5LVQA

Crystal structure of human pcaf bromodomain in complex with compound-d (cpd-d), n-methyl-2-(tetrahydro-2h-pyran-4-yloxy)benzamide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
108
structure length
108
Chain Sequence
DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase KAT2B
publication title Discovery of New Bromodomain Scaffolds by Biosensor Fragment Screening.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5lvqA00
5I83A 3S92A 4YAXA 5CUAA 1ZS5A 5F25A 3QZVA 4QSUA 4TTEA 5CUGA 2DATA 5LJ0A 5EI4A 4O74A 4A9EA 4QC1A 5E9MA 4QSSA 4F3IA 5H1UA 4O70A 2YYNA 5E3DA 4NXJA 5E74A 4QSRA 5FE4A 5L99A 3ONIA 2YQDA 4TS8A 1F68A 4QNSA 2L5EA 3G0LA 5KTUA 3MXFA 4LZSA 2G4AA 4ZQLA 4TQNA 3JVLA 3HMHA 5EK9A 4HXNA 2GRCA 5E9IA 4YYGA 4N4IA 5AMEA 5IBNA 3G0JA 4MEOA 5FH8A 5DKDA 4CUPA 2YW5A 3I3JA 5E9LA 4QEWA 4RVRA 4QSTA 2KTBB 3MUKA 5HQ7A 4NQMA 5CPEA 5IGLA 5FH7A 5ENEA 5FH6A 4YYJA 4NR6A 4Z6HA 5CUDA 2DKWA 4LYSA 4MR3A 3U5OA 3Q2EA 4TYLA 3MB3A 5D25A 5DKCA 3LQHA 3SVHA 5FB0A 5FBXA 4HXLA 3U5PA 4LYWA 5I40A 5D3LA 4YH3A 5EPSA 5ENHA 5EWWA 5AD2A 5A85A 3UVYA 2DWWA 4YBMA 4A9OA 4UYGA 5EISA 4N3WA 4QY4A 4TU6A 4YY6A 4YATA 5EP7A 4NRBA 4TT4A 4PCEA 4MR5A 5EM3A 5ENBA 4UITA 2F6JA 2NXBA 4IORA 5KTXA 4YABA 5L8TA 4O7FA 4O7CA 2RFJA 3LQIA 5A5SA 1EQFA 5EU1A 5CUEA 2RNXA 2LSPB 3O34A 5E9YA 5I89A 5EQ1A 5EWDA 4Y03A 4CUTA 4QSPA 5L97A 3Q2FA 2RNWA 5LVRA 5CY9A 5AMFA 4BW2A 5F63A 5DX4A 5HRWA 2FSAA 5K29A 4TU4A 4X2IA 3AQAA 5ENFA 4NQNA 4PY6A 5DYCA 5HELA 5A5NA 4CFLA 5AD3A 2E3KA 5FFWA 4QBMA 5L8UA 4NYXA 5C4QA 5D24A 5C89A 5HENA 4CUSA 4MEPA 4BW3A 5II2A 1JSPB 5J0DA 4QB3A 4Z93A 4HXSA 4CL9A 5HRXA 4QC3A 5F5ZA 5L98A 4O7EA 5F36A 3S91A 2R0VA 4Q0OA 4HBYA 2N9GA 5DLXA 5FDZA 4LRGA 4ALHA 4LZ2A 2R10A 5DW2A 5HFRA 4UIYA 5ENGA 3O35A 5KU3A 5F60A 5D3HA 4BHWA 5I7XA 4CLBA 3O37A 4OGJA 4A9HA 5C87A 2YELA 4PS5A 4BJXA 4CUQA 1WUMA 4TZ8A 3MULA 4IOOA 5ENJA 4XYAA 4C66A 4A9IA 4QSXA 4NRAA 3U5MA 5CP5A 3DAIA 3P1FA 2RS9B 4UIXA 5DW1A 4OUFA 5LJ1A 5H1TA 4ALGA 4MR6A 3SVFA 3QZTA 4UIUA 4WHWA 4BW1A 4LYIA 5FG4A 5CQ3A 5DFDA 4YYMA 5E9KA 4UYEA 2R0YA 5BT4A 4MENA 3U5NA 5EV9A 5LKZA 4HXPA 5ACYA 4GPJA 5JI8A 5CUBA 4NYVA 4UYHA 5D26A 4J1PA 4NRCA 5I29A 5I88A 4NS5A 5E7DA 2YDWA 5A5RA 5II1A 2YEMA 5FE5A 4YYIA 5FE9A 4YY4A 5EICA 4UIVA 4AKNA 4N4FA 2D9EA 3JVJA 4LZRA 4QR5A 5DFCA 4UYFB 5FG6A 4YBTA 5ENCA 5CU8A 5D3TA 5DFBA 4IR3A 3U5KA 4NR4A 2DVQA 5HLSA 5F3AA 2DVRA 4WHUA 2RI7A 5IGKA 5I86A 4O7BA 4HBVA 1E6IA 4QYDA 5FFYA 5HQ5A 5BT3A 5DKHA 4NR8A 4NUEA 4XUAA 5L96A 4PTBA 5KTWA 5HQ6A 5EGUA 4LR6A 3O33A 5A83A 4A9NA 3UVXA 5CQTA 4YC9A 5A81A 4DONA 4YYHA 5G4SA 4TT6A 5JWMA 4O7AA 2F6NA 4YH4A 5LUUA 4A9LA 3O36A 5EA1A 5CTLA 3UW9A 4NR7A 4O76A 5LJ2A 3IU5A 4QZSA 3TLPA 4TZ2A 4Z1SA 5EVAA 4NR9A 5F62A 2OUOA 3GG3A 3UVDA 4YBSA 5HCLA 5I1QA 5FE7A 5FE6A 4NUCA 4HXRA 4O77A 5DYAA 4QSQA 3D7CA 4NR5A 3HMFA 5FE8A 2I7KA 3UVWA 5ETBA 2WP2A 4MR4A 5LVQA 3U5JA 2H60A 4A9KA 5D7XA 4YYDA 5FE2A 4A9JA 2WP1A 5H85A 3QZSA 5F61A 4IR4A 2OSSA 3P1EA 5FB1A 5E9VA 5HJCA 5CQ7A 4ZW1A 5H1VA 1WUGA 5IG6A 3P1DA 4IR5A 4KV4A 4A9FA 3UV4A 5C85A 4PCIA 3SVGA 2I8NA 3HMEA 4LDFA 5DBMA 4HBWA 5EPBA 2L85A 5KHMA 3AADA 3RCWA 5A5OA 5HEMA 4QSWA 5CQ8A 5FE0A 5D3JA 5LKXA 4QEUA 4HXKA 2D82A 4UYDA 4YADA 3LQJA 5HM0A 4ZC9A 5DYXA 5F1LA 5D3RA 4WIVA 4FLPA 4QR4A 4LC2A 3UV2A 5D3PA 1N72A 5E3GA 5F1HA 5HFQA 3MQMA 4HBXA 5I80A 5EPRA 5KO4A 5TB6A 2OO1A 5FE3A 5EWHA 5FFVA 5EWVA 4HXOA 4UIZA 4BW4A 5FE1A 2MJVB 5HRVA 4CUUA 4J0SA 4O72A 4Z6IA 4QSVA 4QUTA 4XUBA 5CUCA 4YK0A 3K2JA 4O75A 4YYNA 3NXBA 3FKMX 4CFKA 3LXJA 3LJWA 4IOQA 4PKLA 