5LVRA

Crystal structure of human pcaf bromodomain in complex with compound-e (cpd-e)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Histone acetyltransferase KAT2B
publication title Discovery of New Bromodomain Scaffolds by Biosensor Fragment Screening.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5lvrA00
4QSUA 4CURA 5I40A 4NQNA 5FH8A 5CFWA 4A9OA 4Y03A 5DLZA 4DONA 5FFVA 2F6JA 4YY4A 4FLPA 4J3IA 5TB6A 5ENCA 2H60A 5EWWA 4NRCA 4IR4A 5CQ7A 5A81A 3QZVA 4KCXA 4NR8A 5BT4A 5CS8A 4UYDA 2D82A 5LKUA 4MR5A 5F62A 3ONIA 4QR3A 4CL9A 5A5QA 5DYXA 4WHWA 4BW2A 5LKXA 2YELA 4UYGA 5F36A 5CUCA 5F61A 3O33A 4NUEA 5CQTA 3SVFA 3AQAA 4NUDA 4J0SA 4YBTA 5CRMA 4Q0OA 5LJ0A 5ENHA 4QSQA 4TQNA 2OSSA 4CLBA 4LC2A 2WP1A 5BT5A 4YH4A 5A5NA 5LKZA 4IOQA 4NR6A 5C87A 4IOOA 4LZRA 5I80A 5LJ2A 3SVGA 4KV1A 5DYCA 5HRXA 5TCMA 3D7CA 4X2IA 2YYNA 4O78A 4RVRA 3TLPA 4YBMA 5LVQA 5DKDA 4UYFB 3HMFA 5DW2A 4UYEA 5I89A 3MXFA 4YYNA 5DFBA 4J1PA 3P1EA 4OUFA 3MQMA 4QR4A 4QBMA 5D26A 5E9IA 3IU6A 5ENBA 5CQ8A 3O35A 4NYVA 4NYWA 3UW9A 4HXLA 4QYDA 3SVHA 5HELA 5EP7A 2RI7A 4LRGA 5C7NA 5HFQA 4TTEA 4NR5A 2YW5A 4CFLA 5CGPA 5CQ6A 5BT3A 5KTUA 4Q0NA 4MEOA 3P1CA 4UITA 5CTLA 3O37A 5HM0A 3LQIA 4QUUA 4YYIA 5F5ZA 3JVKA 4QSVA 5D0CA 5FG4A 5L99A 5HEMA 3QZTA 4HXNA 3RCWA 5FE3A 3K2JA 5ENFA 5IGLA 4YK0A 5LVRA 2E3KA 4ALHA 2I8NA 5IG6A 4ZQLA 2L5EA 4TS8A 4YY6A 5CUAA 4CUPA 5EPSA 5KHMA 4NRBA 3UV5A 5AMFA 5A5OA 5JI8A 5DKHA 5I88A 5D3RA 5DY7A 5EM3A 4HXPA 5FB0A 5FG5A 2MJVB 2RFJA 4XY8A 5H1TA 4A9FA 4YYDA 4N4HA 4GPJA 5L97A 1E6IA 4HXKA 4HBVA 5LUUA 4UIUA 5IGMA 4MEQA 2YQDA 3LQJA 4IR3A 5EPBA 4ZC9A 5E9KA 3G0LA 4CUQA 4O7EA 4YC9A 4MR6A 3U5PA 2DKWA 3MB4A 4YH3A 4XYAA 5A82A 3U5NA 4YBSA 4NQMA 4TU6A 4QSXA 3LXJA 3P1FA 5F1HA 5CQAA 5CUDA 4NXJA 3IU5A 5FE8A 5IGKA 4TT2A 4Z1QA 4HXSA 4QR5A 2RNXA 5COIA 5AMEA 4HXOA 4QEWA 4BW4A 5DFDA 4IR6A 5J0DA 4J0RA 5CUEA 1F68A 3U5LA 3UV2A 1JM4B 4CFKA 5E9LA 2FSAA 4YADA 3UVWA 2F6NA 4QSSA 4PKLA 5FDZA 5E73A 5DYAA 5E9MA 2YEKA 5A83A 3U5MA 5FE9A 2R0VA 4NR7A 5DYUA 4QSRA 2WP2A 4NR9A 4NYXA 4NS5A 3MUKA 5KTXA 5A5PA 4LDFA 5FE6A 4NRAA 5E9VA 5IGNA 4YYGA 5DX4A 4CUTA 4YYKA 4ZW1A 5HRVA 4Z93A 3AADA 3MULA 4YAXA 5L8TA 4OGIA 4QY4A 3P5OA 5A5SA 5G4SA 3JVLA 5C89A 5FG6A 2LSPB 5ENGA 3U5JA 5H1UA 5E3DA 3LQHA 3O34A 2DVQA 3G0JA 5L96A 5ETDA 3JVMA 5A7CA 2KTBB 5EICA 4Z1SA 4N3WA 5D3SA 5LKTA 4O70A 5HQ7A 5I7XA 4O7AA 5E7DA 4A9LA 2DATA 2R0SA 3ZYUA 4TZ8A 4N4FA 5ACYA 4LZ2A 5D24A 1ZS5A 4UIXA 2N9GA 5II1A 5D3PA 5EWVA 4QC3A 5CZGA 5F60A 5E9YA 4QZSA 5F2PA 2G4AA 4QSWA 3O36A 5DLXA 5IBNA 5FH6A 4A9KA 4CUUA 4LYIA 4PTBA 4E96A 4CUSA 3JVJA 5HCLA 3U5KA 5D3HA 4O71A 5C85A 5I1QA 5CQ3A 4O7FA 2GRCA 2R10A 4IR5A 4UIZA 2I7KA 1WUMA 3DWYA 5DBMA 4ALGA 5FE2A 5KO4A 5EA1A 5K29A 3DAIA 4QNSA 5EK9A 3LJWA 4N4GA 2OUOA 4NUCA 5ENEA 4OGJA 5A85A 3HMEA 4KV4A 5CUGA 5I83A 2RO1A 5E3GA 5CQ4A 5HRWA 4BW1A 5ENJA 4Z6HA 4PS5A 5KTWA 5I86A 4TU4A 4BJXA 3UVXA 1N72A 4YATA 5ENIA 5HLSA 2DWWA 2E7NA 4A9JA 4HBXA 5D3NA 3Q2EA 5C4QA 5FB1A 4UIWA 5FH7A 4UYFA 4O7CA 4UIYA 5I7YA 3GG3A 4N4IA 5C8GA 4PCIA 4LYWA 4Z6IA 5EI4A 5EWHA 5HQ6A 4O75A 5KU3A 2RNYA 4O77A 5FE1A 2YDWA 5A5RA 4YABA 4QUTA 3MB3A 3Q2FA 4UYHA 5EVAA 5EGUA 4LYSA 4AKNA 4IORA 5CQ5A 5EISA 3UVDA 5F63A 5HFRA 3I3JA 5F25A 5HENA 4MR3A 4QEVA 5E74A 3S91A 4A9EA 4NR4A 4BW3A 5FFWA 4C66A 4HXMA 4WIVA 5CRZA 5DKCA 4QSPA 3QZSA 1JSPB 3NXBA 5FE0A 4O74A 5D3TA 3UV4A 1EQFA 5CP5A 4LR6A 1WUGA 5FBXA 5H85A 2OO1A 5EPRA 5L8UA 5EWCA 5H1VA 4XUAA 4C67A 2RNWA 5LJ1A 5FE7A 5CPEA 4MR4A 5AD3A 5EQ1A 4F3IA 2DVSA 3FKMX 5E0RA 2E7OA 2YEMA 5F3AA 4MEPA 4TT4A 4QSTA 5IIDA 5EV9A 5CUBA 4MENA 2R0YA 2DVRA 5D7XA 5DW1A 4WHUA 4TT6A 4A9HA 4LZSA 2L84A 4HXRA 4O7BA 4TZ2A 1X0JA 5ETBA 4YYMA 5EU1A 4QC1A 5DFCA 5D3JA 5AD2A 5CY9A 5FE5A 4PY6A 4PCEA 4QYLA 5II2A 4HBWA 4YYHA 2NXBA 5FFYA 4A9IA 4A9NA 4QEUA 2L85A 4A9MA 4XUBA 4O72A 3P1DA 5D25A 3UVYA 4YYJA 4QB3A 5G4RA 5L98A 3S92A 2DVVA 5HJCA 4XY9A 5FE4A 4O76A 5F1LA 5I29A 4UIVA 4BHWA 5CU8A 5EWDA 5D3LA 5HQ5A 5JWMA 2D9EA 2RS9B 3U5OA 3HMHA 4TYLA 4HBYA
