1F4IA

Solution structure of the hhr23a uba(2) mutant p333e, deficient in binding the hiv-1 accessory protein vpr
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
45
structure length
45
Chain Sequence
QEKEAIERLKALGFEESLVIQAYFACEKNENLAANFLLSQNFDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV EXCISION REPAIR PROTEIN PROTEIN RAD23 HOMOLOG A
publication title Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr.
pubmed doi rcsb
molecule tags Dna binding protein,transcription
total genus 8
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1f4iA00
3IECA 2B3TA 2WZJA 3GLHE 1G4AE 1QZEA 2JY8A 1VQ1A 1ZV1A 1JR3E 2DHYA 1OKSA 1TR8A 2HAKA 3H4JA 1NV9A 4R71A 1HJPA 1ZMWA 1XB2B 1WJ7A 1EFUB 1P3QQ 4F2LA 2LVQD 1WGLA 2HWJA 5JI2E 2EKKA 1G41A 1HQYE 1ZMVA 1YLAA 3LCUA 1UFZA 1DO0A 2JNHA 2K9DA 2DENA 1HT1E 2R0IA 2DI0A 1CUKA 2RRUA 3K9PA 1VEKA 2G3QA 2OOBA 2QSFX 2LVNC 1C7YA 1WR1B 2KNVA 4F1IA 1OTRA 3T6PA 1OAIA 4HEOA 4WP2A 1T6OA 1TTEA 2DAKA 1SG9A 2JY7A 2CP8A 2QNJA 2CWBA 4UN2B 1VEGA 2ZTDA 2JY5A 1WHCA 1IM2A 1T43A 2JZ1A 3MMPA 2BWBA 1GO5A 2L4FA 1V92A 3BBZA 2JUJA 2DAMA 2MR9A 1WGNA 2MROB 1PGYA 1IXSA 3F92A 2LBCA 2BWEA 3LCVB 2JY6B 1VG5A 3E21A 5DFLA 1BVSA 2O25A 1E94E 2L4EA 1DV0A 1Y8GA 3B89A 2OO9A 2EJSA 1VEJA 1HT2E 2KNAA 2LTUA 1ZMUA 1R4GA 4GEWA 2JP7A 3IHPA 1G3IA 1F4IA 2OOAA 3K9OA 3FRHA 3GLFE 1WIVA 2ZTCA 3FE3A 1Q02A 2DNAA 2H5XA 1A5TA 2DAIA 4Q7JA 1DO2A 3FRIA 1MN3A 2MJ5B 2LVAA 2QHOB 2K0BX 2DKLA 2DAGA 3E46A 4DBGB 2DZLA 1KYIA 2KHHA 4G3OA 1AIPC 3GLIE 3GLGE 1IFYA 2LVOC 1NV8A 2JZ0A 2KNZA 2L2DA 1OQYA 2EKFA 2LVPC 2MGWA 1XXHE 1VDLA 2DAEA
chains in the Genus database with same CATH superfamily
4D80A 1N33M 1NY6A 3FUWA 4DR4M 2B3TA 2HL7A 1GJTA 2FS1A 5C18A 4DV2M 1D2NA 4XK8F 1E9RA 1OFIA 3HY5A 4G6ZA 3U6LA 1VQ1A 2ZBKB 2VIIA 4ANRA 3Q8XA 3GLGA 3TWMA 3W0FA 1C1KA 3DA1A 3RGPA 1IY2A 1NV9A 4R71A 2YR0A 3MHVC 4DV3M 1PM5A 1N32M 1NJGA 3KOYE 2ZANA 2D7EA 3GPPA 2OPFA 4MB7A 4IBKA 3K2LA 3LVWA 4X65M 2UUBM 1P3QQ 4QOSA 4GMQA 2LVQD 5FTLA 5ITQA 4JI8M 4L15A 1HQYE 3L26A 2F5PA 3SMSA 2R4JA 4B7FA 1DGBA 2DENA 3FTCA 4CGYB 4Z6YA 5BPVA 2Q2EB 2DI0A 5DYIA 4DR2M 2CHQA 3JAMS 3U6EA 4MGYE 3FTDA 3IG5A 4FCVA 2KEBA 3FUTA 1OTRA 1Z5CA 4JN6A 1OAIA 4NXNM 4HEOA 2EUCA 1L2CA 1IBKM 4JI4M 1TTEA 2LWXA 4K0KM 3AOEA 3AV0A 4UN2B 2VQFM 4LRTA 3KVWA 4LGMA 3KOZE 1N34M 3KFUG 5LMNM 3KS8A 1KFVA 2UXBM 4FVMA 5EXTA 1IXZA 1YE9A 3A98B 1GO5A 4AI6A 3BBZA 1EIJA 3VFDA 4PCZA 2NQ8C 3HWSA 1IXSA 3F92A 3JR5A 3GLIB 5LMUM 3LVVA 2CEAA 4G4QA 1NO1A 1I4WA 2RKOA 2XSZD 2O25A 3I51A 1QANA 1DV0A 3VK7A 1L8QA 4QHTA 4LG2A 2BNKA 1SXJE 3I01M 3HHZA 3T1HM 4AG6A 3KS4A 4L4UA 5EXPA 3U60B 1X37A 3U61A 4PD2A 2F5QA 1ORYB 3SASA 1ZMUA 2JP7A 1GVNA 3IHPA 3U5ZB 1G3IA 1J5EM 