5ETDA 4HXMA 4A9MA 5IGNA 2DVSA 3UV5A 2R0SA 5BT5A 5C8GA 5DYUA 3P5OA 5D0CA 3JVMA 4E96A 5E0RA 5A5PA 4J3IA 5A7CA 4QUUA 5D3SA 3ZYUA 4XY8A 5FG5A 4C67A 4N4HA 5D3NA 4NUDA 5CGPA 4J0RA 5CQ4A 5CZGA 5DLZA 5LKUA 4QEVA 4NYWA 5G4RA 5DY7A 5CFWA 2L84A 5CQ6A 2YEKA 3U5LA 4KV1A 5CS8A 1JM4B 2E7OA 3P1CA 5CQAA 3MB4A 5C7NA 3JVKA 2RNYA 5E73A 4Z1QA 5F2PA 2E7NA 5IIDA 5TCMA 5LKTA 5CRMA 5COIA 4N4GA 4KCXA 4IR6A 4CURA 4QR3A 4XY9A 5I7YA 5A82A 4O78A 4O71A 3DWYA 5CQ5A 4UIWA 4QYLA 5CRZA 3IU6A 2DVVA 5EWCA 4UYFA 4MEQA 5IGMA 5A5QA 4TT2A 4YYKA 1X0JA 2RO1A 5ENIA 4OGIA 4Q0NA
chains in the Genus database with same CATH superfamily
5I83A 3S92A 4AKIA 4YAXA 5CUAA 1ZS5A 5F25A 3QZVA 4QSUA 4TTEA 5CUGA 2DATA 5LJ0A 5EI4A 4O74A 4A9EA 4QC1A 5E9MA 4QSSA 4F3IA 5H1UA 4O70A 2YYNA 5E3DA 4NXJA 5E74A 4QSRA 5FE4A 5L99A 3ONIA 2YQDA 4TS8A 1F68A 4QNSA 2L5EA 3G0LA 5KTUA 3MXFA 4LZSA 2G4AA 4ZQLA 4TQNA 3JVLA 3HMHA 5EK9A 4HXNA 2GRCA 1PUOA 5E9IA 4YYGA 4N4IA 5AMEA 5IBNA 3G0JA 4MEOA 5FH8A 5DKDA 4CUPA 2YW5A 3I3JA 5E9LA 4QEWA 4RVRA 4QSTA 2KTBB 3MUKA 5HQ7A 4NQMA 4AKHA 5CPEA 5IGLA 5FH7A 5ENEA 5FH6A 4YYJA 4NR6A 4Z6HA 5CUDA 2DKWA 4LYSA 4MR3A 3U5OA 3Q2EA 4TYLA 3MB3A 5D25A 5DKCA 3LQHA 3SVHA 5FB0A 5FBXA 4HXLA 3U5PA 4LYWA 5I40A 5D3LA 4YH3A 5EPSA 5ENHA 5EWWA 5AD2A 5A85A 3UVYA 2DWWA 4YBMA 4AKGA 4A9OA 4UYGA 3D1BA 5EISA 4N3WA 4QY4A 4TU6A 4YY6A 4YATA 5EP7A 4NRBA 4TT4A 4PCEA 4MR5A 5EM3A 5ENBA 4UITA 2F6JA 2NXBA 4IORA 5KTXA 4YABA 5L8TA 4O7FA 4O7CA 2RFJA 3LQIA 5A5SA 1EQFA 5EU1A 5CUEA 2RNXA 2LSPB 3O34A 5E9YA 5I89A 5EQ1A 5EWDA 4Y03A 4CUTA 4QSPA 5L97A 3Q2FA 2RNWA 5LVRA 5CY9A 5AMFA 4BW2A 5F63A 5DX4A 5HRWA 2FSAA 5K29A 4AI6A 4TU4A 4X2IA 3AQAA 5ENFA 4NQNA 4PY6A 5DYCA 5HELA 5A5NA 4CFLA 5AD3A 2E3KA 5FFWA 4QBMA 5L8UA 4NYXA 5C4QA 5D24A 5C89A 5HENA 4CUSA 4MEPA 4BW3A 5II2A 1JSPB 5J0DA 4QB3A 4Z93A 4HXSA 4CL9A 5HRXA 4QC3A 5F5ZA 5L98A 4O7EA 5F36A 3S91A 2R0VA 4Q0OA 4HBYA 2N9GA 5DLXA 5FDZA 4LRGA 4ALHA 4LZ2A 2R10A 5DW2A 5HFRA 4UIYA 5ENGA 3O35A 5KU3A 5F60A 5D3HA 4BHWA 5I7XA 4CLBA 3O37A 4OGJA 4A9HA 5C87A 2YELA 4PS5A 4BJXA 4CUQA 1WUMA 4TZ8A 3MULA 4IOOA 5ENJA 4XYAA 4C66A 4A9IA 4QSXA 4NRAA 3U5MA 5CP5A 3DAIA 3P1FA 2RS9B 4UIXA 5DW1A 4OUFA 5LJ1A 5H1TA 4ALGA 4MR6A 3SVFA 3QZTA 4UIUA 4WHWA 4BW1A 4LYIA 5FG4A 5CQ3A 5DFDA 4YYMA 5E9KA 4UYEA 2R0YA 5BT4A 4MENA 3U5NA 5EV9A 5LKZA 4HXPA 5ACYA 4GPJA 5JI8A 5CUBA 4NYVA 4UYHA 5D26A 4J1PA 4NRCA 5I29A 5I88A 2EJNA 4NS5A 5E7DA 2YDWA 5A5RA 5II1A 2YEMA 5FE5A 4YYIA 5FE9A 4YY4A 5EICA 4UIVA 4AKNA 4N4FA 2D9EA 3JVJA 4LZRA 4QR5A 3ERRA 5DFCA 4UYFB 5FG6A 4YBTA 5ENCA 5CU8A 5D3TA 5DFBA 4IR3A 3U5KA 4NR4A 2DVQA 5HLSA 5F3AA 2DVRA 1ZKRA 4WHUA 3VKHA 2RI7A 5IGKA 5I86A 4O7BA 4HBVA 1E6IA 4QYDA 5FFYA 3VKGA 5HQ5A 5BT3A 5DKHA 4NR8A 4NUEA 4XUAA 5L96A 4PTBA 5KTWA 5HQ6A 5EGUA 4LR6A 3O33A 5A83A 4A9NA 3UVXA 5CQTA 4YC9A 5A81A 4DONA 4YYHA 5G4SA 4TT6A 5JWMA 4O7AA 2F6NA 4YH4A 5LUUA 4A9LA 3O36A 5EA1A 5CTLA 3UW9A 4NR7A 4O76A 5LJ2A 3IU5A 4QZSA 3TLPA 4TZ2A 4Z1SA 5EVAA 4NR9A 5F62A 2OUOA 3GG3A 3UVDA 4YBSA 5HCLA 5I1QA 5FE7A 5FE6A 4NUCA 4HXRA 4O77A 5DYAA 4QSQA 3D7CA 4NR5A 3HMFA 5FE8A 2I7KA 3UVWA 5ETBA 2WP2A 4MR4A 5LVQA 3U5JA 2H60A 4A9KA 5D7XA 4YYDA 5FE2A 4A9JA 2WP1A 5H85A 3QZSA 5F61A 4IR4A 2OSSA 3P1EA 5FB1A 5E9VA 5HJCA 5CQ7A 4ZW1A 5H1VA 1WUGA 5IG6A 3P1DA 4IR5A 4KV4A 4A9FA 3UV4A 5C85A 4PCIA 3SVGA 2I8NA 3HMEA 4LDFA 5DBMA 3D1DA 4HBWA 5EPBA 2L85A 5KHMA 3AADA 3RCWA 5A5OA 5HEMA 4QSWA 5CQ8A 5FE0A 5D3JA 5LKXA 4QEUA 4HXKA 2D82A 4UYDA 4YADA 3LQJA 5HM0A 4ZC9A 5DYXA 5F1LA 5D3RA 4WIVA 4FLPA 4QR4A 4LC2A 3UV2A 5D3PA 1N72A 5E3GA 