1F4IA

Solution structure of the hhr23a uba(2) mutant p333e, deficient in binding the hiv-1 accessory protein vpr
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
45
structure length
45
Chain Sequence
b'QEKEAIERLKALGFEESLVIQAYFACEKNENLAANFLLSQNFDDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV EXCISION REPAIR PROTEIN PROTEIN RAD23 HOMOLOG A
publication title Biochemical and structural analysis of the interaction between the UBA(2) domain of the DNA repair protein HHR23A and HIV-1 Vpr.
pubmed doi rcsb
molecule tags Dna binding protein,transcription
total genus 8
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1f4iA00
4Q7JA 5DFLA 1R4GA 1WGLA 2DHYA 2DZLA 2JY8A 2L4EA 2DAGA 3E46A 2O25A 2DAMA 2JZ0A 2OO9A 2R0IA 2WZJA 1VEKA 2KNAA 2MGWA 3K9PA 1IFYA 2LVPC 2DNAA 1OQYA 3IHPA 4UN2B 1WJ7A 1OTRA 1HJPA 1BVSA 1VQ1A 3E21A 1ZMWA 1Y8GA 3T6PA 1XB2B 2JUJA 3LCUA 1TTEA 2KHHA 3GLHE 3FE3A 2BWBA 2JZ1A 1G4AE 2EKFA 3H4JA 3B89A 3GLGE 2KNVA 2JNHA 1T6OA 2DI0A 1WR1B 2HWJA 2OOAA 1HT2E 1WGNA 1VEGA 4G3OA 1QZEA 1DO2A 1XXHE 2MJ5B 4WP2A 1E94E 2DAEA 1MN3A 2MR9A 1CUKA 3BBZA 1G41A 1HT1E 2JY6B 2L2DA 5JI2E 1WIVA 1DV0A 2RRUA 1ZMVA 2HAKA 2ZTCA 2OOBA 1OAIA 1JR3E 4R71A 1WHCA 1KYIA 1VDLA 1UFZA 1NV8A 1A5TA 2QHOB 1G3IA 2LVOC 4GEWA 1SG9A 1AIPC 2LVQD 3MMPA 2LVAA 1GO5A 3LCVB 1F4IA 1P3QQ 4F1IA 3IECA 2B3TA 2ZTDA 2EKKA 2LVNC 2DENA 2KNZA 2H5XA 1OKSA 2QNJA 2G3QA 2JY7A 1ZV1A 2K9DA 3F92A 1VG5A 4F2LA 1C7YA 1T43A 2K0BX 1IXSA 2EJSA 2CWBA 2JP7A 2LBCA 1DO0A 2DKLA 3GLFE 3FRIA 3FRHA 1PGYA 1V92A 2LTUA 3GLIE 2DAIA 2BWEA 2L4FA 1Q02A 3K9OA 1YLAA 1TR8A 2MROB 1VEJA 4HEOA 2QSFX 1IM2A 2JY5A 2DAKA 1ZMUA 4DBGB 1NV9A 2CP8A 1HQYE 1EFUB
chains in the Genus database with same CATH superfamily
2Q2EB 4Q7JA 5GKNA 1R4GA 1WGLA 2C9OA 5ITUA 3FUUA 2DZLA 2L4EA 1GKIA 2MH8A 4NRVA 4BB9A 4G4RA 3U5ZB 4GRIA 3TE6A 5DNYA 2JZ0A 2CV0A 4Z8XA 3AFHA 3IG5A 1QDRA 2OO9A 3HHYA 4JI5M 3J2PB 4QNRA 5C1BA 4AQYM 4G4NA 2C98A 1TDZA 3K9PA 3U6EA 4IBBA 4AI6A 4UN2B 1IY0A 4FWGA 2XFTA 1HJPA 1VQ1A 3FTDA 5IREB 1ZMWA 1Y8GA 3T6PA 1XXHA 3VKHA 4FCTA 1L2CA 4R3DA 3GLHE 3T15A 2X49A 5L8RF 4B08A 4GC9A 3U6OA 4RNAA 2X8AA 4PD2A 3TWKA 2XH9A 3B74A 2KNVA 2Y0TA 4ANRA 1IN5A 1JR3A 1AUAA 2LNHC 3CF6E 1UM8A 3VKGA 1TGUA 3SHGB 4MM3B 4L8RC 2D7GA 4L6V6 1NSFA 3LMMA 3LW5F 1PJJA 2J7OA 1L2BA 3SAVA 3GLGA 1Z59A 3Q8XA 1D0KA 1XXHE 1QVRA 2QP9X 1Q3BA 2JWSA 2QCUA 1V33A 2DAEA 4NXMM 2MR9A 1G41A 2FH0A 4DR2M 4JYAM 3ZH9B 2RRUA 2ZTCA 3W0FA 1JR3E 2CV2A 2YNMD 4DR3M 1FJGM 3QWLA 4OVZB 5KPTA 2LVOC 4GKKM 1Q3CA 3L26A 2O5RA 2GNOA 2LHCA 3J81S 3CF0A 1XC8A 2WSFF 4LRSA 3GPYA 4LJ6A 4L4UA 3E4RA 3ILKA 4LF4M 3IECA 4QNMA 2BNKA 2B3TA 2KRUA 5EP3A 4LJ7A 4IIWA 4I8OA 4LJ8A 3SATA 2UXDM 4L16A 3J7AS 2KNZA 