chains in the Genus database with same CATH superfamily
4QSUA 4CURA 5I40A 4NQNA 5FH8A 5CFWA 4A9OA 4Y03A 5DLZA 4DONA 5FFVA 2F6JA 3VKGA 4YY4A 4FLPA 4J3IA 5TB6A 5ENCA 2H60A 5EWWA 4NRCA 4IR4A 5CQ7A 5A81A 3QZVA 4KCXA 4NR8A 5BT4A 5CS8A 4UYDA 2D82A 5LKUA 4MR5A 5F62A 3ONIA 4QR3A 4CL9A 5A5QA 5DYXA 4WHWA 4BW2A 5LKXA 2YELA 4UYGA 5F36A 5CUCA 5F61A 3O33A 4NUEA 5CQTA 3SVFA 3AQAA 4NUDA 4J0SA 4YBTA 5CRMA 4Q0OA 5LJ0A 5ENHA 4QSQA 4TQNA 2OSSA 4CLBA 4LC2A 2WP1A 5BT5A 4YH4A 5A5NA 5LKZA 4IOQA 4NR6A 5C87A 4IOOA 4LZRA 5I80A 5LJ2A 3SVGA 4KV1A 5DYCA 5HRXA 5TCMA 3D7CA 4X2IA 2YYNA 4O78A 4RVRA 3TLPA 4YBMA 5LVQA 5DKDA 4UYFB 3HMFA 5DW2A 4UYEA 5I89A 3MXFA 4YYNA 5DFBA 4J1PA 3P1EA 4OUFA 3MQMA 4QR4A 4QBMA 5D26A 5E9IA 3IU6A 5ENBA 5CQ8A 3O35A 4NYVA 4NYWA 3UW9A 4HXLA 4QYDA 3SVHA 5HELA 5EP7A 2RI7A 4LRGA 5C7NA 1ZKRA 5HFQA 2EJNA 4TTEA 4NR5A 2YW5A 4CFLA 5CGPA 5CQ6A 5BT3A 5KTUA 4Q0NA 4MEOA 3P1CA 4UITA 5CTLA 3O37A 5HM0A 3LQIA 4QUUA 4YYIA 5F5ZA 3JVKA 4QSVA 5D0CA 5FG4A 5L99A 5HEMA 3QZTA 4HXNA 3RCWA 5FE3A 3K2JA 5ENFA 5IGLA 4YK0A 5LVRA 2E3KA 4ALHA 2I8NA 5IG6A 4ZQLA 2L5EA 4TS8A 4YY6A 3VKHA 5CUAA 4CUPA 5EPSA 5KHMA 4NRBA 3UV5A 5AMFA 5A5OA 5JI8A 4AI6A 5DKHA 5I88A 5D3RA 5DY7A 5EM3A 4HXPA 5FB0A 5FG5A 2MJVB 2RFJA 4XY8A 5H1TA 4A9FA 3D1BA 4YYDA 4N4HA 4GPJA 5L97A 1E6IA 4HXKA 4HBVA 5LUUA 4UIUA 5IGMA 4MEQA 2YQDA 3LQJA 4IR3A 5EPBA 4ZC9A 5E9KA 3G0LA 4CUQA 4O7EA 4YC9A 4MR6A 3D1DA 3U5PA 2DKWA 3MB4A 4YH3A 4XYAA 5A82A 3U5NA 4YBSA 4NQMA 4TU6A 4QSXA 3LXJA 3P1FA 5F1HA 5CQAA 5CUDA 4NXJA 3IU5A 5FE8A 5IGKA 4TT2A 4Z1QA 4HXSA 4QR5A 2RNXA 5COIA 5AMEA 4HXOA 4QEWA 4BW4A 5DFDA 4IR6A 5J0DA 4J0RA 5CUEA 1F68A 3U5LA 3UV2A 1JM4B 4CFKA 5E9LA 2FSAA 4YADA 3UVWA 2F6NA 4QSSA 4PKLA 5FDZA 5E73A 5DYAA 5E9MA 2YEKA 5A83A 3U5MA 5FE9A 2R0VA 4NR7A 5DYUA 4QSRA 2WP2A 4NR9A 4NYXA 4NS5A 3MUKA 5KTXA 5A5PA 4LDFA 5FE6A 4NRAA 5E9VA 5IGNA 4YYGA 5DX4A 4CUTA 4YYKA 4ZW1A 5HRVA 4Z93A 3AADA 3MULA 4YAXA 5L8TA 4OGIA 4QY4A 3P5OA 5A5SA 5G4SA 3JVLA 5C89A 5FG6A 2LSPB 5ENGA 3U5JA 5H1UA 5E3DA 3LQHA 3O34A 2DVQA 3G0JA 5L96A 5ETDA 3JVMA 5A7CA 2KTBB 5EICA 4Z1SA 4N3WA 5D3SA 3ERRA 5LKTA 4O70A 5HQ7A 5I7XA 4O7AA 5E7DA 4A9LA 2DATA 2R0SA 3ZYUA 4TZ8A 4N4FA 5ACYA 4LZ2A 5D24A 1ZS5A 4UIXA 2N9GA 5II1A 5D3PA 5EWVA 4QC3A 5CZGA 5F60A 5E9YA 4QZSA 5F2PA 2G4AA 4QSWA 3O36A 5DLXA 5IBNA 5FH6A 4A9KA 4CUUA 4LYIA 4PTBA 4E96A 4CUSA 3JVJA 5HCLA 3U5KA 5D3HA 4O71A 5C85A 5I1QA 5CQ3A 4O7FA 2GRCA 2R10A 4IR5A 4UIZA 2I7KA 1WUMA 3DWYA 5DBMA 4ALGA 5FE2A 5KO4A 5EA1A 5K29A 3DAIA 4QNSA 5EK9A 3LJWA 4N4GA 2OUOA 4NUCA 5ENEA 4OGJA 5A85A 3HMEA 4KV4A 5CUGA 5I83A 2RO1A 5E3GA 5CQ4A 5HRWA 4BW1A 5ENJA 4Z6HA 4PS5A 5KTWA 5I86A 4TU4A 4BJXA 3UVXA 1N72A 4YATA 5ENIA 5HLSA 2DWWA 2E7NA 4A9JA 4HBXA 5D3NA 3Q2EA 5C4QA 5FB1A 4UIWA 5FH7A 4UYFA 4O7CA 4UIYA 5I7YA 3GG3A 4N4IA 5C8GA 4PCIA 4LYWA 4Z6IA 5EI4A 5EWHA 5HQ6A 4O75A 5KU3A 2RNYA 4O77A 5FE1A 2YDWA 5A5RA 4YABA 4QUTA 3MB3A 3Q2FA 4UYHA 5EVAA 5EGUA 4AKIA 4LYSA 4AKNA 4IORA 5CQ5A 5EISA 3UVDA 5F63A 5HFRA 3I3JA 5F25A 5HENA 4MR3A 4QEVA 5E74A 3S91A 4A9EA 4NR4A 4BW3A 5FFWA 4C66A 4HXMA 4WIVA 