4IA 4TT2A 4ZQLA 5KTXA 3P1DA 3O37A 5A5SA 4HBXA 4QEWA 5I7XA 5ACYA 4WHWA 5L8UA 4QYLA 4HXPA 2R0VA 3QZTA 3UVWA 4QSWA 3UV2A 5HQ5A 4TTEA 4LC2A 5D3RA 2WP2A 4NR7A 5LKTA 4WIVA 5D3LA 2E3KA 3U5MA 4QSUA 5E9MA 5KO4A 5D25A 5LVQA 4J0RA 2RNYA 3FKMX 4Z93A 4O7EA 4YC9A 2E7NA 5FH8A 5ENGA 5G4RA 4UIVA 4O74A 4CLBA 4NXJA 3I3JA 4UIZA 4J3IA 5D26A 5D3TA 4O75A 3MULA 4UYFA 5F25A 4QNSA 2RNXA 5A7CA 4YADA 4YAXA 3RCWA 4NYVA 5CY9A 5EPRA 2MJVB 5IGMA 4Y03A 4Z6IA 4LDFA 4RVRA 4PCIA 5CUEA 2R0SA 4YBTA 3UVXA 4BJXA 4PKLA 5CZGA 1WUMA 4CUPA 5CQAA 5F36A 5EWVA 5KU3A 5CGPA 3G0JA 4HXOA 3G0LA 3U5PA 2OSSA 4MR6A 4QSXA 5BT3A 3P1CA 5F1HA 5HRXA 5DYAA 5IIDA 3MQMA 5BT4A 5KTUA 4MEQA 4PCEA 4CFLA 1X0JA 2LSPB 5D3JA 4PY6A 2NXBA 4CFKA 5IGLA 2RS9B 4A9FA 4MEOA 4KCXA 5I40A 5FE5A 4AI6A 4HBWA 4YY6A 5I86A 5LKUA 4X2IA 4CURA 3D1BA 4GPJA 4HBVA 5CUDA 2F6NA 4YATA 4F3IA 5DX4A 5I80A 5FH7A 4NYWA 2L5EA 5CQ8A 4TZ2A 5HFRA 5FE8A 5CRMA 4UYEA 4XUAA 5A5PA 4IR5A 2OUOA 5CPEA 5EQ1A 2DATA 5IBNA 3UVYA 4QSSA 5FE1A 4HBYA 4NUCA 5ENHA 4YH3A 4QR4A 4Z6HA 2FSAA
chains in the Genus database with same CATH topology
4YABA 1E6IA 4QEUA 4BW1A 4J1PA 3K2JA 4O77A 5EK9A 2RO1A 4KV1A 5TB6A 5D3NA 5HRVA 5A81A 5I1QA 5H1TA 3HMHA 1N72A 5FE3A 5G4SA 5DFDA 4XY8A 5II2A 3O33A 3P5OA 5H85A 4UYDA 5EI4A 4IOQA 4LR6A 4YYHA 4TU4A 4QR5A 3NXBA 5JWMA 3S92A 5HELA 4QC3A 3UV5A 4YYIA 5AMFA 4CUSA 5A82A 5FE6A 5AD3A 4QSTA 4NR8A 5DKDA 5E9IA 2F6JA 5EISA 5C85A 5LJ2A 4QC1A 5F63A 4Z1SA 4TYLA 5LKXA 4YY4A 5CTLA 2WP1A 3MB4A 5FG6A 4NUDA 5D3SA 3O34A 4OUFA 4NR9A 5A5RA 2R10A 5EWDA 4A9OA 4YBSA 5ENFA 5EM3A 5L97A 5A5OA 2DWWA 5ENEA 5EA1A 2YW5A 2D9EA 4QUUA 5ETDA 5DFCA 4Z1QA 5FDZA 5ENCA 3JVJA 5F5ZA 5EV9A 4O7AA 4QZSA 4CL9A 5DKCA 4DONA 5D3PA 4QB3A 5FFYA 5CQ7A 5HLSA 3LQHA 5E9VA 5I29A 4IOOA 4N4FA 4TT6A 3LQIA 5FE4A 4YYGA 2YEMA 5HENA 1WUGA 4UIYA 1JM4B 4UYGA 5EWCA 4O7FA 5DYUA 5FE2A 5CUCA 4BW3A 4IR6A 5E9YA 2G4AA 5C89A 5JI8A 4A9KA 3MUKA 5E9LA 5A83A 5CRZA 5LJ1A 2OO1A 3ONIA 4O78A 3D7CA 2RNWA 4MR3A 3SVFA 2GRCA 4UYFB 3SVGA 5FBXA 1ZS5A 4NYXA 5CQ6A 5EVAA 3MB3A 4NRAA 4E96A 5A85A 3MXFA 4NRBA 5C7NA 4A9HA 5D0CA 5COIA 2DVQA 3AQAA 2YQDA 4YK0A 5F3AA 5DW1A 4QYDA 3Q2FA 2YDWA 5D7XA 2E7OA 4LZ2A 3U5KA 5E3DA 3U5LA 4QY4A 4YYNA 5FH6A 5HQ6A 2L85A 3GG3A 4HXMA 4NR4A 5ENIA 3AADA 5A5QA 5HRWA 4HXNA 5TCMA 4O71A 2YYNA 4N3WA 4AKNA 4KV4A 5EWWA 4NR6A 5F1LA 2DVVA 5CQTA 4CUTA 5IGKA 5HCLA 5LUUA 4QBMA 4BW4A 5ENJA 5DW2A 5FFVA 4LYIA 5DYCA 4IORA 2YELA 4PS5A 4ALGA 3LJWA 4MENA 5FG5A 5EICA 1EQFA 4LYWA 4Q0OA 3JVMA 2KTBB 4XY9A 4C66A 4MEPA 5EU1A 5I83A 4YBMA 4TU6A 5DFBA 5DLXA 5E73A 5E0RA 5L8TA 2RI7A 3O36A 3U5JA 5FE9A 4A9IA 4O7CA 4QSVA 4PTBA 5F61A 3SVHA 4A9NA 5FE7A 4A9JA 4UYHA 5LKZA 4MR5A 4QSQA 4HXLA 