1XNRM 4WURA 1Z5CA 1G59A 5IT9S 3AV0A 4OW0A 1OKSA 3GLIA 3L25A 1OFHA 1L2DA 1QDTA 3KOWE 1C7YA 3GP1A 1MU5A 1R5LA 2R18A 2CV1A 2Z4RA 2CWBA 3GQ3A 2LBCA 2D7HA 1D0LA 2F5OA 1TH4A 5IZ7D 4JI7M 1NO1A 4M0WA 5FSWA 2KEBA 1PGYA 2RGHA 4ITQA 1NY6A 4P17A 1V92A 3T1YM 4OVZA 4DR1M 5EQTA 4RF1A 3GLIE 4JN6A 4LJ4A 3R9XB 5C18A 5LMNM 1N32M 2UUBM 1TR8A 4D82A 4HEOA 1DGHB 2JY5A 2FE8A 3FUWA 4DBGB 1NJGA 1NV9A 1LV7A 1ZQ9A 2QENA 4D80A 3KOYE 3HU2A 2A5YB 3KSXA 4IBDA 5DFLA 2YQZA 1SXJE 3FKEA 3CGWA 4DV4M 2DWMA 2DHYA 4MGZE 2CUZA 2JY8A 1I4WA 2O25A 2DAMA 4AKGA 1V34A 3FUXA 3A98B 2DVWB 1NNJA 1J5EM 4WW0A 1IBLM 3BOSA 2F4VM 1XXHB 3FUVA 3J80S 3L27A 1QUTA 2ZAOA 3VDUA 2QBYB 4LFBM 2DNAA 4LGMA 1GJSA 3FTCA 3E21A 1BVSA 2O01F 3EIEA 2R6FA 2Y0QA 2V1CA 4G6ZA 1N75A 4D81A 1N33M 3FE3A 2BWBA 3OTOM 1NY5A 1W5TA 3H4JA 4X64M 3WHKA 3GLGB 1DGHA 3SYLA 4IBCA 3NBXX 1OAOC 2HWJA 2F5SA 4JI3M 4XBOA 1HT2E 2H1RA 1VEGA 3GLHA 3PVSA 2RKOA 3C58A 2EO2A 2XSZD 2QQ8A 3LVWA 4IJFA 1DO2A 2DZNB 3J7BA 4XGIA 1HQCA 2C5RA 4NC6A 4Z6YA 4CGYB 1MX0A 1Z6TA 3AOGA 3GRYA 5FLXS 4B3SM 1IY2A 4B3TM 1GVNA 1Z5AA 2JY6B 1TF0B 1QUSA 1WIVA 3HJSA 1ZMVA 3SHFA 3KSJA 2OOBA 1OAIA 1QQWA 1PM5A 1L1ZA 3U6MA 1WHCA 4JXJA 3BXWA 1UFZA 1NV8A 2R4JA 2LHGA 3GPUA 2QBYA 4B7FA 2QHOB 1G3IA 1DGBA 4MGYE 4CJ6A 3AOEC 3VK7A 2LVQD 1T3TA 3HKPA 3RGSA 1IBMM 1KSFX 4II7A 3HU1A 2UU9M 3TPZA 4LFCM 4F1IA 1F4IA 4LF5M 4YHHM 4DR7M 2XFSA 4M9SA 4HL4A 1IXZA 3GLIB 1E9RA 3GLFA 3GQ4A 3RE8A 3CF2A 4FCWA 4REZA 1ZAEA 1IN4A 2ZM6M 3R8FA 3KFUG 3M6AA 5E26A 2DENA 1IBKM 1PJIA 3U6LA 3TQSA 2QNJA 2G3QA 2R46A 3L29A 5KQDA 4DV3M 1E9SA 2K9DA 4AKHA 1LTMA 4M9ZA 3TWLA 3Q8GA 2VF7A 4B3RM 2J5YA 2LXEA 4NSOB 5EP1A 1T43A 1Q39A 2K0BX 2Z8YM 4Y28F 1N36M 3HZJA 5FTMA 2EJSA 5FTLA 5KPZA 3LVVA 1QAQA 1IN7A 1SXJB 1PJTA 1JQJC 3GLFE 4MGHA 4LF8M 1ORYB 3FRIA 4TUWA 4MB7A 1TH2A 3K1JA 3UK6A 2KZSA 1J09A 1G8PA 1JR3D 3HJ8A 4X66M 4RKUF 5ITTA 5E6JA 2EA0A 5ITRA 3KS8A 4X65M 3C9PA 5A2QS 1N77A 2DAIA 4W5WA 2L4FA 2C99A 2XEPA 1XWIA 5BPVA 1Q02A 2HKJA 2UXCM 3RFWA 3U60B 2MROB 1VEJA 2KW0A 3JR4A 4LY6A 2KRKA 4KODA 4AKIA 3K92A 4QHSA 2G5GX 1ZMUA 5EXTA 5FTJA 2XLJA 2F5PA 3MK6A 2FS1A 2CP8A 2V1UA 4IJEA 1R7RA 1HQYE 1EFUB 3K8ZA 2ZAMA 3HJQA 1JB0F 5KO3A 3GRRA 4LJAA 2DAGA 3E46A 2C9CA 1X37A 1Z5BA 2HHHM 5EJCA 3B7ZA 2KZUA 4DV2M 3AL0C 1VEKA 4FWDA 1SXJA 4DV6M 2EUCA 2I7PA 2KNAA 3UMMA 2GQFA 4FCVA 2LVPC 4IBJA 1GABA 3AJIB 1OQYA 3IHPA 5KPRA 1WJ7A 3KOXE 3IG8A 4S12A 3A45A 3U6QA 4AG5A 1XB2B 4JI0M 2KHHA 3PNVA 1QZMA 1G4AE 2JZ1A 2EKFA 2R65A 3GLHB 1YUBA 3ZC7B 3B89A 3KS4A 3U60A 1I94M 1XMOM 2DWLA 3SAWA 1PJQA 4NOOB 4DR5M 2JNHA 2G8LA 3HY5A 2DI0A 3VFDA 4G4OA 1HNWM 1WR1B 4KHPM 3D8BA 3U6CA 3I4YA 4QOSA 2N35A 2LH0A 3HU3A 3SC3A 1N78A 1EE8A 1OJLA 1RU3A 1G71A 1TDHA 2KA6B 5BR8M 1YSYA 1MJGM 