4KT0F 5E6JA 3U6CA 4NSOB 4FCWA 2ZTCA 4EIWA 1TH3A 3W67A 1N78A 2H5XA 1A5TA 1PJSA 4MH0E 4S12A 4BB9A 3AOEC 4DV6M 4ITQA 2LVAA 4I81A 3T1YM 3EIEA 4NRVA 4DV5M 5F3WA 3K8ZA 2ZAMA 4AG5A 4PT5A 4LJ7A 3U6OA 4DBGB 3VK8A 3VKHA 1TDZA 1IFYA 2KA6B 3FTEA 2L2DA 4B3RM 1OQYA 3HU2A 1XXHE 4W5WA 3TL4X 1JR3A 4B3MM 5GKNA 3HJQA 1SXJD 3IECA 3C58A 2HHHM 2W82A 4LF4M 4DR3M 2WZJA 3B74A 2XF3A 1NJFA 3GLHE 2JA2A 1SXJB 3WHKA 3C3EA 4JI6M 3LW5F 3A42A 4GC5A 3GO8A 4NL4H 1TR8A 2HAKA 4WURA 3T38A 3EIHA 1KSFX 1XXHA 2YFQA 4JYAM 1OIPA 3AOGA 1QAQA 2D7GA 1XB2B 3GPXA 1DGGA 5EP1A 3HKPA 4YHHM 3KP0E 1WJ7A 3KW6A 4Y28F 2R45A 3HZJA 4FWDA 5EP4A 4AKHA 5ITXA 2QQ8A 3B9PA 1GJSA 5FTNA 3OTOM 3SAVA 1IY1A 1XNQM 4LF6M 3GRRA 1XMQM 3IG8A 3V76A 1DO0A 4B3SM 3UGJA 5KPZA 1HT1E 2J7OA 1NHGC 4QNRA 2C99A 1V33A 1CUKA 2RRUA 3K9PA 1H6UA 4FW9A 3TQSA 3U6SA 2G3QA 3SARA 3I4YA 5IT9S 2UXCM 5JI3E 4DUYM 2KDLA 2LVNC 5IZ7D 3UZUA 7CATA 3HU1A 2CV2A 2KNVA 1ZAEA 4FWGA 1PJQA 3ZC7B 3T6PA 1UM8A 1W5SA 4JV5M 1AUAA 2XEPA 4OW0A 2Y20A 1N36M 4X62M 5FTJA 2KZUA 1GL7A 2DAKA 3BOSA 3TWLA 4FWHA 2C98A 1HQCA 3GLHB 1R2ZA 5EQTA 3K1JA 2VQEM 3UJNA 4AKIA 1Q3CA 2O01F 3SYKA 1QQWA 2JY5A 3LQRA 1TGUA 1IM2A 1D0LA 4M0WA 1HR0M 1QUSA 1DGHA 2WSCF 1QDTA 3MMPA 3CGWA 3L2AA 4AW4A 1IN8A 4QNMA 2FFJA 2JUJA 1IBMM 2LBCA 4M9SA 1YUBA 3GLGB 3QYEA 2BWEA 3NBXX 1GL6A 2UUCM 4IBDA 4YY3M 3LCVB 1VG5A 4JI0M 2Y0TA 2QPAA 3KSJA 4FCTA 5DFLA 4IBBA 4M9ZA 1GKIA 4CHTB 1E94E 2RGOA 4R3DA 2N35A 2V1CA 3GQ5A 4KODA 3TE6A 2A5YB 1VEJA 1HT2E 3L29A 3GLFA 3SAUA 2LTUA 3NBIA 3D8LA 3PVSA 4LJ5A 3J80S 3R9XB 2JWSA 1R4GA 1DGHB 1JB0F 3FD9A 2OOAA 1W5TA 2L7IA 2X8AA 3TPZA 3RE8A 3BXWA 3VLFB 5C1BA 5ITUA 3GQ3A 4DV0M 2OQ4A 3KSXA 3DFZA 4I4LA 1MX0A 2R65A 3HHYA 1FJGM 2K6BA 2DNAA 3U6QA 4NRWA 2DXIA 1DO2A 1IY0A 3FRIA 5KPRA 3MK6A 4RF0A 1OJLA 5EP2A 2DKLA 2DAGA 1MJGM 2E5LM 2APLA 1IXRC 2XZUA 4L6V6 2DZLA 2ZM6M 1IN6A 3L27A 1KYIA 2KHHA 3ZCBB 3SFZA 4NXMM 4BLCA 4JI1M 1GABA 1QZMA 4QOZC 2M60A 2KNZA 2XZFA 4CIZA 2D7HA 2L09A 4LY6A 2QCUA 2DAEA 2MJ5B 2Z4RA 3WHLA 4LCBA 2UUAM 4PDGA 2ERCA 2FOIC 2FNAA 2QBYA 4GITA 4GHLA 3AJIB 2Y21A 4REZA 2LHGA 1PJJA 2G8LA 1G4AE 3HJSA 4IBCA 1D0MA 3B7ZA 2DVWB 1IXSB 1G71A 2GQFA 1G59A 1JR3E 2DHYA 1OKSA 3DOAA 2DZOB 3HX3A 2VDBB 1E9SA 4OX9M 4LRSA 5A2QS 2R4EA 3SMPA 4IJFA 1IN5A 2Z7JA 3B7QA 4KLNA 2DWMA 4DR7M 1L2BA 4A3VB 1QAOA 1TH4A 3ILKA 4M9XA 2DWNA 1EFUB 2DHRA 3E9SA 2CHVA 1Z59A 1NSFA 2BJVA 1JQJC 3QWLA 4HL4A 4L16A 4F2LA 2DWLA 5E26A 3SATA 4R7GA 5JI2E 4GH9A 5KQDA 2EKKA 2GNOA 4MGIE 1HNXM 3GRUA 3U61B 5ITTA 1YLAA 1D0KA 3PXGA 1UFZA 4FD2A 2L6OA 1XHBA 3MJ5A 4P17A 2K9DA 3SHGB 1I94M 3GRVA 3W68A 3ZH9B 4DR6M 3C3DA 4LFBM 3U6PA 2CE7A 5ITXE 2C9CA 2Y0QA 4JI7M 2LH0A 2OOBA 2QSFX 3HU3A 1C7YA 4II7A 1WR1B 4L78A 1YSYA 4F1IA 1NNJA 