4X66M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x66M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x66M02
4JI6M 5LMUM 3A42A 3JAMS 3DOAA 3GO8A 1TDZA 1Z5CA 5FLXS 3SASA 4YHHM 5ITYA 4K0KM 1N33M 4G4QA 1HNXM 3U6LA 2F5NA 4JYAM 4LFAM 4DV4M 4DR4M 2ZM6M 3U6OA 1N36M 3VK7A 4X66M 3A45A 3J80S 4DR6M 4AQYM 4B3TM 1R2YA 2Q2EB 4JI8M 4GKKM 4LF9M 4JI4M 4ITQA 5ITQA 4LF5M 4JI5M 2OPFA 5A2QS 1J5EM 1IBMM 3U6EA 4GKJM 4X62M 5ITRA 1IBLM 4B3RM 3JR5A 4PCZA 4DUZM 4DV1M 1PJJA 3TWKA 3J7AS 2UXBM 4PDGA 3C58A 4G4OA 2UXDM 1TDHA 3T1HM 5IT9S 5LMNM 2UXCM 3U6CA 1Z5AA 3JR4A 2XZUA 1L2CA 2F5SA 3U6DA 2E5LM 4DV0M 4CISA 1KFVA 1HNZM 4JV5M 1XNQM 4DV7M 1XC8A 4LF8M 1Z5BA 4JI0M 4PD2A 3W0FA 1Z59A 3U6SA 4LFBM 3VK8A 1L2BA 1PJIA 3GPXA 4LF7M 4JI1M 4DV2M 3U6PA 3GQ3A 1MX0A 1R2ZA 1XNRM 1PM5A 5BR8M 3J81S 5ITXA 3GQ4A 3U6QA 4JI2M 4DV5M 4JI3M 4X64M 4DUYM 4DV6M 4JI7M 1K3WA 3GP1A 1XMQM 1Q39A 2F5OA 1FJGM 1L1TA 4DR7M 3OTOM 4NXNM 3SARA 1N32M 4DR3M 2EA0A 3SATA 4NRVA 1I94M 2UUAM 3U6MA 1L1ZA 2UU9M 4B3MM 4LFCM 4YY3M 2XZFA 5ITTA 3SBJA 4PDIA 3SAWA 5IWAM 1L2DA 1HR0M 1EE8A 1K82A 1IBKM 2F5QA 4LF4M 3GPYA 2VQEM 2F5PA 3GPPA 2HHHM 4OX9M 2ZBKB 1Q3CA 4DR1M 2OQ4A 3GPUA 4DR5M 1K3XA 1HNWM 2UUCM 2F4VM 2HKJA 3TWMA 1N34M 3SAUA 1NNJA 3GQ5A 4MB7A 4DR2M 3A46A 4DV3M 2VQFM 4G4RA 2UUBM 3SAVA 4KHPM 4NXMM 1Q3BA 1MU5A 4B3SM 3T1YM 1XMOM 4NRWA 4G4NA 3TWLA 5ITXE 4LF6M 4X65M 5ITUA
chains in the Genus database with same CATH superfamily
2ZTDA 1T6OA 4IBBA 2GQFA 3CTWB 2VIIA 3L25A 5FSWA 1GO5A 3PXGA 3U60B 2RRUA 4OVZB 3UGJA 4FWGA 5ITYA 4K0KM 3LVWA 4AI6A 2CE7A 2MJ5B 4G4QA 3RGSA 3VLFB 2F5NA 1JB0F 5EQTA 2C5RA 2O01F 2QPAA 1IN5A 2EUCA 2DAGA 1J7KA 2N35A 3M7GA 4KT0F 2ZM6M 1N36M 2G3QA 3KW6A 1PJQA 4JI8M 2LBCA 3KS4A 5EJCA 2DWMA 4LF9M 4GKKM 5E26A 3BOSA 5JI2E 3WHKA 4IBKA 2DAKA 2OPFA 2EKFA 4NSRA 1J5EM 1IN6A 2LHCA 3FYDA 1GJSA 2C98A 1I4WA 3CF2A 1AIPC 1P3QQ 2QP9X 2LVQD 2OO9A 4HL4A 1DGHB 3PNVA 1NV8A 5GKNA 1JR3A 2X4AA 2DNAA 3B7ZA 1IM2A 5IT9S 3QYEA 3LQQA 5LMNM 3MK6A 2LXEA 3VDPA 4MH0E 3GLGA 2FOIC 3AFHA 2KW0A 5EXSA 3FUXA 1VEGA 3Q8GA 3NBXX 4B7HA 3H4MA 2JNHA 4DV0M 3TL4X 2XGNA 4LJ7A 4JV5M 2KZSA 1QQWA 4JN6A 3E4RA 3FRIA 2BJWA 1XC8A 4LF8M 3I51A 2MGWA 3U61B 2BNKA 5H37D 4IBCA 4KO8A 1UFZA 1PJSA 3L29A 3RE8A 4BLCA 2KXEA 3GRYA 5FTMA 2XH9A 1IY2A 1QUSA 4JI1M 4R71A 2LH0A 4JXJA 4CIZA 1R2ZA 4LJ5A 2QBYB 4UN2B 3J81S 1TGUA 2HL7A 5ITXA 4JI2M 2R0IA 2LWXA 3U60A 3IHPA 4OVZA 4JI7M 1E9RA 1WJ7A 2BJVA 2F5PA 4AW4A 4MM3B 4A3VB 3BBZA 1DGFA 5F3WA 2LHGA 1OAOC 4NXNM 3SARA 1N32M 2HCBA 1JR3E 3UK6A 1EIJA 2UU9M 2UUAM 1L1ZA 2KZUA 1QDRA 2CEAA 