4RF0A 5EXPA 4BBAA 2QZ4A 3M7GA 2YFQA 1IXSB 3SARA 3TL4X 2OPFA 1K3WA 1NNUC 4NRWA 2APLA 1CUKA 3BBZA 5IWAM 2DXIA 4LZJA 1OFIA 4JV5M 3W0LB 4JI4M 4AZFA 1DV0A 3H4MA 3KW6A 2HAKA 3NWLA 1D0MA 3B7NA 4MGKE 2K6BA 4XK8F 2CHGA 3FYDA 1KYIA 1VDLA 2ERCA 4I81A 4R7GA 4EIWA 4P16A 2DWZB 3A42A 2CHQA 1H6UA 4MGIE 1SG9A 3U6SA 3W67A 3GLFB 1OIZA 2Y21A 1XHBA 4L78A 2LVAA 2HL7A 1XNQM 3SMPA 3LCVB 3PFIA 2XGNA 5ITYA 2W82A 2ZTDA 1QAMA 4LF6M 1DGGA 2EKKA 2VF8A 4NXNM 2LVNC 2D7EA 2L7HA 3KXEC 2J7NA 3RGPA 1NVMA 3U61B 2H5XA 5KQ8A 4KT0F 2UUAM 4OX9M 4GHLA 2OQ4A 2CE7A 2VIIA 3F92A 2XZUA 5ITQA 3FD9A 4FWHA 1HR0M 3QYEA 3HHXA 4X62M 1IXSA 3KDSE 3T38A 1OIPA 2L7IA 2NQ8C 3I01M 2E5LM 4KLNA 2CEAA 1DO0A 3C3DA 4LJ5A 1W5SA 3ZQJA 3GO8A 3DFZA 3DA1A 5LMUM 3FRHA 2WSCF 4GITA 2CFOA 4M0DA 2WSEF 5EXSA 2RGOA 5DYIA 2FNAA 5ITXE 3VK8A 2DHRA 2FFJA 3KP0E 1R2ZA 4IBFA 4A3VB 1KFVA 2DWNA 3K9OA 3JR5A 3ZCBB 7CATA 2ZANA 4PDIA 8CATA 2Y20A 1K82A 1IM2A 1HNZM 4FW9A 1NHGC 3HWSA 3NBIA 3FTEA 3AKZA 3MJ5A 3FUTA 5FTKA 4CIZA 2JP7A 3PNYA 2AHMA 3KP1E 3U61A 2KXEA 3GPXA 1GL6A 3K2LA 3HHWA 5JI3E 4DR6M 3EIHA 4K0KM 4IBEA 1IY1A 2Z4SA 3SFZA 4QOZC 3FYCA 1C1KA 3WHLA 3UJNA 1HNXM 1TH3A 2R0IA 2WZJA 3SBJA 2LWXA 5EXXA 4FVMA 3U6DA 4JI2M 2MGWA 3U5ZA 1DGFA 4QHTA 1IFYA 4DV7M 4DUZM 4L15A 4LGYA 2XZFA 1OTRA 4LCBA 1D2NA 3LQRA 4DV1M 2HCBA 2KDLA 3QAUA 3QYBA 3L28A 3M0EA 2JUJA 3I04M 3LCUA 1TTEA 5EP4A 3PXGA 3SMSA 4LF7M 3VDPA 4CHTB 2R4EA 4DV5M 3GLGE 2R45A 1R6BX 4GH9A 4IBKA 2BJWA 5DYGA 1GL7A 3DZDA 4LFAM 1T6OA 4BLCA 2DZOB 4LJ9A 3KOZE 2OOAA 1WGNA 1FNNA 4G3OA 4JI8M 1QZEA 1L1TA 1VDDA 2Z3XA 2F5QA 4GIPA 2XF3A 5FTNA 1J7KA 3B7QA 5EP2A 3U6PA 2MJ5B 3A46A 4WP2A 1E94E 1IXRC 3GRVA 1GLNA 1MN3A 4GC5A 2P5TA 4AG6A 1HT1E 2CHVA 5JI2E 2L2DA 4GMQA 3UZUA 3V76A 2VQEM 1PRBA 4I5SA 3D8LA 1WXQA 1QANA 3CTWB 4R71A 1NHWC 2JA2A 2CRUA 4DUYM 1IN8A 2JXNA 3VLFB 1A5TA 4GEWA 4OU7A 3GQ5A 1N34M 2L6OA 2R44A 2V6ZM 4DR4M 1AIPC 3C3EA 4JI1M 2F5NA 3MMPA 4IBGA 3KVWA 1GO5A 4LRTA 2I7NA 1P3QQ 1QYRA 3THGA 3GPPA 4DV0M 3L2AA 4PT5A 4GHAA 4GKJM 3HX3A 3I4VA 2R62A 2Z7JA 1PJSA 3T1HM 2BJVA 3LQQA 3JAMS 2YR0A 2M60A 1SXJD 4PDGA 4HLQA 2M5ZA 4MH0E 4PCZA 4YY3M 5F3WA 2JY7A 1ZV1A 2ZBKB 3FTFA 2FOIC 1VG5A 4F2LA 4B7GA 3E9SA 3B9PA 1XMQM 3MHVC 1R2YA 4JI6M 4NL4H 1K3XA 4B3MM 4AW4A 4IBIA 3AOEA 3HGIA 3UGJA 4I4LA 2DKLA 5H37D 4M9XA 2XSZA 3I51A 1E32A 4KO8A 1L8QA 4LZZA 3HHZA 2VQFM 2C96A 2LTUA 4FD2A 3TWMA 1EIJA 2K47A 4B7HA 1SXJC 2BWEA 4NSRA 4ZPXA 4LF9M 1QAOA 2UXBM 1IN6A 1IQPA 2QPAA 3J27B 4LG2A 1YLAA 3SYKA 5ITXA 4CISA 1NJFA 2QSFX 3GRUA 2L09A 2DAKA 1YE9A 2VDBB 3W68A 2X4AA 4G4QA 3SASA 3DOAA 3SAUA 1GJTA 2UUCM 1S3SA
chains in the Genus database with same CATH topology
