1F4IA

Solution structure of the hhr23a uba(2) mutant p333e, deficient in binding the hiv-1 accessory protein vpr
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
45
structure length
45
Chain Sequence
QEKEAIERLKALGFEESLVIQAYFACEKNENLAANFLLSQNFDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr.
pubmed doi rcsb
molecule tags Dna binding protein,transcription
molecule keywords UV EXCISION REPAIR PROTEIN PROTEIN RAD23 HOMOLOG A
total genus 8
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1f4iA00
2LVOC 1IFYA 2WZJA 1Q02A 2MGWA 1HT1E 2LVAA 2DAKA 3GLHE 1XXHE 2DNAA 2JY8A 2JY6B 1CUKA 1WJ7A 2B3TA 3GLIE 2MROB 1KYIA 1OKSA 2LVPC 1VQ1A 2EKKA 1WHCA 3LCVB 4F1IA 2DHYA 1A5TA 3H4JA 2K0BX 1BVSA 4G3OA 2DKLA 1VEKA 2DAEA 2EJSA 5DFLA 1F4IA 1ZV1A 2RRUA 3F92A 2QHOB 2JY5A 2MR9A 4GEWA 1NV9A 5JI2E 2HWJA 3E46A 1R4GA 3BBZA 2JP7A 1XB2B 2JNHA 3E21A 2KNVA 4R71A 2DZLA 3IHPA 2H5XA 1Y8GA 1VG5A 1HJPA 3GLGE 1V92A 2DAGA 2KHHA 2DI0A 1G3IA 4WP2A 2LTUA 2R0IA 1ZMVA 1G4AE 1T43A 1UFZA 2CP8A 2OOAA 1DO0A 1GO5A 1IXSA 4UN2B 1C7YA 3K9OA 1PGYA 3IECA 2OOBA 1YLAA 1WGLA 1TR8A 1MN3A 2JZ1A 4DBGB 3FRIA 1IM2A 2L4FA 1WGNA 4F2LA 1OAIA 1E94E 1VEGA 2EKFA 1AIPC 1WR1B 3T6PA 2LVNC 2L2DA 2DAIA 2QSFX 1OQYA 2L4EA 2CWBA 1JR3E 2KNZA 1HQYE 2G3QA 2OO9A 2QNJA 3MMPA 1EFUB 1WIVA 1ZMUA 1DO2A 2BWBA 1G41A 1VEJA 1ZMWA 2LBCA 2ZTCA 1QZEA 2DENA 3K9PA 2JUJA 1P3QQ 3FRHA 2ZTDA 1HT2E 3LCUA 2JY7A 1TTEA 1OTRA 4Q7JA 3FE3A 2O25A 1NV8A 1VDLA 2BWEA 1SG9A 2HAKA 2JZ0A 2DAMA 1DV0A 2K9DA 3B89A 3GLFE 1T6OA 2LVQD 4HEOA 2KNAA 2MJ5B
chains in the Genus database with same CATH superfamily
1FNNA 2LVOC 1J09A 3HZJA 3KW6A 2QCUA 1Q02A 4LRSA 2ERCA 1GABA 2WSFF 2Z4RA 3K1JA 1TH3A 3SBJA 4DV0M 4OX9M 1HT1E 2LVAA 1ORYB 3UZUA 3GLHE 4LY6A 1K3XA 2UU9M 2CUZA 5IREB 4MH0E 1MJGM 1Z5BA 1HQCA 2MH8A 2QZ4A 1CUKA 3PNYA 4FCWA 3SFZA 3A46A 4JN6A 4NRWA 3VLFB 3T38A 2LVPC 2GQFA 4F1IA 4AKGA 2EUCA 3B7NA 2DHYA 1A5TA 2K0BX 2XFTA 1NVMA 2DKLA 2R6FA 3U6SA 1XC8A 2Y20A 4IBBA 4D82A 1F4IA 3F92A 2QHOB 3OTOM 3AJIB 3J2PB 2JY5A 2LH0A 4BB9A 3GP1A 4GC9A 3TWMA 3SMPA 2HWJA 3AL0C 1QYRA 1TDHA 4PT5A 3GO8A 4QHTA 4XBOA 2C5RA 1IN6A 1JB0F 4LGYA 2D7GA 4R71A 3HHXA 1TGUA 4L6V6 4AKHA 4HLQA 1Y8GA 4RKUF 3SASA 5JI3E 1HJPA 1Z59A 3GLGE 1V92A 2F5OA 1G59A 3UMMA 3FTFA 1YUBA 1TH4A 1G3IA 3L2AA 2VF7A 3A45A 2VQFM 3Q8GA 3U6LA 3NWLA 2UXCM 1UFZA 2HKJA 1L8QA 2DZNB 1QANA 2V6ZM 1S3SA 4S12A 3HGIA 4G4RA 2BJWA 2QBYA 3HU1A 2CHQA 3HHYA 3AFHA 4IBIA 1PGYA 3EIEA 3MHVC 3VDUA 1MX0A 4IJFA 1RU3A 2VIIA 4KODA 3HKPA 3KOWE 3J7BA 4LJ8A 3U6QA 1MN3A 2HL7A 2Z7JA 1HNZM 4LJ6A 4DBGB 3HJ8A 1IXSB 1WGNA 4I4LA 4F2LA 4B3SM 4RNAA 3J81S 1IBLM 3B7ZA 4Z6YA 3R9XB 5KPTA 1C1KA 2CHVA 1XWIA 3A98B 1WR1B 2CV0A 2L2DA 4JI5M 