5F1HA 5HFQA 3MQMA 4HBXA 5I80A 5EPRA 5KO4A 5TB6A 2OO1A 5FE3A 5EWHA 5FFVA 5EWVA 4HXOA 4UIZA 4BW4A 5FE1A 2MJVB 5HRVA 4CUUA 4J0SA 4O72A 4Z6IA 4QSVA 4QUTA 4XUBA 5CUCA 4YK0A 3K2JA 4O75A 4YYNA 3NXBA 3FKMX 4CFKA 3LXJA 3LJWA 4IOQA 4PKLA 5ETDA 4HXMA 4A9MA 5IGNA 2DVSA 3UV5A 2R0SA 5BT5A 5C8GA 5DYUA 3P5OA 5D0CA 3JVMA 4E96A 5E0RA 5A5PA 4J3IA 5A7CA 4QUUA 5D3SA 3ZYUA 4XY8A 5FG5A 4C67A 4N4HA 5D3NA 4NUDA 5CGPA 4J0RA 5CQ4A 5CZGA 5DLZA 5LKUA 4QEVA 4NYWA 5G4RA 5DY7A 5CFWA 2L84A 5CQ6A 2YEKA 3U5LA 4KV1A 5CS8A 1JM4B 2E7OA 3P1CA 5CQAA 3MB4A 5C7NA 3JVKA 2RNYA 5E73A 4Z1QA 5F2PA 2E7NA 5IIDA 5TCMA 5LKTA 5CRMA 5COIA 4N4GA 4KCXA 4IR6A 4CURA 4QR3A 4XY9A 5I7YA 5A82A 4O78A 4O71A 3DWYA 5CQ5A 4UIWA 4QYLA 5CRZA 3IU6A 2DVVA 5EWCA 4UYFA 4MEQA 5IGMA 5A5QA 4TT2A 4YYKA 1X0JA 2RO1A 5ENIA 4OGIA 4Q0NA
chains in the Genus database with same CATH topology
5I83A 3S92A 4YAXA 5CUAA 1ZS5A 5F25A 3QZVA 4QSUA 4TTEA 5CUGA 2DATA 5LJ0A 5EI4A 4O74A 4A9EA 4QC1A 5E9MA 4QSSA 4F3IA 5H1UA 4O70A 2YYNA 5E3DA 4NXJA 5E74A 4QSRA 5FE4A 5L99A 3ONIA 2YQDA 4TS8A 1F68A 4QNSA 2L5EA 3G0LA 5KTUA 3MXFA 4LZSA 2G4AA 4ZQLA 4TQNA 3JVLA 3HMHA 5EK9A 4HXNA 2GRCA 5E9IA 4YYGA 4N4IA 5AMEA 5IBNA 3G0JA 4MEOA 5FH8A 5DKDA 4CUPA 2YW5A 3I3JA 5E9LA 4QEWA 4RVRA 4QSTA 2KTBB 3MUKA 5HQ7A 4NQMA 5CPEA 5IGLA 5FH7A 5ENEA 5FH6A 4YYJA 4NR6A 4Z6HA 5CUDA 2DKWA 4LYSA 4MR3A 3U5OA 3Q2EA 4TYLA 3MB3A 5D25A 5DKCA 3LQHA 3SVHA 5FB0A 5FBXA 4HXLA 3U5PA 4LYWA 5I40A 5D3LA 4YH3A 5EPSA 5ENHA 5EWWA 5AD2A 5A85A 3UVYA 2DWWA 4YBMA 4A9OA 4UYGA 5EISA 4N3WA 4QY4A 4TU6A 4YY6A 4YATA 5EP7A 4NRBA 4TT4A 4PCEA 4MR5A 5EM3A 5ENBA 4UITA 2F6JA 2NXBA 4IORA 5KTXA 4YABA 5L8TA 4O7FA 4O7CA 2RFJA 3LQIA 5A5SA 1EQFA 5EU1A 5CUEA 2RNXA 2LSPB 3O34A 5E9YA 5I89A 5EQ1A 5EWDA 4Y03A 4CUTA 4QSPA 5L97A 3Q2FA 2RNWA 5LVRA 5CY9A 5AMFA 4BW2A 5F63A 5DX4A 5HRWA 2FSAA 5K29A 4TU4A 4X2IA 3AQAA 5ENFA 4NQNA 4PY6A 5DYCA 5HELA 5A5NA 4CFLA 5AD3A 2E3KA 5FFWA 4QBMA 5L8UA 4NYXA 5C4QA 5D24A 5C89A 5HENA 4CUSA 4MEPA 4BW3A 5II2A 1JSPB 5J0DA 4QB3A 4Z93A 4HXSA 4CL9A 5HRXA 4QC3A 5F5ZA 5L98A 4O7EA 5F36A 3S91A 2R0VA 4Q0OA 4HBYA 2N9GA 5DLXA 5FDZA 4LRGA 4ALHA 4LZ2A 2R10A 5DW2A 5HFRA 4UIYA 5ENGA 3O35A 5KU3A 5F60A 5D3HA 4BHWA 5I7XA 4CLBA 3O37A 4OGJA 4A9HA 5C87A 2YELA 4PS5A 4BJXA 4CUQA 1WUMA 4TZ8A 3MULA 4IOOA 5ENJA 4XYAA 4C66A 4A9IA 4QSXA 4NRAA 3U5MA 5CP5A 3DAIA 3P1FA 2RS9B 4UIXA 5DW1A 4OUFA 5LJ1A 5H1TA 4ALGA 4MR6A 3SVFA 3QZTA 4UIUA 4WHWA 4BW1A 4LYIA 5FG4A 5CQ3A 5DFDA 4YYMA 5E9KA 4UYEA 2R0YA 5BT4A 4MENA 3U5NA 5EV9A 5LKZA 4HXPA 5ACYA 4GPJA 5JI8A 5CUBA 4NYVA 4UYHA 5D26A 4J1PA 4NRCA 5I29A 5I88A 4NS5A 5E7DA 2YDWA 5A5RA 5II1A 2YEMA 5FE5A 4YYIA 5FE9A 4YY4A 5EICA 4UIVA 4AKNA 4N4FA 2D9EA 3JVJA 4LZRA 4QR5A 5DFCA 4UYFB 5FG6A 4YBTA 5ENCA 5CU8A 5D3TA 5DFBA 4IR3A 3U5KA 4NR4A 2DVQA 5HLSA 5F3AA 2DVRA 4WHUA 2RI7A 5IGKA 5I86A 4O7BA 4HBVA 1E6IA 4QYDA 5FFYA 5HQ5A 5BT3A 5DKHA 4NR8A 4NUEA 4XUAA 5L96A 4PTBA 5KTWA 5HQ6A 5EGUA 4LR6A 3O33A 5A83A 4A9NA 3UVXA 5CQTA 4YC9A 5A81A 4DONA 4YYHA 5G4SA 4TT6A 5JWMA 4O7AA 2F6NA 4YH4A 5LUUA 4A9LA 3O36A 5EA1A 5CTLA 3UW9A 4NR7A 4O76A 5LJ2A 3IU5A 4QZSA 3TLPA 4TZ2A 4Z1SA 5EVAA 4NR9A 5F62A 2OUOA 3GG3A 3UVDA 4YBSA 5HCLA 5I1QA 5FE7A 5FE6A 4NUCA 4HXRA 4O77A 5DYAA 4QSQA 3D7CA 4NR5A 3HMFA 5FE8A 2I7KA 3UVWA 5ETBA 2WP2A 4MR4A 5LVQA 3U5JA 2H60A 4A9KA 5D7XA 4YYDA 5FE2A 4A9JA 2WP1A 5H85A 3QZSA 5F61A 4IR4A 2OSSA 3P1EA 5FB1A 5E9VA 5HJCA 5CQ7A 4ZW1A 5H1VA 1WUGA 5IG6A 3P1DA 4IR5A 4KV4A 4A9FA 3UV4A 5C85A 4PCIA 3SVGA 2I8NA 3HMEA 4LDFA 5DBMA 4HBWA 5EPBA 2L85A 5KHMA 3AADA 3RCWA 5A5OA 