4I8OA 5C18A 2J7NA 4L78A 3GLGE 3HU2A 1C7YA 2EJSA 4R3DA 2K47A 2J7OA 1OJLA 1ZAEA 2CWBA 3QYBA 1QAMA 2BWEA 3GPYA 4P17A 1TH4A 3GLHB 1IY0A 3E9SA 1XXHB 3KOZE 2JY7A 2ZBKB 3HHXA 3FKEA 4FWDA 2KA6B 1PGYA 1DGHA 1G41A 3AOEA 2JP7A 2JXNA 3D8BA 3L27A 2HKJA 2L7HA 4FD2A 5C1BA 1TF0B 2QENA 1QZEA 4IJFA 2CHVA 3HHZA 1R5LA 2R65A 3SAVA 4NXMM 2QCUA 2RKOA 1ZMUA 2K9DA 1NNUC 3ZQJA 3B7QA 3K9OA 2QZ4A 4KODA 3T1YM 2V1UA 5ITXE 3ZC7B 2C9CA 1IFYA 2K0BX 3B89A 3AKZA 4P16A 4JI6M 2FS1A 3EIEA 4LGMA 3IECA 1DV0A 1TDZA 5BPVA 1G8PA 1Z5CA 4NOOB 1G3IA 3GLGB 3ZCBB 1IXZA 3U61A 1G59A 1N33M 4DR6M 3J2PB 1HNXM 3U6LA 2WSEF 3KVWA 2C99A 3EIHA 4HLQA 1TH2A 4XK8F 3LCUA 4DV4M 4GEWA 3I01M 1PRBA 1QDTA 3FRHA 4X66M 1ZV1A 3A45A 2DVWB 4GIPA 5FTNA 2LNHC 2LVPC 3SMSA 5KO3A 4AQYM 2HHHM 2Z7JA 4AZFA 1R2YA 2QBYA 3CF6E 4JI4M 2OOAA 4ITQA 4LRSA 4LF5M 4LJ4A 7CATA 1DO0A 2XSZD 5A2QS 1WIVA 3KOWE 5IZ7D 1IBMM 1QUTA 4GKJM 2GNOA 4X62M 2APLA 1IXSA 3VFDA 1OTRA 3JR5A 2WZJA 2CV0A 4RF0A 2I7NA 2EO2A 3Q8XA 3HY5A 5FTKA 3J7BA 2UXDM 4GMQA 1YUBA 1G71A 2ZTCA 3T1HM 3I4VA 2YFQA 2G5GX 2DWNA 4LJ6A 4LJAA 4GHAA 1GVNA 2R62A 3JR4A 2XZUA 3VKHA 3GLHA 1Z6TA 5EP1A 1XXHA 5EXXA 3V76A 4II7A 3PNYA 2R44A 1N75A 2RGHA 5IREB 4CISA 3GRUA 1IN4A 1HNZM 2C96A 4QOSA 3J27B 4AKIA 4D82A 1E32A 1TH3A 3GLIA 3FTDA 2G8LA 4JI0M 4M0WA 4MGKE 3SMPA 3W0FA 1Z59A 3UZUA 1D0KA 2CRUA 2L4FA 3U6SA 2QNJA 1V33A 4BBAA 2CUZA 3A98B 1PJIA 3GPXA 2B3TA 4RF1A 1L8QA 4LF7M 1EFUB 4AKHA 4FVMA 3U6PA 1MX0A 4CJ6A 2HAKA 1XNRM 4WURA 3UMMA 3W68A 1PM5A 3M6AA 3MMPA 3I04M 3SYKA 4OU7A 3U6QA 4D80A 4G3OA 3R9XB 2H1RA 3F92A 1TR8A 4DUYM 4Y28F 2XF3A 2NQ8C 4GHLA 3K9PA 3FUTA 3GP1A 1XMQM 1QZMA 1Q39A 3E46A 1L1TA 4DR7M 1F4IA 3HWSA 2V1CA 1YSYA 3LMMA 3NBIA 4MGZE 4DR3M 1N77A 1WGLA 2DZOB 4HEOA 1ZMVA 2O5RA 2XZFA 5ITTA 1OFIA 1T3TA 2KRKA 3T15A 3SAWA 3C3DA 2D7EA 2JZ0A 3GLHE 1XXHE 2R6FA 2R18A 1L2DA 2VDBB 4AG5A 2XSZA 1IBKM 1VG5A 4I5SA 2KEBA 2O25A 4LZJA 1Q3CA 1GLNA 1WGNA 2DHYA 4LGYA 2LVAA 1ZQ9A 2XEPA 3GLIE 3DFZA 3HKPA 2Y21A 3TWMA 1NNJA 3DA1A 1Y8GA 3GQ5A 4DV3M 1MJGM 2VQFM 1NV9A 2MROB 4L6V6 1IXSB 3T6PA 3AV0A 3WHLA 4KHPM 3HHYA 1NVMA 4ANRA 3L26A 4CGYB 3BXWA 2XLJA 4B3SM 3FTEA 3IG8A 1OAIA 2JY8A 1WHCA 5E6JA 3AOGA 1W5TA 1QAOA 1OKSA 3HX3A 4MGYE 4X65M 2L7IA 4B7FA 5LMUM 4L15A 4GH9A 2DKLA 3SASA 4YHHM 5KPRA 4TUWA 4WW0A 4RKUF 4NSOB 2Z4SA 3QWLA 1QYRA 2C9OA 2JUJA 2VF7A 4LFAM 4DR4M 3U6OA 4GC9A 3GLFA 3VK7A 3HJQA 2CFOA 1YLAA 1HT1E 4M9SA 2YR0A 1NHWC 2Q2EB 3B9PA 3L2AA 3GLIB 3T38A 3FTFA 1VDDA 2V6ZM 3HJ8A 1T43A 4AKGA 3KOYE 4XBOA 1SXJC 2CP8A 2DWLA 4PT5A 3SC3A 3U6EA 1NO1A 4LRTA 4B3RM 4XGIA 3B74A 1R7RA 