4Q7JA 5DFLA 1R4GA 1WGLA 2DHYA 2DZLA 2JY8A 2L4EA 2DAGA 3E46A 2O25A 2DAMA 2JZ0A 2OO9A 2R0IA 2WZJA 1VEKA 2KNAA 2MGWA 3K9PA 1IFYA 2LVPC 2DNAA 1OQYA 3IHPA 4UN2B 1WJ7A 1OTRA 1HJPA 1BVSA 1VQ1A 3E21A 1ZMWA 1Y8GA 3T6PA 1XB2B 2JUJA 3LCUA 1TTEA 2KHHA 3GLHE 3FE3A 2BWBA 2JZ1A 1G4AE 2EKFA 3H4JA 3B89A 3GLGE 2KNVA 2JNHA 1T6OA 2DI0A 1WR1B 2HWJA 2OOAA 1HT2E 1WGNA 1VEGA 4G3OA 1QZEA 1DO2A 1XXHE 2MJ5B 4WP2A 1E94E 2DAEA 1MN3A 2MR9A 1CUKA 3BBZA 1G41A 1HT1E 2JY6B 2L2DA 5JI2E 1WIVA 1DV0A 2RRUA 1ZMVA 2HAKA 2ZTCA 2OOBA 1OAIA 1JR3E 4R71A 1WHCA 1KYIA 1VDLA 1UFZA 1NV8A 1A5TA 2QHOB 1G3IA 2LVOC 4GEWA 1SG9A 1AIPC 2LVQD 3MMPA 2LVAA 1GO5A 3LCVB 1F4IA 1P3QQ 4F1IA 3IECA 2B3TA 2ZTDA 2EKKA 2LVNC 2DENA 2KNZA 2H5XA 1OKSA 2QNJA 2G3QA 2JY7A 1ZV1A 2K9DA 3F92A 1VG5A 4F2LA 1C7YA 1T43A 2K0BX 1IXSA 2EJSA 2CWBA 2JP7A 2LBCA 1DO0A 2DKLA 3GLFE 3FRIA 3FRHA 1PGYA 1V92A 2LTUA 3GLIE 2DAIA 2BWEA 2L4FA 1Q02A 3K9OA 1YLAA 1TR8A 2MROB 1VEJA 4HEOA 2QSFX 1IM2A 2JY5A 2DAKA 1ZMUA 4DBGB 1NV9A 2CP8A 1HQYE 1EFUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q7J A;  5DFL A;  1R4G A;  1WGL A;  2DHY A;  2DZL A;  2JY8 A;  2L4E A;  2DAG A;  3E46 A;  2O25 A;  2DAM A;  2JZ0 A;  2OO9 A;  2R0I A;  2WZJ A;  1VEK A;  2KNA A;  2MGW A;  3K9P A;  1IFY A;  2LVP C;  2DNA A;  1OQY A;  3IHP A;  4UN2 B;  1WJ7 A;  1OTR A;  1HJP A;  1BVS A;  1VQ1 A;  3E21 A;  1ZMW A;  1Y8G A;  3T6P A;  1XB2 B;  2JUJ A;  3LCU A;  1TTE A;  2KHH A;  3GLH E;  3FE3 A;  2BWB A;  2JZ1 A;  1G4A E;  2EKF A;  3H4J A;  3B89 A;  3GLG E;  2KNV A;  2JNH A;  1T6O A;  2DI0 A;  1WR1 B;  2HWJ A;  2OOA A;  1HT2 E;  1WGN A;  1VEG A;  4G3O A;  1QZE A;  1DO2 A;  1XXH E;  2MJ5 B;  4WP2 A;  1E94 E;  2DAE A;  1MN3 A;  2MR9 A;  1CUK A;  3BBZ A;  1G41 A;  1HT1 E;  2JY6 B;  2L2D A;  5JI2 E;  1WIV A;  1DV0 A;  2RRU A;  1ZMV A;  2HAK A;  2ZTC A;  2OOB A;  1OAI A;  1JR3 E;  4R71 A;  1WHC A;  1KYI A;  1VDL A;  1UFZ A;  1NV8 A;  1A5T A;  2QHO B;  1G3I A;  2LVO C;  4GEW A;  1SG9 A;  1AIP C;  2LVQ D;  3MMP A;  2LVA A;  1GO5 A;  3LCV B;  1F4I A;  1P3Q Q;  4F1I A;  3IEC A;  2B3T A;  2ZTD A;  2EKK A;  2LVN C;  2DEN A;  2KNZ A;  2H5X A;  1OKS A;  2QNJ A;  2G3Q A;  2JY7 A;  1ZV1 A;  2K9D A;  3F92 A;  1VG5 A;  4F2L A;  1C7Y A;  1T43 A;  2K0B X;  1IXS A;  2EJS A;  2CWB A;  2JP7 A;  2LBC A;  1DO0 A;  2DKL A;  3GLF E;  3FRI A;  3FRH A;  1PGY A;  1V92 A;  2LTU A;  3GLI E;  2DAI A;  2BWE A;  2L4F A;  1Q02 A;  3K9O A;  1YLA A;  1TR8 A;  2MRO B;  1VEJ A;  4HEO A;  2QSF X;  1IM2 A;  2JY5 A;  2DAK A;  1ZMU A;  4DBG B;  1NV9 A;  2CP8 A;  1HQY E;  1EFU B; 
#chains in the Genus database with same CATH topology