5CRZA 5DKCA 4QSPA 3QZSA 1JSPB 3NXBA 5FE0A 4O74A 5D3TA 3UV4A 1EQFA 4AKHA 5CP5A 4LR6A 1WUGA 5FBXA 5H85A 2OO1A 5EPRA 5L8UA 5EWCA 5H1VA 4XUAA 4C67A 2RNWA 5LJ1A 5FE7A 5CPEA 4MR4A 5AD3A 5EQ1A 4F3IA 2DVSA 3FKMX 1PUOA 5E0RA 2E7OA 2YEMA 5F3AA 4MEPA 4TT4A 4QSTA 5IIDA 5EV9A 5CUBA 4MENA 2R0YA 2DVRA 5D7XA 5DW1A 4WHUA 4TT6A 4A9HA 4LZSA 2L84A 4HXRA 4O7BA 4TZ2A 1X0JA 5ETBA 4YYMA 5EU1A 4QC1A 5DFCA 5D3JA 5AD2A 5CY9A 5FE5A 4PY6A 4PCEA 4QYLA 5II2A 4HBWA 4YYHA 2NXBA 5FFYA 4A9IA 4A9NA 4QEUA 2L85A 4A9MA 4AKGA 4XUBA 4O72A 3P1DA 5D25A 3UVYA 4YYJA 4QB3A 5G4RA 5L98A 3S92A 2DVVA 5HJCA 4XY9A 5FE4A 4O76A 5F1LA 5I29A 4UIVA 4BHWA 5CU8A 5EWDA 5D3LA 5HQ5A 5JWMA 2D9EA 2RS9B 3U5OA 3HMHA 4TYLA 4HBYA
chains in the Genus database with same CATH topology
4QSUA 4CURA 5I40A 4NQNA 5FH8A 5CFWA 4A9OA 4Y03A 5DLZA 4DONA 5FFVA 2F6JA 4YY4A 4FLPA 4J3IA 5TB6A 5ENCA 2H60A 5EWWA 4NRCA 4IR4A 5CQ7A 5A81A 3QZVA 4KCXA 4NR8A 5BT4A 5CS8A 4UYDA 2D82A 5LKUA 4MR5A 5F62A 3ONIA 4QR3A 4CL9A 5A5QA 5DYXA 4WHWA 4BW2A 5LKXA 2YELA 4UYGA 5F36A 5CUCA 5F61A 3O33A 4NUEA 5CQTA 3SVFA 3AQAA 4NUDA 4J0SA 4YBTA 5CRMA 4Q0OA 5LJ0A 5ENHA 4QSQA 4TQNA 2OSSA 4CLBA 4LC2A 2WP1A 5BT5A 4YH4A 5A5NA 5LKZA 4IOQA 4NR6A 5C87A 4IOOA 4LZRA 5I80A 5LJ2A 3SVGA 4KV1A 5DYCA 5HRXA 5TCMA 3D7CA 4X2IA 2YYNA 4O78A 4RVRA 3TLPA 4YBMA 5LVQA 5DKDA 4UYFB 3HMFA 5DW2A 4UYEA 5I89A 3MXFA 4YYNA 5DFBA 4J1PA 3P1EA 4OUFA 3MQMA 4QR4A 4QBMA 5D26A 5E9IA 3IU6A 5ENBA 5CQ8A 3O35A 4NYVA 4NYWA 3UW9A 4HXLA 4QYDA 3SVHA 5HELA 5EP7A 2RI7A 4LRGA 5C7NA 5HFQA 4TTEA 4NR5A 2YW5A 4CFLA 5CGPA 5CQ6A 5BT3A 5KTUA 4Q0NA 4MEOA 3P1CA 4UITA 5CTLA 3O37A 5HM0A 3LQIA 4QUUA 4YYIA 5F5ZA 3JVKA 4QSVA 5D0CA 5FG4A 5L99A 5HEMA 3QZTA 4HXNA 3RCWA 5FE3A 3K2JA 5ENFA 5IGLA 4YK0A 5LVRA 2E3KA 4ALHA 2I8NA 5IG6A 4ZQLA 2L5EA 4TS8A 4YY6A 5CUAA 4CUPA 5EPSA 5KHMA 4NRBA 3UV5A 5AMFA 5A5OA 5JI8A 5DKHA 5I88A 5D3RA 5DY7A 5EM3A 4HXPA 5FB0A 5FG5A 2MJVB 2RFJA 4XY8A 5H1TA 4A9FA 4YYDA 4N4HA 4GPJA 5L97A 1E6IA 4HXKA 4HBVA 5LUUA 4UIUA 5IGMA 4MEQA 2YQDA 3LQJA 4IR3A 5EPBA 4ZC9A 5E9KA 3G0LA 4CUQA 4O7EA 4YC9A 4MR6A 3U5PA 2DKWA 3MB4A 4YH3A 4XYAA 5A82A 3U5NA 4YBSA 4NQMA 4TU6A 4QSXA 3LXJA 3P1FA 5F1HA 5CQAA 5CUDA 4NXJA 3IU5A 5FE8A 5IGKA 4TT2A 4Z1QA 4HXSA 4QR5A 2RNXA 5COIA 5AMEA 4HXOA 4QEWA 4BW4A 5DFDA 4IR6A 5J0DA 4J0RA 5CUEA 1F68A 3U5LA 3UV2A 1JM4B 4CFKA 5E9LA 2FSAA 4YADA 3UVWA 2F6NA 4QSSA 4PKLA 5FDZA 5E73A 5DYAA 5E9MA 2YEKA 5A83A 3U5MA 5FE9A 2R0VA 4NR7A 5DYUA 4QSRA 2WP2A 4NR9A 4NYXA 4NS5A 3MUKA 5KTXA 5A5PA 4LDFA 5FE6A 4NRAA 5E9VA 5IGNA 4YYGA 5DX4A 4CUTA 4YYKA 4ZW1A 5HRVA 4Z93A 3AADA 3MULA 4YAXA 5L8TA 4OGIA 4QY4A 3P5OA 5A5SA 5G4SA 3JVLA 5C89A 5FG6A 2LSPB 5ENGA 3U5JA 5H1UA 5E3DA 3LQHA 3O34A 2DVQA 3G0JA 5L96A 5ETDA 3JVMA 5A7CA 2KTBB 5EICA 4Z1SA 4N3WA 5D3SA 5LKTA 4O70A 5HQ7A 5I7XA 4O7AA 5E7DA 4A9LA 2DATA 2R0SA 3ZYUA 4TZ8A 4N4FA 5ACYA 4LZ2A 5D24A 1ZS5A 4UIXA 2N9GA 5II1A 5D3PA 5EWVA 4QC3A 5CZGA 5F60A 5E9YA 4QZSA 5F2PA 2G4AA 4QSWA 3O36A 5DLXA 5IBNA 5FH6A 4A9KA 4CUUA 4LYIA 4PTBA 4E96A 4CUSA 3JVJA 5HCLA 3U5KA 5D3HA 4O71A 5C85A 5I1QA 5CQ3A 4O7FA 2GRCA 2R10A 4IR5A 4UIZA 2I7KA 1WUMA 3DWYA 5DBMA 4ALGA 5FE2A 5KO4A 5EA1A 5K29A 3DAIA 4QNSA 5EK9A 3LJWA 4N4GA 2OUOA 4NUCA 5ENEA 4OGJA 5A85A 3HMEA 4KV4A 5CUGA 5I83A 2RO1A 5E3GA 5CQ4A 5HRWA 4BW1A 5ENJA 4Z6HA 4PS5A 5KTWA 5I86A 4TU4A 4BJXA 3UVXA 1N72A 4YATA 5ENIA 5HLSA 2DWWA 2E7NA 4A9JA 4HBXA 5D3NA 3Q2EA 5C4QA 5FB1A 4UIWA 5FH7A 4UYFA 4O7CA 4UIYA 5I7YA 3GG3A 4N4IA 5C8GA 4PCIA 4LYWA 4Z6IA 5EI4A 5EWHA 5HQ6A 4O75A 5KU3A 2RNYA 4O77A 5FE1A 