4LYSA 3U5NA 4UIWA 4NS5A 5II1A 3U5OA 4IR4A 5DKHA 2DVRA 4Q0NA 5EP7A 5IG6A 5EPSA 5FB1A 4NQNA 4YYMA 5CUGA 3UV4A 2N9GA 4TT4A 5HQ7A 5L99A 5L96A 5K29A 4ZC9A 3S91A 5CQ3A 5CFWA 5FE0A 3Q2EA 5CU8A 5F60A 4TZ8A 5EPBA 4J0SA 4NQMA 5E74A 4YH4A 5ENBA 5F62A 4C67A 4QR3A 5A5NA 5KTWA 4CUUA 4O7BA 3LXJA 4NRCA 5H1VA 5E9KA 5ETBA 3DAIA 5I7YA 5D3HA 3QZSA 4TQNA 2H60A 4MR4A 4N4GA 2DVSA 5L98A 4OGJA 2D82A 4HXSA 5EGUA 5LVRA 4HXRA 5CS8A 3QZVA 4A9MA 2YEKA 3HMEA 5C87A 4OGIA 4YYJA 5BT5A 5J0DA 5AMEA 5FB0A 4HXKA 5LJ0A 4ALHA 5CUAA 5CQ5A 1JSPB 2R0YA 4UIXA 4UIUA 3LQJA 4BHWA 4CUQA 5DLZA 2I7KA 5DBMA 5F2PA 5HFQA 5FFWA 4IR3A 4TS8A 2RFJA 4XYAA 3P1EA 3IU6A 2DKWA 3HMFA 5H1UA 5E7DA 4YYDA 5I89A 4YYKA 3IU5A 2L84A 2I8NA 4NR5A 4WHUA 3UW9A 3ZYUA 5CP5A 4O76A 3JVKA 5CUBA 4A9LA 1F68A 4XUBA 5IGNA 5HJCA 4QEVA 5EWHA 5HEMA 4LZRA 5HM0A 4NUEA 4UITA 4ZW1A 5FG4A 5AD2A 4QSRA 3UVDA 4O70A 4QSPA 4O72A 3JVLA 4N4HA 4FLPA 4A9EA 4BW2A 5CQ4A 5C4QA 5KHMA 3P1FA 3DWYA 5DYXA 5E3GA 5C8GA 3O35A 4QUTA 5DY7A 5D24A 4LZSA 5I88A 3TLPA 4LRGA 4N4IA 4TT2A 4ZQLA 5KTXA 3P1DA 3O37A 5A5SA 4HBXA 4QEWA 5I7XA 5ACYA 4WHWA 5L8UA 4QYLA 4HXPA 2R0VA 3QZTA 3UVWA 4QSWA 3UV2A 5HQ5A 4TTEA 4LC2A 5D3RA 2WP2A 4NR7A 5LKTA 4WIVA 5D3LA 2E3KA 3U5MA 4QSUA 5E9MA 5KO4A 5D25A 5LVQA 4J0RA 2RNYA 3FKMX 4Z93A 4O7EA 4YC9A 2E7NA 5FH8A 5ENGA 5G4RA 4UIVA 4O74A 4CLBA 4NXJA 3I3JA 4UIZA 4J3IA 5D26A 5D3TA 4O75A 3MULA 4UYFA 5F25A 4QNSA 2RNXA 5A7CA 4YADA 4YAXA 3RCWA 4NYVA 5CY9A 5EPRA 2MJVB 5IGMA 4Y03A 4Z6IA 4LDFA 4RVRA 4PCIA 5CUEA 2R0SA 4YBTA 3UVXA 4BJXA 4PKLA 5CZGA 1WUMA 4CUPA 5CQAA 5F36A 5EWVA 5KU3A 5CGPA 3G0JA 4HXOA 3G0LA 3U5PA 2OSSA 4MR6A 4QSXA 5BT3A 3P1CA 5F1HA 5HRXA 5DYAA 5IIDA 3MQMA 5BT4A 5KTUA 4MEQA 4PCEA 4CFLA 1X0JA 2LSPB 5D3JA 4PY6A 2NXBA 4CFKA 5IGLA 2RS9B 4A9FA 4MEOA 4KCXA 5I40A 5FE5A 4HBWA 4YY6A 5I86A 5LKUA 4X2IA 4CURA 4GPJA 4HBVA 5CUDA 2F6NA 4YATA 4F3IA 5DX4A 5I80A 5FH7A 4NYWA 2L5EA 5CQ8A 4TZ2A 5HFRA 5FE8A 5CRMA 4UYEA 4XUAA 5A5PA 4IR5A 2OUOA 5CPEA 5EQ1A 2DATA 5IBNA 3UVYA 4QSSA 5FE1A 4HBYA 4NUCA 5ENHA 4YH3A 4QR4A 4Z6HA 2FSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAB A;  1E6I A;  4QEU A;  4BW1 A;  4J1P A;  3K2J A;  4O77 A;  5EK9 A;  2RO1 A;  4KV1 A;  5TB6 A;  5D3N A;  5HRV A;  5A81 A;  5I1Q A;  5H1T A;  3HMH A;  1N72 A;  5FE3 A;  5G4S A;  5DFD A;  4XY8 A;  5II2 A;  3O33 A;  3P5O A;  5H85 A;  4UYD A;  5EI4 A;  4IOQ A;  4LR6 A;  4YYH A;  4TU4 A;  4QR5 A;  3NXB A;  5JWM A;  3S92 A;  5HEL A;  4QC3 A;  3UV5 A;  4YYI A;  5AMF A;  4CUS A;  5A82 A;  5FE6 A;  5AD3 A;  4QST A;  4NR8 A;  5DKD A;  5E9I A;  2F6J A;  5EIS A;  5C85 A;  5LJ2 A;  4QC1 A;  5F63 A;  4Z1S A;  4TYL A;  5LKX A;  4YY4 A;  5CTL A;  2WP1 A;  