3B7NA 1K3XA 1T6OA 3VKGA 1SG9A 1JR3D 2JY7A 5EP3A 3UMMA 4OVZA 5FTMA 2QNJA 2CWBA 4GRIA 2L7HA 3ZQJA 3SBJA 1PJIA 1L1TA 3KOWE 1Z5AA 2MH8A 3A46A 4CJ6A 3C9PA 1WHCA 3Q8GA 1XC8A 2JZ1A 3FUXA 4L8RC 3M0EA 2F5SA 2VF8A 1K3WA 1MU5A 1WGNA 5L8RF 2CRUA 1QAMA 3J27B 3L28A 4PDIA 4TUWA 4IBJA 4NC6A 2JY6B 4NOOB 3H4MA 1BVSA 1R5LA 1XXHB 2HKJA 5KPTA 4LJ9A 2M5ZA 5ITYA 4D81A 4B7HA 4B08A 3AL0C 1Y8GA 2I7PA 2R46A 3A45A 3CF2A 3NWLA 4HLQA 4MGKE 4DR1M 4AQYM 4P16A 4LJ4A 5EXXA 3GQ4A 3SAWA 3PNVA 3J7AS 1WXQA 1E32A 4QHSA 3UK6A 2CV0A 1FNNA 2QP9X 1IQPA 2YNMD 4Z8XA 3U6MA 2Z3XA 2FE8A 1F4IA 8CATA 1GLNA 2WSFF 3K9OA 2DZNB 3FRHA 2VF7A 3GLFE 1Q3BA 3L25A 1WIVA 3SYLA 3FE3A 1Q02A 2CFOA 4AZFA 4MM3B 4OU7A 3W0LB 4Q7JA 4XGIA 2C9OA 4LFCM 1XNRM 2QHOB 2K0BX 2R62A 3FUUA 3CF6E 5DNYA 1HNZM 3FYCA 2XH9A 4DR5M 4G3OA 3GLIE 2F5NA 4B3TM 3CF0A 1K82A 2LVOC 4JI2M 1J09A 2LHCA 1DGFA 2QZ4A 1NV8A 4LZZA 1L1ZA 1Z6TA 1OFHA 2MGWA 1LTMA 2EKFA 2QENA 1N77A 4G4OA 4MGHA 1NNUC 5EJCA 4ZPXA 1S3SA 1R7RA 3QAUA 4G4RA 2O5RA 2KRUA 3TWKA 3K92A 1NHWC 3KXEC 4I5SA 3HHXA 3KP1E 4NSRA 3RGSA 4IJEA 4D82A 1EE8A 2UXDM 1N75A 1QZEA 2JY8A 2KRKA 3LQQA 3GLIA 1ZV1A 1L2DA 3H4JA 2ZAOA 3SC3A 1R6BX 1XWIA 2KW0A 1HJPA 1ZMWA 4CISA 3THGA 1IN4A 3AKZA 3GLFB 1IN7A 2XSZA 1XMOM 2J7NA 1R2YA 2UU9M 2V1UA 1WGLA 4LZJA 2HWJA 4X66M 2CUZA 2DWZB 5H37D 1G41A 4GHAA 3U60A 3PFIA 4LF7M 1ZMVA 3J81S 1LV7A 3LCUA 3U6DA 2JNHA 3U5ZA 1ZQ9A 1PJTA 4IBIA 2R0IA 2R44A 1NY5A 4LJ8A 3GPYA 4AKGA 1VEKA 4RF1A 4RNAA 2X49A 1QDRA 3VDPA 2CV1A 3CTWB 4BBAA 2K47A 3HGIA 5FSWA 4IBGA 3HJ8A 1T3TA 2JXNA 4WP2A 3T15A 4JI5M 2AHMA 4DV7M 3GPUA 3FUVA 3JR4A 4WW0A 2CP8A 4GIPA 2XGNA 2C5RA 4LJAA 4XBOA 1NVMA 1QUTA 2RGHA 1VEGA 2ZTDA 4KO8A 1T43A 1Q39A 2FH0A 2BWBA 3KDSE 2L4FA 1V92A 2QBYB 2HCBA 4KHPM 1RU3A 3M7GA 2DAMA 1SXJA 2MR9A 2MROB 4JXJA 5IREB 1PGYA 3J2PB 3RFWA 5ITRA 4DV1M 2R6FA 2XFSA 5KO3A 3DZDA 1VDDA 3M6AA 2H1RA 1OAOC 3E4RA 3E21A 3SHFA 5EXSA 2XFTA 2I7NA 1TH2A 3PNYA 4B7GA 5BR8M 4DV4M 4G4NA 4GKKM 4LGYA 3HHWA 4LFAM 1OIZA 2L4EA 1QYRA 3QYBA 3B89A 2OO9A 3I04M 4IIWA 3FYDA 2EJSA 4GC9A 1TDHA 5KQ8A 1IBLM 2F4VM 2EO2A 4X64M 4GKJM 2X4AA 2KNAA 2EA0A 3VDUA 2J5YA 2V6ZM 3D8BA 4GEWA 3FKEA 4IBFA 4JI3M 4MGZE 1QVRA 3R8FA 4M0DA 4RKUF 2F5OA 4I8OA 2R18A 4IBEA 3GRYA 3FTFA 5FLXS 4LJ6A 2DAIA 3J7BA 2G5GX 1MN3A 2P5TA 2WSEF 4LF5M 2LXEA 2LNHC 2KXEA 2YQZA 3E46A 5FTKA 2Z8YM 4DUZM 3GP1A 1G8PA 4LF8M 5IWAM 1PRBA 3AFHA 4LF9M 2CHGA 2Z4SA 1AIPC 1V34A 3GLHA 1J7KA 3GLGE 1SXJC 4OVZB 2BJWA 3I4VA 5DYGA 2C96A 1HNWM 2JZ0A 3KOXE 2LVPC 1TF0B 2KZSA 1VDLA 2XLJA 3LMMA 1Z5BA
chains in the Genus database with same CATH topology