 2Q2E B;  4Q7J A;  5GKN A;  1R4G A;  1WGL A;  2C9O A;  5ITU A;  3FUU A;  2DZL A;  2L4E A;  1GKI A;  2MH8 A;  4NRV A;  4BB9 A;  4G4R A;  3U5Z B;  4GRI A;  3TE6 A;  5DNY A;  2JZ0 A;  2CV0 A;  4Z8X A;  3AFH A;  3IG5 A;  1QDR A;  2OO9 A;  3HHY A;  4JI5 M;  3J2P B;  4QNR A;  5C1B A;  4AQY M;  4G4N A;  2C98 A;  1TDZ A;  3K9P A;  3U6E A;  4IBB A;  4AI6 A;  4UN2 B;  1IY0 A;  4FWG A;  2XFT A;  1HJP A;  1VQ1 A;  3FTD A;  5IRE B;  1ZMW A;  1Y8G A;  3T6P A;  1XXH A;  3VKH A;  4FCT A;  1L2C A;  4R3D A;  3GLH E;  3T15 A;  2X49 A;  5L8R F;  4B08 A;  4GC9 A;  3U6O A;  4RNA A;  2X8A A;  4PD2 A;  3TWK A;  2XH9 A;  3B74 A;  2KNV A;  2Y0T A;  4ANR A;  1IN5 A;  1JR3 A;  1AUA A;  2LNH C;  3CF6 E;  1UM8 A;  3VKG A;  1TGU A;  3SHG B;  4MM3 B;  4L8R C;  2D7G A;  4L6V 6;  1NSF A;  3LMM A;  3LW5 F;  1PJJ A;  2J7O A;  1L2B A;  3SAV A;  3GLG A;  1Z59 A;  3Q8X A;  1D0K A;  1XXH E;  1QVR A;  2QP9 X;  1Q3B A;  2JWS A;  2QCU A;  1V33 A;  2DAE A;  4NXM M;  2MR9 A;  1G41 A;  2FH0 A;  4DR2 M;  4JYA M;  3ZH9 B;  2RRU A;  2ZTC A;  3W0F A;  1JR3 E;  2CV2 A;  2YNM D;  4DR3 M;  1FJG M;  3QWL A;  4OVZ B;  5KPT A;  2LVO C;  4GKK M;  1Q3C A;  3L26 A;  2O5R A;  2GNO A;  2LHC A;  3J81 S;  3CF0 A;  1XC8 A;  2WSF F;  4LRS A;  3GPY A;  4LJ6 A;  4L4U A;  3E4R A;  3ILK A;  4LF4 M;  3IEC A;  4QNM A;  2BNK A;  2B3T A;  2KRU A;  5EP3 A;  4LJ7 A;  4IIW A;  4I8O A;  4LJ8 A;  3SAT A;  2UXD M;  4L16 A;  3J7A S;  2KNZ A;  1XNR M;  4WUR A;  1Z5C A;  1G59 A;  5IT9 S;  3AV0 A;  4OW0 A;  1OKS A;  3GLI A;  3L25 A;  1OFH A;  1L2D A;  1QDT A;  3KOW E;  1C7Y A;  3GP1 A;  1MU5 A;  1R5L A;  2R18 A;  2CV1 A;  2Z4R A;  2CWB A;  3GQ3 A;  2LBC A;  2D7H A;  1D0L A;  2F5O A;  1TH4 A;  5IZ7 D;  4JI7 M;  1NO1 A;  4M0W A;  5FSW A;  2KEB A;  1PGY A;  2RGH A;  4ITQ A;  1NY6 A;  4P17 A;  1V92 A;  3T1Y M;  4OVZ A;  4DR1 M;  5EQT A;  4RF1 A;  3GLI E;  4JN6 A;  4LJ4 A;  3R9X B;  5C18 A;  5LMN M;  1N32 M;  2UUB M;  1TR8 A;  4D82 A;  4HEO A;  1DGH B;  2JY5 A;  2FE8 A;  3FUW A;  4DBG B;  1NJG A;  1NV9 A;  1LV7 A;  1ZQ9 A;  2QEN A;  4D80 A;  3KOY E;  3HU2 A;  2A5Y B;  3KSX A;  4IBD A;  5DFL A;  2YQZ A;  1SXJ E;  3FKE A;  3CGW A;  4DV4 M;  2DWM A;  2DHY A;  4MGZ E;  2CUZ A;  2JY8 A;  1I4W A;  2O25 A;  2DAM A;  4AKG A;  1V34 A;  3FUX A;  3A98 B;  2DVW B;  1NNJ A;  1J5E M;  4WW0 A;  1IBL M;  3BOS A;  2F4V M;  1XXH B;  3FUV A;  3J80 S;  3L27 A;  1QUT A;  2ZAO A;  3VDU A;  2QBY B;  4LFB M;  2DNA A;  4LGM A;  1GJS A;  3FTC A;  3E21 A;  1BVS A;  2O01 F;  3EIE A;  2R6F A;  2Y0Q A;  2V1C A;  4G6Z A;  1N75 A;  4D81 A;  1N33 M;  3FE3 A;  2BWB A;  3OTO M;  1NY5 A;  1W5T A;  3H4J A;  4X64 M;  3WHK A;  3GLG B;  1DGH A;  3SYL A;  4IBC A;  3NBX X;  1OAO C;  2HWJ A;  2F5S A;  4JI3 M;  4XBO A;  1HT2 E;  2H1R A;  1VEG A;  3GLH A;  3PVS A;  2RKO A;  3C58 A;  2EO2 A;  2XSZ D;  2QQ8 A;  3LVW A;  