2I7PA 3UJNA 4DUZM 4DV1M 4AG6A 3K1JA 2KNVA 4LY6A 3TWKA 3J7AS 1IY1A 2M5ZA 3L28A 2UXBM 4PDGA 4G4OA 1OIPA 1HJPA 3SHFA 2QSFX 2KHHA 2UXCM 4IBFA 3K2LA 1J09A 2LVOC 3U5ZB 1HT2E 1L2CA 5KPZA 2F5SA 4I4LA 2E5LM 2DAEA 3LQRA 1GKIA 3TE6A 1KFVA 5EXPA 1WR1B 2QHOB 2ZAMA 8CATA 4DV7M 1Z5BA 4DBGB 1QAQA 4ZPXA 1OQYA 2ZANA 4LFBM 5EP2A 3SYLA 3GLFE 3KDSE 2Y0QA 4R7GA 1QVRA 1H6UA 4IBGA 2EKKA 3KFUG 3SFZA 4FCTA 2DXIA 2XFSA 4DV2M 2FFJA 1OIZA 3GQ3A 4BB9A 1X37A 4QNRA 1BVSA 1VEJA 3GQ4A 4REZA 4JI3M 1IN8A 1LV7A 3W67A 1G4AE 3B7NA 2R4JA 1IQPA 1ZMWA 2BWBA 5KQDA 3KP0E 1FJGM 1NJFA 3I4YA 4LJ8A 1LTMA 3U6MA 1HQYE 1DO2A 2DAMA 4B3MM 4YY3M 4LFCM 3SBJA 4PDIA 4L8RC 5KPTA 1VQ1A 1D0LA 3DZDA 4L16A 5L8RF 1NSFA 1HR0M 4LF4M 1K82A 2MH8A 4GITA 4OW0A 2VQEM 1DGGA 3GPPA 3GLFB 4MGIE 2A5YB 3K8ZA 4GRIA 2CV1A 1HQCA 4MGHA 3RFWA 4LCBA 1V92A 3SHGB 3KXEC 3W0LB 4M0DA 2DZNB 1K3XA 2UUCM 1HNWM 3HHWA 3D8LA 4MB7A 4DR2M 3PFIA 1D2NA 3LW5F 3R8FA 1V34A 1E94E 3HJSA 2DAIA 1RU3A 2X8AA 3ILKA 1Q3BA 3FUWA 3FD9A 3U5ZA 2K6BA 4F1IA 3E21A 4G4NA 1R4GA 2FH0A 4CHTB 2MR9A 5ITUA 2F5OA 3C3EA 3A42A 2Z4RA 2WSCF 3DOAA 1SXJD 4KLNA 4M9XA 3JAMS 3GO8A 2FNAA 1SXJB 3H4JA 2Y20A 2R46A 2L09A 5FLXS 1KYIA 4Z6YA 2Z8YM 2P5TA 4FWHA 4G6ZA 3MJ5A 4JYAM 3C9PA 3KOXE 4QNMA 2ZAOA 5DYIA 5KQ8A 5DNYA 3J80S 3TPZA 4B3TM 1TTEA 2HWJA 5ITQA 2JY5A 4JI5M 1GJTA 4Q7JA 1WXQA 3GRRA 5DFLA 3AL0C 1QANA 2LTUA 5ITRA 1IBLM 2DZLA 4M9ZA 4LZZA 4QHTA 4S12A 4PCZA 3KSJA 1PJJA 3AJIB 2KNZA 5EXTA 2M60A 3HZJA 4I81A 4IBEA 1N78A 4IBIA 4FW9A 2CHGA 3ZH9B 4B7GA 3C58A 2OOBA 1TDHA 3MHVC 3KS8A 2ERCA 1CUKA 1NY6A 3U6CA 2W82A 4LG2A 1Z5AA 4FCVA 1DGBA 4D81A 4QOZC 1IXRC 3K92A 2YQZA 2D7HA 1NY5A 1YE9A 2J5YA 3U6DA 3FUVA 3LVVA 3CGWA 2FE8A 2L6OA 3AOEC 3CF0A 3FUUA 3HGIA 3TQSA 3FYCA 1XNQM 2XFTA 2DWZB 2DHRA 1C1KA 3FE3A 1IN7A 4PD2A 3THGA 2RGOA 2WSFF 1S3SA 3IG5A 1KSFX 3LCVB 3VK8A 1L2BA 1PJTA 3RGPA 4L4UA 2CV2A 1AUAA 3VDUA 3KP1E 1SG9A 2D7GA 1UM8A 1E9SA 1MN3A 5BR8M 3M0EA 4IBDA 1VDLA 3VKGA 1SXJA 4DV5M 2CHQA 4X64M 4DV6M 1NHGC 2KRUA 2L4EA 1K3WA 1Q02A 1R6BX 2JY6B 2DENA 3OTOM 3FTCA 2JZ1A 3GRVA 4EIWA 5FTLA 2EA0A 3SATA 1VEKA 4NRVA 1I94M 5EP4A 2KNAA 1JR3D 1GL7A 2QQ8A 4IIWA 3KSXA 2YNMD 4FCWA 3NWLA 5DYGA 5IWAM 2Z3XA 2H5XA 2F5QA 1EE8A 2JWSA 3HU3A 5FTJA 3PVSA 2VF8A 1GL6A 1XB2B 4OX9M 4GC5A 1NJGA 4DR1M 1W5SA 1GABA 2OQ4A 3GPUA 4DR5M 2F4VM 1XWIA 1N34M 1D0MA 1JQJC 1OFHA 2R45A 4NL4H 4QHSA 4F2LA 2LVNC 3SAUA 4WP2A 4W5WA 1ORYB 3QAUA 4RNAA 2AHMA 5EP3A 3A46A 4G4RA 1XHBA 5JI3E 2UUBM 2R4EA 2X49A 3HU1A 1FNNA 2DI0A 2JA2A 4Z8XA 4B08A 1A5TA 4IBJA 2KDLA 1MU5A 2Y0TA 1XMOM 4NRWA 3TWLA 4LJ9A 4LF6M 4IJEA 2L2DA 1SXJE 4NC6A
