1F4IA

Solution structure of the hhr23a uba(2) mutant p333e, deficient in binding the hiv-1 accessory protein vpr
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
45
structure length
45
Chain Sequence
QEKEAIERLKALGFEESLVIQAYFACEKNENLAANFLLSQNFDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein,transcription
molecule keywords UV EXCISION REPAIR PROTEIN PROTEIN RAD23 HOMOLOG A
publication title Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr.
pubmed doi rcsb
total genus 8
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1f4iA00
1SG9A 2DAEA 1A5TA 2DHYA 1ZMUA 1MN3A 1UFZA 2K9DA 1GO5A 1Q02A 3GLFE 2B3TA 2BWEA 3LCUA 2KNVA 2L2DA 2G3QA 2CP8A 3H4JA 1NV9A 2BWBA 4R71A 2DAMA 1DO2A 2ZTDA 2DAKA 2CWBA 2JZ0A 1VQ1A 1OQYA 3BBZA 1WGLA 1XB2B 2JY8A 2JP7A 3GLHE 2LVPC 2EKKA 3T6PA 1JR3E 4WP2A 1VEKA 2DI0A 2RRUA 4F1IA 4GEWA 2JNHA 2JZ1A 2KNAA 1AIPC 1G41A 2DENA 1HQYE 1TR8A 1VDLA 3E46A 5DFLA 4DBGB 1T43A 1R4GA 2DNAA 2LVQD 2KHHA 2MGWA 2LVOC 4Q7JA 1OTRA 2EJSA 2WZJA 2LTUA 1XXHE 1HT1E 3K9PA 1TTEA 1G3IA 5JI2E 3GLGE 1PGYA 1WJ7A 2JY5A 3LCVB 3E21A 1WHCA 1OKSA 1DV0A 1ZMVA 2DZLA 2DAIA 2OO9A 4G3OA 2LBCA 1NV8A 1IXSA 2OOAA 2HWJA 1WIVA 1C7YA 2H5XA 3GLIE 3FRIA 3MMPA 3FE3A 2L4FA 1IFYA 1Y8GA 3F92A 2L4EA 1HJPA 4F2LA 2JY7A 2K0BX 1BVSA 2LVAA 2R0IA 2HAKA 1DO0A 2OOBA 1F4IA 1CUKA 1ZV1A 1VG5A 1T6OA 1P3QQ 1E94E 2MROB 2QSFX 1WGNA 1OAIA 1EFUB 1QZEA 2ZTCA 2JUJA 2MR9A 4UN2B 1KYIA 2QNJA 1WR1B 2MJ5B 2LVNC 1V92A 3FRHA 3IHPA 2EKFA 1VEJA 1ZMWA 2O25A 2DKLA 1IM2A 1HT2E 3K9OA 1VEGA 2QHOB 2JY6B 2KNZA 2DAGA 3B89A 1YLAA 3IECA 4HEOA 1G4AE
chains in the Genus database with same CATH superfamily
5H37D 4FCTA 3BOSA 2DAEA 4L8RC 1QAOA 2DHYA 1DGBA 2K9DA 2XEPA 1XMOM 1V33A 2K6BA 4MGZE 1J09A 3GLFE 2Z3XA 1K3XA 2DZNB 1OIPA 2UUBM 4NOOB 2KNVA 1YUBA 4M0DA 3I01M 4GHAA 1JR3D 2CP8A 1IBLM 2XSZA 3SHFA 1GJSA 2GQFA 2G5GX 3M6AA 4R7GA 2K47A 1NO1A 3SAUA 2DAKA 2D7HA 2H1RA 3T15A 3TWMA 1IXSB 2HHHM 3CTWB 3U60B 4JV5M 1VQ1A 2MH8A 3AJIB 4AG6A 3BBZA 1NNJA 4LFAM 5DYGA 5FTNA 4TUWA 1E32A 2JY8A 5EQTA 1SXJD 1W5TA 1DGHB 5EP1A 2UUCM 5IT9S 1G8PA 4HL4A 3HWSA 2LVPC 3GPPA 4AZFA 3U6CA 2RGOA 5KPTA 3TL4X 4LZZA 1TH3A 2L7IA 1EIJA 5A2QS 8CATA 3D8LA 4OW0A 1K82A 2DI0A 3R9XB 4GEWA 4YY3M 1IXZA 2JNHA 2JZ1A 1TH4A 2KNAA 3V76A 4DV3M 3GLHB 1AIPC 3SASA 4DR1M 2HKJA 3FYDA 2MGWA 3I04M 3VKGA 1NJGA 1MU5A 4JI2M 1QZMA 2CRUA 3DFZA 2LTUA 2EA0A 4GHLA 1Z6TA 2XZFA 1OFIA 3NWLA 4WURA 3BXWA 3LCVB 1WHCA 1OKSA 3KSXA 4GC5A 4JXJA 1DV0A 4LF5M 1GKIA 2O5RA 1LV7A 2DZLA 3I4VA 1Z5CA 1HNZM 2M60A 2OOAA 2AHMA 4BB9A 3AFHA 2H5XA 4RF0A 2F5OA 3KS8A 3LQQA 4JI5M 4FWDA 3UJNA 3FRIA 1E9RA 3TPZA 1QVRA 1IFYA 1NNUC 1Y8GA 4GC9A 1IN6A 2LHCA 4F2LA 3ZQJA 4DR6M 1D0LA 1OIZA 2OOBA 