3MB4 A;  5FG6 A;  4NUD A;  5D3S A;  3O34 A;  4OUF A;  4NR9 A;  5A5R A;  2R10 A;  5EWD A;  4A9O A;  4YBS A;  5ENF A;  5EM3 A;  5L97 A;  5A5O A;  2DWW A;  5ENE A;  5EA1 A;  2YW5 A;  2D9E A;  4QUU A;  5ETD A;  5DFC A;  4Z1Q A;  5FDZ A;  5ENC A;  3JVJ A;  5F5Z A;  5EV9 A;  4O7A A;  4QZS A;  4CL9 A;  5DKC A;  4DON A;  5D3P A;  4QB3 A;  5FFY A;  5CQ7 A;  5HLS A;  3LQH A;  5E9V A;  5I29 A;  4IOO A;  4N4F A;  4TT6 A;  3LQI A;  5FE4 A;  4YYG A;  2YEM A;  5HEN A;  1WUG A;  4UIY A;  1JM4 B;  4UYG A;  5EWC A;  4O7F A;  5DYU A;  5FE2 A;  5CUC A;  4BW3 A;  4IR6 A;  5E9Y A;  2G4A A;  5C89 A;  5JI8 A;  4A9K A;  3MUK A;  5E9L A;  5A83 A;  5CRZ A;  5LJ1 A;  2OO1 A;  3ONI A;  4O78 A;  3D7C A;  2RNW A;  4MR3 A;  3SVF A;  2GRC A;  4UYF B;  3SVG A;  5FBX A;  1ZS5 A;  4NYX A;  5CQ6 A;  5EVA A;  3MB3 A;  4NRA A;  4E96 A;  5A85 A;  3MXF A;  4NRB A;  5C7N A;  4A9H A;  5D0C A;  5COI A;  2DVQ A;  3AQA A;  2YQD A;  4YK0 A;  5F3A A;  5DW1 A;  4QYD A;  3Q2F A;  2YDW A;  5D7X A;  2E7O A;  4LZ2 A;  3U5K A;  5E3D A;  3U5L A;  4QY4 A;  4YYN A;  5FH6 A;  5HQ6 A;  2L85 A;  3GG3 A;  4HXM A;  4NR4 A;  5ENI A;  3AAD A;  5A5Q A;  5HRW A;  4HXN A;  5TCM A;  4O71 A;  2YYN A;  4N3W A;  4AKN A;  4KV4 A;  5EWW A;  4NR6 A;  5F1L A;  2DVV A;  5CQT A;  4CUT A;  5IGK A;  5HCL A;  5LUU A;  4QBM A;  4BW4 A;  5ENJ A;  5DW2 A;  5FFV A;  4LYI A;  5DYC A;  4IOR A;  2YEL A;  4PS5 A;  4ALG A;  3LJW A;  4MEN A;  5FG5 A;  5EIC A;  1EQF A;  4LYW A;  4Q0O A;  3JVM A;  2KTB B;  4XY9 A;  4C66 A;  4MEP A;  5EU1 A;  5I83 A;  4YBM A;  4TU6 A;  5DFB A;  5DLX A;  5E73 A;  5E0R A;  5L8T A;  2RI7 A;  3O36 A;  3U5J A;  5FE9 A;  4A9I A;  4O7C A;  4QSV A;  4PTB A;  5F61 A;  3SVH A;  4A9N A;  5FE7 A;  4A9J A;  4UYH A;  5LKZ A;  4MR5 A;  4QSQ A;  4HXL A;  4LYS A;  3U5N A;  4UIW A;  4NS5 A;  5II1 A;  3U5O A;  4IR4 A;  5DKH A;  2DVR A;  4Q0N A;  5EP7 A;  5IG6 A;  5EPS A;  5FB1 A;  4NQN A;  4YYM A;  5CUG A;  3UV4 A;  2N9G A;  4TT4 A;  5HQ7 A;  5L99 A;  5L96 A;  5K29 A;  4ZC9 A;  3S91 A;  5CQ3 A;  5CFW A;  5FE0 A;  3Q2E A;  5CU8 A;  5F60 A;  4TZ8 A;  5EPB A;  4J0S A;  4NQM A;  5E74 A;  4YH4 A;  5ENB A;  5F62 A;  4C67 A;  4QR3 A;  5A5N A;  5KTW A;  4CUU A;  4O7B A;  3LXJ A;  4NRC A;  5H1V A;  5E9K A;  5ETB A;  3DAI A;  5I7Y A;  5D3H A;  3QZS A;  4TQN A;  2H60 A;  4MR4 A;  4N4G A;  2DVS A;  5L98 A;  4OGJ A;  2D82 A;  4HXS A;  5EGU A;  5LVR A;  4HXR A;  5CS8 A;  3QZV A;  4A9M A;  2YEK A;  3HME A;  5C87 A;  4OGI A;  4YYJ A;  5BT5 A;  5J0D A;  5AME A;  5FB0 A;  4HXK A;  5LJ0 A;  4ALH A;  5CUA A;  5CQ5 A;  1JSP B;  2R0Y A;  4UIX A;  4UIU A;  3LQJ A;  4BHW A;  4CUQ A;  5DLZ A;  