chains in the Genus database with same CATH topology
4IBBA 3CTWB 2VIIA 3L25A 5FSWA 3PXGA 3U60B 4OVZB 3UGJA 4FWGA 5ITYA 4K0KM 3LVWA 4AI6A 2CE7A 4G4QA 3RGSA 3VLFB 2F5NA 2C5RA 5EQTA 2QPAA 1IN5A 2EUCA 3M7GA 1J7KA 2ZM6M 1N36M 3KW6A 4JI8M 3KS4A 5EJCA 2DWMA 4LF9M 4GKKM 5E26A 3BOSA 5JI2E 3WHKA 4IBKA 2OPFA 4NSRA 1J5EM 1IN6A 3FYDA 2C98A 1I4WA 3CF2A 2QP9X 4HL4A 1DGHB 3PNVA 5GKNA 1JR3A 2X4AA 1IM2A 5IT9S 3LQQA 5LMNM 3MK6A 2LXEA 3VDPA 4MH0E 3GLGA 2FOIC 3AFHA 2KW0A 5EXSA 3FUXA 4B7HA 3H4MA 4DV0M 3TL4X 2XGNA 4LJ7A 4JV5M 2KZSA 1QQWA 4JN6A 3E4RA 1XC8A 2BJWA 4LF8M 3I51A 3U61B 2BNKA 5H37D 4IBCA 4KO8A 3L29A 3RE8A 4BLCA 2KXEA 3GRYA 5FTMA 2XH9A 1IY2A 4JI1M 2LH0A 4JXJA 1R2ZA 4LJ5A 2QBYB 3J81S 1TGUA 2HL7A 5ITXA 4JI2M 2LWXA 3U60A 4OVZA 4JI7M 1E9RA 2BJVA 4AW4A 4MM3B 4A3VB 1DGFA 5F3WA 4NXNM 3SARA 1N32M 2HCBA 3UK6A 2UU9M 2UUAM 1L1ZA 2KZUA 5C18A 2CEAA 4I8OA 2J7NA 4L78A 3HU2A 4R3DA 2K47A 2J7OA 1OJLA 1ZAEA 1QAMA 3GPYA 3KOZE 1TH4A 1IY0A 3E9SA 1XXHB 3GLHB 2F5PA 2ZBKB 3HHXA 3FKEA 4FWDA 2KA6B 1DGHA 1G41A 3AOEA 3D8BA 3L27A 2HKJA 2L7HA 4FD2A 5C1BA 2QENA 4IJFA 2CHVA 3HHZA 2R65A 3SAVA 4NXMM 2QCUA 2RKOA 3T1YM 1NNUC 2QZ4A 4KODA 2V1UA 5ITXE 3ZC7B 2C9CA 3AKZA 4P16A 4JI6M 3EIEA 4LGMA 1TDZA 5BPVA 1G8PA 1Z5CA 4NOOB 1G3IA 3GLGB 3ZCBB 1IXZA 3U61A 1G59A 1N33M 3J2PB 1HNXM 3U6LA 3KVWA 2C99A 3EIHA 4HLQA 1TH2A 4DV4M 4X66M 3A45A 2DVWB 4GIPA 5FTNA 2LNHC 3SMSA 4AQYM 5KO3A 2HHHM 4DR6M 2Z7JA 4AZFA 1R2YA 2QBYA 3CF6E 4JI4M 4ITQA 4LRSA 4LF5M 4LJ4A 7CATA 1DO0A 2XSZD 5A2QS 3KOWE 5IZ7D 1IBMM 4GKJM 4X62M 3VFDA 3JR5A 2CV0A 4RF0A 2I7NA 2EO2A 3Q8XA 5FTKA 3J7BA 2UXDM 4GMQA 1YUBA 3T1HM 3I4VA 2YFQA 2G5GX 2DWNA 4LJ6A 4LJAA 4GHAA 1GVNA 2R62A 3JR4A 2XZUA 3VKHA 3GLHA 1Z6TA 5EP1A 1XXHA 5EXXA 4II7A 3PNYA 2RGHA 1N75A 5IREB 4CISA 3GRUA 1IN4A 1HNZM 2C96A 4QOSA 3J27B 4AKIA 4D82A 1E32A 1TH3A 3GLIA 3FTDA 2G8LA 4JI0M 4M0WA 4MGKE 3SMPA 3W0FA 1Z59A 3UZUA 3U6SA 4BBAA 2CUZA 3A98B 1PJIA 3GPXA 4RF1A 1L8QA 4LF7M 4AKHA 4FVMA 3U6PA 1MX0A 1XNRM 4WURA 3UMMA 1PM5A 3M6AA 3SYKA 4OU7A 3U6QA 4D80A 3R9XB 2H1RA 4DUYM 2XF3A 2NQ8C 4GHLA 3FUTA 3GP1A 1XMQM 1QZMA 1Q39A 1L1TA 4DR7M 3HWSA 2V1CA 1YSYA 3LMMA 3NBIA 4MGZE 4DR3M 1N77A 2DZOB 2O5RA 2XZFA 5ITTA 1OFIA 1T3TA 2KRKA 3T15A 3SAWA 2D7EA 2R18A 1L2DA 4AG5A 2XSZA 1IBKM 4I5SA 2KEBA 4LZJA 1Q3CA 1GLNA 4LGYA 2XEPA 1ZQ9A 3DFZA 3HKPA 2Y21A 3TWMA 1NNJA 3DA1A 3GQ5A 4DV3M 2VQFM 1IXSB 3AV0A 3WHLA 4KHPM 3HHYA 1NVMA 3L26A 4CGYB 2XLJA 4B3SM 3FTEA 3IG8A 5E6JA 3AOGA 1W5TA 1QAOA 4MGYE 4X65M 2L7IA 4B7FA 5LMUM 4L15A 4GH9A 3SASA 4YHHM 5KPRA 4TUWA 