4DV0M 4II7A 2Y0TA 3JAMS 4AKHA 2VDBB 4BBAA 1ORYB 1T6OA 1YE9A 3GRRA 4PT5A 4CJ6A 2W82A 3GLGA 4DR2M 1WGNA 3FTCA 5FLXS 3SARA 1OAIA 3FUVA 1QZEA 4MH0E 3L2AA 3M0EA 4NXMM 4LRSA 3KOYE 7CATA 2V6ZM 1YSYA 1IY1A 3WHKA 5KPZA 4DR3M 2UU9M 4IBBA 3GLIA 2DWZB 2MJ5B 1N33M 2LVNC 3KXEC 3FTEA 2Z4RA 1L2BA 4KHPM 1GL7A 4I81A 3C3DA 2FE8A 4Y28F 4IBEA 3HGIA 3AL0C 3W0FA 1I4WA 1VEJA 4QNMA 1QDRA 1ZMWA 4FVMA 4XBOA 4KO8A 4LCBA 4DV7M 4B7FA 3HU2A 1QAQA 4LJ8A 4X66M 4LF8M 3L25A 2QPAA 2VF7A 4Z8XA 3TWKA 4IBGA 4B7GA 5DNYA 3J80S 2WSEF 2KNZA 4MGHA 3J27B 4AKGA 4G4QA 1R7RA 1IQPA 5EJCA 3SMPA 3THGA 1G4AE 2KW0A 1GVNA 3K2LA 3U6OA 1HNWM 2N35A 3U6PA 4LFCM 1GO5A 4JI6M 3GQ3A 3A98B 3HHWA 3K1JA 2I7NA 4DUYM 3SYLA 2YFQA 2XGNA 3B7QA 4AI6A 4R71A 2DAMA 4A3VB 1DO2A 5LMNM 3MHVC 4MB7A 4DV2M 3HKPA 3SATA 2GNOA 2BNKA 2QBYB 3J7AS 1H6UA 3W68A 1RU3A 4L16A 3I4YA 1R2YA 3HHXA 4IBCA 3U6LA 3JR4A 2XF3A 3AOEC 5C18A 3RFWA 5ITUA 2EUCA 3SYKA 3U60A 4AKIA 2D7EA 2QENA 4WP2A 1SXJC 3A46A 4K0KM 1VEKA 3K8ZA 5FSWA 4XGIA 1OAOC 2KZSA 2RRUA 3MJ5A 3A42A 3PVSA 1DGHA 1N36M 4M9XA 2CHVA 2ZBKB 3CF6E 1IY0A 4LF6M 4FWHA 4LGMA 1Z59A 4CIZA 3HHYA 1R4GA 2DNAA 2L6OA 3U61B 3L27A 2LVOC 2DWLA 4I8OA 1OTRA 1N78A 1KFVA 4LY6A 5C1BA 2EJSA 2WZJA 4IBIA 4G4NA 3VKHA 5BPVA 2QCUA 5JI2E 2C99A 2CUZA 1PGYA 3GLGE 2JY5A 5KO3A 2KDLA 3GLHA 4RNAA 2X4AA 4M0WA 4G4OA 1E9SA 3PXGA 3U5ZB 2CHGA 1JQJC 1GABA 1MX0A 1SXJB 1XXHB 1T3TA 3GQ5A 5FTKA 4CGYB 3GLIE 3MMPA 3U6SA 4LRTA 4MGYE 5EP4A 4NSRA 3FD9A 3GRVA 2KRKA 2C98A 3GPYA 3H4MA 2L4EA 5IREB 3RGSA 1S3SA 2LNHC 2JY7A 1BVSA 2LVAA 2R0IA 2FS1A 2Z4SA 2Q2EB 2ZANA 2XSZD 1L1TA 1F4IA 1CUKA 1WXQA 3TWLA 4NXNM 4P16A 1E94E 1N75A 3QAUA 3UGJA 3KW6A 4D81A 2F5PA 4PD2A 1N77A 1PM5A 4DR7M 2EO2A 2MR9A 2Y21A 3QWLA 3UK6A 3EIHA 4L15A 2YR0A 5KPRA 4KT0F 4LF9M 3HU3A 2FNAA 4JI7M 1WR1B 2XLJA 5E6JA 3PFIA 2CV2A 4X62M 3DZDA 4DR5M 5FTMA 4OX9M 2ZAMA 4MGKE 1GLNA 2C9OA 4JYAM 2O25A 4S12A 1PJIA 4JI4M 1D0KA 1TDHA 3CGWA 3FUXA 3J2PB 3EIEA 4L78A 1D0MA 3AOGA 5L8RF 1IN7A 2L7HA 3GP1A 2QHOB 1PJTA 4D82A 2JY6B 1L2DA 4B3MM 1ZAEA 1YLAA 1PJSA 4Z6YA 1L1ZA 1NHGC 3FKEA 3J7BA 2DVWB 4G4RA 4BLCA 1ZMUA 1MN3A 1UFZA 3C9PA 4MM3B 2B3TA 2BWEA 2M5ZA 2R65A 1EE8A 1OFHA 2F5QA 1DGFA 1HNXM 2WSFF 3IG5A 4GRIA 4LJ5A 2G3QA 1JB0F 3KP0E 3LMMA 2BWBA 2R18A 2XH9A 3HY5A 2CV1A 2C96A 2YQZA 2DZOB 5EXSA 3SFZA 4LJ7A 3GLFB 3SAWA 2CWBA 2DWMA 1X37A 2OPFA 1HQCA 2RKOA 2FH0A 1WGLA 3QYEA 1IXRC 3FTFA 1XWIA 5BR8M 4GMQA 1XNQM 4AG5A 3MK6A 4M9ZA 4MGIE 4DV1M 3D8BA 5JI3E 1AUAA 3GLHE 3LVWA 3LVVA 4DUZM 2DHRA 2R45A 4KODA 3T6PA 4WW0A 4DR4M 4L6V6 3Q8GA 3SC3A 3GQ4A 1NSFA 2LWXA 3FTDA 4OVZB 2G8LA 4CISA 3B74A 3T1HM 3I51A 3AV0A 4OU7A 4IBJA 2A5YB 3GO8A 1XC8A 2DENA 4RKUF 1HQYE 1VDLA 4R3DA 5DFLA 3B7NA 4DBGB 1T43A 3TE6A 