4IJF A;  1DO2 A;  2DZN B;  3J7B A;  4XGI A;  1HQC A;  2C5R A;  4NC6 A;  4Z6Y A;  4CGY B;  1MX0 A;  1Z6T A;  3AOG A;  3GRY A;  5FLX S;  4B3S M;  1IY2 A;  4B3T M;  1GVN A;  1Z5A A;  2JY6 B;  1TF0 B;  1QUS A;  1WIV A;  3HJS A;  1ZMV A;  3SHF A;  3KSJ A;  2OOB A;  1OAI A;  1QQW A;  1PM5 A;  1L1Z A;  3U6M A;  1WHC A;  4JXJ A;  3BXW A;  1UFZ A;  1NV8 A;  2R4J A;  2LHG A;  3GPU A;  2QBY A;  4B7F A;  2QHO B;  1G3I A;  1DGB A;  4MGY E;  4CJ6 A;  3AOE C;  3VK7 A;  2LVQ D;  1T3T A;  3HKP A;  3RGS A;  1IBM M;  1KSF X;  4II7 A;  3HU1 A;  2UU9 M;  3TPZ A;  4LFC M;  4F1I A;  1F4I A;  4LF5 M;  4YHH M;  4DR7 M;  2XFS A;  4M9S A;  4HL4 A;  1IXZ A;  3GLI B;  1E9R A;  3GLF A;  3GQ4 A;  3RE8 A;  3CF2 A;  4FCW A;  4REZ A;  1ZAE A;  1IN4 A;  2ZM6 M;  3R8F A;  3KFU G;  3M6A A;  5E26 A;  2DEN A;  1IBK M;  1PJI A;  3U6L A;  3TQS A;  2QNJ A;  2G3Q A;  2R46 A;  3L29 A;  5KQD A;  4DV3 M;  1E9S A;  2K9D A;  4AKH A;  1LTM A;  4M9Z A;  3TWL A;  3Q8G A;  2VF7 A;  4B3R M;  2J5Y A;  2LXE A;  4NSO B;  5EP1 A;  1T43 A;  1Q39 A;  2K0B X;  2Z8Y M;  4Y28 F;  1N36 M;  3HZJ A;  5FTM A;  2EJS A;  5FTL A;  5KPZ A;  3LVV A;  1QAQ A;  1IN7 A;  1SXJ B;  1PJT A;  1JQJ C;  3GLF E;  4MGH A;  4LF8 M;  1ORY B;  3FRI A;  4TUW A;  4MB7 A;  1TH2 A;  3K1J A;  3UK6 A;  2KZS A;  1J09 A;  1G8P A;  1JR3 D;  3HJ8 A;  4X66 M;  4RKU F;  5ITT A;  5E6J A;  2EA0 A;  5ITR A;  3KS8 A;  4X65 M;  3C9P A;  5A2Q S;  1N77 A;  2DAI A;  4W5W A;  2L4F A;  2C99 A;  2XEP A;  1XWI A;  5BPV A;  1Q02 A;  2HKJ A;  2UXC M;  3RFW A;  3U60 B;  2MRO B;  1VEJ A;  2KW0 A;  3JR4 A;  4LY6 A;  2KRK A;  4KOD A;  4AKI A;  3K92 A;  4QHS A;  2G5G X;  1ZMU A;  5EXT A;  5FTJ A;  2XLJ A;  2F5P A;  3MK6 A;  2FS1 A;  2CP8 A;  2V1U A;  4IJE A;  1R7R A;  1HQY E;  1EFU B;  3K8Z A;  2ZAM A;  3HJQ A;  1JB0 F;  5KO3 A;  3GRR A;  4LJA A;  2DAG A;  3E46 A;  2C9C A;  1X37 A;  1Z5B A;  2HHH M;  5EJC A;  3B7Z A;  2KZU A;  4DV2 M;  3AL0 C;  1VEK A;  4FWD A;  1SXJ A;  4DV6 M;  2EUC A;  2I7P A;  2KNA A;  3UMM A;  2GQF A;  4FCV A;  2LVP C;  4IBJ A;  1GAB A;  3AJI B;  1OQY A;  3IHP A;  5KPR A;  1WJ7 A;  3KOX E;  3IG8 A;  4S12 A;  3A45 A;  3U6Q A;  4AG5 A;  1XB2 B;  4JI0 M;  2KHH A;  3PNV A;  1QZM A;  1G4A E;  2JZ1 A;  2EKF A;  2R65 A;  3GLH B;  1YUB A;  3ZC7 B;  3B89 A;  3KS4 A;  3U60 A;  1I94 M;  1XMO M;  2DWL A;  3SAW A;  1PJQ A;  4NOO B;  4DR5 M;  2JNH A;  2G8L A;  3HY5 A;  2DI0 A;  3VFD A;  4G4O A;  1HNW M;  1WR1 B;  4KHP M;  3D8B A;  3U6C A;  3I4Y A;  4QOS A;  2N35 A;  2LH0 A;  3HU3 A;  3SC3 A;  1N78 A;  1EE8 A;  1OJL A;  1RU3 A;  1G71 A;  1TDH A;  2KA6 B;  5BR8 M;  1YSY A;  1MJG M;  4RF0 A;  5EXP A;  4BBA A;  2QZ4 A;  3M7G A;  2YFQ A;  1IXS B;  