5HEMA 4QSWA 5CQ8A 5FE0A 5D3JA 5LKXA 4QEUA 4HXKA 2D82A 4UYDA 4YADA 3LQJA 5HM0A 4ZC9A 5DYXA 5F1LA 5D3RA 4WIVA 4FLPA 4QR4A 4LC2A 3UV2A 5D3PA 1N72A 5E3GA 5F1HA 5HFQA 3MQMA 4HBXA 5I80A 5EPRA 5KO4A 5TB6A 2OO1A 5FE3A 5EWHA 5FFVA 5EWVA 4HXOA 4UIZA 4BW4A 5FE1A 2MJVB 5HRVA 4CUUA 4J0SA 4O72A 4Z6IA 4QSVA 4QUTA 4XUBA 5CUCA 4YK0A 3K2JA 4O75A 4YYNA 3NXBA 3FKMX 4CFKA 3LXJA 3LJWA 4IOQA 4PKLA 5ETDA 4HXMA 4A9MA 5IGNA 2DVSA 3UV5A 2R0SA 5BT5A 5C8GA 5DYUA 3P5OA 5D0CA 3JVMA 4E96A 5E0RA 5A5PA 4J3IA 5A7CA 4QUUA 5D3SA 3ZYUA 4XY8A 5FG5A 4C67A 4N4HA 5D3NA 4NUDA 5CGPA 4J0RA 5CQ4A 5CZGA 5DLZA 5LKUA 4QEVA 4NYWA 5G4RA 5DY7A 5CFWA 2L84A 5CQ6A 2YEKA 3U5LA 4KV1A 5CS8A 1JM4B 2E7OA 3P1CA 5CQAA 3MB4A 5C7NA 3JVKA 2RNYA 5E73A 4Z1QA 5F2PA 2E7NA 5IIDA 5TCMA 5LKTA 5CRMA 5COIA 4N4GA 4KCXA 4IR6A 4CURA 4QR3A 4XY9A 5I7YA 5A82A 4O78A 4O71A 3DWYA 5CQ5A 4UIWA 4QYLA 5CRZA 3IU6A 2DVVA 5EWCA 4UYFA 4MEQA 5IGMA 5A5QA 4TT2A 4YYKA 1X0JA 2RO1A 5ENIA 4OGIA 4Q0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I83 A;  3S92 A;  4YAX A;  5CUA A;  1ZS5 A;  5F25 A;  3QZV A;  4QSU A;  4TTE A;  5CUG A;  2DAT A;  5LJ0 A;  5EI4 A;  4O74 A;  4A9E A;  4QC1 A;  5E9M A;  4QSS A;  4F3I A;  5H1U A;  4O70 A;  2YYN A;  5E3D A;  4NXJ A;  5E74 A;  4QSR A;  5FE4 A;  5L99 A;  3ONI A;  2YQD A;  4TS8 A;  1F68 A;  4QNS A;  2L5E A;  3G0L A;  5KTU A;  3MXF A;  4LZS A;  2G4A A;  4ZQL A;  4TQN A;  3JVL A;  3HMH A;  5EK9 A;  4HXN A;  2GRC A;  5E9I A;  4YYG A;  4N4I A;  5AME A;  5IBN A;  3G0J A;  4MEO A;  5FH8 A;  5DKD A;  4CUP A;  2YW5 A;  3I3J A;  5E9L A;  4QEW A;  4RVR A;  4QST A;  2KTB B;  3MUK A;  5HQ7 A;  4NQM A;  5CPE A;  5IGL A;  5FH7 A;  5ENE A;  5FH6 A;  4YYJ A;  4NR6 A;  4Z6H A;  5CUD A;  2DKW A;  4LYS A;  4MR3 A;  3U5O A;  3Q2E A;  4TYL A;  3MB3 A;  5D25 A;  5DKC A;  3LQH A;  3SVH A;  5FB0 A;  5FBX A;  4HXL A;  3U5P A;  4LYW A;  5I40 A;  5D3L A;  4YH3 A;  5EPS A;  5ENH A;  5EWW A;  5AD2 A;  5A85 A;  3UVY A;  2DWW A;  4YBM A;  4A9O A;  4UYG A;  5EIS A;  4N3W A;  4QY4 A;  4TU6 A;  4YY6 A;  4YAT A;  5EP7 A;  4NRB A;  4TT4 A;  4PCE A;  4MR5 A;  5EM3 A;  5ENB A;  4UIT A;  2F6J A;  2NXB A;  4IOR A;  5KTX A;  4YAB A;  5L8T A;  4O7F A;  4O7C A;  2RFJ A;  3LQI A;  5A5S A;  1EQF A;  5EU1 A;  5CUE A;  2RNX A;  2LSP B;  3O34 A;  5E9Y A;  5I89 A;  5EQ1 A;  5EWD A;  4Y03 A;  4CUT A;  4QSP A;  5L97 A;  3Q2F A;  2RNW A;  5LVR A;  5CY9 A;  5AMF A;  4BW2 A;  5F63 A;  5DX4 A;  5HRW A;  2FSA A;  5K29 A;  4TU4 A;  4X2I A;  3AQA A;  5ENF A;  4NQN A;  4PY6 A;  5DYC A;  5HEL A;  5A5N A;  4CFL A;  5AD3 A;  2E3K A;  5FFW A;  4QBM A;  5L8U A;  4NYX A;  5C4Q A;  5D24 A;  5C89 A;  5HEN A;  4CUS A;  4MEP A;  4BW3 A;  5II2 A;  1JSP B;  5J0D A;  4QB3 A;  4Z93 A;  4HXS A;  4CL9 A;  5HRX A;  4QC3 A;  5F5Z A;  5L98 A;  4O7E A;  5F36 A;  3S91 A;  2R0V A;  4Q0O A;  4HBY A;  2N9G A;  5DLX A;  5FDZ A;  4LRG A;  4ALH A;  4LZ2 A;  2R10 A;  5DW2 A;  5HFR A;  4UIY A;  5ENG A;  3O35 A;  5KU3 A;  5F60 A;  5D3H A;  4BHW A;  5I7X A;  4CLB A;  3O37 A;  4OGJ A;  4A9H A;  5C87 A;  2YEL A;  4PS5 A;  4BJX A;  4CUQ A;  1WUM A;  4TZ8 A;  3MUL A;  4IOO A;  5ENJ A;  4XYA A;  4C66 A;  4A9I A;  4QSX A;  4NRA A;  3U5M A;  5CP5 A;  3DAI A;  3P1F A;  2RS9 B;  4UIX A;  5DW1 A;  4OUF A;  5LJ1 A;  5H1T A;  4ALG A;  4MR6 A;  3SVF A;  3QZT A;  4UIU A;  4WHW A;  4BW1 A;  4LYI A;  5FG4 A;  5CQ3 A;  5DFD A;  4YYM A;  5E9K A;  4UYE A;  2R0Y A;  5BT4 A;  4MEN A;  3U5N A;  5EV9 A;  5LKZ A;  4HXP A;  5ACY A;  4GPJ A;  5JI8 A;  5CUB A;  