4Q7JA 2BJWA 3ZH9B 2XFSA 3KOZE 1MJGM 4FW9A 4LJ4A 4PCZA 1PJJA 3KS4A 5F3WA 1QQWA 2CE7A 2FFJA 3W0LB 1G3IA 4QHSA 4JI0M 1QYRA 3VLFB 2QZ4A 4B7HA 3UZUA 1WJ7A 4QOZC 4JI3M 2KRUA 4W5WA 1ZMVA 4LJAA 5ITXA 2C9CA 3VFDA 4EIWA 1OJLA 1GJTA 4G3OA 2R46A 1JR3A 2LBCA 4I5SA 3HJ8A 5EXPA 1N32M 3B7ZA 1IXSA 2HWJA 1XMQM 2VIIA 3U6MA 1NY6A 3RGPA 3VDUA 2HL7A 1D2NA 5E26A 2QP9X 2CV0A 2VF8A 3KFUG 1UM8A 4AW4A 1NHWC 3U6DA 1HJPA 2CEAA 3AOEA 2K0BX 5GKNA 2HAKA 3R8FA 2J5YA 3U5ZA 3J81S 3SBJA 3HX3A 3PNYA 4CHTB 1SXJA 1XXHA 1ZV1A 1VG5A 1QANA 1P3QQ 3KOWE 1NJFA 3SAVA 1IN4A 4NL4H 2QSFX 1EFUB 3CF0A 4DV6M 2ZTCA 2JUJA 4UN2B 3E4RA 5ITTA 4DV4M 2L09A 4GIPA 4I4LA 4KLNA 4AQYM 1V92A 3FRHA 2X8AA 5EXTA 5IZ7D 2EKFA 3SHGB 2VQEM 2UXCM 4GKJM 2NQ8C 1L2CA 4PDGA 4LGYA 4NRWA 4QHTA 2V1CA 3QYBA 4IBKA 1G59A 4GKKM 4B3RM 1HT2E 5ITYA 4FCVA 1V34A 1HR0M 3ILKA 1Z5BA 2DAGA 2O01F 2D7GA 3IECA 4G6ZA 4HEOA 2J7NA 1SG9A 4NC6A 1K3WA 2JWSA 1A5TA 1G71A 2KZUA 2Y20A 4L4UA 2Y0QA 4NRVA 2UXDM 1J7KA 2LHGA 1Q02A 2JA2A 1FNNA 4JN6A 4ZPXA 2XZUA 1TDZA 3LCUA 4LF4M 2JXNA 1I94M 2L2DA 2CHQA 4XK8F 3H4JA 1NV9A 4QOSA 1R6BX 2X49A 3B9PA 3FUWA 4LJ9A 3KSJA 1L8QA 2ZTDA 3RE8A 1Q3CA 3FYCA 3PNVA 1PJQA 2DXIA 3E9SA 3C58A 5FTLA 2QQ8A 3AKZA 2JZ0A 1OQYA 1IN8A 2J7OA 5KQDA 2BJVA 5ITRA 1VDDA 2Z7JA 3CF2A 1XB2B 3NBIA 3L28A 3SMSA 2ZAOA 4IBDA 4P17A 5LMUM 2JP7A 3HZJA 3GLFA 3HU1A 3VK7A 1QUSA 2APLA 2V1UA 5ITXE 3L29A 2EKKA 2F4VM 1XHBA 2KEBA 3ZCBB 1JR3E 1TGUA 3U6QA 4GITA 2Z8YM 4IJFA 4IBFA 5EP2A 4DV5M 3KOXE 4F1IA 1J5EM 1QUTA 2KXEA 3IG8A 3U6EA 3LQRA 1DGGA 3GRUA 5KQ8A 3Q8XA 1G41A 1Z5AA 1LTMA 2VQFM 5ITQA 1TR8A 1IBMM 3E46A 2HCBA 3KP1E 2RGHA 2LVQD 2KHHA 3C3EA 4PDIA 1ZQ9A 1NVMA 4GH9A 4OVZA 2DWNA 1SXJE 1XXHE 3GPXA 1HT1E 3K9PA 1TTEA 1W5SA 3T1YM 3W67A 3HHZA 3E21A 2R4EA 3LW5F 1R5LA 3VK8A 3UMMA 2F5NA 4D80A 1XNRM 2OO9A 2DAIA 2R4JA 3DOAA 1TF0B 5IWAM 3GPUA 2C5RA 1NV8A 1FJGM 3TQSA 1WIVA 4LJ6A 2OQ4A 1C7YA 2QBYA 1NY5A 4JI8M 3L26A 3OTOM 4FWGA 1KSFX 4ITQA 1IN5A 1Q39A 1IY2A 3GLGB 3FE3A 3T38A 4B3SM 2L4FA 3HJQA 4ANRA 3F92A 1Q3BA 2YNMD 4M9SA 4B3TM 5EP3A 2F5SA 1DO0A 4LZJA 4FD2A 3GLIB 2ZM6M 5DYIA 5EXXA 2MROB 2R6FA 1R2ZA 1IBKM 4YHHM 2R44A 3HJSA 1QDTA 4X65M 1GL6A 1PRBA 1KYIA 4JI1M 2QNJA 4IJEA 1N34M 2P5TA 2FOIC 3KVWA 3GRYA 3U61A 1C1KA 3IHPA 4FCWA 3NBXX 4LFBM 2UXBM 4NSOB 1QAMA 3KDSE 3M7GA 4HLQA 2E5LM 3VDPA 3ZC7B 2DKLA 4RF1A 4LF7M 2I7PA 2LH0A 2WSCF 3A45A 3FUTA 3K92A 4IIWA 1IM2A 3K9OA 2KA6B 1VEGA 4B08A 4LG2A 3DA1A 3JR5A 1TH2A 2CFOA 2ERCA 5FTJA 2XFTA 3B89A 2LXEA 2R62A 4QNRA 3FUUA 4REZA 2UUAM 4X64M 3WHLA
chains in the Genus database with same CATH topology