3SAR A;  3TL4 X;  2OPF A;  1K3W A;  1NNU C;  4NRW A;  2APL A;  1CUK A;  3BBZ A;  5IWA M;  2DXI A;  4LZJ A;  1OFI A;  4JV5 M;  3W0L B;  4JI4 M;  4AZF A;  1DV0 A;  3H4M A;  3KW6 A;  2HAK A;  3NWL A;  1D0M A;  3B7N A;  4MGK E;  2K6B A;  4XK8 F;  2CHG A;  3FYD A;  1KYI A;  1VDL A;  2ERC A;  4I81 A;  4R7G A;  4EIW A;  4P16 A;  2DWZ B;  3A42 A;  2CHQ A;  1H6U A;  4MGI E;  1SG9 A;  3U6S A;  3W67 A;  3GLF B;  1OIZ A;  2Y21 A;  1XHB A;  4L78 A;  2LVA A;  2HL7 A;  1XNQ M;  3SMP A;  3LCV B;  3PFI A;  2XGN A;  5ITY A;  2W82 A;  2ZTD A;  1QAM A;  4LF6 M;  1DGG A;  2EKK A;  2VF8 A;  4NXN M;  2LVN C;  2D7E A;  2L7H A;  3KXE C;  2J7N A;  3RGP A;  1NVM A;  3U61 B;  2H5X A;  5KQ8 A;  4KT0 F;  2UUA M;  4OX9 M;  4GHL A;  2OQ4 A;  2CE7 A;  2VII A;  3F92 A;  2XZU A;  5ITQ A;  3FD9 A;  4FWH A;  1HR0 M;  3QYE A;  3HHX A;  4X62 M;  1IXS A;  3KDS E;  3T38 A;  1OIP A;  2L7I A;  2NQ8 C;  3I01 M;  2E5L M;  4KLN A;  2CEA A;  1DO0 A;  3C3D A;  4LJ5 A;  1W5S A;  3ZQJ A;  3GO8 A;  3DFZ A;  3DA1 A;  5LMU M;  3FRH A;  2WSC F;  4GIT A;  2CFO A;  4M0D A;  2WSE F;  5EXS A;  2RGO A;  5DYI A;  2FNA A;  5ITX E;  3VK8 A;  2DHR A;  2FFJ A;  3KP0 E;  1R2Z A;  4IBF A;  4A3V B;  1KFV A;  2DWN A;  3K9O A;  3JR5 A;  3ZCB B;  7CAT A;  2ZAN A;  4PDI A;  8CAT A;  2Y20 A;  1K82 A;  1IM2 A;  1HNZ M;  4FW9 A;  1NHG C;  3HWS A;  3NBI A;  3FTE A;  3AKZ A;  3MJ5 A;  3FUT A;  5FTK A;  4CIZ A;  2JP7 A;  3PNY A;  2AHM A;  3KP1 E;  3U61 A;  2KXE A;  3GPX A;  1GL6 A;  3K2L A;  3HHW A;  5JI3 E;  4DR6 M;  3EIH A;  4K0K M;  4IBE A;  1IY1 A;  2Z4S A;  3SFZ A;  4QOZ C;  3FYC A;  1C1K A;  3WHL A;  3UJN A;  1HNX M;  1TH3 A;  2R0I A;  2WZJ A;  3SBJ A;  2LWX A;  5EXX A;  4FVM A;  3U6D A;  4JI2 M;  2MGW A;  3U5Z A;  1DGF A;  4QHT A;  1IFY A;  4DV7 M;  4DUZ M;  4L15 A;  4LGY A;  2XZF A;  1OTR A;  4LCB A;  1D2N A;  3LQR A;  4DV1 M;  2HCB A;  2KDL A;  3QAU A;  3QYB A;  3L28 A;  3M0E A;  2JUJ A;  3I04 M;  3LCU A;  1TTE A;  5EP4 A;  3PXG A;  3SMS A;  4LF7 M;  3VDP A;  4CHT B;  2R4E A;  4DV5 M;  3GLG E;  2R45 A;  1R6B X;  4GH9 A;  4IBK A;  2BJW A;  5DYG A;  1GL7 A;  3DZD A;  4LFA M;  1T6O A;  4BLC A;  2DZO B;  4LJ9 A;  3KOZ E;  2OOA A;  1WGN A;  1FNN A;  4G3O A;  4JI8 M;  1QZE A;  1L1T A;  1VDD A;  2Z3X A;  2F5Q A;  4GIP A;  2XF3 A;  5FTN A;  1J7K A;  3B7Q A;  5EP2 A;  3U6P A;  2MJ5 B;  3A46 A;  4WP2 A;  1E94 E;  1IXR C;  3GRV A;  1GLN A;  1MN3 A;  4GC5 A;  2P5T A;  4AG6 A;  1HT1 E;  2CHV A;  5JI2 E;  2L2D A;  4GMQ A;  3UZU A;  3V76 A;  2VQE M;  1PRB A;  4I5S A;  3D8L A;  1WXQ A;  1QAN A;  3CTW B;  4R71 A;  1NHW C;  2JA2 A;  2CRU A;  4DUY M;  1IN8 A;  2JXN A;  3VLF B;  1A5T A;  4GEW A;  4OU7 A;  3GQ5 A;  1N34 M;  