3IECA 2B3TA 2WZJA 3GLHE 1G4AE 1QZEA 2JY8A 1VQ1A 1ZV1A 1JR3E 2DHYA 1OKSA 1TR8A 2HAKA 3H4JA 1NV9A 4R71A 1HJPA 1ZMWA 1XB2B 1WJ7A 1EFUB 1P3QQ 4F2LA 2LVQD 1WGLA 2HWJA 5JI2E 2EKKA 1G41A 1HQYE 1ZMVA 1YLAA 3LCUA 1UFZA 1DO0A 2JNHA 2K9DA 2DENA 1HT1E 2R0IA 2DI0A 1CUKA 2RRUA 3K9PA 1VEKA 2G3QA 2OOBA 2QSFX 2LVNC 1C7YA 1WR1B 2KNVA 4F1IA 1OTRA 3T6PA 1OAIA 4HEOA 4WP2A 1T6OA 1TTEA 2DAKA 1SG9A 2JY7A 2CP8A 2QNJA 2CWBA 4UN2B 1VEGA 2ZTDA 2JY5A 1WHCA 1IM2A 1T43A 2JZ1A 3MMPA 2BWBA 1GO5A 2L4FA 1V92A 3BBZA 2JUJA 2DAMA 2MR9A 1WGNA 2MROB 1PGYA 1IXSA 3F92A 2LBCA 2BWEA 3LCVB 2JY6B 1VG5A 3E21A 5DFLA 1BVSA 2O25A 1E94E 2L4EA 1DV0A 1Y8GA 3B89A 2OO9A 2EJSA 1VEJA 1HT2E 2KNAA 2LTUA 1ZMUA 1R4GA 4GEWA 2JP7A 3IHPA 1G3IA 1F4IA 2OOAA 3K9OA 3FRHA 3GLFE 1WIVA 2ZTCA 3FE3A 1Q02A 2DNAA 2H5XA 1A5TA 2DAIA 4Q7JA 1DO2A 3FRIA 1MN3A 2MJ5B 2LVAA 2QHOB 2K0BX 2DKLA 2DAGA 3E46A 4DBGB 2DZLA 1KYIA 2KHHA 4G3OA 1AIPC 3GLIE 3GLGE 1IFYA 2LVOC 1NV8A 2JZ0A 2KNZA 2L2DA 1OQYA 2EKFA 2LVPC 2MGWA 1XXHE 1VDLA 2DAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEC A;  2B3T A;  2WZJ A;  3GLH E;  1G4A E;  1QZE A;  2JY8 A;  1VQ1 A;  1ZV1 A;  1JR3 E;  2DHY A;  1OKS A;  1TR8 A;  2HAK A;  3H4J A;  1NV9 A;  4R71 A;  1HJP A;  1ZMW A;  1XB2 B;  1WJ7 A;  1EFU B;  1P3Q Q;  4F2L A;  2LVQ D;  1WGL A;  2HWJ A;  5JI2 E;  2EKK A;  1G41 A;  1HQY E;  1ZMV A;  1YLA A;  3LCU A;  1UFZ A;  1DO0 A;  2JNH A;  2K9D A;  2DEN A;  1HT1 E;  2R0I A;  2DI0 A;  1CUK A;  2RRU A;  3K9P A;  1VEK A;  2G3Q A;  2OOB A;  2QSF X;  2LVN C;  1C7Y A;  1WR1 B;  2KNV A;  4F1I A;  1OTR A;  3T6P A;  1OAI A;  4HEO A;  4WP2 A;  1T6O A;  1TTE A;  2DAK A;  1SG9 A;  2JY7 A;  2CP8 A;  2QNJ A;  2CWB A;  4UN2 B;  1VEG A;  2ZTD A;  2JY5 A;  1WHC A;  1IM2 A;  1T43 A;  2JZ1 A;  3MMP A;  2BWB A;  1GO5 A;  2L4F A;  1V92 A;  3BBZ A;  2JUJ A;  2DAM A;  2MR9 A;  1WGN A;  2MRO B;  1PGY A;  1IXS A;  3F92 A;  2LBC A;  2BWE A;  3LCV B;  2JY6 B;  1VG5 A;  3E21 A;  5DFL A;  1BVS A;  2O25 A;  1E94 E;  2L4E A;  1DV0 A;  1Y8G A;  3B89 A;  2OO9 A;  2EJS A;  1VEJ A;  1HT2 E;  2KNA A;  2LTU A;  1ZMU A;  1R4G A;  4GEW A;  2JP7 A;  3IHP A;  1G3I A;  1F4I A;  2OOA A;  3K9O A;  3FRH A;  3GLF E;  1WIV A;  2ZTC A;  3FE3 A;  1Q02 A;  2DNA A;  2H5X A;  1A5T A;  2DAI A;  4Q7J A;  1DO2 A;  3FRI A;  1MN3 A;  2MJ5 B;  2LVA A;  2QHO B;  2K0B X;  2DKL A;  2DAG A;  3E46 A;  4DBG B;  2DZL A;  1KYI A;  2KHH A;  4G3O A;  1AIP C;  3GLI E;  3GLG E;  1IFY A;  2LVO C;  1NV8 A;  2JZ0 A;  2KNZ A;  2L2D A;  1OQY A;  2EKF A;  2LVP C;  2MGW A;  1XXH E;  1VDL A;  2DAE A; 
#chains in the Genus database with same CATH topology