1SG9A 2DAEA 1A5TA 2DHYA 1ZMUA 1MN3A 1UFZA 2K9DA 1GO5A 1Q02A 3GLFE 2B3TA 2BWEA 3LCUA 2KNVA 2L2DA 2G3QA 2CP8A 3H4JA 1NV9A 2BWBA 4R71A 2DAMA 1DO2A 2ZTDA 2DAKA 2CWBA 2JZ0A 1VQ1A 1OQYA 3BBZA 1WGLA 1XB2B 2JY8A 2JP7A 3GLHE 2LVPC 2EKKA 3T6PA 1JR3E 4WP2A 1VEKA 2DI0A 2RRUA 4F1IA 4GEWA 2JNHA 2JZ1A 2KNAA 1AIPC 1G41A 2DENA 1HQYE 1TR8A 1VDLA 3E46A 5DFLA 4DBGB 1T43A 1R4GA 2DNAA 2LVQD 2KHHA 2MGWA 2LVOC 4Q7JA 1OTRA 2EJSA 2WZJA 2LTUA 1XXHE 1HT1E 3K9PA 1TTEA 1G3IA 5JI2E 3GLGE 1PGYA 1WJ7A 2JY5A 3LCVB 3E21A 1WHCA 1OKSA 1DV0A 1ZMVA 2DZLA 2DAIA 2OO9A 4G3OA 2LBCA 1NV8A 1IXSA 2OOAA 2HWJA 1WIVA 1C7YA 2H5XA 3GLIE 3FRIA 3MMPA 3FE3A 2L4FA 1IFYA 1Y8GA 3F92A 2L4EA 1HJPA 4F2LA 2JY7A 2K0BX 1BVSA 2LVAA 2R0IA 2HAKA 1DO0A 2OOBA 1F4IA 1CUKA 1ZV1A 1VG5A 1T6OA 1P3QQ 1E94E 2MROB 2QSFX 1WGNA 1OAIA 1EFUB 1QZEA 2ZTCA 2JUJA 2MR9A 4UN2B 1KYIA 2QNJA 1WR1B 2MJ5B 2LVNC 1V92A 3FRHA 3IHPA 2EKFA 1VEJA 1ZMWA 2O25A 2DKLA 1IM2A 1HT2E 3K9OA 1VEGA 2QHOB 2JY6B 2KNZA 2DAGA 3B89A 1YLAA 3IECA 4HEOA 1G4AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SG9 A;  2DAE A;  1A5T A;  2DHY A;  1ZMU A;  1MN3 A;  1UFZ A;  2K9D A;  1GO5 A;  1Q02 A;  3GLF E;  2B3T A;  2BWE A;  3LCU A;  2KNV A;  2L2D A;  2G3Q A;  2CP8 A;  3H4J A;  1NV9 A;  2BWB A;  4R71 A;  2DAM A;  1DO2 A;  2ZTD A;  2DAK A;  2CWB A;  2JZ0 A;  1VQ1 A;  1OQY A;  3BBZ A;  1WGL A;  1XB2 B;  2JY8 A;  2JP7 A;  3GLH E;  2LVP C;  2EKK A;  3T6P A;  1JR3 E;  4WP2 A;  1VEK A;  2DI0 A;  2RRU A;  4F1I A;  4GEW A;  2JNH A;  2JZ1 A;  2KNA A;  1AIP C;  1G41 A;  2DEN A;  1HQY E;  1TR8 A;  1VDL A;  3E46 A;  5DFL A;  4DBG B;  1T43 A;  1R4G A;  2DNA A;  2LVQ D;  2KHH A;  2MGW A;  2LVO C;  4Q7J A;  1OTR A;  2EJS A;  2WZJ A;  2LTU A;  1XXH E;  1HT1 E;  3K9P A;  1TTE A;  1G3I A;  5JI2 E;  3GLG E;  1PGY A;  1WJ7 A;  2JY5 A;  3LCV B;  3E21 A;  1WHC A;  1OKS A;  1DV0 A;  1ZMV A;  2DZL A;  2DAI A;  2OO9 A;  4G3O A;  2LBC A;  1NV8 A;  1IXS A;  2OOA A;  2HWJ A;  1WIV A;  1C7Y A;  2H5X A;  3GLI E;  3FRI A;  3MMP A;  3FE3 A;  2L4F A;  1IFY A;  1Y8G A;  3F92 A;  2L4E A;  1HJP A;  4F2L A;  2JY7 A;  2K0B X;  1BVS A;  2LVA A;  2R0I A;  2HAK A;  1DO0 A;  2OOB A;  1F4I A;  1CUK A;  1ZV1 A;  1VG5 A;  1T6O A;  1P3Q Q;  1E94 E;  2MRO B;  2QSF X;  1WGN A;  1OAI A;  1EFU B;  1QZE A;  2ZTC A;  2JUJ A;  2MR9 A;  4UN2 B;  1KYI A;  2QNJ A;  1WR1 B;  2MJ5 B;  2LVN C;  1V92 A;  3FRH A;  3IHP A;  2EKF A;  1VEJ A;  1ZMW A;  2O25 A;  2DKL A;  1IM2 A;  1HT2 E;  3K9O A;  1VEG A;  2QHO B;  2JY6 B;  2KNZ A;  2DAG A;  3B89 A;  1YLA A;  3IEC A;  4HEO A;  1G4A E; 
#chains in the Genus database with same CATH topology