2I7K A;  5DBM A;  5F2P A;  5HFQ A;  5FFW A;  4IR3 A;  4TS8 A;  2RFJ A;  4XYA A;  3P1E A;  3IU6 A;  2DKW A;  3HMF A;  5H1U A;  5E7D A;  4YYD A;  5I89 A;  4YYK A;  3IU5 A;  2L84 A;  2I8N A;  4NR5 A;  4WHU A;  3UW9 A;  3ZYU A;  5CP5 A;  4O76 A;  3JVK A;  5CUB A;  4A9L A;  1F68 A;  4XUB A;  5IGN A;  5HJC A;  4QEV A;  5EWH A;  5HEM A;  4LZR A;  5HM0 A;  4NUE A;  4UIT A;  4ZW1 A;  5FG4 A;  5AD2 A;  4QSR A;  3UVD A;  4O70 A;  4QSP A;  4O72 A;  3JVL A;  4N4H A;  4FLP A;  4A9E A;  4BW2 A;  5CQ4 A;  5C4Q A;  5KHM A;  3P1F A;  3DWY A;  5DYX A;  5E3G A;  5C8G A;  3O35 A;  4QUT A;  5DY7 A;  5D24 A;  4LZS A;  5I88 A;  3TLP A;  4LRG A;  4N4I A;  4TT2 A;  4ZQL A;  5KTX A;  3P1D A;  3O37 A;  5A5S A;  4HBX A;  4QEW A;  5I7X A;  5ACY A;  4WHW A;  5L8U A;  4QYL A;  4HXP A;  2R0V A;  3QZT A;  3UVW A;  4QSW A;  3UV2 A;  5HQ5 A;  4TTE A;  4LC2 A;  5D3R A;  2WP2 A;  4NR7 A;  5LKT A;  4WIV A;  5D3L A;  2E3K A;  3U5M A;  4QSU A;  5E9M A;  5KO4 A;  5D25 A;  5LVQ A;  4J0R A;  2RNY A;  3FKM X;  4Z93 A;  4O7E A;  4YC9 A;  2E7N A;  5FH8 A;  5ENG A;  5G4R A;  4UIV A;  4O74 A;  4CLB A;  4NXJ A;  3I3J A;  4UIZ A;  4J3I A;  5D26 A;  5D3T A;  4O75 A;  3MUL A;  4UYF A;  5F25 A;  4QNS A;  2RNX A;  5A7C A;  4YAD A;  4YAX A;  3RCW A;  4NYV A;  5CY9 A;  5EPR A;  2MJV B;  5IGM A;  4Y03 A;  4Z6I A;  4LDF A;  4RVR A;  4PCI A;  5CUE A;  2R0S A;  4YBT A;  3UVX A;  4BJX A;  4PKL A;  5CZG A;  1WUM A;  4CUP A;  5CQA A;  5F36 A;  5EWV A;  5KU3 A;  5CGP A;  3G0J A;  4HXO A;  3G0L A;  3U5P A;  2OSS A;  4MR6 A;  4QSX A;  5BT3 A;  3P1C A;  5F1H A;  5HRX A;  5DYA A;  5IID A;  3MQM A;  5BT4 A;  5KTU A;  4MEQ A;  4PCE A;  4CFL A;  1X0J A;  2LSP B;  5D3J A;  4PY6 A;  2NXB A;  4CFK A;  5IGL A;  2RS9 B;  4A9F A;  4MEO A;  4KCX A;  5I40 A;  5FE5 A;  4HBW A;  4YY6 A;  5I86 A;  5LKU A;  4X2I A;  4CUR A;  4GPJ A;  4HBV A;  5CUD A;  2F6N A;  4YAT A;  4F3I A;  5DX4 A;  5I80 A;  5FH7 A;  4NYW A;  2L5E A;  5CQ8 A;  4TZ2 A;  5HFR A;  5FE8 A;  5CRM A;  4UYE A;  4XUA A;  5A5P A;  4IR5 A;  2OUO A;  5CPE A;  5EQ1 A;  2DAT A;  5IBN A;  3UVY A;  4QSS A;  5FE1 A;  4HBY A;  4NUC A;  5ENH A;  4YH3 A;  4QR4 A;  4Z6H A;  2FSA A; 
#chains in the Genus database with same CATH topology
 4YAB A;  1E6I A;  4QEU A;  4BW1 A;  4J1P A;  3K2J A;  4O77 A;  5EK9 A;  2RO1 A;  4KV1 A;  5TB6 A;  5D3N A;  5HRV A;  5A81 A;  5I1Q A;  5H1T A;  3HMH A;  1N72 A;  5FE3 A;  5G4S A;  5DFD A;  4XY8 A;  5II2 A;  3O33 A;  3P5O A;  5H85 A;  4UYD A;  5EI4 A;  4IOQ A;  4LR6 A;  4YYH A;  4TU4 A;  4QR5 A;  3NXB A;  5JWM A;  3S92 A;  5HEL A;  4QC3 A;  3UV5 A;  4YYI A;  5AMF A;  4CUS A;  5A82 A;  5FE6 A;  5AD3 