4AW4A 2F4VM 4Z8XA 3W0FA 2DAIA 4OW0A 4EIWA 3GPXA 3C58A 3HU3A 1HNXM 1PJQA 5FTKA 2DHRA 1N78A 4IJEA 4JV5M 4I81A 4IBJA 4GHLA 1JQJC 5EXPA 1YE9A 4X62M 2G3QA 4PDGA 2YFQA 1N32M 3MMPA 3VK7A 2OQ4A 4AG6A 3V76A 4DV7M 4IBDA 4REZA 3U6EA 3E4RA 2CV2A 4CJ6A 1NHGC 1OFHA 1ZMWA 4DV6M 3QAUA 2DENA 5EJCA 5FSWA 2I7PA 1NY5A 2OPFA 2X8AA 2LHCA 1TH2A 3GRRA 2VQEM 2XFSA 3I4YA 4DUYM 1DGHA 1TTEA 4Q7JA 2EA0A 2ZAMA 5ITQA 4JYAM 2QENA 2BWEA 1HR0M 2LHGA 4PD2A 3SATA 2I7NA 5EQTA 1J5EM 2KA6B 4NSOB 3B89A 3CTWB 1E32A 3GLFE 4DV4M 2E5LM 2CRUA 4LRTA 5C1BA 4TUWA 2MJ5B 1DGFA 2H1RA 2JWSA 4I5SA 4GITA 1JR3D 4DR3M 4LF6M 3GLGA 1ZQ9A 1QVRA 1SXJD 1FJGM 4DR2M 2DVWB 2KEBA 1GLNA 4GRIA 4LF5M 1IN8A 3FUUA 1IQPA 5H37D 1LTMA 3AKZA 2DNAA 5EP1A 3ZC7B 1DGBA 1X37A 1WJ7A 2RGHA 4LFBM 3J7AS 2AHMA 4GMQA 4FWHA 2HHHM 1L1TA 3LCVB 3SARA 2J7NA 4ITQA 5KPRA 2UXDM 4G3OA 2XGNA 3FUWA 4LJAA 3T15A 4JI4M 2N35A 2L7HA 3MJ5A 2MR9A 2WSCF 3LW5F 3HY5A 2KRUA 2ZM6M 2R65A 3CF0A 5DYGA 3SC3A 3E46A 3U5ZA 1XNQM 3BBZA 3MK6A 1N34M 3GLHA 3LQQA 3RFWA 5EXXA 5DYIA 3E21A 2KNVA 2VF8A 3IHPA 4GIPA 2D7EA 2D7HA 2Z3XA 3KFUG 4W5WA 3KP0E 5FTMA 2C98A 2H5XA 3DOAA 3DZDA 4B7FA 3JR5A 1VG5A 1XNRM 1PJTA 2M5ZA 2DAGA 4QNMA 3GLHB 2DI0A 4QOZC 3VKHA 2A5YB 1YSYA 3B7QA 4WP2A 2R0IA 4XK8F 1ZMVA 1W5SA 4MGHA 1T43A 2JA2A 4GC5A 4LJ9A 2G5GX 4NRVA 4DR6M 4M9SA 1IXSA 4X65M 4KLNA 1ZAEA 4UN2B 4JI6M 3K9OA 3U61A 1NO1A 3PXGA 1PM5A 3FTEA 3IG8A 4MM3B 2Y21A 4HL4A 1L2DA 2DWNA 1YLAA 1OJLA 2DWMA 3SAVA 1TR8A 4JXJA 1D0KA 3VKGA 4D80A 1SXJC 1QAOA 2Q2EB 3HU2A 2QBYB 3FRIA 2L4FA 5ITYA 1OAIA 1VEGA 2Y0QA 1NNUC 1AIPC 3T6PA 7CATA 1JR3A 4CHTB 2RGOA 4AI6A 1SXJA 3HJQA 4DV1M 3T1HM 3FYCA 4DUZM 4IBCA 3CF6E 4X66M 4MGZE 2CWBA 3HWSA 5FTLA 2KNZA 1HQYE 4PCZA 2OO9A 2QNJA 1PRBA 1PJSA 1GJSA 1EFUB 1DO2A 5LMUM 3AOGA 2XH9A 4LGMA 4JI8M 4DR7M 3TE6A 1Z6TA 4KO8A 2X49A 3D8BA 3RGSA 2ZTDA 4OU7A 5ITTA 4NXNM 4L4UA 3U6PA 1HT2E 1N36M 4OVZA 4G4NA 2O25A 1N75A 4PDIA 3TPZA 5KQDA 1NV8A 1VDLA 4FCVA 2X4AA 2JZ0A 3BOSA 2DAMA 1DV0A 4FCTA 1D0MA 2Z8YM 4NSRA 3VDPA 1K82A 2KNAA 3FD9A 2QP9X 1NHWC 3C9PA 3UK6A 4M9ZA 1G8PA 2WSEF 5IWAM 2K6BA 2F5NA 4CISA 2C9OA 1N77A 3H4MA 5EXSA 1E9RA 5A2QS 2R4EA 4R3DA 3KSXA 4B3MM 1OFIA 2DAKA 4RF1A 4NL4H 2DZOB 2FFJA 2JY8A 2JY6B 4KHPM 2R4JA 2FNAA 1QDTA 5KPZA 4LF4M 2LWXA 2MROB 4L78A 2YQZA 1OKSA 2EKKA 3HHZA 3QWLA 4QHSA 3C3EA 3H4JA 2APLA 1VEKA 2DAEA 2EJSA 5DFLA 3TWLA 1KFVA 4D81A 1QAQA 1OAOC 2R45A 4G4OA 4DR1M 1NV9A 5JI2E 2XZUA 1TF0B 4DV3M 2JP7A 4G6ZA 2NQ8C 1XB2B 3W0LB 4DV5M 2JNHA 4GHAA 1AUAA 4JI0M 2KZUA 4GH9A 3U6DA 1UM8A 3KS4A 3PVSA 1GVNA 3SHGB 1XXHB 2KHHA 4LJ5A 3WHLA 4WURA 3RE8A 3U6MA 2O5RA 4G4QA 1VDDA 2LTUA 5FTNA 2UXBM 2DWLA 4MGYE 1G4AE 5EP2A 4AG5A 3GPYA 2OOAA 2C9CA 1R5LA 3GPUA 5KO3A 4R7GA 