4NYV A;  4UYH A;  5D26 A;  4J1P A;  4NRC A;  5I29 A;  5I88 A;  4NS5 A;  5E7D A;  2YDW A;  5A5R A;  5II1 A;  2YEM A;  5FE5 A;  4YYI A;  5FE9 A;  4YY4 A;  5EIC A;  4UIV A;  4AKN A;  4N4F A;  2D9E A;  3JVJ A;  4LZR A;  4QR5 A;  5DFC A;  4UYF B;  5FG6 A;  4YBT A;  5ENC A;  5CU8 A;  5D3T A;  5DFB A;  4IR3 A;  3U5K A;  4NR4 A;  2DVQ A;  5HLS A;  5F3A A;  2DVR A;  4WHU A;  2RI7 A;  5IGK A;  5I86 A;  4O7B A;  4HBV A;  1E6I A;  4QYD A;  5FFY A;  5HQ5 A;  5BT3 A;  5DKH A;  4NR8 A;  4NUE A;  4XUA A;  5L96 A;  4PTB A;  5KTW A;  5HQ6 A;  5EGU A;  4LR6 A;  3O33 A;  5A83 A;  4A9N A;  3UVX A;  5CQT A;  4YC9 A;  5A81 A;  4DON A;  4YYH A;  5G4S A;  4TT6 A;  5JWM A;  4O7A A;  2F6N A;  4YH4 A;  5LUU A;  4A9L A;  3O36 A;  5EA1 A;  5CTL A;  3UW9 A;  4NR7 A;  4O76 A;  5LJ2 A;  3IU5 A;  4QZS A;  3TLP A;  4TZ2 A;  4Z1S A;  5EVA A;  4NR9 A;  5F62 A;  2OUO A;  3GG3 A;  3UVD A;  4YBS A;  5HCL A;  5I1Q A;  5FE7 A;  5FE6 A;  4NUC A;  4HXR A;  4O77 A;  5DYA A;  4QSQ A;  3D7C A;  4NR5 A;  3HMF A;  5FE8 A;  2I7K A;  3UVW A;  5ETB A;  2WP2 A;  4MR4 A;  5LVQ A;  3U5J A;  2H60 A;  4A9K A;  5D7X A;  4YYD A;  5FE2 A;  4A9J A;  2WP1 A;  5H85 A;  3QZS A;  5F61 A;  4IR4 A;  2OSS A;  3P1E A;  5FB1 A;  5E9V A;  5HJC A;  5CQ7 A;  4ZW1 A;  5H1V A;  1WUG A;  5IG6 A;  3P1D A;  4IR5 A;  4KV4 A;  4A9F A;  3UV4 A;  5C85 A;  4PCI A;  3SVG A;  2I8N A;  3HME A;  4LDF A;  5DBM A;  4HBW A;  5EPB A;  2L85 A;  5KHM A;  3AAD A;  3RCW A;  5A5O A;  5HEM A;  4QSW A;  5CQ8 A;  5FE0 A;  5D3J A;  5LKX A;  4QEU A;  4HXK A;  2D82 A;  4UYD A;  4YAD A;  3LQJ A;  5HM0 A;  4ZC9 A;  5DYX A;  5F1L A;  5D3R A;  4WIV A;  4FLP A;  4QR4 A;  4LC2 A;  3UV2 A;  5D3P A;  1N72 A;  5E3G A;  5F1H A;  5HFQ A;  3MQM A;  4HBX A;  5I80 A;  5EPR A;  5KO4 A;  5TB6 A;  2OO1 A;  5FE3 A;  5EWH A;  5FFV A;  5EWV A;  4HXO A;  4UIZ A;  4BW4 A;  5FE1 A;  2MJV B;  5HRV A;  4CUU A;  4J0S A;  4O72 A;  4Z6I A;  4QSV A;  4QUT A;  4XUB A;  5CUC A;  4YK0 A;  3K2J A;  4O75 A;  4YYN A;  3NXB A;  3FKM X;  4CFK A;  3LXJ A;  3LJW A;  4IOQ A;  4PKL A;  5ETD A;  4HXM A;  4A9M A;  5IGN A;  2DVS A;  3UV5 A;  2R0S A;  5BT5 A;  5C8G A;  5DYU A;  3P5O A;  5D0C A;  3JVM A;  4E96 A;  5E0R A;  5A5P A;  4J3I A;  5A7C A;  4QUU A;  5D3S A;  3ZYU A;  4XY8 A;  5FG5 A;  4C67 A;  4N4H A;  5D3N A;  4NUD A;  5CGP A;  4J0R A;  5CQ4 A;  5CZG A;  5DLZ A;  5LKU A;  4QEV A;  4NYW A;  5G4R A;  5DY7 A;  5CFW A;  2L84 A;  5CQ6 A;  2YEK A;  3U5L A;  4KV1 A;  5CS8 A;  1JM4 B;  2E7O A;  3P1C A;  5CQA A;  3MB4 A;  5C7N A;  3JVK A;  2RNY A;  5E73 A;  4Z1Q A;  5F2P A;  2E7N A;  5IID A;  5TCM A;  5LKT A;  5CRM A;  5COI A;  4N4G A;  4KCX A;  4IR6 A;  4CUR A;  4QR3 A;  4XY9 A;  5I7Y A;  5A82 A;  4O78 A;  4O71 A;  3DWY A;  5CQ5 A;  4UIW A;  4QYL A;  5CRZ A;  3IU6 A;  2DVV A;  5EWC A;  4UYF A;  4MEQ A;  5IGM A;  5A5Q A;  4TT2 A;  4YYK A;  1X0J A;  2RO1 A;  5ENI A;  4OGI A;  4Q0N A; 
#chains in the Genus database with same CATH topology
 5I83 A;  3S92 A;  4AKI A;  4YAX A;  5CUA A;  1ZS5 A;  5F25 A;  3QZV A;  4QSU A;  4TTE A;  5CUG A;  2DAT A;  5LJ0 A;  5EI4 A;  4O74 A;  4A9E A;  4QC1 A;  5E9M A;  4QSS A;  4F3I A;  5H1U A;  4O70 A;  2YYN A;  5E3D A;  4NXJ A;  5E74 A;  4QSR A;  5FE4 A;  5L99 A;  3ONI A;  2YQD A;  4TS8 A;  1F68 A;  4QNS A;  2L5E A;  3G0L A;  5KTU A;  3MXF A;  4LZS A;  2G4A A;  4ZQL A;  4TQN A;  3JVL A;  3HMH A;  5EK9 A;  4HXN A;  2GRC A;  1PUO A;  5E9I A;  4YYG A;  4N4I A;  5AME A;  5IBN A;  3G0J A;  4MEO A;  5FH8 A;  5DKD