A;  4QST A;  4NR8 A;  5DKD A;  5E9I A;  2F6J A;  5EIS A;  5C85 A;  5LJ2 A;  4QC1 A;  5F63 A;  4Z1S A;  4TYL A;  5LKX A;  4YY4 A;  5CTL A;  2WP1 A;  3MB4 A;  5FG6 A;  4NUD A;  5D3S A;  3O34 A;  4OUF A;  4NR9 A;  5A5R A;  2R10 A;  5EWD A;  4A9O A;  4YBS A;  5ENF A;  5EM3 A;  5L97 A;  5A5O A;  2DWW A;  5ENE A;  5EA1 A;  2YW5 A;  2D9E A;  4QUU A;  5ETD A;  4AKH A;  5DFC A;  4Z1Q A;  5FDZ A;  2EJN A;  5ENC A;  3JVJ A;  5F5Z A;  5EV9 A;  4O7A A;  4QZS A;  4CL9 A;  5DKC A;  4DON A;  5D3P A;  4QB3 A;  5FFY A;  5CQ7 A;  5HLS A;  3LQH A;  5E9V A;  5I29 A;  4IOO A;  4N4F A;  4TT6 A;  3LQI A;  5FE4 A;  4YYG A;  2YEM A;  5HEN A;  1WUG A;  4UIY A;  1JM4 B;  4UYG A;  5EWC A;  4O7F A;  5DYU A;  5FE2 A;  5CUC A;  4BW3 A;  4IR6 A;  5E9Y A;  2G4A A;  5C89 A;  5JI8 A;  4A9K A;  3MUK A;  5E9L A;  5A83 A;  5CRZ A;  5LJ1 A;  2OO1 A;  3ONI A;  4O78 A;  3D7C A;  2RNW A;  4MR3 A;  3SVF A;  2GRC A;  4UYF B;  3SVG A;  5FBX A;  1ZS5 A;  4NYX A;  5CQ6 A;  5EVA A;  3MB3 A;  4NRA A;  4E96 A;  5A85 A;  3MXF A;  4NRB A;  5C7N A;  4A9H A;  5D0C A;  5COI A;  1PUO A;  2DVQ A;  3AQA A;  2YQD A;  4YK0 A;  5F3A A;  5DW1 A;  4QYD A;  3Q2F A;  2YDW A;  5D7X A;  2E7O A;  4LZ2 A;  3U5K A;  5E3D A;  3U5L A;  4QY4 A;  4YYN A;  5FH6 A;  5HQ6 A;  2L85 A;  3GG3 A;  4HXM A;  4NR4 A;  5ENI A;  3AAD A;  5A5Q A;  5HRW A;  4HXN A;  5TCM A;  4O71 A;  2YYN A;  4N3W A;  4AKN A;  4KV4 A;  5EWW A;  4NR6 A;  5F1L A;  2DVV A;  5CQT A;  4CUT A;  5IGK A;  5HCL A;  5LUU A;  4QBM A;  4BW4 A;  5ENJ A;  5DW2 A;  5FFV A;  4LYI A;  5DYC A;  4IOR A;  2YEL A;  4PS5 A;  4ALG A;  3LJW A;  4MEN A;  5FG5 A;  5EIC A;  1EQF A;  4LYW A;  4Q0O A;  3JVM A;  2KTB B;  4XY9 A;  4C66 A;  4MEP A;  5EU1 A;  5I83 A;  4YBM A;  4TU6 A;  5DFB A;  5DLX A;  5E73 A;  5E0R A;  5L8T A;  2RI7 A;  3O36 A;  3U5J A;  5FE9 A;  4A9I A;  4O7C A;  4QSV A;  4PTB A;  5F61 A;  3SVH A;  4A9N A;  5FE7 A;  4A9J A;  4UYH A;  5LKZ A;  4MR5 A;  4QSQ A;  4HXL A;  4LYS A;  3U5N A;  4UIW A;  4NS5 A;  5II1 A;  3U5O A;  4IR4 A;  5DKH A;  2DVR A;  4Q0N A;  5EP7 A;  5IG6 A;  5EPS A;  5FB1 A;  4NQN A;  4YYM A;  5CUG A;  3UV4 A;  2N9G A;  4TT4 A;  5HQ7 A;  5L99 A;  5L96 A;  5K29 A;  4ZC9 A;  3S91 A;  5CQ3 A;  5CFW A;  5FE0 A;  3Q2E A;  5CU8 A;  5F60 A;  4TZ8 A;  5EPB A;  4J0S A;  4NQM A;  5E74 A;  4YH4 A;  5ENB A;  5F62 A;  4C67 A;  4QR3 A;  5A5N A;  5KTW A;  4CUU A;  4O7B A;  3LXJ A;  4NRC A;  5H1V A;  5E9K A;  5ETB A;  3DAI A;  5I7Y A;  5D3H A;  3QZS A;  4TQN A;  2H60 A;  4MR4 A;  4N4G A;  2DVS A;  5L98 A;  4OGJ A;  2D82 A;  4HXS A;  5EGU A;  4AKI A;  5LVR A;  4HXR A;  5CS8 A;  1ZKR A;  3QZV A;  4A9M A;  3VKG