3L25A 1QQWA 4QOSA 5ITXE 3I4VA 2C96A 2XSZD 1PJIA 1Q3CA 1C7YA 5GKNA 4B7GA 4AQYM 4JI2M 2UUBM 3I01M 4FD2A 2ZAOA 1DGHB 4FWGA 1IN4A 1Q3BA 2OOBA 1L1ZA 4CGYB 2W82A 1IXRC 1GL7A 1QUSA 1QZMA 3JAMS 3W68A 5DNYA 1Z5AA 3C3DA 3SAUA 2LXEA 3L29A 2CV1A 3M7GA 3TWKA 2R18A 3FUTA 2JZ1A 4LF9M 2DWZB 3DA1A 4BBAA 3UGJA 1IY0A 3W67A 1NJGA 4MB7A 4LG2A 4P17A 3AOEA 4NC6A 1R7RA 1R6BX 5FTJA 2CE7A 4CIZA 2LVNC 1DGGA 2J5YA 4GKJM 1T3TA 3KXEC 2V1UA 4Y28F 2UUCM 1D0LA 4L16A 2L4EA 2GNOA 3SAWA 4M0WA 3ZH9B 3KVWA 2Y0TA 3U61B 1PJJA 3B74A 4DR5M 3L26A 1G41A 1VEJA 3SYLA 1NSFA 1XMOM 1QZEA 1K3WA 2CFOA 4FW9A 1HNWM 3KOZE 4M0DA 2JUJA 3GLIA 3AV0A 3GRYA 4X64M 4JI7M 2JY7A 5IT9S 3LVVA 3FE3A 4P16A 3LQRA 4MGIE 3GLFB 1IBKM 5ITUA 1I94M 1Q39A 2HAKA 3RGPA 2BNKA 2K9DA 5IZ7D 2F5SA 1TDZA 1V33A 4WW0A 2LVQD 3LVWA 5EP4A 4LFAM 1OIZA 1IFYA 3ILKA 2P5TA 2WZJA 4LF7M 4AZFA 3VFDA 4B7HA 1NY6A 2G8LA 2C99A 3I51A 3GQ4A 3R8FA 2MGWA 4B08A 1IBMM 2KZSA 2ZBKB 3THGA 2K47A 3LMMA 1SXJE 2XSZA 2R46A 1XXHE 1IY1A 3KOYE 3TL4X 1I4WA 3HHWA 1E9SA 4I8OA 2RKOA 4LZZA 3IG5A 2B3TA 2KDLA 3GLIE 1KYIA 1VQ1A 2R62A 3BXWA 3GQ3A 1WHCA 1G71A 3QYBA 2UUAM 2XZFA 1BVSA 4JI3M 1ZV1A 2RRUA 4KT0F 1OIPA 3KP1E 3T1YM 4GEWA 1IN5A 3D8LA 1R4GA 3SHFA 1V34A 3GRVA 3U6OA 4YHHM 3PNVA 2M60A 3L27A 1Z5CA 2CHGA 2DZLA 5F3WA 1GJTA 2J7OA 1L2BA 4ZPXA 2ZANA 4DV2M 4NOOB 5ITRA 2XLJA 3KS8A 3TQSA 4FVMA 1NNJA 1H6UA 2L6OA 2YNMD 2FOIC 3M0EA 4A3VB 3J27B 3PFIA 5BR8M 4DR4M 4K0KM 2CP8A 2F5QA 1DO0A 1GO5A 3GPPA 4QNRA 3QYEA 4FWDA 2EO2A 3NBIA 4RF0A 4LCBA 1QAMA 3K8ZA 1XHBA 1IY2A 4YY3M 1QUTA 1R2ZA 3IECA 2YR0A 1L2CA 4LF8M 3NBXX 4NXMM 4LZJA 4BLCA 2LNHC 3JR4A 4AKIA 2KXEA 1WGLA 5ITXA 1WXQA 3VK8A 3GLGB 4IBFA 3FTDA 3U6CA 2V1CA 2L7IA 5E26A 1IM2A 1EE8A 3SYKA 2QQ8A 3E9SA 2XEPA 4MGKE 4JI1M 5E6JA 2L09A 3FTCA 3HX3A 3CF2A 3KDSE 1E94E 3U60A 2EKFA 2R44A 5LMNM 3U5ZB 4B3RM 2VDBB 4ANRA 3ZCBB 2CEAA 1XXHA 1N33M 4OVZB 1MU5A 5KQ8A 3FUVA 2QSFX 1OQYA 1GKIA 2BJVA 3HJSA 5BPVA 1NJFA 3GRUA 1JR3E 1W5TA 2QPAA 3A42A 3WHKA 3K92A 2KRKA 2KW0A 2FS1A 3FUXA 4IBEA 4L8RC 1GL6A 4GKKM 3FYDA 5C18A 4L15A 1WIVA 1ZMUA 3L28A 2HCBA 4IBKA 8CATA 1R2YA 3GLFA 1EIJA 2BWBA 3EIHA 2DXIA 4IBGA 2LBCA 2F5PA 4B3TM 2ZTCA 3AOEC 3CGWA 3K9PA 3U60B 1P3QQ 3I04M 3GLIB 4M9XA 1IXZA 1J7KA 3FRHA 4LFCM 2Z4SA 2XF3A 2O01F 1LV7A 3B9PA 3DFZA 3LCUA 3K2LA 3M6AA 3ZQJA 1OTRA 4II7A 5EP3A 1SXJB 1D2NA 4LJ4A 1QDRA 4XGIA 3KSJA 5FLXS 5EXTA 2FH0A 1XMQM 3FKEA 1SG9A 2JXNA 3KOXE 2FE8A 1KSFX 4IIWA 3J80S 3Q8XA 4LJ7A 3SMSA 5L8RF 3GQ5A 1T6OA 3UJNA 4HEOA 1IN7A
chains in the Genus database with same CATH topology