4WW0A 4NSOB 2Z4SA 3QWLA 1QYRA 2C9OA 4LFAM 4DR4M 3U6OA 4GC9A 3GLFA 3VK7A 3HJQA 2CFOA 4M9SA 1HT1E 2YR0A 1NHWC 2Q2EB 3B9PA 3L2AA 3GLIB 3T38A 3FTFA 1VDDA 2V6ZM 3HJ8A 4AKGA 3KOYE 4XBOA 1SXJC 2DWLA 4PT5A 3SC3A 3U6EA 4B3RM 4LRTA 4XGIA 1R7RA 2I7PA 3UJNA 4DUZM 4DV1M 4AG6A 3K1JA 4LY6A 3TWKA 3J7AS 1IY1A 2M5ZA 3L28A 2UXBM 4PDGA 4G4OA 3SHFA 2UXCM 4IBFA 3K2LA 1J09A 3U5ZB 1HT2E 1L2CA 5KPZA 2F5SA 4I4LA 2E5LM 3LQRA 1GKIA 3TE6A 1KFVA 5EXPA 2ZAMA 8CATA 4DV7M 1Z5BA 1QAQA 4ZPXA 2ZANA 4LFBM 5EP2A 3SYLA 3KDSE 2Y0QA 4R7GA 1QVRA 1H6UA 4IBGA 3KFUG 3SFZA 4FCTA 2DXIA 2XFSA 4DV2M 2FFJA 3GQ3A 4BB9A 1X37A 4QNRA 3GQ4A 4REZA 4JI3M 1IN8A 1LV7A 1G4AE 2R4JA 1IQPA 5KQDA 1FJGM 3KP0E 1NJFA 3I4YA 4LJ8A 3U6MA 1HQYE 1DO2A 4B3MM 4LFCM 4YY3M 3SBJA 4PDIA 4L8RC 5KPTA 3DZDA 4L16A 1NSFA 1HR0M 4LF4M 1K82A 4GITA 4OW0A 2VQEM 1DGGA 3GPPA 3GLFB 4MGIE 2A5YB 3K8ZA 4GRIA 2CV1A 1HQCA 4MGHA 3RFWA 4LCBA 3SHGB 3KXEC 3W0LB 4M0DA 2DZNB 1K3XA 2UUCM 1HNWM 3HHWA 3D8LA 4MB7A 4DR2M 3PFIA 1D2NA 3R8FA 1E94E 3HJSA 2X8AA 3ILKA 1Q3BA 3FUWA 3FD9A 3U5ZA 4G4NA 2F5OA 4CHTB 5ITUA 3A42A 2Z4RA 3JAMS 3DOAA 1SXJD 4KLNA 4M9XA 3GO8A 2FNAA 1SXJB 2Y20A 2R46A 2L09A 5FLXS 1KYIA 4Z6YA 2P5TA 4FWHA 4G6ZA 3MJ5A 4JYAM 3KOXE 4QNMA 2ZAOA 5DYIA 5KQ8A 5DNYA 3J80S 3TPZA 4B3TM 5ITQA 4JI5M 3AL0C 1WXQA 3GRRA 1QANA 5ITRA 1IBLM 4M9ZA 4LZZA 4QHTA 4S12A 4PCZA 3KSJA 1PJJA 3AJIB 5EXTA 2M60A 4I81A 4IBEA 1N78A 4IBIA 4FW9A 2CHGA 3ZH9B 4B7GA 3C58A 1TDHA 3MHVC 3KS8A 2ERCA 1NY6A 3U6CA 2W82A 4LG2A 1Z5AA 4FCVA 1DGBA 4D81A 4QOZC 1IXRC 3K92A 2YQZA 2D7HA 1NY5A 1YE9A 3U6DA 3FUVA 3LVVA 3FUUA 2FE8A 2L6OA 3AOEC 3CF0A 3HGIA 3TQSA 3FYCA 1XNQM 2XFTA 2DWZB 2DHRA 1C1KA 1IN7A 4PD2A 3THGA 2RGOA 1S3SA 3IG5A 1KSFX 3VK8A 1L2BA 3RGPA 4L4UA 2CV2A 3VDUA 3KP1E 2D7GA 1UM8A 1E9SA 5BR8M 3M0EA 4IBDA 3VKGA 1SXJA 4DV5M 2CHQA 4X64M 4DV6M 1NHGC 2KRUA 1K3WA 1R6BX 3OTOM 3FTCA 4EIWA 3GRVA 5FTLA 2EA0A 3SATA 4NRVA 1I94M 5EP4A 1JR3D 1GL7A 4IIWA 3KSXA 2YNMD 4FCWA 3NWLA 5DYGA 5IWAM 2Z3XA 2F5QA 1EE8A 3HU3A 5FTJA 3PVSA 1GL6A 4OX9M 4GC5A 1NJGA 4DR1M 1W5SA 2OQ4A 3GPUA 4DR5M 2F4VM 1XWIA 1N34M 1JQJC 1OFHA 2R45A 4NL4H 4QHSA 3SAUA 4W5WA 1ORYB 3QAUA 4RNAA 2AHMA 5EP3A 3A46A 4G4RA 1XHBA 5JI3E 2UUBM 2R4EA 2X49A 3HU1A 1FNNA 2JA2A 4Z8XA 4B08A 4IBJA 1MU5A 2Y0TA 1XMOM 4NRWA 3TWLA 4LJ9A 4LF6M 4IJEA 1SXJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 M;  5LMU M;  3A42 A;  3JAM S;  3DOA A;  3GO8 A;  1TDZ A;  1Z5C A;  5FLX S;  3SAS A;  4YHH M;  5ITY A;  4K0K M;  1N33 M;  4G4Q A;  1HNX M;  3U6L A;  2F5N A;  4JYA M;  4LFA M;  4DV4 M;  4DR4 M;  2ZM6 M;  3U6O