2YDWA 5A5RA 4YABA 4QUTA 3MB3A 3Q2FA 4UYHA 5EVAA 5EGUA 4LYSA 4AKNA 4IORA 5CQ5A 5EISA 3UVDA 5F63A 5HFRA 3I3JA 5F25A 5HENA 4MR3A 4QEVA 5E74A 3S91A 4A9EA 4NR4A 4BW3A 5FFWA 4C66A 4HXMA 4WIVA 5CRZA 5DKCA 4QSPA 3QZSA 1JSPB 3NXBA 5FE0A 4O74A 5D3TA 3UV4A 1EQFA 5CP5A 4LR6A 1WUGA 5FBXA 5H85A 2OO1A 5EPRA 5L8UA 5EWCA 5H1VA 4XUAA 4C67A 2RNWA 5LJ1A 5FE7A 5CPEA 4MR4A 5AD3A 5EQ1A 4F3IA 2DVSA 3FKMX 5E0RA 2E7OA 2YEMA 5F3AA 4MEPA 4TT4A 4QSTA 5IIDA 5EV9A 5CUBA 4MENA 2R0YA 2DVRA 5D7XA 5DW1A 4WHUA 4TT6A 4A9HA 4LZSA 2L84A 4HXRA 4O7BA 4TZ2A 1X0JA 5ETBA 4YYMA 5EU1A 4QC1A 5DFCA 5D3JA 5AD2A 5CY9A 5FE5A 4PY6A 4PCEA 4QYLA 5II2A 4HBWA 4YYHA 2NXBA 5FFYA 4A9IA 4A9NA 4QEUA 2L85A 4A9MA 4XUBA 4O72A 3P1DA 5D25A 3UVYA 4YYJA 4QB3A 5G4RA 5L98A 3S92A 2DVVA 5HJCA 4XY9A 5FE4A 4O76A 5F1LA 5I29A 4UIVA 4BHWA 5CU8A 5EWDA 5D3LA 5HQ5A 5JWMA 2D9EA 2RS9B 3U5OA 3HMHA 4TYLA 4HBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QSU A;  4CUR A;  5I40 A;  4NQN A;  5FH8 A;  5CFW A;  4A9O A;  4Y03 A;  5DLZ A;  4DON A;  5FFV A;  2F6J A;  4YY4 A;  4FLP A;  4J3I A;  5TB6 A;  5ENC A;  2H60 A;  5EWW A;  4NRC A;  4IR4 A;  5CQ7 A;  5A81 A;  3QZV A;  4KCX A;  4NR8 A;  5BT4 A;  5CS8 A;  4UYD A;  2D82 A;  5LKU A;  4MR5 A;  5F62 A;  3ONI A;  4QR3 A;  4CL9 A;  5A5Q A;  5DYX A;  4WHW A;  4BW2 A;  5LKX A;  2YEL A;  4UYG A;  5F36 A;  5CUC A;  5F61 A;  3O33 A;  4NUE A;  5CQT A;  3SVF A;  3AQA A;  4NUD A;  4J0S A;  4YBT A;  5CRM A;  4Q0O A;  5LJ0 A;  5ENH A;  4QSQ A;  4TQN A;  2OSS A;  4CLB A;  4LC2 A;  2WP1 A;  5BT5 A;  4YH4 A;  5A5N A;  5LKZ A;  4IOQ A;  4NR6 A;  5C87 A;  4IOO A;  4LZR A;  5I80 A;  5LJ2 A;  3SVG A;  4KV1 A;  5DYC A;  5HRX A;  5TCM A;  3D7C A;  4X2I A;  2YYN A;  4O78 A;  4RVR A;  3TLP A;  4YBM A;  5LVQ A;  5DKD A;  4UYF B;  3HMF A;  5DW2 A;  4UYE A;  5I89 A;  3MXF A;  4YYN A;  5DFB A;  4J1P A;  3P1E A;  4OUF A;  3MQM A;  4QR4 A;  4QBM A;  5D26 A;  5E9I A;  3IU6 A;  5ENB A;  5CQ8 A;  3O35 A;  4NYV A;  4NYW A;  3UW9 A;  4HXL A;  4QYD A;  3SVH A;  5HEL A;  5EP7 A;  2RI7 A;  4LRG A;  5C7N A;  5HFQ A;  4TTE A;  4NR5 A;  2YW5 A;  4CFL A;  5CGP A;  5CQ6 A;  5BT3 A;  5KTU A;  4Q0N A;  4MEO A;  3P1C A;  4UIT A;  5CTL A;  3O37 A;  5HM0 A;  3LQI A;  4QUU A;  4YYI A;  5F5Z A;  3JVK A;  4QSV A;  5D0C A;  5FG4 A;  5L99 A;  5HEM A;  3QZT A;  4HXN A;  3RCW A;  5FE3 A;  3K2J A;  5ENF A;  5IGL A;  4YK0 A;  5LVR A;  2E3K A;  4ALH A;  2I8N A;  5IG6 A;  4ZQL A;  2L5E A;  4TS8 A;  4YY6 A;  5CUA A;  4CUP A;  5EPS A;  5KHM A;  4NRB A;  3UV5 A;  5AMF A;  5A5O A;  5JI8 A;  5DKH A;  5I88 A;  5D3R A;  5DY7 A;  5EM3 A;  4HXP A;  5FB0 A;  5FG5 A;  2MJV B;  2RFJ A;  4XY8 A;  5H1T A;  4A9F A;  4YYD A;  4N4H A;  4GPJ A;  5L97 A;  1E6I A;  4HXK A;  4HBV A;  5LUU A;  4UIU A;  5IGM A;  4MEQ A;  2YQD A;  3LQJ A;  4IR3 A;  5EPB A;  4ZC9 A;  5E9K A;  3G0L A;  4CUQ A;  4O7E A;  4YC9 A;  4MR6 A;  3U5P A;  2DKW A;  3MB4 A;  4YH3 A;  4XYA A;  5A82 A;  3U5N A;  4YBS A;  4NQM A;  4TU6 A;  4QSX A;  3LXJ A;  3P1F A;  5F1H A;  5CQA A;  5CUD A;  4NXJ A;  3IU5 A;  5FE8 A;  5IGK A;  4TT2 A;  4Z1Q A;  4HXS A;  4QR5 A;  2RNX A;  5COI A;  5AME A;  4HXO A;  4QEW A;  4BW4 A;  5DFD A;  4IR6 A;  5J0D A;  4J0R A;  5CUE A;  1F68 A;  3U5L A;  3UV2 A;  1JM4 B;  4CFK A;  5E9L A;  2FSA A;  4YAD A;  3UVW A;  2F6N A;  4QSS A;  4PKL A;  5FDZ A;  5E73 A;  5DYA A;  5E9M A;  2YEK A;  5A83 A;  3U5M A;  5FE9 A;  2R0V A;  4NR7 A;  5DYU A;  4QSR A;  2WP2 A;  4NR9 A;  4NYX A;  4NS5 A;  3MUK A;  5KTX A;  