2LVOC 1IFYA 2WZJA 1Q02A 2MGWA 1HT1E 2LVAA 2DAKA 3GLHE 1XXHE 2DNAA 2JY8A 2JY6B 1CUKA 1WJ7A 2B3TA 3GLIE 2MROB 1KYIA 1OKSA 2LVPC 1VQ1A 2EKKA 1WHCA 3LCVB 4F1IA 2DHYA 1A5TA 3H4JA 2K0BX 1BVSA 4G3OA 2DKLA 1VEKA 2DAEA 2EJSA 5DFLA 1F4IA 1ZV1A 2RRUA 3F92A 2QHOB 2JY5A 2MR9A 4GEWA 1NV9A 5JI2E 2HWJA 3E46A 1R4GA 3BBZA 2JP7A 1XB2B 2JNHA 3E21A 2KNVA 4R71A 2DZLA 3IHPA 2H5XA 1Y8GA 1VG5A 1HJPA 3GLGE 1V92A 2DAGA 2KHHA 2DI0A 1G3IA 4WP2A 2LTUA 2R0IA 1ZMVA 1G4AE 1T43A 1UFZA 2CP8A 2OOAA 1DO0A 1GO5A 1IXSA 4UN2B 1C7YA 3K9OA 1PGYA 3IECA 2OOBA 1YLAA 1WGLA 1TR8A 1MN3A 2JZ1A 4DBGB 3FRIA 1IM2A 2L4FA 1WGNA 4F2LA 1OAIA 1E94E 1VEGA 2EKFA 1AIPC 1WR1B 3T6PA 2LVNC 2L2DA 2DAIA 2QSFX 1OQYA 2L4EA 2CWBA 1JR3E 2KNZA 1HQYE 2G3QA 2OO9A 2QNJA 3MMPA 1EFUB 1WIVA 1ZMUA 1DO2A 2BWBA 1G41A 1VEJA 1ZMWA 2LBCA 2ZTCA 1QZEA 2DENA 3K9PA 2JUJA 1P3QQ 3FRHA 2ZTDA 1HT2E 3LCUA 2JY7A 1TTEA 1OTRA 4Q7JA 3FE3A 2O25A 1NV8A 1VDLA 2BWEA 1SG9A 2HAKA 2JZ0A 2DAMA 1DV0A 2K9DA 3B89A 3GLFE 1T6OA 2LVQD 4HEOA 2KNAA 2MJ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVO C;  1IFY A;  2WZJ A;  1Q02 A;  2MGW A;  1HT1 E;  2LVA A;  2DAK A;  3GLH E;  1XXH E;  2DNA A;  2JY8 A;  2JY6 B;  1CUK A;  1WJ7 A;  2B3T A;  3GLI E;  2MRO B;  1KYI A;  1OKS A;  2LVP C;  1VQ1 A;  2EKK A;  1WHC A;  3LCV B;  4F1I A;  2DHY A;  1A5T A;  3H4J A;  2K0B X;  1BVS A;  4G3O A;  2DKL A;  1VEK A;  2DAE A;  2EJS A;  5DFL A;  1F4I A;  1ZV1 A;  2RRU A;  3F92 A;  2QHO B;  2JY5 A;  2MR9 A;  4GEW A;  1NV9 A;  5JI2 E;  2HWJ A;  3E46 A;  1R4G A;  3BBZ A;  2JP7 A;  1XB2 B;  2JNH A;  3E21 A;  2KNV A;  4R71 A;  2DZL A;  3IHP A;  2H5X A;  1Y8G A;  1VG5 A;  1HJP A;  3GLG E;  1V92 A;  2DAG A;  2KHH A;  2DI0 A;  1G3I A;  4WP2 A;  2LTU A;  2R0I A;  1ZMV A;  1G4A E;  1T43 A;  1UFZ A;  2CP8 A;  2OOA A;  1DO0 A;  1GO5 A;  1IXS A;  4UN2 B;  1C7Y A;  3K9O A;  1PGY A;  3IEC A;  2OOB A;  1YLA A;  1WGL A;  1TR8 A;  1MN3 A;  2JZ1 A;  4DBG B;  3FRI A;  1IM2 A;  2L4F A;  1WGN A;  4F2L A;  1OAI A;  1E94 E;  1VEG A;  2EKF A;  1AIP C;  1WR1 B;  3T6P A;  2LVN C;  2L2D A;  2DAI A;  2QSF X;  1OQY A;  2L4E A;  2CWB A;  1JR3 E;  2KNZ A;  1HQY E;  2G3Q A;  2OO9 A;  2QNJ A;  3MMP A;  1EFU B;  1WIV A;  1ZMU A;  1DO2 A;  2BWB A;  1G41 A;  1VEJ A;  1ZMW A;  2LBC A;  2ZTC A;  1QZE A;  2DEN A;  3K9P A;  2JUJ A;  1P3Q Q;  3FRH A;  2ZTD A;  1HT2 E;  3LCU A;  2JY7 A;  1TTE A;  1OTR A;  4Q7J A;  3FE3 A;  2O25 A;  1NV8 A;  1VDL A;  2BWE A;  1SG9 A;  2HAK A;  2JZ0 A;  2DAM A;  1DV0 A;  2K9D A;  3B89 A;  3GLF E;  1T6O A;  2LVQ D;  4HEO A;  2KNA A;  2MJ5 B; 
#chains in the Genus database with same CATH topology