A;  4CUP A;  2YW5 A;  3I3J A;  5E9L A;  4QEW A;  4RVR A;  4QST A;  2KTB B;  3MUK A;  5HQ7 A;  4NQM A;  4AKH A;  5CPE A;  5IGL A;  5FH7 A;  5ENE A;  5FH6 A;  4YYJ A;  4NR6 A;  4Z6H A;  5CUD A;  2DKW A;  4LYS A;  4MR3 A;  3U5O A;  3Q2E A;  4TYL A;  3MB3 A;  5D25 A;  5DKC A;  3LQH A;  3SVH A;  5FB0 A;  5FBX A;  4HXL A;  3U5P A;  4LYW A;  5I40 A;  5D3L A;  4YH3 A;  5EPS A;  5ENH A;  5EWW A;  5AD2 A;  5A85 A;  3UVY A;  2DWW A;  4YBM A;  4AKG A;  4A9O A;  4UYG A;  3D1B A;  5EIS A;  4N3W A;  4QY4 A;  4TU6 A;  4YY6 A;  4YAT A;  5EP7 A;  4NRB A;  4TT4 A;  4PCE A;  4MR5 A;  5EM3 A;  5ENB A;  4UIT A;  2F6J A;  2NXB A;  4IOR A;  5KTX A;  4YAB A;  5L8T A;  4O7F A;  4O7C A;  2RFJ A;  3LQI A;  5A5S A;  1EQF A;  5EU1 A;  5CUE A;  2RNX A;  2LSP B;  3O34 A;  5E9Y A;  5I89 A;  5EQ1 A;  5EWD A;  4Y03 A;  4CUT A;  4QSP A;  5L97 A;  3Q2F A;  2RNW A;  5LVR A;  5CY9 A;  5AMF A;  4BW2 A;  5F63 A;  5DX4 A;  5HRW A;  2FSA A;  5K29 A;  4AI6 A;  4TU4 A;  4X2I A;  3AQA A;  5ENF A;  4NQN A;  4PY6 A;  5DYC A;  5HEL A;  5A5N A;  4CFL A;  5AD3 A;  2E3K A;  5FFW A;  4QBM A;  5L8U A;  4NYX A;  5C4Q A;  5D24 A;  5C89 A;  5HEN A;  4CUS A;  4MEP A;  4BW3 A;  5II2 A;  1JSP B;  5J0D A;  4QB3 A;  4Z93 A;  4HXS A;  4CL9 A;  5HRX A;  4QC3 A;  5F5Z A;  5L98 A;  4O7E A;  5F36 A;  3S91 A;  2R0V A;  4Q0O A;  4HBY A;  2N9G A;  5DLX A;  5FDZ A;  4LRG A;  4ALH A;  4LZ2 A;  2R10 A;  5DW2 A;  5HFR A;  4UIY A;  5ENG A;  3O35 A;  5KU3 A;  5F60 A;  5D3H A;  4BHW A;  5I7X A;  4CLB A;  3O37 A;  4OGJ A;  4A9H A;  5C87 A;  2YEL A;  4PS5 A;  4BJX A;  4CUQ A;  1WUM A;  4TZ8 A;  3MUL A;  4IOO A;  5ENJ A;  4XYA A;  4C66 A;  4A9I A;  4QSX A;  4NRA A;  3U5M A;  5CP5 A;  3DAI A;  3P1F A;  2RS9 B;  4UIX A;  5DW1 A;  4OUF A;  5LJ1 A;  5H1T A;  4ALG A;  4MR6 A;  3SVF A;  3QZT A;  4UIU A;  4WHW A;  4BW1 A;  4LYI A;  5FG4 A;  5CQ3 A;  5DFD A;  4YYM A;  5E9K A;  4UYE A;  2R0Y A;  5BT4 A;  4MEN A;  3U5N A;  5EV9 A;  5LKZ A;  4HXP A;  5ACY A;  4GPJ A;  5JI8 A;  5CUB A;  4NYV A;  4UYH A;  5D26 A;  4J1P A;  4NRC A;  5I29 A;  5I88 A;  2EJN A;  4NS5 A;  5E7D A;  2YDW A;  5A5R A;  5II1 A;  2YEM A;  5FE5 A;  4YYI A;  5FE9 A;  4YY4 A;  5EIC A;  4UIV A;  4AKN A;  4N4F A;  2D9E A;  3JVJ A;  4LZR A;  4QR5 A;  3ERR A;  5DFC A;  4UYF B;  5FG6 A;  4YBT A;  5ENC A;  5CU8 A;  5D3T A;  5DFB A;  4IR3 A;  3U5K A;  4NR4 A;  2DVQ A;  5HLS A;  5F3A A;  2DVR A;  1ZKR A;  4WHU A;  3VKH A;  2RI7 A;  5IGK A;  5I86 A;  4O7B A;  4HBV A;  1E6I A;  4QYD A;  5FFY A;  3VKG A;  5HQ5 A;  5BT3 A;  5DKH A;  4NR8 A;  4NUE A;  4XUA A;  5L96 A;  4PTB A;  5KTW A;  5HQ6 A;  5EGU A;  4LR6 A;  3O33 A;  5A83 A;  4A9N A;  3UVX A;  5CQT A;  4YC9 A;  5A81 A;  4DON A;  4YYH A;  5G4S A;  4TT6 A;  5JWM A;  4O7A A;  2F6N A;  4YH4 A;  5LUU A;  4A9L A;  3O36 A;  5EA1 A;  5CTL A;  3UW9 A;  4NR7 A;  4O76 A;  5LJ2 A;  3IU5 A;  4QZS A;  3TLP A;  4TZ2 A;  4Z1S A;  5EVA A;  4NR9 A;  5F62 A;  2OUO A;  3GG3 A;  3UVD A;  4YBS A;  5HCL A;  5I1Q A;  5FE7 A;  5FE6 A;  4NUC A;  4HXR A;  4O77 A;  5DYA A;  4QSQ A;  3D7C A;  4NR5 A;  3HMF A;  5FE8 A;  2I7K A;  3UVW A;  5ETB A;  2WP2 A;  4MR4 A;  5LVQ A;  3U5J A;  2H60 A;  4A9K A;  5D7X A;  4YYD A;  5FE2 A;  4A9J A;  2WP1 A;  5H85 A;  3QZS A;  5F61 A;  4IR4 A;  2OSS A;  3P1E A;  5FB1 A;  5E9V A;  5HJC A;  5CQ7 A;  4ZW1 A;  5H1V A;  1WUG A;  5IG6 A;  3P1D A;  4IR5 A;  4KV4 A;  4A9F A;  3UV4 A;  5C85 A;  4PCI A;  3SVG A;  2I8N A;  3HME A;  4LDF A;  5DBM A;  3D1D A;  4HBW A;  5EPB