A;  1N36 M;  3VK7 A;  4X66 M;  3A45 A;  3J80 S;  4DR6 M;  4AQY M;  4B3T M;  1R2Y A;  2Q2E B;  4JI8 M;  4GKK M;  4LF9 M;  4JI4 M;  4ITQ A;  5ITQ A;  4LF5 M;  4JI5 M;  2OPF A;  5A2Q S;  1J5E M;  1IBM M;  3U6E A;  4GKJ M;  4X62 M;  5ITR A;  1IBL M;  4B3R M;  3JR5 A;  4PCZ A;  4DUZ M;  4DV1 M;  1PJJ A;  3TWK A;  3J7A S;  2UXB M;  4PDG A;  3C58 A;  4G4O A;  2UXD M;  1TDH A;  3T1H M;  5IT9 S;  5LMN M;  2UXC M;  3U6C A;  1Z5A A;  3JR4 A;  2XZU A;  1L2C A;  2F5S A;  3U6D A;  2E5L M;  4DV0 M;  4CIS A;  1KFV A;  1HNZ M;  4JV5 M;  1XNQ M;  4DV7 M;  1XC8 A;  4LF8 M;  1Z5B A;  4JI0 M;  4PD2 A;  3W0F A;  1Z59 A;  3U6S A;  4LFB M;  3VK8 A;  1L2B A;  1PJI A;  3GPX A;  4LF7 M;  4JI1 M;  4DV2 M;  3U6P A;  3GQ3 A;  1MX0 A;  1R2Z A;  1XNR M;  1PM5 A;  5BR8 M;  3J81 S;  5ITX A;  3GQ4 A;  3U6Q A;  4JI2 M;  4DV5 M;  4JI3 M;  4X64 M;  4DUY M;  4DV6 M;  4JI7 M;  1K3W A;  3GP1 A;  1XMQ M;  1Q39 A;  2F5O A;  1FJG M;  1L1T A;  4DR7 M;  3OTO M;  4NXN M;  3SAR A;  1N32 M;  4DR3 M;  2EA0 A;  3SAT A;  4NRV A;  1I94 M;  2UUA M;  3U6M A;  1L1Z A;  2UU9 M;  4B3M M;  4LFC M;  4YY3 M;  2XZF A;  5ITT A;  3SBJ A;  4PDI A;  3SAW A;  5IWA M;  1L2D A;  1HR0 M;  1EE8 A;  1K82 A;  1IBK M;  2F5Q A;  4LF4 M;  3GPY A;  2VQE M;  2F5P A;  3GPP A;  2HHH M;  4OX9 M;  2ZBK B;  1Q3C A;  4DR1 M;  2OQ4 A;  3GPU A;  4DR5 M;  1K3X A;  1HNW M;  2UUC M;  2F4V M;  2HKJ A;  3TWM A;  1N34 M;  3SAU A;  1NNJ A;  3GQ5 A;  4MB7 A;  4DR2 M;  3A46 A;  4DV3 M;  2VQF M;  4G4R A;  2UUB M;  3SAV A;  4KHP M;  4NXM M;  1Q3B A;  1MU5 A;  4B3S M;  3T1Y M;  1XMO M;  4NRW A;  4G4N A;  3TWL A;  5ITX E;  4LF6 M;  4X65 M;  5ITU A; 
#chains in the Genus database with same CATH topology
 2ZTD A;  1T6O A;  4IBB A;  2GQF A;  3CTW B;  2VII A;  3L25 A;  5FSW A;  1GO5 A;  3PXG A;  3U60 B;  2RRU A;  4OVZ B;  3UGJ A;  4FWG A;  5ITY A;  4K0K M;  3LVW A;  4AI6 A;  2CE7 A;  2MJ5 B;  4G4Q A;  3RGS A;  3VLF B;  2F5N A;  1JB0 F;  5EQT A;  2C5R A;  2O01 F;  2QPA A;  1IN5 A;  2EUC A;  2DAG A;  1J7K A;  2N35 A;  3M7G A;  4KT0 F;  2ZM6 M;  1N36 M;  2G3Q A;  3KW6 A;  1PJQ A;  4JI8 M;  2LBC A;  3KS4 A;  5EJC A;  2DWM A;  4LF9 M;  4GKK M;  5E26 A;  3BOS A;  5JI2 E;  3WHK A;  4IBK A;  2DAK A;  2OPF A;  2EKF A;  4NSR A;  1J5E M;  1IN6 A;  2LHC A;  3FYD A;  1GJS A;  2C98 A;  1I4W A;  3CF2 A;  1AIP C;  1P3Q Q;  2QP9 X;  2LVQ D;  2OO9 A;  4HL4 A;  1DGH B;  3PNV A;  1NV8 A;  5GKN A;  1JR3 A;  2X4A A;  2DNA A;  3B7Z A;  1IM2 A;  5IT9 S;  3QYE A;  3LQQ A;  5LMN M;  3MK6 A;  2LXE A;  3VDP A;  4MH0 E;  