 1FNN A;  2LVO C;  1J09 A;  3HZJ A;  3KW6 A;  2QCU A;  1Q02 A;  4LRS A;  2ERC A;  1GAB A;  2WSF F;  2Z4R A;  3K1J A;  1TH3 A;  3SBJ A;  4DV0 M;  4OX9 M;  1HT1 E;  2LVA A;  1ORY B;  3UZU A;  3GLH E;  4LY6 A;  1K3X A;  2UU9 M;  2CUZ A;  5IRE B;  4MH0 E;  1MJG M;  1Z5B A;  1HQC A;  2MH8 A;  2QZ4 A;  1CUK A;  3PNY A;  4FCW A;  3SFZ A;  3A46 A;  4JN6 A;  4NRW A;  3VLF B;  3T38 A;  2LVP C;  2GQF A;  4F1I A;  4AKG A;  2EUC A;  3B7N A;  2DHY A;  1A5T A;  2K0B X;  2XFT A;  1NVM A;  2DKL A;  2R6F A;  3U6S A;  1XC8 A;  2Y20 A;  4IBB A;  4D82 A;  1F4I A;  3F92 A;  2QHO B;  3OTO M;  3AJI B;  3J2P B;  2JY5 A;  2LH0 A;  4BB9 A;  3GP1 A;  4GC9 A;  3TWM A;  3SMP A;  2HWJ A;  3AL0 C;  1QYR A;  1TDH A;  4PT5 A;  3GO8 A;  4QHT A;  4XBO A;  2C5R A;  1IN6 A;  1JB0 F;  4LGY A;  2D7G A;  4R71 A;  3HHX A;  1TGU A;  4L6V 6;  4AKH A;  4HLQ A;  1Y8G A;  4RKU F;  3SAS A;  5JI3 E;  1HJP A;  1Z59 A;  3GLG E;  1V92 A;  2F5O A;  1G59 A;  3UMM A;  3FTF A;  1YUB A;  1TH4 A;  1G3I A;  3L2A A;  2VF7 A;  3A45 A;  2VQF M;  3Q8G A;  3U6L A;  3NWL A;  2UXC M;  1UFZ A;  2HKJ A;  1L8Q A;  2DZN B;  1QAN A;  2V6Z M;  1S3S A;  4S12 A;  3HGI A;  4G4R A;  2BJW A;  2QBY A;  3HU1 A;  2CHQ A;  3HHY A;  3AFH A;  4IBI A;  1PGY A;  3EIE A;  3MHV C;  3VDU A;  1MX0 A;  4IJF A;  1RU3 A;  2VII A;  4KOD A;  3HKP A;  3KOW E;  3J7B A;  4LJ8 A;  3U6Q A;  1MN3 A;  2HL7 A;  2Z7J A;  1HNZ M;  4LJ6 A;  4DBG B;  3HJ8 A;  1IXS B;  1WGN A;  4I4L A;  4F2L A;  4B3S M;  4RNA A;  3J81 S;  1IBL M;  3B7Z A;  4Z6Y A;  3R9X B;  5KPT A;  1C1K A;  2CHV A;  1XWI A;  3A98 B;  1WR1 B;  2CV0 A;  2L2D A;  4JI5 M;  4AW4 A;  2F4V M;  4Z8X A;  3W0F A;  2DAI A;  4OW0 A;  4EIW A;  3GPX A;  3C58 A;  3HU3 A;  1HNX M;  1PJQ A;  5FTK A;  2DHR A;  1N78 A;  4IJE A;  4JV5 M;  4I81 A;  4IBJ A;  4GHL A;  1JQJ C;  5EXP A;  1YE9 A;  4X62 M;  2G3Q A;  4PDG A;  2YFQ A;  1N32 M;  3MMP A;  3VK7 A;  2OQ4 A;  4AG6 A;  3V76 A;  4DV7 M;  4IBD A;  4REZ A;  3U6E A;  3E4R A;  2CV2 A;  4CJ6 A;  1NHG C;  1OFH A;  1ZMW A;  4DV6 M;  3QAU A;  2DEN A;  5EJC A;  5FSW A;  2I7P A;  1NY5 A;  2OPF A;  2X8A A;  2LHC A;  1TH2 A;  3GRR A;  2VQE M;  2XFS A;  3I4Y A;  4DUY M;  1DGH A;  1TTE A;  4Q7J A;  2EA0 A;  2ZAM A;  5ITQ A;  4JYA M;  2QEN A;  2BWE A;  1HR0 M;  2LHG A;  4PD2 A;  3SAT A;  2I7N A;  5EQT A;  1J5E M;  2KA6 B;  4NSO B;  3B89 A;  3CTW B;  1E32 A;  3GLF E;  4DV4 M;  2E5L M;  2CRU A;  4LRT A;  5C1B A;  4TUW A;  2MJ5 B;  1DGF A;  2H1R A;  2JWS A;  4I5S A;  4GIT A;  1JR3 D;  4DR3 M;  4LF6 M;  3GLG A;  1ZQ9 A;  1QVR A;  1SXJ D;  1FJG M;  4DR2 M;  2DVW B;  2KEB A;  1GLN A;  4GRI A;  4LF5 M;  1IN8 A;  3FUU A;  1IQP A;  5H37 D;  1LTM A;  3AKZ A;  2DNA A;  5EP1 A;  3ZC7 B;  1DGB A;  1X37 A;  1WJ7 A;  2RGH A;  4LFB M;  3J7A S;  2AHM A;  4GMQ A;  4FWH A;  2HHH M;  1L1T A;  3LCV B;  3SAR A;  2J7N A;  4ITQ A;  5KPR A;  2UXD M;  4G3O A;  2XGN A;  3FUW A;  4LJA