5A5P A;  4LDF A;  5FE6 A;  4NRA A;  5E9V A;  5IGN A;  4YYG A;  5DX4 A;  4CUT A;  4YYK A;  4ZW1 A;  5HRV A;  4Z93 A;  3AAD A;  3MUL A;  4YAX A;  5L8T A;  4OGI A;  4QY4 A;  3P5O A;  5A5S A;  5G4S A;  3JVL A;  5C89 A;  5FG6 A;  2LSP B;  5ENG A;  3U5J A;  5H1U A;  5E3D A;  3LQH A;  3O34 A;  2DVQ A;  3G0J A;  5L96 A;  5ETD A;  3JVM A;  5A7C A;  2KTB B;  5EIC A;  4Z1S A;  4N3W A;  5D3S A;  5LKT A;  4O70 A;  5HQ7 A;  5I7X A;  4O7A A;  5E7D A;  4A9L A;  2DAT A;  2R0S A;  3ZYU A;  4TZ8 A;  4N4F A;  5ACY A;  4LZ2 A;  5D24 A;  1ZS5 A;  4UIX A;  2N9G A;  5II1 A;  5D3P A;  5EWV A;  4QC3 A;  5CZG A;  5F60 A;  5E9Y A;  4QZS A;  5F2P A;  2G4A A;  4QSW A;  3O36 A;  5DLX A;  5IBN A;  5FH6 A;  4A9K A;  4CUU A;  4LYI A;  4PTB A;  4E96 A;  4CUS A;  3JVJ A;  5HCL A;  3U5K A;  5D3H A;  4O71 A;  5C85 A;  5I1Q A;  5CQ3 A;  4O7F A;  2GRC A;  2R10 A;  4IR5 A;  4UIZ A;  2I7K A;  1WUM A;  3DWY A;  5DBM A;  4ALG A;  5FE2 A;  5KO4 A;  5EA1 A;  5K29 A;  3DAI A;  4QNS A;  5EK9 A;  3LJW A;  4N4G A;  2OUO A;  4NUC A;  5ENE A;  4OGJ A;  5A85 A;  3HME A;  4KV4 A;  5CUG A;  5I83 A;  2RO1 A;  5E3G A;  5CQ4 A;  5HRW A;  4BW1 A;  5ENJ A;  4Z6H A;  4PS5 A;  5KTW A;  5I86 A;  4TU4 A;  4BJX A;  3UVX A;  1N72 A;  4YAT A;  5ENI A;  5HLS A;  2DWW A;  2E7N A;  4A9J A;  4HBX A;  5D3N A;  3Q2E A;  5C4Q A;  5FB1 A;  4UIW A;  5FH7 A;  4UYF A;  4O7C A;  4UIY A;  5I7Y A;  3GG3 A;  4N4I A;  5C8G A;  4PCI A;  4LYW A;  4Z6I A;  5EI4 A;  5EWH A;  5HQ6 A;  4O75 A;  5KU3 A;  2RNY A;  4O77 A;  5FE1 A;  2YDW A;  5A5R A;  4YAB A;  4QUT A;  3MB3 A;  3Q2F A;  4UYH A;  5EVA A;  5EGU A;  4LYS A;  4AKN A;  4IOR A;  5CQ5 A;  5EIS A;  3UVD A;  5F63 A;  5HFR A;  3I3J A;  5F25 A;  5HEN A;  4MR3 A;  4QEV A;  5E74 A;  3S91 A;  4A9E A;  4NR4 A;  4BW3 A;  5FFW A;  4C66 A;  4HXM A;  4WIV A;  5CRZ A;  5DKC A;  4QSP A;  3QZS A;  1JSP B;  3NXB A;  5FE0 A;  4O74 A;  5D3T A;  3UV4 A;  1EQF A;  5CP5 A;  4LR6 A;  1WUG A;  5FBX A;  5H85 A;  2OO1 A;  5EPR A;  5L8U A;  5EWC A;  5H1V A;  4XUA A;  4C67 A;  2RNW A;  5LJ1 A;  5FE7 A;  5CPE A;  4MR4 A;  5AD3 A;  5EQ1 A;  4F3I A;  2DVS A;  3FKM X;  5E0R A;  2E7O A;  2YEM A;  5F3A A;  4MEP A;  4TT4 A;  4QST A;  5IID A;  5EV9 A;  5CUB A;  4MEN A;  2R0Y A;  2DVR A;  5D7X A;  5DW1 A;  4WHU A;  4TT6 A;  4A9H A;  4LZS A;  2L84 A;  4HXR A;  4O7B A;  4TZ2 A;  1X0J A;  5ETB A;  4YYM A;  5EU1 A;  4QC1 A;  5DFC A;  5D3J A;  5AD2 A;  5CY9 A;  5FE5 A;  4PY6 A;  4PCE A;  4QYL A;  5II2 A;  4HBW A;  4YYH A;  2NXB A;  5FFY A;  4A9I A;  4A9N A;  4QEU A;  2L85 A;  4A9M A;  4XUB A;  4O72 A;  3P1D A;  5D25 A;  3UVY A;  4YYJ A;  4QB3 A;  5G4R A;  5L98 A;  3S92 A;  2DVV A;  5HJC A;  4XY9 A;  5FE4 A;  4O76 A;  5F1L A;  5I29 A;  4UIV A;  4BHW A;  5CU8 A;  5EWD A;  5D3L A;  5HQ5 A;  5JWM A;  2D9E A;  2RS9 B;  3U5O A;  3HMH A;  4TYL A;  4HBY A; 
#chains in the Genus database with same CATH topology
 4QSU A;  4CUR A;  5I40 A;  4NQN A;  5FH8 A;  5CFW A;  4A9O A;  4Y03 A;  5DLZ A;  4DON A;  5FFV A;  2F6J A;  3VKG A;  4YY4 A;  4FLP A;  4J3I A;  5TB6 A;  5ENC A;  2H60 A;  5EWW A;  4NRC A;  4IR4 A;  5CQ7 A;  5A81 A;  3QZV A;  4KCX A;  4NR8 A;  5BT4 A;  5CS8 A;  4UYD A;  2D82 A;  5LKU A;  4MR5 A;  5F62 A;  3ONI A;  4QR3 A;  4CL9 A;  5A5Q A;  5DYX A;  4WHW A;  4BW2 A;  5LKX A;  2YEL A;  4UYG A;  5F36 A;  5CUC A;  5F61 A;  3O33 A;  4NUE A;  5CQT A;  3SVF A;  3AQA A;  4NUD A;  4J0S A;  4YBT A;  5CRM A;  4Q0O A;  5LJ0 A;  5ENH A;  4QSQ A;  4TQN A;  2OSS