3GLG A;  2FOI C;  3AFH A;  2KW0 A;  5EXS A;  3FUX A;  1VEG A;  3Q8G A;  3NBX X;  4B7H A;  3H4M A;  2JNH A;  4DV0 M;  3TL4 X;  2XGN A;  4LJ7 A;  4JV5 M;  2KZS A;  1QQW A;  4JN6 A;  3E4R A;  3FRI A;  2BJW A;  1XC8 A;  4LF8 M;  3I51 A;  2MGW A;  3U61 B;  2BNK A;  5H37 D;  4IBC A;  4KO8 A;  1UFZ A;  1PJS A;  3L29 A;  3RE8 A;  4BLC A;  2KXE A;  3GRY A;  5FTM A;  2XH9 A;  1IY2 A;  1QUS A;  4JI1 M;  4R71 A;  2LH0 A;  4JXJ A;  4CIZ A;  1R2Z A;  4LJ5 A;  2QBY B;  4UN2 B;  3J81 S;  1TGU A;  2HL7 A;  5ITX A;  4JI2 M;  2R0I A;  2LWX A;  3U60 A;  3IHP A;  4OVZ A;  4JI7 M;  1E9R A;  1WJ7 A;  2BJV A;  2F5P A;  4AW4 A;  4MM3 B;  4A3V B;  3BBZ A;  1DGF A;  5F3W A;  2LHG A;  1OAO C;  4NXN M;  3SAR A;  1N32 M;  2HCB A;  1JR3 E;  3UK6 A;  1EIJ A;  2UU9 M;  2UUA M;  1L1Z A;  2KZU A;  1QDR A;  2CEA A;  4I8O A;  5C18 A;  2J7N A;  4L78 A;  3GLG E;  3HU2 A;  1C7Y A;  2EJS A;  4R3D A;  2K47 A;  2J7O A;  1OJL A;  1ZAE A;  2CWB A;  3QYB A;  1QAM A;  2BWE A;  3GPY A;  4P17 A;  1TH4 A;  3GLH B;  1IY0 A;  3E9S A;  1XXH B;  3KOZ E;  2JY7 A;  2ZBK B;  3HHX A;  3FKE A;  4FWD A;  2KA6 B;  1PGY A;  1DGH A;  1G41 A;  3AOE A;  2JP7 A;  2JXN A;  3D8B A;  3L27 A;  2HKJ A;  2L7H A;  4FD2 A;  5C1B A;  1TF0 B;  2QEN A;  1QZE A;  4IJF A;  2CHV A;  3HHZ A;  1R5L A;  2R65 A;  3SAV A;  4NXM M;  2QCU A;  2RKO A;  1ZMU A;  2K9D A;  1NNU C;  3ZQJ A;  3B7Q A;  3K9O A;  2QZ4 A;  4KOD A;  3T1Y M;  2V1U A;  5ITX E;  3ZC7 B;  2C9C A;  1IFY A;  2K0B X;  3B89 A;  3AKZ A;  4P16 A;  4JI6 M;  2FS1 A;  3EIE A;  4LGM A;  3IEC A;  1DV0 A;  1TDZ A;  5BPV A;  1G8P A;  1Z5C A;  4NOO B;  1G3I A;  3GLG B;  3ZCB B;  1IXZ A;  3U61 A;  1G59 A;  1N33 M;  4DR6 M;  3J2P B;  1HNX M;  3U6L A;  2WSE F;  3KVW A;  2C99 A;  3EIH A;  4HLQ A;  1TH2 A;  4XK8 F;  3LCU A;  4DV4 M;  4GEW A;  3I01 M;  1PRB A;  1QDT A;  3FRH A;  4X66 M;  1ZV1 A;  3A45 A;  2DVW B;  4GIP A;  5FTN A;  2LNH C;  2LVP C;  3SMS A;  5KO3 A;  4AQY M;  2HHH M;  2Z7J A;  4AZF A;  1R2Y A;  2QBY A;  3CF6 E;  4JI4 M;  2OOA A;  4ITQ A;  4LRS A;  4LF5 M;  4LJ4 A;  7CAT A;  1DO0 A;  2XSZ D;  5A2Q S;  1WIV A;  3KOW E;  5IZ7 D;  1IBM M;  1QUT A;  4GKJ M;  2GNO A;  4X62 M;  2APL A;  1IXS A;  3VFD A;  1OTR A;  3JR5 A;  2WZJ A;  2CV0 A;  4RF0 A;  2I7N A;  2EO2 A;  3Q8X A;  3HY5 A;  5FTK A;  3J7B A;  2UXD M;  4GMQ A;  1YUB A;  1G71 A;  2ZTC A;  3T1H M;  3I4V A;  2YFQ A;  2G5G X;  2DWN A;  4LJ6 A;  4LJA A;  4GHA A;  1GVN A;  2R62 A;  3JR4 A;  2XZU A;  3VKH A;  3GLH A;  1Z6T A;  5EP1 A;  1XXH A;  5EXX A;  3V76 A;  4II7 