A;  3T15 A;  4JI4 M;  2N35 A;  2L7H A;  3MJ5 A;  2MR9 A;  2WSC F;  3LW5 F;  3HY5 A;  2KRU A;  2ZM6 M;  2R65 A;  3CF0 A;  5DYG A;  3SC3 A;  3E46 A;  3U5Z A;  1XNQ M;  3BBZ A;  3MK6 A;  1N34 M;  3GLH A;  3LQQ A;  3RFW A;  5EXX A;  5DYI A;  3E21 A;  2KNV A;  2VF8 A;  3IHP A;  4GIP A;  2D7E A;  2D7H A;  2Z3X A;  3KFU G;  4W5W A;  3KP0 E;  5FTM A;  2C98 A;  2H5X A;  3DOA A;  3DZD A;  4B7F A;  3JR5 A;  1VG5 A;  1XNR M;  1PJT A;  2M5Z A;  2DAG A;  4QNM A;  3GLH B;  2DI0 A;  4QOZ C;  3VKH A;  2A5Y B;  1YSY A;  3B7Q A;  4WP2 A;  2R0I A;  4XK8 F;  1ZMV A;  1W5S A;  4MGH A;  1T43 A;  2JA2 A;  4GC5 A;  4LJ9 A;  2G5G X;  4NRV A;  4DR6 M;  4M9S A;  1IXS A;  4X65 M;  4KLN A;  1ZAE A;  4UN2 B;  4JI6 M;  3K9O A;  3U61 A;  1NO1 A;  3PXG A;  1PM5 A;  3FTE A;  3IG8 A;  4MM3 B;  2Y21 A;  4HL4 A;  1L2D A;  2DWN A;  1YLA A;  1OJL A;  2DWM A;  3SAV A;  1TR8 A;  4JXJ A;  1D0K A;  3VKG A;  4D80 A;  1SXJ C;  1QAO A;  2Q2E B;  3HU2 A;  2QBY B;  3FRI A;  2L4F A;  5ITY A;  1OAI A;  1VEG A;  2Y0Q A;  1NNU C;  1AIP C;  3T6P A;  7CAT A;  1JR3 A;  4CHT B;  2RGO A;  4AI6 A;  1SXJ A;  3HJQ A;  4DV1 M;  3T1H M;  3FYC A;  4DUZ M;  4IBC A;  3CF6 E;  4X66 M;  4MGZ E;  2CWB A;  3HWS A;  5FTL A;  2KNZ A;  1HQY E;  4PCZ A;  2OO9 A;  2QNJ A;  1PRB A;  1PJS A;  1GJS A;  1EFU B;  1DO2 A;  5LMU M;  3AOG A;  2XH9 A;  4LGM A;  4JI8 M;  4DR7 M;  3TE6 A;  1Z6T A;  4KO8 A;  2X49 A;  3D8B A;  3RGS A;  2ZTD A;  4OU7 A;  5ITT A;  4NXN M;  4L4U A;  3U6P A;  1HT2 E;  1N36 M;  4OVZ A;  4G4N A;  2O25 A;  1N75 A;  4PDI A;  3TPZ A;  5KQD A;  1NV8 A;  1VDL A;  4FCV A;  2X4A A;  2JZ0 A;  3BOS A;  2DAM A;  1DV0 A;  4FCT A;  1D0M A;  2Z8Y M;  4NSR A;  3VDP A;  1K82 A;  2KNA A;  3FD9 A;  2QP9 X;  1NHW C;  3C9P A;  3UK6 A;  4M9Z A;  1G8P A;  2WSE F;  5IWA M;  2K6B A;  2F5N A;  4CIS A;  2C9O A;  1N77 A;  3H4M A;  5EXS A;  1E9R A;  5A2Q S;  2R4E A;  4R3D A;  3KSX A;  4B3M M;  1OFI A;  2DAK A;  4RF1 A;  4NL4 H;  2DZO B;  2FFJ A;  2JY8 A;  2JY6 B;  4KHP M;  2R4J A;  2FNA A;  1QDT A;  5KPZ A;  4LF4 M;  2LWX A;  2MRO B;  4L78 A;  2YQZ A;  1OKS A;  2EKK A;  3HHZ A;  3QWL A;  4QHS A;  3C3E A;  3H4J A;  2APL A;  1VEK A;  2DAE A;  2EJS A;  5DFL A;  3TWL A;  1KFV A;  4D81 A;  1QAQ A;  1OAO C;  2R45 A;  4G4O A;  4DR1 M;  1NV9 A;  5JI2 E;  2XZU A;  1TF0 B;  4DV3 M;  2JP7 A;  4G6Z A;  2NQ8 C;  1XB2 B;  3W0L B;  4DV5 M;  2JNH A;  4GHA A;  1AUA A;  4JI0 M;  2KZU A;  4GH9 A;  3U6D A;  1UM8 A;  3KS4 A;  3PVS A;  1GVN A;  3SHG B;  1XXH B;  2KHH A;  4LJ5 A;  3WHL A;  4WUR A;  3RE8 A;  3U6M A;  2O5R A;  4G4Q A;  1VDD A;  2LTU A;  5FTN A;  2UXB M;  2DWL A;  4MGY E;  1G4A E;  5EP2 A;  4AG5 A;  3GPY A;  2OOA