A;  2L85 A;  5KHM A;  3AAD A;  3RCW A;  5A5O A;  5HEM A;  4QSW A;  5CQ8 A;  5FE0 A;  5D3J A;  5LKX A;  4QEU A;  4HXK A;  2D82 A;  4UYD A;  4YAD A;  3LQJ A;  5HM0 A;  4ZC9 A;  5DYX A;  5F1L A;  5D3R A;  4WIV A;  4FLP A;  4QR4 A;  4LC2 A;  3UV2 A;  5D3P A;  1N72 A;  5E3G A;  5F1H A;  5HFQ A;  3MQM A;  4HBX A;  5I80 A;  5EPR A;  5KO4 A;  5TB6 A;  2OO1 A;  5FE3 A;  5EWH A;  5FFV A;  5EWV A;  4HXO A;  4UIZ A;  4BW4 A;  5FE1 A;  2MJV B;  5HRV A;  4CUU A;  4J0S A;  4O72 A;  4Z6I A;  4QSV A;  4QUT A;  4XUB A;  5CUC A;  4YK0 A;  3K2J A;  4O75 A;  4YYN A;  3NXB A;  3FKM X;  4CFK A;  3LXJ A;  3LJW A;  4IOQ A;  4PKL A;  5ETD A;  4HXM A;  4A9M A;  5IGN A;  2DVS A;  3UV5 A;  2R0S A;  5BT5 A;  5C8G A;  5DYU A;  3P5O A;  5D0C A;  3JVM A;  4E96 A;  5E0R A;  5A5P A;  4J3I A;  5A7C A;  4QUU A;  5D3S A;  3ZYU A;  4XY8 A;  5FG5 A;  4C67 A;  4N4H A;  5D3N A;  4NUD A;  5CGP A;  4J0R A;  5CQ4 A;  5CZG A;  5DLZ A;  5LKU A;  4QEV A;  4NYW A;  5G4R A;  5DY7 A;  5CFW A;  2L84 A;  5CQ6 A;  2YEK A;  3U5L A;  4KV1 A;  5CS8 A;  1JM4 B;  2E7O A;  3P1C A;  5CQA A;  3MB4 A;  5C7N A;  3JVK A;  2RNY A;  5E73 A;  4Z1Q A;  5F2P A;  2E7N A;  5IID A;  5TCM A;  5LKT A;  5CRM A;  5COI A;  4N4G A;  4KCX A;  4IR6 A;  4CUR A;  4QR3 A;  4XY9 A;  5I7Y A;  5A82 A;  4O78 A;  4O71 A;  3DWY A;  5CQ5 A;  4UIW A;  4QYL A;  5CRZ A;  3IU6 A;  2DVV A;  5EWC A;  4UYF A;  4MEQ A;  5IGM A;  5A5Q A;  4TT2 A;  4YYK A;  1X0J A;  2RO1 A;  5ENI A;  4OGI A;  4Q0N A; 
#chains in the Genus database with same CATH homology
 5I83 A;  3S92 A;  4YAX A;  5CUA A;  1ZS5 A;  5F25 A;  3QZV A;  4QSU A;  4TTE A;  5CUG A;  2DAT A;  5LJ0 A;  5EI4 A;  4O74 A;  4A9E A;  4QC1 A;  5E9M A;  4QSS A;  4F3I A;  5H1U A;  4O70 A;  2YYN A;  5E3D A;  4NXJ A;  5E74 A;  4QSR A;  5FE4 A;  5L99 A;  3ONI A;  2YQD A;  4TS8 A;  1F68 A;  4QNS A;  2L5E A;  3G0L A;  5KTU A;  3MXF A;  4LZS A;  2G4A A;  4ZQL A;  4TQN A;  3JVL A;  3HMH A;  5EK9 A;  4HXN A;  2GRC A;  5E9I A;  4YYG A;  4N4I A;  5AME A;  5IBN A;  3G0J A;  4MEO A;  5FH8 A;  5DKD A;  4CUP A;  2YW5 A;  3I3J A;  5E9L A;  4QEW A;  4RVR A;  4QST A;  2KTB B;  3MUK A;  5HQ7 A;  4NQM A;  5CPE A;  5IGL A;  5FH7 A;  5ENE A;  5FH6 A;  4YYJ A;  4NR6 A;  4Z6H A;  5CUD A;  2DKW A;  4LYS A;  4MR3 A;  3U5O A;  3Q2E A;  4TYL A;  3MB3 A;  5D25 A;  5DKC A;  3LQH A;  3SVH A;  5FB0 A;  5FBX A;  4HXL A;  3U5P A;  4LYW A;  5I40 A;  5D3L A;  4YH3 A;  5EPS A;  5ENH A;  5EWW A;  5AD2 A;  5A85 A;  3UVY A;  2DWW A;  4YBM A;  4A9O A;  4UYG A;  5EIS A;  4N3W A;  4QY4 A;  4TU6 A;  4YY6 A;  4YAT A;  5EP7 A;  4NRB A;  4TT4 A;  4PCE A;  4MR5 A;  5EM3 A;  5ENB A;  4UIT A;  2F6J A;  2NXB A;  4IOR A;  5KTX A;  4YAB A;  5L8T A;  4O7F A;  4O7C A;  2RFJ A;  3LQI A;  5A5S A;  1EQF A;  5EU1 A;  5CUE A;  2RNX A;  2LSP B;  3O34 A;  5E9Y A;  5I89 A;  5EQ1 A;  5EWD A;  4Y03 A;  4CUT A;  4QSP A;  5L97 A;  3Q2F A;  2RNW A;  5LVR A;  5CY9 A;  5AMF A;  4BW2 A;  5F63 A;  5DX4 A;  5HRW A;  2FSA A;  5K29 A;  4TU4 A;  4X2I A;  3AQA A;  5ENF A;  4NQN A;  4PY6 A;  5DYC A;  5HEL A;  5A5N A;  4CFL A;  5AD3 A;  2E3K A;  5FFW A;  4QBM A;  5L8U A;  4NYX A;  5C4Q A;  5D24 A;  5C89 A;  5HEN A;  4CUS A;  4MEP A;  4BW3 A;  5II2 A;  1JSP B;  5J0D A;  4QB3 A;  4Z93 A;  4HXS A;  4CL9 A;  5HRX A;  4QC3 A;  5F5Z A;  5L98 A;  4O7E A;  5F36 A;  3S91 A;  2R0V A;  4Q0O A;  4HBY A;  2N9G A;  5DLX A;  5FDZ A;  4LRG A;  4ALH A;  4LZ2 A;  2R10 A;  5DW2 A;  5HFR A;  4UIY A;  5ENG A;  3O35 A;  5KU3 A;  5F60 A;  