A;  2YEK A;  3HME A;  5C87 A;  4OGI A;  4YYJ A;  5BT5 A;  5J0D A;  5AME A;  5FB0 A;  4HXK A;  5LJ0 A;  4ALH A;  5CUA A;  5CQ5 A;  1JSP B;  2R0Y A;  4UIX A;  4UIU A;  3VKH A;  3LQJ A;  4BHW A;  4CUQ A;  5DLZ A;  2I7K A;  5DBM A;  5F2P A;  5HFQ A;  5FFW A;  4IR3 A;  4TS8 A;  2RFJ A;  4XYA A;  3P1E A;  3IU6 A;  2DKW A;  3HMF A;  5H1U A;  5E7D A;  4YYD A;  5I89 A;  4YYK A;  3IU5 A;  2L84 A;  2I8N A;  4NR5 A;  4WHU A;  3UW9 A;  3ZYU A;  5CP5 A;  4O76 A;  3JVK A;  5CUB A;  4A9L A;  1F68 A;  4XUB A;  5IGN A;  5HJC A;  4QEV A;  5EWH A;  5HEM A;  4LZR A;  5HM0 A;  4NUE A;  4UIT A;  4ZW1 A;  5FG4 A;  5AD2 A;  4QSR A;  3UVD A;  4O70 A;  4QSP A;  4O72 A;  3JVL A;  4N4H A;  4FLP A;  4A9E A;  4BW2 A;  3ERR A;  5CQ4 A;  5C4Q A;  5KHM A;  3P1F A;  3DWY A;  4AKG A;  5DYX A;  5E3G A;  5C8G A;  3O35 A;  3D1D A;  4QUT A;  5DY7 A;  5D24 A;  4LZS A;  5I88 A;  3TLP A;  4LRG A;  4N4I A;  4TT2 A;  4ZQL A;  5KTX A;  3P1D A;  3O37 A;  5A5S A;  4HBX A;  4QEW A;  5I7X A;  5ACY A;  4WHW A;  5L8U A;  4QYL A;  4HXP A;  2R0V A;  3QZT A;  3UVW A;  4QSW A;  3UV2 A;  5HQ5 A;  4TTE A;  4LC2 A;  5D3R A;  2WP2 A;  4NR7 A;  5LKT A;  4WIV A;  5D3L A;  2E3K A;  3U5M A;  4QSU A;  5E9M A;  5KO4 A;  5D25 A;  5LVQ A;  4J0R A;  2RNY A;  3FKM X;  4Z93 A;  4O7E A;  4YC9 A;  2E7N A;  5FH8 A;  5ENG A;  5G4R A;  4UIV A;  4O74 A;  4CLB A;  4NXJ A;  3I3J A;  4UIZ A;  4J3I A;  5D26 A;  5D3T A;  4O75 A;  3MUL A;  4UYF A;  5F25 A;  4QNS A;  2RNX A;  5A7C A;  4YAD A;  4YAX A;  3RCW A;  4NYV A;  5CY9 A;  5EPR A;  2MJV B;  5IGM A;  4Y03 A;  4Z6I A;  4LDF A;  4RVR A;  4PCI A;  5CUE A;  2R0S A;  4YBT A;  3UVX A;  4BJX A;  4PKL A;  5CZG A;  1WUM A;  4CUP A;  5CQA A;  5F36 A;  5EWV A;  5KU3 A;  5CGP A;  3G0J A;  4HXO A;  3G0L A;  3U5P A;  2OSS A;  4MR6 A;  4QSX A;  5BT3 A;  3P1C A;  5F1H A;  5HRX A;  5DYA A;  5IID A;  3MQM A;  5BT4 A;  5KTU A;  4MEQ A;  4PCE A;  4CFL A;  1X0J A;  2LSP B;  5D3J A;  4PY6 A;  2NXB A;  4CFK A;  5IGL A;  2RS9 B;  4A9F A;  4MEO A;  4KCX A;  5I40 A;  5FE5 A;  4AI6 A;  4HBW A;  4YY6 A;  5I86 A;  5LKU A;  4X2I A;  4CUR A;  3D1B A;  4GPJ A;  4HBV A;  5CUD A;  2F6N A;  4YAT A;  4F3I A;  5DX4 A;  5I80 A;  5FH7 A;  4NYW A;  2L5E A;  5CQ8 A;  4TZ2 A;  5HFR A;  5FE8 A;  5CRM A;  4UYE A;  4XUA A;  5A5P A;  4IR5 A;  2OUO A;  5CPE A;  5EQ1 A;  2DAT A;  5IBN A;  3UVY A;  4QSS A;  5FE1 A;  4HBY A;  4NUC A;  5ENH A;  4YH3 A;  4QR4 A;  4Z6H A;  2FSA A; 
#chains in the Genus database with same CATH homology