A;  2C9C A;  1R5L A;  3GPU A;  5KO3 A;  4R7G A;  3L25 A;  1QQW A;  4QOS A;  5ITX E;  3I4V A;  2C96 A;  2XSZ D;  1PJI A;  1Q3C A;  1C7Y A;  5GKN A;  4B7G A;  4AQY M;  4JI2 M;  2UUB M;  3I01 M;  4FD2 A;  2ZAO A;  1DGH B;  4FWG A;  1IN4 A;  1Q3B A;  2OOB A;  1L1Z A;  4CGY B;  2W82 A;  1IXR C;  1GL7 A;  1QUS A;  1QZM A;  3JAM S;  3W68 A;  5DNY A;  1Z5A A;  3C3D A;  3SAU A;  2LXE A;  3L29 A;  2CV1 A;  3M7G A;  3TWK A;  2R18 A;  3FUT A;  2JZ1 A;  4LF9 M;  2DWZ B;  3DA1 A;  4BBA A;  3UGJ A;  1IY0 A;  3W67 A;  1NJG A;  4MB7 A;  4LG2 A;  4P17 A;  3AOE A;  4NC6 A;  1R7R A;  1R6B X;  5FTJ A;  2CE7 A;  4CIZ A;  2LVN C;  1DGG A;  2J5Y A;  4GKJ M;  1T3T A;  3KXE C;  2V1U A;  4Y28 F;  2UUC M;  1D0L A;  4L16 A;  2L4E A;  2GNO A;  3SAW A;  4M0W A;  3ZH9 B;  3KVW A;  2Y0T A;  3U61 B;  1PJJ A;  3B74 A;  4DR5 M;  3L26 A;  1G41 A;  1VEJ A;  3SYL A;  1NSF A;  1XMO M;  1QZE A;  1K3W A;  2CFO A;  4FW9 A;  1HNW M;  3KOZ E;  4M0D A;  2JUJ A;  3GLI A;  3AV0 A;  3GRY A;  4X64 M;  4JI7 M;  2JY7 A;  5IT9 S;  3LVV A;  3FE3 A;  4P16 A;  3LQR A;  4MGI E;  3GLF B;  1IBK M;  5ITU A;  1I94 M;  1Q39 A;  2HAK A;  3RGP A;  2BNK A;  2K9D A;  5IZ7 D;  2F5S A;  1TDZ A;  1V33 A;  4WW0 A;  2LVQ D;  3LVW A;  5EP4 A;  4LFA M;  1OIZ A;  1IFY A;  3ILK A;  2P5T A;  2WZJ A;  4LF7 M;  4AZF A;  3VFD A;  4B7H A;  1NY6 A;  2G8L A;  2C99 A;  3I51 A;  3GQ4 A;  3R8F A;  2MGW A;  4B08 A;  1IBM M;  2KZS A;  2ZBK B;  3THG A;  2K47 A;  3LMM A;  1SXJ E;  2XSZ A;  2R46 A;  1XXH E;  1IY1 A;  3KOY E;  3TL4 X;  1I4W A;  3HHW A;  1E9S A;  4I8O A;  2RKO A;  4LZZ A;  3IG5 A;  2B3T A;  2KDL A;  3GLI E;  1KYI A;  1VQ1 A;  2R62 A;  3BXW A;  3GQ3 A;  1WHC A;  1G71 A;  3QYB A;  2UUA M;  2XZF A;  1BVS A;  4JI3 M;  1ZV1 A;  2RRU A;  4KT0 F;  1OIP A;  3KP1 E;  3T1Y M;  4GEW A;  1IN5 A;  3D8L A;  1R4G A;  3SHF A;  1V34 A;  3GRV A;  3U6O A;  4YHH M;  3PNV A;  2M60 A;  3L27 A;  1Z5C A;  2CHG A;  2DZL A;  5F3W A;  1GJT A;  2J7O A;  1L2B A;  4ZPX A;  2ZAN A;  4DV2 M;  4NOO B;  5ITR A;  2XLJ A;  3KS8 A;  3TQS A;  4FVM A;  1NNJ A;  1H6U A;  2L6O A;  2YNM D;  2FOI C;  3M0E A;  4A3V B;  3J27 B;  3PFI A;  5BR8 M;  4DR4 M;  4K0K M;  2CP8 A;  2F5Q A;  1DO0 A;  1GO5 A;  3GPP A;  4QNR A;  3QYE A;  4FWD A;  2EO2 A;  3NBI A;  4RF0 A;  4LCB A;  1QAM A;  3K8Z A;  1XHB A;  1IY2 A;  4YY3 M;  1QUT A;  1R2Z A;  3IEC A;  2YR0 A;  1L2C A;  4LF8 M;  3NBX X;  4NXM M;  4LZJ A;  4BLC A;  2LNH C;  3JR4 A;  4AKI A;  2KXE A;  1WGL A;  5ITX A;  1WXQ A;  3VK8 A;  3GLG B;  4IBF A;  3FTD A;  3U6C A;  2V1C A;  2L7I A;  5E26 A;  1IM2 A;  1EE8 A;  3SYK A;  2QQ8 A;  3E9S A;  2XEP A;  4MGK E;  4JI1 M;  5E6J A;  2L09 A;  3FTC A;  3HX3 