 4D80 A;  1N33 M;  1NY6 A;  3FUW A;  4DR4 M;  2B3T A;  2HL7 A;  1GJT A;  2FS1 A;  5C18 A;  4DV2 M;  1D2N A;  4XK8 F;  1E9R A;  1OFI A;  3HY5 A;  4G6Z A;  3U6L A;  1VQ1 A;  2ZBK B;  2VII A;  4ANR A;  3Q8X A;  3GLG A;  3TWM A;  3W0F A;  1C1K A;  3DA1 A;  3RGP A;  1IY2 A;  1NV9 A;  4R71 A;  2YR0 A;  3MHV C;  4DV3 M;  1PM5 A;  1N32 M;  1NJG A;  3KOY E;  2ZAN A;  2D7E A;  3GPP A;  2OPF A;  4MB7 A;  4IBK A;  3K2L A;  3LVW A;  4X65 M;  2UUB M;  1P3Q Q;  4QOS A;  4GMQ A;  2LVQ D;  5FTL A;  5ITQ A;  4JI8 M;  4L15 A;  1HQY E;  3L26 A;  2F5P A;  3SMS A;  2R4J A;  4B7F A;  1DGB A;  2DEN A;  3FTC A;  4CGY B;  4Z6Y A;  5BPV A;  2Q2E B;  2DI0 A;  5DYI A;  4DR2 M;  2CHQ A;  3JAM S;  3U6E A;  4MGY E;  3FTD A;  3IG5 A;  4FCV A;  2KEB A;  3FUT A;  1OTR A;  1Z5C A;  4JN6 A;  1OAI A;  4NXN M;  4HEO A;  2EUC A;  1L2C A;  1IBK M;  4JI4 M;  1TTE A;  2LWX A;  4K0K M;  3AOE A;  3AV0 A;  4UN2 B;  2VQF M;  4LRT A;  3KVW A;  4LGM A;  3KOZ E;  1N34 M;  3KFU G;  5LMN M;  3KS8 A;  1KFV A;  2UXB M;  4FVM A;  5EXT A;  1IXZ A;  1YE9 A;  3A98 B;  1GO5 A;  4AI6 A;  3BBZ A;  1EIJ A;  3VFD A;  4PCZ A;  2NQ8 C;  3HWS A;  1IXS A;  3F92 A;  3JR5 A;  3GLI B;  5LMU M;  3LVV A;  2CEA A;  4G4Q A;  1NO1 A;  1I4W A;  2RKO A;  2XSZ D;  2O25 A;  3I51 A;  1QAN A;  1DV0 A;  3VK7 A;  1L8Q A;  4QHT A;  4LG2 A;  2BNK A;  1SXJ E;  3I01 M;  3HHZ A;  3T1H M;  4AG6 A;  3KS4 A;  4L4U A;  5EXP A;  3U60 B;  1X37 A;  3U61 A;  4PD2 A;  2F5Q A;  1ORY B;  3SAS A;  1ZMU A;  2JP7 A;  1GVN A;  3IHP A;  3U5Z B;  1G3I A;  1J5E M;  4KT0 F;  5E6J A;  3U6C A;  4NSO B;  4FCW A;  2ZTC A;  4EIW A;  1TH3 A;  3W67 A;  1N78 A;  2H5X A;  1A5T A;  1PJS A;  4MH0 E;  4S12 A;  4BB9 A;  3AOE C;  4DV6 M;  4ITQ A;  2LVA A;  4I81 A;  3T1Y M;  3EIE A;  4NRV A;  4DV5 M;  5F3W A;  3K8Z A;  2ZAM A;  4AG5 A;  4PT5 A;  4LJ7 A;  3U6O A;  4DBG B;  3VK8 A;  3VKH A;  1TDZ A;  1IFY A;  2KA6 B;  3FTE A;  2L2D A;  4B3R M;  1OQY A;  3HU2 A;  1XXH E;  4W5W A;  3TL4 X;  1JR3 A;  4B3M M;  5GKN A;  3HJQ A;  1SXJ D;  3IEC A;  3C58 A;  2HHH M;  2W82 A;  4LF4 M;  4DR3 M;  2WZJ A;  3B74 A;  2XF3 A;  1NJF A;  3GLH E;  2JA2 A;  1SXJ B;  3WHK A;  3C3E A;  4JI6 M;  3LW5 F;  3A42 A;  4GC5 A;  3GO8 A;  4NL4 H;  1TR8 A;  2HAK A;  4WUR A;  3T38 A;  3EIH A;  1KSF X;  1XXH A;  2YFQ A;  4JYA M;  1OIP A;  3AOG A;  1QAQ A;  2D7G A;  1XB2 B;  3GPX A;  1DGG A;  5EP1 A;  3HKP A;  4YHH M;  3KP0 E;  1WJ7 A;  3KW6 A;  4Y28 F;  2R45 A;  3HZJ A;  4FWD A;  5EP4 A;  4AKH A;  5ITX A;  2QQ8 A;  3B9P A;  1GJS A;  5FTN A;  3OTO M;  3SAV A;  1IY1 A;  1XNQ M;  4LF6 M;  3GRR A;  1XMQ M;  3IG8 A;  3V76 A;  1DO0 A;  4B3S M;  3UGJ A;  5KPZ A;  1HT1 E;  2J7O A;  1NHG C;  4QNR A;  2C99 A;  1V33 A;  1CUK A;  2RRU A;  3K9P A;  1H6U A;  4FW9 A;  3TQS A;  3U6S A;  2G3Q A;  3SAR A;  3I4Y A;  5IT9 S;  2UXC M;  5JI3 E;  4DUY M;  2KDL A;  2LVN C;  5IZ7 D;  3UZU A;  7CAT