2L6O A;  2R44 A;  2V6Z M;  4DR4 M;  1AIP C;  3C3E A;  4JI1 M;  2F5N A;  3MMP A;  4IBG A;  3KVW A;  1GO5 A;  4LRT A;  2I7N A;  1P3Q Q;  1QYR A;  3THG A;  3GPP A;  4DV0 M;  3L2A A;  4PT5 A;  4GHA A;  4GKJ M;  3HX3 A;  3I4V A;  2R62 A;  2Z7J A;  1PJS A;  3T1H M;  2BJV A;  3LQQ A;  3JAM S;  2YR0 A;  2M60 A;  1SXJ D;  4PDG A;  4HLQ A;  2M5Z A;  4MH0 E;  4PCZ A;  4YY3 M;  5F3W A;  2JY7 A;  1ZV1 A;  2ZBK B;  3FTF A;  2FOI C;  1VG5 A;  4F2L A;  4B7G A;  3E9S A;  3B9P A;  1XMQ M;  3MHV C;  1R2Y A;  4JI6 M;  4NL4 H;  1K3X A;  4B3M M;  4AW4 A;  4IBI A;  3AOE A;  3HGI A;  3UGJ A;  4I4L A;  2DKL A;  5H37 D;  4M9X A;  2XSZ A;  3I51 A;  1E32 A;  4KO8 A;  1L8Q A;  4LZZ A;  3HHZ A;  2VQF M;  2C96 A;  2LTU A;  4FD2 A;  3TWM A;  1EIJ A;  2K47 A;  4B7H A;  1SXJ C;  2BWE A;  4NSR A;  4ZPX A;  4LF9 M;  1QAO A;  2UXB M;  1IN6 A;  1IQP A;  2QPA A;  3J27 B;  4LG2 A;  1YLA A;  3SYK A;  5ITX A;  4CIS A;  1NJF A;  2QSF X;  3GRU A;  2L09 A;  2DAK A;  1YE9 A;  2VDB B;  3W68 A;  2X4A A;  4G4Q A;  3SAS A;  3DOA A;  3SAU A;  1GJT A;  2UUC M;  1S3S A; 
#chains in the Genus database with same CATH homology
 4Q7J A;  5DFL A;  1R4G A;  1WGL A;  2DHY A;  2DZL A;  2JY8 A;  2L4E A;  2DAG A;  3E46 A;  2O25 A;  2DAM A;  2JZ0 A;  2OO9 A;  2R0I A;  2WZJ A;  1VEK A;  2KNA A;  2MGW A;  3K9P A;  1IFY A;  2LVP C;  2DNA A;  1OQY A;  3IHP A;  4UN2 B;  1WJ7 A;  1OTR A;  1HJP A;  1BVS A;  1VQ1 A;  3E21 A;  1ZMW A;  1Y8G A;  3T6P A;  1XB2 B;  2JUJ A;  3LCU A;  1TTE A;  2KHH A;  3GLH E;  3FE3 A;  2BWB A;  2JZ1 A;  1G4A E;  2EKF A;  3H4J A;  3B89 A;  3GLG E;  2KNV A;  2JNH A;  1T6O A;  2DI0 A;  1WR1 B;  2HWJ A;  2OOA A;  1HT2 E;  1WGN A;  1VEG A;  4G3O A;  1QZE A;  1DO2 A;  1XXH E;  2MJ5 B;  4WP2 A;  1E94 E;  2DAE A;  1MN3 A;  2MR9 A;  1CUK A;  3BBZ A;  1G41 A;  1HT1 E;  2JY6 B;  2L2D A;  5JI2 E;  1WIV A;  1DV0 A;  2RRU A;  1ZMV A;  2HAK A;  2ZTC A;  2OOB A;  1OAI A;  1JR3 E;  4R71 A;  1WHC A;  1KYI A;  1VDL A;  1UFZ A;  1NV8 A;  1A5T A;  2QHO B;  1G3I A;  2LVO C;  4GEW A;  1SG9 A;  1AIP C;  2LVQ D;  3MMP A;  2LVA A;  1GO5 A;  3LCV B;  1F4I A;  1P3Q Q;  4F1I A;  3IEC A;  2B3T A;  2ZTD A;  2EKK A;  2LVN C;  2DEN A;  2KNZ A;  2H5X A;  1OKS A;  2QNJ A;  2G3Q A;  2JY7 A;  1ZV1 A;  2K9D A;  3F92 A;  1VG5 A;  4F2L A;  1C7Y A;  1T43 A;  2K0B X;  1IXS A;  2EJS A;  2CWB A;  2JP7 A;  2LBC A;  1DO0 A;  2DKL A;  3GLF E;  3FRI A;  3FRH A;  1PGY A;  1V92 A;  2LTU A;  3GLI E;  2DAI A;  2BWE A;  2L4F A;  1Q02 A;  3K9O A;  1YLA A;  1TR8 A;  2MRO B;  1VEJ A;  4HEO A;  2QSF X;  1IM2 A;  2JY5 A;  2DAK A;  1ZMU A;  4DBG B;  1NV9 A;  2CP8 A;  1HQY E;  1EFU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...