A;  3CF2 A;  3KDS E;  1E94 E;  3U60 A;  2EKF A;  2R44 A;  5LMN M;  3U5Z B;  4B3R M;  2VDB B;  4ANR A;  3ZCB B;  2CEA A;  1XXH A;  1N33 M;  4OVZ B;  1MU5 A;  5KQ8 A;  3FUV A;  2QSF X;  1OQY A;  1GKI A;  2BJV A;  3HJS A;  5BPV A;  1NJF A;  3GRU A;  1JR3 E;  1W5T A;  2QPA A;  3A42 A;  3WHK A;  3K92 A;  2KRK A;  2KW0 A;  2FS1 A;  3FUX A;  4IBE A;  4L8R C;  1GL6 A;  4GKK M;  3FYD A;  5C18 A;  4L15 A;  1WIV A;  1ZMU A;  3L28 A;  2HCB A;  4IBK A;  8CAT A;  1R2Y A;  3GLF A;  1EIJ A;  2BWB A;  3EIH A;  2DXI A;  4IBG A;  2LBC A;  2F5P A;  4B3T M;  2ZTC A;  3AOE C;  3CGW A;  3K9P A;  3U60 B;  1P3Q Q;  3I04 M;  3GLI B;  4M9X A;  1IXZ A;  1J7K A;  3FRH A;  4LFC M;  2Z4S A;  2XF3 A;  2O01 F;  1LV7 A;  3B9P A;  3DFZ A;  3LCU A;  3K2L A;  3M6A A;  3ZQJ A;  1OTR A;  4II7 A;  5EP3 A;  1SXJ B;  1D2N A;  4LJ4 A;  1QDR A;  4XGI A;  3KSJ A;  5FLX S;  5EXT A;  2FH0 A;  1XMQ M;  3FKE A;  1SG9 A;  2JXN A;  3KOX E;  2FE8 A;  1KSF X;  4IIW A;  3J80 S;  3Q8X A;  4LJ7 A;  3SMS A;  5L8R F;  3GQ5 A;  1T6O A;  3UJN A;  4HEO A;  1IN7 A; 
#chains in the Genus database with same CATH homology
 2LVO C;  1IFY A;  2WZJ A;  1Q02 A;  2MGW A;  1HT1 E;  2LVA A;  2DAK A;  3GLH E;  1XXH E;  2DNA A;  2JY8 A;  2JY6 B;  1CUK A;  1WJ7 A;  2B3T A;  3GLI E;  2MRO B;  1KYI A;  1OKS A;  2LVP C;  1VQ1 A;  2EKK A;  1WHC A;  3LCV B;  4F1I A;  2DHY A;  1A5T A;  3H4J A;  2K0B X;  1BVS A;  4G3O A;  2DKL A;  1VEK A;  2DAE A;  2EJS A;  5DFL A;  1F4I A;  1ZV1 A;  2RRU A;  3F92 A;  2QHO B;  2JY5 A;  2MR9 A;  4GEW A;  1NV9 A;  5JI2 E;  2HWJ A;  3E46 A;  1R4G A;  3BBZ A;  2JP7 A;  1XB2 B;  2JNH A;  3E21 A;  2KNV A;  4R71 A;  2DZL A;  3IHP A;  2H5X A;  1Y8G A;  1VG5 A;  1HJP A;  3GLG E;  1V92 A;  2DAG A;  2KHH A;  2DI0 A;  1G3I A;  4WP2 A;  2LTU A;  2R0I A;  1ZMV A;  1G4A E;  1T43 A;  1UFZ A;  2CP8 A;  2OOA A;  1DO0 A;  1GO5 A;  1IXS A;  4UN2 B;  1C7Y A;  3K9O A;  1PGY A;  3IEC A;  2OOB A;  1YLA A;  1WGL A;  1TR8 A;  1MN3 A;  2JZ1 A;  4DBG B;  3FRI A;  1IM2 A;  2L4F A;  1WGN A;  4F2L A;  1OAI A;  1E94 E;  1VEG A;  2EKF A;  1AIP C;  1WR1 B;  3T6P A;  2LVN C;  2L2D A;  2DAI A;  2QSF X;  1OQY A;  2L4E A;  2CWB A;  1JR3 E;  2KNZ A;  1HQY E;  2G3Q A;  2OO9 A;  2QNJ A;  3MMP A;  1EFU B;  1WIV A;  1ZMU A;  1DO2 A;  2BWB A;  1G41 A;  1VEJ A;  1ZMW A;  2LBC A;  2ZTC A;  1QZE A;  2DEN A;  3K9P A;  2JUJ A;  1P3Q Q;  3FRH A;  2ZTD A;  1HT2 E;  3LCU A;  2JY7 A;  1TTE A;  1OTR A;  4Q7J A;  3FE3 A;  2O25 A;  1NV8 A;  1VDL A;  2BWE A;  1SG9 A;  2HAK A;  2JZ0 A;  2DAM A;  1DV0 A;  2K9D A;  3B89 A;  3GLF E;  1T6O A;  2LVQ D;  4HEO A;  2KNA A;  2MJ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...