 4YAB A;  1E6I A;  4QEU A;  4BW1 A;  4J1P A;  3K2J A;  4O77 A;  5EK9 A;  2RO1 A;  4KV1 A;  5TB6 A;  5D3N A;  5HRV A;  5A81 A;  5I1Q A;  5H1T A;  3HMH A;  1N72 A;  5FE3 A;  5G4S A;  5DFD A;  4XY8 A;  5II2 A;  3O33 A;  3P5O A;  5H85 A;  4UYD A;  5EI4 A;  4IOQ A;  4LR6 A;  4YYH A;  4TU4 A;  4QR5 A;  3NXB A;  5JWM A;  3S92 A;  5HEL A;  4QC3 A;  3UV5 A;  4YYI A;  5AMF A;  4CUS A;  5A82 A;  5FE6 A;  5AD3 A;  4QST A;  4NR8 A;  5DKD A;  5E9I A;  2F6J A;  5EIS A;  5C85 A;  5LJ2 A;  4QC1 A;  5F63 A;  4Z1S A;  4TYL A;  5LKX A;  4YY4 A;  5CTL A;  2WP1 A;  3MB4 A;  5FG6 A;  4NUD A;  5D3S A;  3O34 A;  4OUF A;  4NR9 A;  5A5R A;  2R10 A;  5EWD A;  4A9O A;  4YBS A;  5ENF A;  5EM3 A;  5L97 A;  5A5O A;  2DWW A;  5ENE A;  5EA1 A;  2YW5 A;  2D9E A;  4QUU A;  5ETD A;  5DFC A;  4Z1Q A;  5FDZ A;  5ENC A;  3JVJ A;  5F5Z A;  5EV9 A;  4O7A A;  4QZS A;  4CL9 A;  5DKC A;  4DON A;  5D3P A;  4QB3 A;  5FFY A;  5CQ7 A;  5HLS A;  3LQH A;  5E9V A;  5I29 A;  4IOO A;  4N4F A;  4TT6 A;  3LQI A;  5FE4 A;  4YYG A;  2YEM A;  5HEN A;  1WUG A;  4UIY A;  1JM4 B;  4UYG A;  5EWC A;  4O7F A;  5DYU A;  5FE2 A;  5CUC A;  4BW3 A;  4IR6 A;  5E9Y A;  2G4A A;  5C89 A;  5JI8 A;  4A9K A;  3MUK A;  5E9L A;  5A83 A;  5CRZ A;  5LJ1 A;  2OO1 A;  3ONI A;  4O78 A;  3D7C A;  2RNW A;  4MR3 A;  3SVF A;  2GRC A;  4UYF B;  3SVG A;  5FBX A;  1ZS5 A;  4NYX A;  5CQ6 A;  5EVA A;  3MB3 A;  4NRA A;  4E96 A;  5A85 A;  3MXF A;  4NRB A;  5C7N A;  4A9H A;  5D0C A;  5COI A;  2DVQ A;  3AQA A;  2YQD A;  4YK0 A;  5F3A A;  5DW1 A;  4QYD A;  3Q2F A;  2YDW A;  5D7X A;  2E7O A;  4LZ2 A;  3U5K A;  5E3D A;  3U5L A;  4QY4 A;  4YYN A;  5FH6 A;  5HQ6 A;  2L85 A;  3GG3 A;  4HXM A;  4NR4 A;  5ENI A;  3AAD A;  5A5Q A;  5HRW A;  4HXN A;  5TCM A;  4O71 A;  2YYN A;  4N3W A;  4AKN A;  4KV4 A;  5EWW A;  4NR6 A;  5F1L A;  2DVV A;  5CQT A;  4CUT A;  5IGK A;  5HCL A;  5LUU A;  4QBM A;  4BW4 A;  5ENJ A;  5DW2 A;  5FFV A;  4LYI A;  5DYC A;  4IOR A;  2YEL A;  4PS5 A;  4ALG A;  3LJW A;  4MEN A;  5FG5 A;  5EIC A;  1EQF A;  4LYW A;  4Q0O A;  3JVM A;  2KTB B;  4XY9 A;  4C66 A;  4MEP A;  5EU1 A;  5I83 A;  4YBM A;  4TU6 A;  5DFB A;  5DLX A;  5E73 A;  5E0R A;  5L8T A;  2RI7 A;  3O36 A;  3U5J A;  5FE9 A;  4A9I A;  4O7C A;  4QSV A;  4PTB A;  5F61 A;  3SVH A;  4A9N A;  5FE7 A;  4A9J A;  4UYH A;  5LKZ A;  4MR5 A;  4QSQ A;  4HXL A;  4LYS A;  3U5N A;  4UIW A;  4NS5 A;  5II1 A;  3U5O A;  4IR4 A;  5DKH A;  2DVR A;  4Q0N A;  5EP7 A;  5IG6 A;  5EPS A;  5FB1 A;  4NQN A;  4YYM A;  5CUG A;  3UV4 A;  2N9G A;  4TT4 A;  5HQ7 A;  5L99 A;  5L96 A;  5K29 A;  4ZC9 A;  3S91 A;  5CQ3 A;  5CFW A;  5FE0 A;  3Q2E A;  5CU8 A;  5F60 A;  4TZ8 A;  5EPB A;  4J0S A;  4NQM A;  5E74 A;  4YH4 A;  5ENB A;  5F62 A;  4C67 A;  4QR3 A;  5A5N A;  5KTW A;  4CUU A;  4O7B A;  3LXJ A;  