 5H37 D;  4FCT A;  3BOS A;  2DAE A;  4L8R C;  1QAO A;  2DHY A;  1DGB A;  2K9D A;  2XEP A;  1XMO M;  1V33 A;  2K6B A;  4MGZ E;  1J09 A;  3GLF E;  2Z3X A;  1K3X A;  2DZN B;  1OIP A;  2UUB M;  4NOO B;  2KNV A;  1YUB A;  4M0D A;  3I01 M;  4GHA A;  1JR3 D;  2CP8 A;  1IBL M;  2XSZ A;  3SHF A;  1GJS A;  2GQF A;  2G5G X;  3M6A A;  4R7G A;  2K47 A;  1NO1 A;  3SAU A;  2DAK A;  2D7H A;  2H1R A;  3T15 A;  3TWM A;  1IXS B;  2HHH M;  3CTW B;  3U60 B;  4JV5 M;  1VQ1 A;  2MH8 A;  3AJI B;  4AG6 A;  3BBZ A;  1NNJ A;  4LFA M;  5DYG A;  5FTN A;  4TUW A;  1E32 A;  2JY8 A;  5EQT A;  1SXJ D;  1W5T A;  1DGH B;  5EP1 A;  2UUC M;  5IT9 S;  1G8P A;  4HL4 A;  3HWS A;  2LVP C;  3GPP A;  4AZF A;  3U6C A;  2RGO A;  5KPT A;  3TL4 X;  4LZZ A;  1TH3 A;  2L7I A;  1EIJ A;  5A2Q S;  8CAT A;  3D8L A;  4OW0 A;  1K82 A;  2DI0 A;  3R9X B;  4GEW A;  4YY3 M;  1IXZ A;  2JNH A;  2JZ1 A;  1TH4 A;  2KNA A;  3V76 A;  4DV3 M;  3GLH B;  1AIP C;  3SAS A;  4DR1 M;  2HKJ A;  3FYD A;  2MGW A;  3I04 M;  3VKG A;  1NJG A;  1MU5 A;  4JI2 M;  1QZM A;  2CRU A;  3DFZ A;  2LTU A;  2EA0 A;  4GHL A;  1Z6T A;  2XZF A;  1OFI A;  3NWL A;  4WUR A;  3BXW A;  3LCV B;  1WHC A;  1OKS A;  3KSX A;  4GC5 A;  4JXJ A;  1DV0 A;  4LF5 M;  1GKI A;  2O5R A;  1LV7 A;  2DZL A;  3I4V A;  1Z5C A;  1HNZ M;  2M60 A;  2OOA A;  2AHM A;  4BB9 A;  3AFH A;  2H5X A;  4RF0 A;  2F5O A;  3KS8 A;  3LQQ A;  4JI5 M;  4FWD A;  3UJN A;  3FRI A;  1E9R A;  3TPZ A;  1QVR A;  1IFY A;  1NNU C;  1Y8G A;  4GC9 A;  1IN6 A;  2LHC A;  4F2L A;  3ZQJ A;  4DR6 M;  1D0L A;  1OIZ A;  2OOB A;  4DV0 M;  4II7 A;  2Y0T A;  3JAM S;  4AKH A;  2VDB B;  4BBA A;  1ORY B;  1T6O A;  1YE9 A;  3GRR A;  4PT5 A;  4CJ6 A;  2W82 A;  3GLG A;  4DR2 M;  1WGN A;  3FTC A;  5FLX S;  3SAR A;  1OAI A;  3FUV A;  1QZE A;  4MH0 E;  3L2A A;  3M0E A;  4NXM M;  4LRS A;  3KOY E;  7CAT A;  2V6Z M;  1YSY A;  1IY1 A;  3WHK A;  5KPZ A;  4DR3 M;  2UU9 M;  4IBB A;  3GLI A;  2DWZ B;  2MJ5 B;  1N33 M;  2LVN C;  3KXE C;  3FTE A;  2Z4R A;  1L2B A;  4KHP M;  1GL7 A;  4I81 A;  3C3D A;  2FE8 A;  4Y28 F;  4IBE A;  3HGI A;  3AL0 C;  3W0F A;  1I4W A;  1VEJ A;  4QNM A;  1QDR A;  1ZMW A;  4FVM A;  4XBO A;  4KO8 A;  4LCB A;  4DV7 M;  4B7F A;  3HU2 A;  1QAQ A;  4LJ8 A;  4X66 M;  4LF8 M;  3L25 A;  2QPA A;  2VF7 A;  4Z8X A;  3TWK A;  4IBG A;  4B7G A;  5DNY A;  3J80 S;  2WSE F;  2KNZ A;  4MGH A;  3J27 B;  4AKG A;  4G4Q A;  1R7R A;  1IQP A;  5EJC A;  3SMP A;  3THG A;  1G4A E;  2KW0 A;  1GVN A;  3K2L A;  3U6O A;  1HNW M;  2N35 A;  3U6P A;  4LFC M;  1GO5 A;  4JI6 M;  3GQ3 A;  3A98 B;  3HHW A;  3K1J A;  2I7N A;  4DUY M;  3SYL A;  2YFQ A;  2XGN A;  3B7Q A;  4AI6 A;  4R71 A;  2DAM A;  4A3V B;  1DO2 A;  5LMN M;  3MHV C;  4MB7 A;  4DV2 M;  3HKP A;  3SAT A;  2GNO A;  2BNK A;  2QBY B;  3J7A S;  1H6U A;  3W68 A;  1RU3 A;  4L16 A;  3I4Y A;  1R2Y A;  3HHX A;  4IBC A;  3U6L A;  3JR4 A;  2XF3 A;  3AOE