A;  3HU1 A;  2CV2 A;  2KNV A;  1ZAE A;  4FWG A;  1PJQ A;  3ZC7 B;  3T6P A;  1UM8 A;  1W5S A;  4JV5 M;  1AUA A;  2XEP A;  4OW0 A;  2Y20 A;  1N36 M;  4X62 M;  5FTJ A;  2KZU A;  1GL7 A;  2DAK A;  3BOS A;  3TWL A;  4FWH A;  2C98 A;  1HQC A;  3GLH B;  1R2Z A;  5EQT A;  3K1J A;  2VQE M;  3UJN A;  4AKI A;  1Q3C A;  2O01 F;  3SYK A;  1QQW A;  2JY5 A;  3LQR A;  1TGU A;  1IM2 A;  1D0L A;  4M0W A;  1HR0 M;  1QUS A;  1DGH A;  2WSC F;  1QDT A;  3MMP A;  3CGW A;  3L2A A;  4AW4 A;  1IN8 A;  4QNM A;  2FFJ A;  2JUJ A;  1IBM M;  2LBC A;  4M9S A;  1YUB A;  3GLG B;  3QYE A;  2BWE A;  3NBX X;  1GL6 A;  2UUC M;  4IBD A;  4YY3 M;  3LCV B;  1VG5 A;  4JI0 M;  2Y0T A;  2QPA A;  3KSJ A;  4FCT A;  5DFL A;  4IBB A;  4M9Z A;  1GKI A;  4CHT B;  1E94 E;  2RGO A;  4R3D A;  2N35 A;  2V1C A;  3GQ5 A;  4KOD A;  3TE6 A;  2A5Y B;  1VEJ A;  1HT2 E;  3L29 A;  3GLF A;  3SAU A;  2LTU A;  3NBI A;  3D8L A;  3PVS A;  4LJ5 A;  3J80 S;  3R9X B;  2JWS A;  1R4G A;  1DGH B;  1JB0 F;  3FD9 A;  2OOA A;  1W5T A;  2L7I A;  2X8A A;  3TPZ A;  3RE8 A;  3BXW A;  3VLF B;  5C1B A;  5ITU A;  3GQ3 A;  4DV0 M;  2OQ4 A;  3KSX A;  3DFZ A;  4I4L A;  1MX0 A;  2R65 A;  3HHY A;  1FJG M;  2K6B A;  2DNA A;  3U6Q A;  4NRW A;  2DXI A;  1DO2 A;  1IY0 A;  3FRI A;  5KPR A;  3MK6 A;  4RF0 A;  1OJL A;  5EP2 A;  2DKL A;  2DAG A;  1MJG M;  2E5L M;  2APL A;  1IXR C;  2XZU A;  4L6V 6;  2DZL A;  2ZM6 M;  1IN6 A;  3L27 A;  1KYI A;  2KHH A;  3ZCB B;  3SFZ A;  4NXM M;  4BLC A;  4JI1 M;  1GAB A;  1QZM A;  4QOZ C;  2M60 A;  2KNZ A;  2XZF A;  4CIZ A;  2D7H A;  2L09 A;  4LY6 A;  2QCU A;  2DAE A;  2MJ5 B;  2Z4R A;  3WHL A;  4LCB A;  2UUA M;  4PDG A;  2ERC A;  2FOI C;  2FNA A;  2QBY A;  4GIT A;  4GHL A;  3AJI B;  2Y21 A;  4REZ A;  2LHG A;  1PJJ A;  2G8L A;  1G4A E;  3HJS A;  4IBC A;  1D0M A;  3B7Z A;  2DVW B;  1IXS B;  1G71 A;  2GQF A;  1G59 A;  1JR3 E;  2DHY A;  1OKS A;  3DOA A;  2DZO B;  3HX3 A;  2VDB B;  1E9S A;  4OX9 M;  4LRS A;  5A2Q S;  2R4E A;  3SMP A;  4IJF A;  1IN5 A;  2Z7J A;  3B7Q A;  4KLN A;  2DWM A;  4DR7 M;  1L2B A;  4A3V B;  1QAO A;  1TH4 A;  3ILK A;  4M9X A;  2DWN A;  1EFU B;  2DHR A;  3E9S A;  2CHV A;  1Z59 A;  1NSF A;  2BJV A;  1JQJ C;  3QWL A;  4HL4 A;  4L16 A;  4F2L A;  2DWL A;  5E26 A;  3SAT A;  4R7G A;  5JI2 E;  4GH9 A;  5KQD A;  2EKK A;  2GNO A;  4MGI E;  1HNX M;  3GRU A;  3U61 B;  5ITT A;  1YLA A;  1D0K A;  3PXG A;  1UFZ A;  4FD2 A;  2L6O A;  1XHB A;  3MJ5 A;  4P17 A;  2K9D A;  3SHG B;  1I94 M;  3GRV A;  3W68 A;  3ZH9 B;  4DR6 M;  3C3D A;  4LFB M;  3U6P A;  2CE7 A;  5ITX E;  2C9C A;  2Y0Q A;  4JI7 M;  2LH0 A;  2OOB A;  2QSF X;  3HU3 A;  1C7Y A;  4II7 A;  1WR1 B;  4L78 A;  1YSY A;  4F1I A;  