A;  4CLB A;  4LC2 A;  2WP1 A;  5BT5 A;  4YH4 A;  5A5N A;  5LKZ A;  4IOQ A;  4NR6 A;  5C87 A;  4IOO A;  4LZR A;  5I80 A;  5LJ2 A;  3SVG A;  4KV1 A;  5DYC A;  5HRX A;  5TCM A;  3D7C A;  4X2I A;  2YYN A;  4O78 A;  4RVR A;  3TLP A;  4YBM A;  5LVQ A;  5DKD A;  4UYF B;  3HMF A;  5DW2 A;  4UYE A;  5I89 A;  3MXF A;  4YYN A;  5DFB A;  4J1P A;  3P1E A;  4OUF A;  3MQM A;  4QR4 A;  4QBM A;  5D26 A;  5E9I A;  3IU6 A;  5ENB A;  5CQ8 A;  3O35 A;  4NYV A;  4NYW A;  3UW9 A;  4HXL A;  4QYD A;  3SVH A;  5HEL A;  5EP7 A;  2RI7 A;  4LRG A;  5C7N A;  1ZKR A;  5HFQ A;  2EJN A;  4TTE A;  4NR5 A;  2YW5 A;  4CFL A;  5CGP A;  5CQ6 A;  5BT3 A;  5KTU A;  4Q0N A;  4MEO A;  3P1C A;  4UIT A;  5CTL A;  3O37 A;  5HM0 A;  3LQI A;  4QUU A;  4YYI A;  5F5Z A;  3JVK A;  4QSV A;  5D0C A;  5FG4 A;  5L99 A;  5HEM A;  3QZT A;  4HXN A;  3RCW A;  5FE3 A;  3K2J A;  5ENF A;  5IGL A;  4YK0 A;  5LVR A;  2E3K A;  4ALH A;  2I8N A;  5IG6 A;  4ZQL A;  2L5E A;  4TS8 A;  4YY6 A;  3VKH A;  5CUA A;  4CUP A;  5EPS A;  5KHM A;  4NRB A;  3UV5 A;  5AMF A;  5A5O A;  5JI8 A;  4AI6 A;  5DKH A;  5I88 A;  5D3R A;  5DY7 A;  5EM3 A;  4HXP A;  5FB0 A;  5FG5 A;  2MJV B;  2RFJ A;  4XY8 A;  5H1T A;  4A9F A;  3D1B A;  4YYD A;  4N4H A;  4GPJ A;  5L97 A;  1E6I A;  4HXK A;  4HBV A;  5LUU A;  4UIU A;  5IGM A;  4MEQ A;  2YQD A;  3LQJ A;  4IR3 A;  5EPB A;  4ZC9 A;  5E9K A;  3G0L A;  4CUQ A;  4O7E A;  4YC9 A;  4MR6 A;  3D1D A;  3U5P A;  2DKW A;  3MB4 A;  4YH3 A;  4XYA A;  5A82 A;  3U5N A;  4YBS A;  4NQM A;  4TU6 A;  4QSX A;  3LXJ A;  3P1F A;  5F1H A;  5CQA A;  5CUD A;  4NXJ A;  3IU5 A;  5FE8 A;  5IGK A;  4TT2 A;  4Z1Q A;  4HXS A;  4QR5 A;  2RNX A;  5COI A;  5AME A;  4HXO A;  4QEW A;  4BW4 A;  5DFD A;  4IR6 A;  5J0D A;  4J0R A;  5CUE A;  1F68 A;  3U5L A;  3UV2 A;  1JM4 B;  4CFK A;  5E9L A;  2FSA A;  4YAD A;  3UVW A;  2F6N A;  4QSS A;  4PKL A;  5FDZ A;  5E73 A;  5DYA A;  5E9M A;  2YEK A;  5A83 A;  3U5M A;  5FE9 A;  2R0V A;  4NR7 A;  5DYU A;  4QSR A;  2WP2 A;  4NR9 A;  4NYX A;  4NS5 A;  3MUK A;  5KTX A;  5A5P A;  4LDF A;  5FE6 A;  4NRA A;  5E9V A;  5IGN A;  4YYG A;  5DX4 A;  4CUT A;  4YYK A;  4ZW1 A;  5HRV A;  4Z93 A;  3AAD A;  3MUL A;  4YAX A;  5L8T A;  4OGI A;  4QY4 A;  3P5O A;  5A5S A;  5G4S A;  3JVL A;  5C89 A;  5FG6 A;  2LSP B;  5ENG A;  3U5J A;  5H1U A;  5E3D A;  3LQH A;  3O34 A;  2DVQ A;  3G0J A;  5L96 A;  5ETD A;  3JVM A;  5A7C A;  2KTB B;  5EIC A;  4Z1S A;  4N3W A;  5D3S A;  3ERR A;  5LKT A;  4O70 A;  5HQ7 A;  5I7X A;  4O7A A;  5E7D A;  4A9L A;  2DAT A;  2R0S A;  3ZYU A;  4TZ8 A;  4N4F A;  5ACY A;  4LZ2 A;  5D24 A;  1ZS5 A;  4UIX A;  2N9G A;  5II1 A;  5D3P A;  5EWV A;  4QC3 A;  5CZG A;  5F60 A;  5E9Y A;  4QZS A;  5F2P A;  2G4A A;  4QSW A;  3O36 A;  5DLX A;  5IBN A;  5FH6 A;  4A9K A;  4CUU A;  4LYI A;  4PTB A;  4E96 A;  4CUS A;  3JVJ A;  5HCL A;  3U5K A;  5D3H A;  4O71 A;  5C85 A;  5I1Q A;  5CQ3 A;  4O7F A;  2GRC A;  2R10 A;  4IR5 A;  4UIZ A;  2I7K A;  1WUM A;  3DWY A;  5DBM A;  4ALG A;  5FE2 A;  5KO4 A;  5EA1 A;  5K29 A;  3DAI A;  4QNS A;  5EK9 A;  3LJW A;  4N4G A;  2OUO A;  4NUC A;  5ENE A;  4OGJ A;  5A85 A;  3HME A;  4KV4 A;  5CUG A;  5I83 A;  2RO1 A;  5E3G A;  5CQ4 A;  5HRW A;  4BW1 A;  5ENJ A;  4Z6H A;  4PS5 A;  5KTW A;  5I86 A;  4TU4 A;  4BJX A;  3UVX A;  1N72 A;  4YAT A;  5ENI A;  5HLS A;  2DWW A;  2E7N A;  4A9J A;  4HBX A;  5D3N A;  3Q2E A;  5C4Q A;  5FB1 A;  4UIW A;  5FH7 A;  4UYF A;  4O7C A;  4UIY A;  5I7Y A;  3GG3 A;  4N4I A;  5C8G A;  