4NRC A;  5H1V A;  5E9K A;  5ETB A;  3DAI A;  5I7Y A;  5D3H A;  3QZS A;  4TQN A;  2H60 A;  4MR4 A;  4N4G A;  2DVS A;  5L98 A;  4OGJ A;  2D82 A;  4HXS A;  5EGU A;  5LVR A;  4HXR A;  5CS8 A;  3QZV A;  4A9M A;  2YEK A;  3HME A;  5C87 A;  4OGI A;  4YYJ A;  5BT5 A;  5J0D A;  5AME A;  5FB0 A;  4HXK A;  5LJ0 A;  4ALH A;  5CUA A;  5CQ5 A;  1JSP B;  2R0Y A;  4UIX A;  4UIU A;  3LQJ A;  4BHW A;  4CUQ A;  5DLZ A;  2I7K A;  5DBM A;  5F2P A;  5HFQ A;  5FFW A;  4IR3 A;  4TS8 A;  2RFJ A;  4XYA A;  3P1E A;  3IU6 A;  2DKW A;  3HMF A;  5H1U A;  5E7D A;  4YYD A;  5I89 A;  4YYK A;  3IU5 A;  2L84 A;  2I8N A;  4NR5 A;  4WHU A;  3UW9 A;  3ZYU A;  5CP5 A;  4O76 A;  3JVK A;  5CUB A;  4A9L A;  1F68 A;  4XUB A;  5IGN A;  5HJC A;  4QEV A;  5EWH A;  5HEM A;  4LZR A;  5HM0 A;  4NUE A;  4UIT A;  4ZW1 A;  5FG4 A;  5AD2 A;  4QSR A;  3UVD A;  4O70 A;  4QSP A;  4O72 A;  3JVL A;  4N4H A;  4FLP A;  4A9E A;  4BW2 A;  5CQ4 A;  5C4Q A;  5KHM A;  3P1F A;  3DWY A;  5DYX A;  5E3G A;  5C8G A;  3O35 A;  4QUT A;  5DY7 A;  5D24 A;  4LZS A;  5I88 A;  3TLP A;  4LRG A;  4N4I A;  4TT2 A;  4ZQL A;  5KTX A;  3P1D A;  3O37 A;  5A5S A;  4HBX A;  4QEW A;  5I7X A;  5ACY A;  4WHW A;  5L8U A;  4QYL A;  4HXP A;  2R0V A;  3QZT A;  3UVW A;  4QSW A;  3UV2 A;  5HQ5 A;  4TTE A;  4LC2 A;  5D3R A;  2WP2 A;  4NR7 A;  5LKT A;  4WIV A;  5D3L A;  2E3K A;  3U5M A;  4QSU A;  5E9M A;  5KO4 A;  5D25 A;  5LVQ A;  4J0R A;  2RNY A;  3FKM X;  4Z93 A;  4O7E A;  4YC9 A;  2E7N A;  5FH8 A;  5ENG A;  5G4R A;  4UIV A;  4O74 A;  4CLB A;  4NXJ A;  3I3J A;  4UIZ A;  4J3I A;  5D26 A;  5D3T A;  4O75 A;  3MUL A;  4UYF A;  5F25 A;  4QNS A;  2RNX A;  5A7C A;  4YAD A;  4YAX A;  3RCW A;  4NYV A;  5CY9 A;  5EPR A;  2MJV B;  5IGM A;  4Y03 A;  4Z6I A;  4LDF A;  4RVR A;  4PCI A;  5CUE A;  2R0S A;  4YBT A;  3UVX A;  4BJX A;  4PKL A;  5CZG A;  1WUM A;  4CUP A;  5CQA A;  5F36 A;  5EWV A;  5KU3 A;  5CGP A;  3G0J A;  4HXO A;  3G0L A;  3U5P A;  2OSS A;  4MR6 A;  4QSX A;  5BT3 A;  3P1C A;  5F1H A;  5HRX A;  5DYA A;  5IID A;  3MQM A;  5BT4 A;  5KTU A;  4MEQ A;  4PCE A;  4CFL A;  1X0J A;  2LSP B;  5D3J A;  4PY6 A;  2NXB A;  4CFK A;  5IGL A;  2RS9 B;  4A9F A;  4MEO A;  4KCX A;  5I40 A;  5FE5 A;  4HBW A;  4YY6 A;  5I86 A;  5LKU A;  4X2I A;  4CUR A;  4GPJ A;  4HBV A;  5CUD A;  2F6N A;  4YAT A;  4F3I A;  5DX4 A;  5I80 A;  5FH7 A;  4NYW A;  2L5E A;  5CQ8 A;  4TZ2 A;  5HFR A;  5FE8 A;  5CRM A;  4UYE A;  4XUA A;  5A5P A;  4IR5 A;  2OUO A;  5CPE A;  5EQ1 A;  2DAT A;  5IBN A;  3UVY A;  4QSS A;  5FE1 A;  4HBY A;  4NUC A;  5ENH A;  4YH3 A;  4QR4 A;  4Z6H A;  2FSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...