C;  5C18 A;  3RFW A;  5ITU A;  2EUC A;  3SYK A;  3U60 A;  4AKI A;  2D7E A;  2QEN A;  4WP2 A;  1SXJ C;  3A46 A;  4K0K M;  1VEK A;  3K8Z A;  5FSW A;  4XGI A;  1OAO C;  2KZS A;  2RRU A;  3MJ5 A;  3A42 A;  3PVS A;  1DGH A;  1N36 M;  4M9X A;  2CHV A;  2ZBK B;  3CF6 E;  1IY0 A;  4LF6 M;  4FWH A;  4LGM A;  1Z59 A;  4CIZ A;  3HHY A;  1R4G A;  2DNA A;  2L6O A;  3U61 B;  3L27 A;  2LVO C;  2DWL A;  4I8O A;  1OTR A;  1N78 A;  1KFV A;  4LY6 A;  5C1B A;  2EJS A;  2WZJ A;  4IBI A;  4G4N A;  3VKH A;  5BPV A;  2QCU A;  5JI2 E;  2C99 A;  2CUZ A;  1PGY A;  3GLG E;  2JY5 A;  5KO3 A;  2KDL A;  3GLH A;  4RNA A;  2X4A A;  4M0W A;  4G4O A;  1E9S A;  3PXG A;  3U5Z B;  2CHG A;  1JQJ C;  1GAB A;  1MX0 A;  1SXJ B;  1XXH B;  1T3T A;  3GQ5 A;  5FTK A;  4CGY B;  3GLI E;  3MMP A;  3U6S A;  4LRT A;  4MGY E;  5EP4 A;  4NSR A;  3FD9 A;  3GRV A;  2KRK A;  2C98 A;  3GPY A;  3H4M A;  2L4E A;  5IRE B;  3RGS A;  1S3S A;  2LNH C;  2JY7 A;  1BVS A;  2LVA A;  2R0I A;  2FS1 A;  2Z4S A;  2Q2E B;  2ZAN A;  2XSZ D;  1L1T A;  1F4I A;  1CUK A;  1WXQ A;  3TWL A;  4NXN M;  4P16 A;  1E94 E;  1N75 A;  3QAU A;  3UGJ A;  3KW6 A;  4D81 A;  2F5P A;  4PD2 A;  1N77 A;  1PM5 A;  4DR7 M;  2EO2 A;  2MR9 A;  2Y21 A;  3QWL A;  3UK6 A;  3EIH A;  4L15 A;  2YR0 A;  5KPR A;  4KT0 F;  4LF9 M;  3HU3 A;  2FNA A;  4JI7 M;  1WR1 B;  2XLJ A;  5E6J A;  3PFI A;  2CV2 A;  4X62 M;  3DZD A;  4DR5 M;  5FTM A;  4OX9 M;  2ZAM A;  4MGK E;  1GLN A;  2C9O A;  4JYA M;  2O25 A;  4S12 A;  1PJI A;  4JI4 M;  1D0K A;  1TDH A;  3CGW A;  3FUX A;  3J2P B;  3EIE A;  4L78 A;  1D0M A;  3AOG A;  5L8R F;  1IN7 A;  2L7H A;  3GP1 A;  2QHO B;  1PJT A;  4D82 A;  2JY6 B;  1L2D A;  4B3M M;  1ZAE A;  1YLA A;  1PJS A;  4Z6Y A;  1L1Z A;  1NHG C;  3FKE A;  3J7B A;  2DVW B;  4G4R A;  4BLC A;  1ZMU A;  1MN3 A;  1UFZ A;  3C9P A;  4MM3 B;  2B3T A;  2BWE A;  2M5Z A;  2R65 A;  1EE8 A;  1OFH A;  2F5Q A;  1DGF A;  1HNX M;  2WSF F;  3IG5 A;  4GRI A;  4LJ5 A;  2G3Q A;  1JB0 F;  3KP0 E;  3LMM A;  2BWB A;  2R18 A;  2XH9 A;  3HY5 A;  2CV1 A;  2C96 A;  2YQZ A;  2DZO B;  5EXS A;  3SFZ A;  4LJ7 A;  3GLF B;  3SAW A;  2CWB A;  2DWM A;  1X37 A;  2OPF A;  1HQC A;  2RKO A;  2FH0 A;  1WGL A;  3QYE A;  1IXR C;  3FTF A;  1XWI A;  5BR8 M;  4GMQ A;  1XNQ M;  4AG5 A;  3MK6 A;  4M9Z A;  4MGI E;  4DV1 M;  3D8B A;  5JI3 E;  1AUA A;  3GLH E;  3LVW A;  3LVV A;  4DUZ M;  2DHR A;  2R45 A;  4KOD A;  3T6P A;  4WW0 A;  4DR4 M;  4L6V 6;  3Q8G A;  3SC3 A;  3GQ4 A;  1NSF A;  2LWX A;  3FTD A;  4OVZ B;  2G8L A;  4CIS A;  3B74 A;  3T1H M;  3I51 A;  3AV0 A;  4OU7 A;  4IBJ A;  2A5Y B;  3GO8 A;  1XC8 A;  2DEN A;  4RKU F;  1HQY E;  1VDL A;  4R3D A;  5DFL A;  3B7N A;  4DBG B;  1T43 