4PCI A;  4LYW A;  4Z6I A;  5EI4 A;  5EWH A;  5HQ6 A;  4O75 A;  5KU3 A;  2RNY A;  4O77 A;  5FE1 A;  2YDW A;  5A5R A;  4YAB A;  4QUT A;  3MB3 A;  3Q2F A;  4UYH A;  5EVA A;  5EGU A;  4AKI A;  4LYS A;  4AKN A;  4IOR A;  5CQ5 A;  5EIS A;  3UVD A;  5F63 A;  5HFR A;  3I3J A;  5F25 A;  5HEN A;  4MR3 A;  4QEV A;  5E74 A;  3S91 A;  4A9E A;  4NR4 A;  4BW3 A;  5FFW A;  4C66 A;  4HXM A;  4WIV A;  5CRZ A;  5DKC A;  4QSP A;  3QZS A;  1JSP B;  3NXB A;  5FE0 A;  4O74 A;  5D3T A;  3UV4 A;  1EQF A;  4AKH A;  5CP5 A;  4LR6 A;  1WUG A;  5FBX A;  5H85 A;  2OO1 A;  5EPR A;  5L8U A;  5EWC A;  5H1V A;  4XUA A;  4C67 A;  2RNW A;  5LJ1 A;  5FE7 A;  5CPE A;  4MR4 A;  5AD3 A;  5EQ1 A;  4F3I A;  2DVS A;  3FKM X;  1PUO A;  5E0R A;  2E7O A;  2YEM A;  5F3A A;  4MEP A;  4TT4 A;  4QST A;  5IID A;  5EV9 A;  5CUB A;  4MEN A;  2R0Y A;  2DVR A;  5D7X A;  5DW1 A;  4WHU A;  4TT6 A;  4A9H A;  4LZS A;  2L84 A;  4HXR A;  4O7B A;  4TZ2 A;  1X0J A;  5ETB A;  4YYM A;  5EU1 A;  4QC1 A;  5DFC A;  5D3J A;  5AD2 A;  5CY9 A;  5FE5 A;  4PY6 A;  4PCE A;  4QYL A;  5II2 A;  4HBW A;  4YYH A;  2NXB A;  5FFY A;  4A9I A;  4A9N A;  4QEU A;  2L85 A;  4A9M A;  4AKG A;  4XUB A;  4O72 A;  3P1D A;  5D25 A;  3UVY A;  4YYJ A;  4QB3 A;  5G4R A;  5L98 A;  3S92 A;  2DVV A;  5HJC A;  4XY9 A;  5FE4 A;  4O76 A;  5F1L A;  5I29 A;  4UIV A;  4BHW A;  5CU8 A;  5EWD A;  5D3L A;  5HQ5 A;  5JWM A;  2D9E A;  2RS9 B;  3U5O A;  3HMH A;  4TYL A;  4HBY A; 
#chains in the Genus database with same CATH homology
 4QSU A;  4CUR A;  5I40 A;  4NQN A;  5FH8 A;  5CFW A;  4A9O A;  4Y03 A;  5DLZ A;  4DON A;  5FFV A;  2F6J A;  4YY4 A;  4FLP A;  4J3I A;  5TB6 A;  5ENC A;  2H60 A;  5EWW A;  4NRC A;  4IR4 A;  5CQ7 A;  5A81 A;  3QZV A;  4KCX A;  4NR8 A;  5BT4 A;  5CS8 A;  4UYD A;  2D82 A;  5LKU A;  4MR5 A;  5F62 A;  3ONI A;  4QR3 A;  4CL9 A;  5A5Q A;  5DYX A;  4WHW A;  4BW2 A;  5LKX A;  2YEL A;  4UYG A;  5F36 A;  5CUC A;  5F61 A;  3O33 A;  4NUE A;  5CQT A;  3SVF A;  3AQA A;  4NUD A;  4J0S A;  4YBT A;  5CRM A;  4Q0O A;  5LJ0 A;  5ENH A;  4QSQ A;  4TQN A;  2OSS A;  4CLB A;  4LC2 A;  2WP1 A;  5BT5 A;  4YH4 A;  5A5N A;  5LKZ A;  4IOQ A;  4NR6 A;  5C87 A;  4IOO A;  4LZR A;  5I80 A;  5LJ2 A;  3SVG A;  4KV1 A;  5DYC A;  5HRX A;  5TCM A;  3D7C A;  4X2I A;  2YYN A;  4O78 A;  4RVR A;  3TLP A;  4YBM A;  5LVQ A;  5DKD A;  4UYF B;  3HMF A;  5DW2 A;  4UYE A;  5I89 A;  3MXF A;  4YYN A;  5DFB A;  4J1P A;  3P1E A;  4OUF A;  3MQM A;  4QR4 A;  4QBM A;  5D26 A;  5E9I A;  3IU6 A;  5ENB A;  5CQ8 A;  3O35 A;  4NYV A;  4NYW A;  3UW9 A;  4HXL A;  4QYD A;  3SVH A;  5HEL A;  5EP7 A;  2RI7 A;  4LRG A;  5C7N A;  5HFQ A;  4TTE A;  4NR5 A;  2YW5 A;  4CFL A;  5CGP A;  5CQ6 A;  5BT3 A;  5KTU A;  4Q0N A;  4MEO A;  3P1C A;  4UIT A;  5CTL A;  3O37 A;  5HM0 A;  3LQI A;  4QUU A;  4YYI A;  5F5Z A;  3JVK A;  4QSV A;  5D0C A;  5FG4 A;  5L99 A;  5HEM A;  3QZT A;  4HXN A;  3RCW A;  5FE3 A;  3K2J A;  5ENF A;  5IGL A;  4YK0 A;  5LVR A;  2E3K A;  4ALH A;  2I8N A;  5IG6 A;  4ZQL A;  2L5E A;  4TS8 A;  4YY6 A;  5CUA A;  4CUP A;  5EPS A;  5KHM A;  4NRB A;  3UV5 A;  5AMF A;  5A5O A;  5JI8 A;  5DKH A;  5I88 A;  5D3R A;  5DY7 A;  5EM3 A;  4HXP A;  5FB0 A;  5FG5 A;  2MJV B;  2RFJ A;  4XY8 A;  5H1T A;  4A9F A;  4YYD A;  4N4H A;  4GPJ A;  5L97 A;  1E6I A;  4HXK A;  4HBV A;  5LUU A;  4UIU A;  5IGM A;  4MEQ A;  2YQD A;  3LQJ A;  4IR3 A;  5EPB A;  4ZC9 A;  5E9K A;  3G0L A;  4CUQ A;  4O7E A;  4YC9 A;  4MR6 A;  3U5P A;  2DKW A;  3MB4 A;  