1NNJ A;  3B7N A;  1K3X A;  1T6O A;  3VKG A;  1SG9 A;  1JR3 D;  2JY7 A;  5EP3 A;  3UMM A;  4OVZ A;  5FTM A;  2QNJ A;  2CWB A;  4GRI A;  2L7H A;  3ZQJ A;  3SBJ A;  1PJI A;  1L1T A;  3KOW E;  1Z5A A;  2MH8 A;  3A46 A;  4CJ6 A;  3C9P A;  1WHC A;  3Q8G A;  1XC8 A;  2JZ1 A;  3FUX A;  4L8R C;  3M0E A;  2F5S A;  2VF8 A;  1K3W A;  1MU5 A;  1WGN A;  5L8R F;  2CRU A;  1QAM A;  3J27 B;  3L28 A;  4PDI A;  4TUW A;  4IBJ A;  4NC6 A;  2JY6 B;  4NOO B;  3H4M A;  1BVS A;  1R5L A;  1XXH B;  2HKJ A;  5KPT A;  4LJ9 A;  2M5Z A;  5ITY A;  4D81 A;  4B7H A;  4B08 A;  3AL0 C;  1Y8G A;  2I7P A;  2R46 A;  3A45 A;  3CF2 A;  3NWL A;  4HLQ A;  4MGK E;  4DR1 M;  4AQY M;  4P16 A;  4LJ4 A;  5EXX A;  3GQ4 A;  3SAW A;  3PNV A;  3J7A S;  1WXQ A;  1E32 A;  4QHS A;  3UK6 A;  2CV0 A;  1FNN A;  2QP9 X;  1IQP A;  2YNM D;  4Z8X A;  3U6M A;  2Z3X A;  2FE8 A;  1F4I A;  8CAT A;  1GLN A;  2WSF F;  3K9O A;  2DZN B;  3FRH A;  2VF7 A;  3GLF E;  1Q3B A;  3L25 A;  1WIV A;  3SYL A;  3FE3 A;  1Q02 A;  2CFO A;  4AZF A;  4MM3 B;  4OU7 A;  3W0L B;  4Q7J A;  4XGI A;  2C9O A;  4LFC M;  1XNR M;  2QHO B;  2K0B X;  2R62 A;  3FUU A;  3CF6 E;  5DNY A;  1HNZ M;  3FYC A;  2XH9 A;  4DR5 M;  4G3O A;  3GLI E;  2F5N A;  4B3T M;  3CF0 A;  1K82 A;  2LVO C;  4JI2 M;  1J09 A;  2LHC A;  1DGF A;  2QZ4 A;  1NV8 A;  4LZZ A;  1L1Z A;  1Z6T A;  1OFH A;  2MGW A;  1LTM A;  2EKF A;  2QEN A;  1N77 A;  4G4O A;  4MGH A;  1NNU C;  5EJC A;  4ZPX A;  1S3S A;  1R7R A;  3QAU A;  4G4R A;  2O5R A;  2KRU A;  3TWK A;  3K92 A;  1NHW C;  3KXE C;  4I5S A;  3HHX A;  3KP1 E;  4NSR A;  3RGS A;  4IJE A;  4D82 A;  1EE8 A;  2UXD M;  1N75 A;  1QZE A;  2JY8 A;  2KRK A;  3LQQ A;  3GLI A;  1ZV1 A;  1L2D A;  3H4J A;  2ZAO A;  3SC3 A;  1R6B X;  1XWI A;  2KW0 A;  1HJP A;  1ZMW A;  4CIS A;  3THG A;  1IN4 A;  3AKZ A;  3GLF B;  1IN7 A;  2XSZ A;  1XMO M;  2J7N A;  1R2Y A;  2UU9 M;  2V1U A;  1WGL A;  4LZJ A;  2HWJ A;  4X66 M;  2CUZ A;  2DWZ B;  5H37 D;  1G41 A;  4GHA A;  3U60 A;  3PFI A;  4LF7 M;  1ZMV A;  3J81 S;  1LV7 A;  3LCU A;  3U6D A;  2JNH A;  3U5Z A;  1ZQ9 A;  1PJT A;  4IBI A;  2R0I A;  2R44 A;  1NY5 A;  4LJ8 A;  3GPY A;  4AKG A;  1VEK A;  4RF1 A;  4RNA A;  2X49 A;  1QDR A;  3VDP A;  2CV1 A;  3CTW B;  4BBA A;  2K47 A;  3HGI A;  5FSW A;  4IBG A;  3HJ8 A;  1T3T A;  2JXN A;  4WP2 A;  3T15 A;  4JI5 M;  2AHM A;  4DV7 M;  3GPU A;  3FUV A;  3JR4 A;  4WW0 A;  2CP8 A;  4GIP A;  2XGN A;  2C5R A;  4LJA A;  4XBO A;  1NVM A;  1QUT A;  2RGH A;  1VEG A;  2ZTD A;  4KO8 A;  1T43 A;  1Q39 A;  2FH0 A;  2BWB A;  3KDS E;  2L4F A;  1V92 A;  2QBY B;  2HCB A;  4KHP M;  1RU3 A;  3M7G A;  2DAM A;  1SXJ A;  2MR9 A;  2MRO B;  4JXJ A;  5IRE B;  1PGY A;  3J2P B;  