5D3H A;  4BHW A;  5I7X A;  4CLB A;  3O37 A;  4OGJ A;  4A9H A;  5C87 A;  2YEL A;  4PS5 A;  4BJX A;  4CUQ A;  1WUM A;  4TZ8 A;  3MUL A;  4IOO A;  5ENJ A;  4XYA A;  4C66 A;  4A9I A;  4QSX A;  4NRA A;  3U5M A;  5CP5 A;  3DAI A;  3P1F A;  2RS9 B;  4UIX A;  5DW1 A;  4OUF A;  5LJ1 A;  5H1T A;  4ALG A;  4MR6 A;  3SVF A;  3QZT A;  4UIU A;  4WHW A;  4BW1 A;  4LYI A;  5FG4 A;  5CQ3 A;  5DFD A;  4YYM A;  5E9K A;  4UYE A;  2R0Y A;  5BT4 A;  4MEN A;  3U5N A;  5EV9 A;  5LKZ A;  4HXP A;  5ACY A;  4GPJ A;  5JI8 A;  5CUB A;  4NYV A;  4UYH A;  5D26 A;  4J1P A;  4NRC A;  5I29 A;  5I88 A;  4NS5 A;  5E7D A;  2YDW A;  5A5R A;  5II1 A;  2YEM A;  5FE5 A;  4YYI A;  5FE9 A;  4YY4 A;  5EIC A;  4UIV A;  4AKN A;  4N4F A;  2D9E A;  3JVJ A;  4LZR A;  4QR5 A;  5DFC A;  4UYF B;  5FG6 A;  4YBT A;  5ENC A;  5CU8 A;  5D3T A;  5DFB A;  4IR3 A;  3U5K A;  4NR4 A;  2DVQ A;  5HLS A;  5F3A A;  2DVR A;  4WHU A;  2RI7 A;  5IGK A;  5I86 A;  4O7B A;  4HBV A;  1E6I A;  4QYD A;  5FFY A;  5HQ5 A;  5BT3 A;  5DKH A;  4NR8 A;  4NUE A;  4XUA A;  5L96 A;  4PTB A;  5KTW A;  5HQ6 A;  5EGU A;  4LR6 A;  3O33 A;  5A83 A;  4A9N A;  3UVX A;  5CQT A;  4YC9 A;  5A81 A;  4DON A;  4YYH A;  5G4S A;  4TT6 A;  5JWM A;  4O7A A;  2F6N A;  4YH4 A;  5LUU A;  4A9L A;  3O36 A;  5EA1 A;  5CTL A;  3UW9 A;  4NR7 A;  4O76 A;  5LJ2 A;  3IU5 A;  4QZS A;  3TLP A;  4TZ2 A;  4Z1S A;  5EVA A;  4NR9 A;  5F62 A;  2OUO A;  3GG3 A;  3UVD A;  4YBS A;  5HCL A;  5I1Q A;  5FE7 A;  5FE6 A;  4NUC A;  4HXR A;  4O77 A;  5DYA A;  4QSQ A;  3D7C A;  4NR5 A;  3HMF A;  5FE8 A;  2I7K A;  3UVW A;  5ETB A;  2WP2 A;  4MR4 A;  5LVQ A;  3U5J A;  2H60 A;  4A9K A;  5D7X A;  4YYD A;  5FE2 A;  4A9J A;  2WP1 A;  5H85 A;  3QZS A;  5F61 A;  4IR4 A;  2OSS A;  3P1E A;  5FB1 A;  5E9V A;  5HJC A;  5CQ7 A;  4ZW1 A;  5H1V A;  1WUG A;  5IG6 A;  3P1D A;  4IR5 A;  4KV4 A;  4A9F A;  3UV4 A;  5C85 A;  4PCI A;  3SVG A;  2I8N A;  3HME A;  4LDF A;  5DBM A;  4HBW A;  5EPB A;  2L85 A;  5KHM A;  3AAD A;  3RCW A;  5A5O A;  5HEM A;  4QSW A;  5CQ8 A;  5FE0 A;  5D3J A;  5LKX A;  4QEU A;  4HXK A;  2D82 A;  4UYD A;  4YAD A;  3LQJ A;  5HM0 A;  4ZC9 A;  5DYX A;  5F1L A;  5D3R A;  4WIV A;  4FLP A;  4QR4 A;  4LC2 A;  3UV2 A;  5D3P A;  1N72 A;  5E3G A;  5F1H A;  5HFQ A;  3MQM A;  4HBX A;  5I80 A;  5EPR A;  5KO4 A;  5TB6 A;  2OO1 A;  5FE3 A;  5EWH A;  5FFV A;  5EWV A;  4HXO A;  4UIZ A;  4BW4 A;  5FE1 A;  2MJV B;  5HRV A;  4CUU A;  4J0S A;  4O72 A;  4Z6I A;  4QSV A;  4QUT A;  4XUB A;  5CUC A;  4YK0 A;  3K2J A;  4O75 A;  4YYN A;  3NXB A;  3FKM X;  4CFK A;  3LXJ A;  3LJW A;  4IOQ A;  4PKL A;  5ETD A;  4HXM A;  4A9M A;  5IGN A;  2DVS A;  3UV5 A;  2R0S A;  5BT5 A;  5C8G A;  5DYU A;  3P5O A;  5D0C A;  3JVM A;  4E96 A;  5E0R A;  5A5P A;  4J3I A;  5A7C A;  4QUU A;  5D3S A;  3ZYU A;  4XY8 A;  5FG5 A;  4C67 A;  4N4H A;  5D3N A;  4NUD A;  5CGP A;  4J0R A;  5CQ4 A;  5CZG A;  5DLZ A;  5LKU A;  4QEV A;  4NYW A;  5G4R A;  5DY7 A;  5CFW A;  2L84 A;  5CQ6 A;  2YEK A;  3U5L A;  4KV1 A;  5CS8 A;  1JM4 B;  2E7O A;  3P1C A;  5CQA A;  3MB4 A;  5C7N A;  3JVK A;  2RNY A;  5E73 A;  4Z1Q A;  5F2P A;  2E7N A;  5IID A;  5TCM A;  5LKT A;  5CRM A;  5COI A;  4N4G A;  4KCX A;  4IR6 A;  4CUR A;  4QR3 A;  4XY9 A;  5I7Y A;  5A82 A;  4O78 A;  4O71 A;  3DWY A;  5CQ5 A;  4UIW A;  4QYL A;  5CRZ A;  3IU6 A;  2DVV A;  5EWC A;  4UYF A;  4MEQ A;  5IGM A;  5A5Q A;  4TT2 A;  4YYK A;  1X0J A;  2RO1 A;  5ENI A;  4OGI A;  4Q0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...