A;  3TE6 A;  4Q7J A;  2BJW A;  3ZH9 B;  2XFS A;  3KOZ E;  1MJG M;  4FW9 A;  4LJ4 A;  4PCZ A;  1PJJ A;  3KS4 A;  5F3W A;  1QQW A;  2CE7 A;  2FFJ A;  3W0L B;  1G3I A;  4QHS A;  4JI0 M;  1QYR A;  3VLF B;  2QZ4 A;  4B7H A;  3UZU A;  1WJ7 A;  4QOZ C;  4JI3 M;  2KRU A;  4W5W A;  1ZMV A;  4LJA A;  5ITX A;  2C9C A;  3VFD A;  4EIW A;  1OJL A;  1GJT A;  4G3O A;  2R46 A;  1JR3 A;  2LBC A;  4I5S A;  3HJ8 A;  5EXP A;  1N32 M;  3B7Z A;  1IXS A;  2HWJ A;  1XMQ M;  2VII A;  3U6M A;  1NY6 A;  3RGP A;  3VDU A;  2HL7 A;  1D2N A;  5E26 A;  2QP9 X;  2CV0 A;  2VF8 A;  3KFU G;  1UM8 A;  4AW4 A;  1NHW C;  3U6D A;  1HJP A;  2CEA A;  3AOE A;  2K0B X;  5GKN A;  2HAK A;  3R8F A;  2J5Y A;  3U5Z A;  3J81 S;  3SBJ A;  3HX3 A;  3PNY A;  4CHT B;  1SXJ A;  1XXH A;  1ZV1 A;  1VG5 A;  1QAN A;  1P3Q Q;  3KOW E;  1NJF A;  3SAV A;  1IN4 A;  4NL4 H;  2QSF X;  1EFU B;  3CF0 A;  4DV6 M;  2ZTC A;  2JUJ A;  4UN2 B;  3E4R A;  5ITT A;  4DV4 M;  2L09 A;  4GIP A;  4I4L A;  4KLN A;  4AQY M;  1V92 A;  3FRH A;  2X8A A;  5EXT A;  5IZ7 D;  2EKF A;  3SHG B;  2VQE M;  2UXC M;  4GKJ M;  2NQ8 C;  1L2C A;  4PDG A;  4LGY A;  4NRW A;  4QHT A;  2V1C A;  3QYB A;  4IBK A;  1G59 A;  4GKK M;  4B3R M;  1HT2 E;  5ITY A;  4FCV A;  1V34 A;  1HR0 M;  3ILK A;  1Z5B A;  2DAG A;  2O01 F;  2D7G A;  3IEC A;  4G6Z A;  4HEO A;  2J7N A;  1SG9 A;  4NC6 A;  1K3W A;  2JWS A;  1A5T A;  1G71 A;  2KZU A;  2Y20 A;  4L4U A;  2Y0Q A;  4NRV A;  2UXD M;  1J7K A;  2LHG A;  1Q02 A;  2JA2 A;  1FNN A;  4JN6 A;  4ZPX A;  2XZU A;  1TDZ A;  3LCU A;  4LF4 M;  2JXN A;  1I94 M;  2L2D A;  2CHQ A;  4XK8 F;  3H4J A;  1NV9 A;  4QOS A;  1R6B X;  2X49 A;  3B9P A;  3FUW A;  4LJ9 A;  3KSJ A;  1L8Q A;  2ZTD A;  3RE8 A;  1Q3C A;  3FYC A;  3PNV A;  1PJQ A;  2DXI A;  3E9S A;  3C58 A;  5FTL A;  2QQ8 A;  3AKZ A;  2JZ0 A;  1OQY A;  1IN8 A;  2J7O A;  5KQD A;  2BJV A;  5ITR A;  1VDD A;  2Z7J A;  3CF2 A;  1XB2 B;  3NBI A;  3L28 A;  3SMS A;  2ZAO A;  4IBD A;  4P17 A;  5LMU M;  2JP7 A;  3HZJ A;  3GLF A;  3HU1 A;  3VK7 A;  1QUS A;  2APL A;  2V1U A;  5ITX E;  3L29 A;  2EKK A;  2F4V M;  1XHB A;  2KEB A;  3ZCB B;  1JR3 E;  1TGU A;  3U6Q A;  4GIT A;  2Z8Y M;  4IJF A;  4IBF A;  5EP2 A;  4DV5 M;  3KOX E;  4F1I A;  1J5E M;  1QUT A;  2KXE A;  3IG8 A;  3U6E A;  3LQR A;  1DGG A;  3GRU A;  5KQ8 A;  3Q8X A;  1G41 A;  1Z5A A;  1LTM A;  2VQF M;  5ITQ A;  1TR8 A;  1IBM M;  3E46 A;  2HCB A;  3KP1 E;  2RGH A;  2LVQ D;  2KHH A;  3C3E A;  4PDI A;  1ZQ9 A;  1NVM A;  4GH9 A;  4OVZ A;  2DWN A;  1SXJ E;  1XXH E;  3GPX A;  1HT1 E;  3K9P A;  1TTE A;  1W5S A;  3T1Y M;  3W67 A;  3HHZ A;  3E21 A;  2R4E A;  3LW5 F;  1R5L A;  3VK8 A;  3UMM A;  2F5N A;  4D80 A;  1XNR M;  