4YH3 A;  4XYA A;  5A82 A;  3U5N A;  4YBS A;  4NQM A;  4TU6 A;  4QSX A;  3LXJ A;  3P1F A;  5F1H A;  5CQA A;  5CUD A;  4NXJ A;  3IU5 A;  5FE8 A;  5IGK A;  4TT2 A;  4Z1Q A;  4HXS A;  4QR5 A;  2RNX A;  5COI A;  5AME A;  4HXO A;  4QEW A;  4BW4 A;  5DFD A;  4IR6 A;  5J0D A;  4J0R A;  5CUE A;  1F68 A;  3U5L A;  3UV2 A;  1JM4 B;  4CFK A;  5E9L A;  2FSA A;  4YAD A;  3UVW A;  2F6N A;  4QSS A;  4PKL A;  5FDZ A;  5E73 A;  5DYA A;  5E9M A;  2YEK A;  5A83 A;  3U5M A;  5FE9 A;  2R0V A;  4NR7 A;  5DYU A;  4QSR A;  2WP2 A;  4NR9 A;  4NYX A;  4NS5 A;  3MUK A;  5KTX A;  5A5P A;  4LDF A;  5FE6 A;  4NRA A;  5E9V A;  5IGN A;  4YYG A;  5DX4 A;  4CUT A;  4YYK A;  4ZW1 A;  5HRV A;  4Z93 A;  3AAD A;  3MUL A;  4YAX A;  5L8T A;  4OGI A;  4QY4 A;  3P5O A;  5A5S A;  5G4S A;  3JVL A;  5C89 A;  5FG6 A;  2LSP B;  5ENG A;  3U5J A;  5H1U A;  5E3D A;  3LQH A;  3O34 A;  2DVQ A;  3G0J A;  5L96 A;  5ETD A;  3JVM A;  5A7C A;  2KTB B;  5EIC A;  4Z1S A;  4N3W A;  5D3S A;  5LKT A;  4O70 A;  5HQ7 A;  5I7X A;  4O7A A;  5E7D A;  4A9L A;  2DAT A;  2R0S A;  3ZYU A;  4TZ8 A;  4N4F A;  5ACY A;  4LZ2 A;  5D24 A;  1ZS5 A;  4UIX A;  2N9G A;  5II1 A;  5D3P A;  5EWV A;  4QC3 A;  5CZG A;  5F60 A;  5E9Y A;  4QZS A;  5F2P A;  2G4A A;  4QSW A;  3O36 A;  5DLX A;  5IBN A;  5FH6 A;  4A9K A;  4CUU A;  4LYI A;  4PTB A;  4E96 A;  4CUS A;  3JVJ A;  5HCL A;  3U5K A;  5D3H A;  4O71 A;  5C85 A;  5I1Q A;  5CQ3 A;  4O7F A;  2GRC A;  2R10 A;  4IR5 A;  4UIZ A;  2I7K A;  1WUM A;  3DWY A;  5DBM A;  4ALG A;  5FE2 A;  5KO4 A;  5EA1 A;  5K29 A;  3DAI A;  4QNS A;  5EK9 A;  3LJW A;  4N4G A;  2OUO A;  4NUC A;  5ENE A;  4OGJ A;  5A85 A;  3HME A;  4KV4 A;  5CUG A;  5I83 A;  2RO1 A;  5E3G A;  5CQ4 A;  5HRW A;  4BW1 A;  5ENJ A;  4Z6H A;  4PS5 A;  5KTW A;  5I86 A;  4TU4 A;  4BJX A;  3UVX A;  1N72 A;  4YAT A;  5ENI A;  5HLS A;  2DWW A;  2E7N A;  4A9J A;  4HBX A;  5D3N A;  3Q2E A;  5C4Q A;  5FB1 A;  4UIW A;  5FH7 A;  4UYF A;  4O7C A;  4UIY A;  5I7Y A;  3GG3 A;  4N4I A;  5C8G A;  4PCI A;  4LYW A;  4Z6I A;  5EI4 A;  5EWH A;  5HQ6 A;  4O75 A;  5KU3 A;  2RNY A;  4O77 A;  5FE1 A;  2YDW A;  5A5R A;  4YAB A;  4QUT A;  3MB3 A;  3Q2F A;  4UYH A;  5EVA A;  5EGU A;  4LYS A;  4AKN A;  4IOR A;  5CQ5 A;  5EIS A;  3UVD A;  5F63 A;  5HFR A;  3I3J A;  5F25 A;  5HEN A;  4MR3 A;  4QEV A;  5E74 A;  3S91 A;  4A9E A;  4NR4 A;  4BW3 A;  5FFW A;  4C66 A;  4HXM A;  4WIV A;  5CRZ A;  5DKC A;  4QSP A;  3QZS A;  1JSP B;  3NXB A;  5FE0 A;  4O74 A;  5D3T A;  3UV4 A;  1EQF A;  5CP5 A;  4LR6 A;  1WUG A;  5FBX A;  5H85 A;  2OO1 A;  5EPR A;  5L8U A;  5EWC A;  5H1V A;  4XUA A;  4C67 A;  2RNW A;  5LJ1 A;  5FE7 A;  5CPE A;  4MR4 A;  5AD3 A;  5EQ1 A;  4F3I A;  2DVS A;  3FKM X;  5E0R A;  2E7O A;  2YEM A;  5F3A A;  4MEP A;  4TT4 A;  4QST A;  5IID A;  5EV9 A;  5CUB A;  4MEN A;  2R0Y A;  2DVR A;  5D7X A;  5DW1 A;  4WHU A;  4TT6 A;  4A9H A;  4LZS A;  2L84 A;  4HXR A;  4O7B A;  4TZ2 A;  1X0J A;  5ETB A;  4YYM A;  5EU1 A;  4QC1 A;  5DFC A;  5D3J A;  5AD2 A;  5CY9 A;  5FE5 A;  4PY6 A;  4PCE A;  4QYL A;  5II2 A;  4HBW A;  4YYH A;  2NXB A;  5FFY A;  4A9I A;  4A9N A;  4QEU A;  2L85 A;  4A9M A;  4XUB A;  4O72 A;  3P1D A;  5D25 A;  3UVY A;  4YYJ A;  4QB3 A;  5G4R A;  5L98 A;  3S92 A;  2DVV A;  5HJC A;  4XY9 A;  5FE4 A;  4O76 A;  5F1L A;  5I29 A;  4UIV A;  4BHW A;  5CU8 A;  5EWD A;  5D3L A;  5HQ5 A;  5JWM A;  2D9E A;  2RS9 B;  3U5O A;  3HMH A;  4TYL A;  4HBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...