3RFW A;  5ITR A;  4DV1 M;  2R6F A;  2XFS A;  5KO3 A;  3DZD A;  1VDD A;  3M6A A;  2H1R A;  1OAO C;  3E4R A;  3E21 A;  3SHF A;  5EXS A;  2XFT A;  2I7N A;  1TH2 A;  3PNY A;  4B7G A;  5BR8 M;  4DV4 M;  4G4N A;  4GKK M;  4LGY A;  3HHW A;  4LFA M;  1OIZ A;  2L4E A;  1QYR A;  3QYB A;  3B89 A;  2OO9 A;  3I04 M;  4IIW A;  3FYD A;  2EJS A;  4GC9 A;  1TDH A;  5KQ8 A;  1IBL M;  2F4V M;  2EO2 A;  4X64 M;  4GKJ M;  2X4A A;  2KNA A;  2EA0 A;  3VDU A;  2J5Y A;  2V6Z M;  3D8B A;  4GEW A;  3FKE A;  4IBF A;  4JI3 M;  4MGZ E;  1QVR A;  3R8F A;  4M0D A;  4RKU F;  2F5O A;  4I8O A;  2R18 A;  4IBE A;  3GRY A;  3FTF A;  5FLX S;  4LJ6 A;  2DAI A;  3J7B A;  2G5G X;  1MN3 A;  2P5T A;  2WSE F;  4LF5 M;  2LXE A;  2LNH C;  2KXE A;  2YQZ A;  3E46 A;  5FTK A;  2Z8Y M;  4DUZ M;  3GP1 A;  1G8P A;  4LF8 M;  5IWA M;  1PRB A;  3AFH A;  4LF9 M;  2CHG A;  2Z4S A;  1AIP C;  1V34 A;  3GLH A;  1J7K A;  3GLG E;  1SXJ C;  4OVZ B;  2BJW A;  3I4V A;  5DYG A;  2C96 A;  1HNW M;  2JZ0 A;  3KOX E;  2LVP C;  1TF0 B;  2KZS A;  1VDL A;  2XLJ A;  3LMM A;  1Z5B A; 
#chains in the Genus database with same CATH homology
 3IEC A;  2B3T A;  2WZJ A;  3GLH E;  1G4A E;  1QZE A;  2JY8 A;  1VQ1 A;  1ZV1 A;  1JR3 E;  2DHY A;  1OKS A;  1TR8 A;  2HAK A;  3H4J A;  1NV9 A;  4R71 A;  1HJP A;  1ZMW A;  1XB2 B;  1WJ7 A;  1EFU B;  1P3Q Q;  4F2L A;  2LVQ D;  1WGL A;  2HWJ A;  5JI2 E;  2EKK A;  1G41 A;  1HQY E;  1ZMV A;  1YLA A;  3LCU A;  1UFZ A;  1DO0 A;  2JNH A;  2K9D A;  2DEN A;  1HT1 E;  2R0I A;  2DI0 A;  1CUK A;  2RRU A;  3K9P A;  1VEK A;  2G3Q A;  2OOB A;  2QSF X;  2LVN C;  1C7Y A;  1WR1 B;  2KNV A;  4F1I A;  1OTR A;  3T6P A;  1OAI A;  4HEO A;  4WP2 A;  1T6O A;  1TTE A;  2DAK A;  1SG9 A;  2JY7 A;  2CP8 A;  2QNJ A;  2CWB A;  4UN2 B;  1VEG A;  2ZTD A;  2JY5 A;  1WHC A;  1IM2 A;  1T43 A;  2JZ1 A;  3MMP A;  2BWB A;  1GO5 A;  2L4F A;  1V92 A;  3BBZ A;  2JUJ A;  2DAM A;  2MR9 A;  1WGN A;  2MRO B;  1PGY A;  1IXS A;  3F92 A;  2LBC A;  2BWE A;  3LCV B;  2JY6 B;  1VG5 A;  3E21 A;  5DFL A;  1BVS A;  2O25 A;  1E94 E;  2L4E A;  1DV0 A;  1Y8G A;  3B89 A;  2OO9 A;  2EJS A;  1VEJ A;  1HT2 E;  2KNA A;  2LTU A;  1ZMU A;  1R4G A;  4GEW A;  2JP7 A;  3IHP A;  1G3I A;  1F4I A;  2OOA A;  3K9O A;  3FRH A;  3GLF E;  1WIV A;  2ZTC A;  3FE3 A;  1Q02 A;  2DNA A;  2H5X A;  1A5T A;  2DAI A;  4Q7J A;  1DO2 A;  3FRI A;  1MN3 A;  2MJ5 B;  2LVA A;  2QHO B;  2K0B X;  2DKL A;  2DAG A;  3E46 A;  4DBG B;  2DZL A;  1KYI A;  2KHH A;  4G3O A;  1AIP C;  3GLI E;  3GLG E;  1IFY A;  2LVO C;  1NV8 A;  2JZ0 A;  2KNZ A;  2L2D A;  1OQY A;  2EKF A;  2LVP C;  2MGW A;  1XXH E;  1VDL A;  2DAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...