2OO9 A;  2DAI A;  2R4J A;  3DOA A;  1TF0 B;  5IWA M;  3GPU A;  2C5R A;  1NV8 A;  1FJG M;  3TQS A;  1WIV A;  4LJ6 A;  2OQ4 A;  1C7Y A;  2QBY A;  1NY5 A;  4JI8 M;  3L26 A;  3OTO M;  4FWG A;  1KSF X;  4ITQ A;  1IN5 A;  1Q39 A;  1IY2 A;  3GLG B;  3FE3 A;  3T38 A;  4B3S M;  2L4F A;  3HJQ A;  4ANR A;  3F92 A;  1Q3B A;  2YNM D;  4M9S A;  4B3T M;  5EP3 A;  2F5S A;  1DO0 A;  4LZJ A;  4FD2 A;  3GLI B;  2ZM6 M;  5DYI A;  5EXX A;  2MRO B;  2R6F A;  1R2Z A;  1IBK M;  4YHH M;  2R44 A;  3HJS A;  1QDT A;  4X65 M;  1GL6 A;  1PRB A;  1KYI A;  4JI1 M;  2QNJ A;  4IJE A;  1N34 M;  2P5T A;  2FOI C;  3KVW A;  3GRY A;  3U61 A;  1C1K A;  3IHP A;  4FCW A;  3NBX X;  4LFB M;  2UXB M;  4NSO B;  1QAM A;  3KDS E;  3M7G A;  4HLQ A;  2E5L M;  3VDP A;  3ZC7 B;  2DKL A;  4RF1 A;  4LF7 M;  2I7P A;  2LH0 A;  2WSC F;  3A45 A;  3FUT A;  3K92 A;  4IIW A;  1IM2 A;  3K9O A;  2KA6 B;  1VEG A;  4B08 A;  4LG2 A;  3DA1 A;  3JR5 A;  1TH2 A;  2CFO A;  2ERC A;  5FTJ A;  2XFT A;  3B89 A;  2LXE A;  2R62 A;  4QNR A;  3FUU A;  4REZ A;  2UUA M;  4X64 M;  3WHL A; 
#chains in the Genus database with same CATH homology
 1SG9 A;  2DAE A;  1A5T A;  2DHY A;  1ZMU A;  1MN3 A;  1UFZ A;  2K9D A;  1GO5 A;  1Q02 A;  3GLF E;  2B3T A;  2BWE A;  3LCU A;  2KNV A;  2L2D A;  2G3Q A;  2CP8 A;  3H4J A;  1NV9 A;  2BWB A;  4R71 A;  2DAM A;  1DO2 A;  2ZTD A;  2DAK A;  2CWB A;  2JZ0 A;  1VQ1 A;  1OQY A;  3BBZ A;  1WGL A;  1XB2 B;  2JY8 A;  2JP7 A;  3GLH E;  2LVP C;  2EKK A;  3T6P A;  1JR3 E;  4WP2 A;  1VEK A;  2DI0 A;  2RRU A;  4F1I A;  4GEW A;  2JNH A;  2JZ1 A;  2KNA A;  1AIP C;  1G41 A;  2DEN A;  1HQY E;  1TR8 A;  1VDL A;  3E46 A;  5DFL A;  4DBG B;  1T43 A;  1R4G A;  2DNA A;  2LVQ D;  2KHH A;  2MGW A;  2LVO C;  4Q7J A;  1OTR A;  2EJS A;  2WZJ A;  2LTU A;  1XXH E;  1HT1 E;  3K9P A;  1TTE A;  1G3I A;  5JI2 E;  3GLG E;  1PGY A;  1WJ7 A;  2JY5 A;  3LCV B;  3E21 A;  1WHC A;  1OKS A;  1DV0 A;  1ZMV A;  2DZL A;  2DAI A;  2OO9 A;  4G3O A;  2LBC A;  1NV8 A;  1IXS A;  2OOA A;  2HWJ A;  1WIV A;  1C7Y A;  2H5X A;  3GLI E;  3FRI A;  3MMP A;  3FE3 A;  2L4F A;  1IFY A;  1Y8G A;  3F92 A;  2L4E A;  1HJP A;  4F2L A;  2JY7 A;  2K0B X;  1BVS A;  2LVA A;  2R0I A;  2HAK A;  1DO0 A;  2OOB A;  1F4I A;  1CUK A;  1ZV1 A;  1VG5 A;  1T6O A;  1P3Q Q;  1E94 E;  2MRO B;  2QSF X;  1WGN A;  1OAI A;  1EFU B;  1QZE A;  2ZTC A;  2JUJ A;  2MR9 A;  4UN2 B;  1KYI A;  2QNJ A;  1WR1 B;  2MJ5 B;  2LVN C;  1V92 A;  3FRH A;  3IHP A;  2EKF A;  1VEJ A;  1ZMW A;  2O25 A;  2DKL A;  1IM2 A;  1HT2 E;  3K9O A;  1VEG A;  2QHO B;  2JY6 B;  2KNZ A;  2DAG A;  3B89 A;  1YLA A;  3IEC A;  4HEO A;  1G4A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...