A;  3PNY A;  2R44 A;  1N75 A;  2RGH A;  5IRE B;  4CIS A;  3GRU A;  1IN4 A;  1HNZ M;  2C96 A;  4QOS A;  3J27 B;  4AKI A;  4D82 A;  1E32 A;  1TH3 A;  3GLI A;  3FTD A;  2G8L A;  4JI0 M;  4M0W A;  4MGK E;  3SMP A;  3W0F A;  1Z59 A;  3UZU A;  1D0K A;  2CRU A;  2L4F A;  3U6S A;  2QNJ A;  1V33 A;  4BBA A;  2CUZ A;  3A98 B;  1PJI A;  3GPX A;  2B3T A;  4RF1 A;  1L8Q A;  4LF7 M;  1EFU B;  4AKH A;  4FVM A;  3U6P A;  1MX0 A;  4CJ6 A;  2HAK A;  1XNR M;  4WUR A;  3UMM A;  3W68 A;  1PM5 A;  3M6A A;  3MMP A;  3I04 M;  3SYK A;  4OU7 A;  3U6Q A;  4D80 A;  4G3O A;  3R9X B;  2H1R A;  3F92 A;  1TR8 A;  4DUY M;  4Y28 F;  2XF3 A;  2NQ8 C;  4GHL A;  3K9P A;  3FUT A;  3GP1 A;  1XMQ M;  1QZM A;  1Q39 A;  3E46 A;  1L1T A;  4DR7 M;  1F4I A;  3HWS A;  2V1C A;  1YSY A;  3LMM A;  3NBI A;  4MGZ E;  4DR3 M;  1N77 A;  1WGL A;  2DZO B;  4HEO A;  1ZMV A;  2O5R A;  2XZF A;  5ITT A;  1OFI A;  1T3T A;  2KRK A;  3T15 A;  3SAW A;  3C3D A;  2D7E A;  2JZ0 A;  3GLH E;  1XXH E;  2R6F A;  2R18 A;  1L2D A;  2VDB B;  4AG5 A;  2XSZ A;  1IBK M;  1VG5 A;  4I5S A;  2KEB A;  2O25 A;  4LZJ A;  1Q3C A;  1GLN A;  1WGN A;  2DHY A;  4LGY A;  2LVA A;  1ZQ9 A;  2XEP A;  3GLI E;  3DFZ A;  3HKP A;  2Y21 A;  3TWM A;  1NNJ A;  3DA1 A;  1Y8G A;  3GQ5 A;  4DV3 M;  1MJG M;  2VQF M;  1NV9 A;  2MRO B;  4L6V 6;  1IXS B;  3T6P A;  3AV0 A;  3WHL A;  4KHP M;  3HHY A;  1NVM A;  4ANR A;  3L26 A;  4CGY B;  3BXW A;  2XLJ A;  4B3S M;  3FTE A;  3IG8 A;  1OAI A;  2JY8 A;  1WHC A;  5E6J A;  3AOG A;  1W5T A;  1QAO A;  1OKS A;  3HX3 A;  4MGY E;  4X65 M;  2L7I A;  4B7F A;  5LMU M;  4L15 A;  4GH9 A;  2DKL A;  3SAS A;  4YHH M;  5KPR A;  4TUW A;  4WW0 A;  4RKU F;  4NSO B;  2Z4S A;  3QWL A;  1QYR A;  2C9O A;  2JUJ A;  2VF7 A;  4LFA M;  4DR4 M;  3U6O A;  4GC9 A;  3GLF A;  3VK7 A;  3HJQ A;  2CFO A;  1YLA A;  1HT1 E;  4M9S A;  2YR0 A;  1NHW C;  2Q2E B;  3B9P A;  3L2A A;  3GLI B;  3T38 A;  3FTF A;  1VDD A;  2V6Z M;  3HJ8 A;  1T43 A;  4AKG A;  3KOY E;  4XBO A;  1SXJ C;  2CP8 A;  2DWL A;  4PT5 A;  3SC3 A;  3U6E A;  1NO1 A;  4LRT A;  4B3R M;  4XGI A;  3B74 A;  1R7R A;  2I7P A;  3UJN A;  4DUZ M;  4DV1 M;  4AG6 A;  3K1J A;  2KNV A;  4LY6 A;  3TWK A;  3J7A S;  1IY1 A;  2M5Z A;  3L28 A;  2UXB M;  4PDG A;  4G4O A;  1OIP A;  1HJP A;  3SHF A;  2QSF X;  2KHH A;  2UXC M;  4IBF A;  3K2L A;  1J09 A;  2LVO C;  3U5Z B;  1HT2 E;  1L2C A;  5KPZ A;  2F5S A;  4I4L A;  2E5L M;  2DAE A;  3LQR A;  1GKI A;  3TE6 A;  1KFV A;  5EXP A;  1WR1 B;  2QHO B;  2ZAM A;  8CAT A;  4DV7 M;  1Z5B A;  4DBG B;  1QAQ A;  4ZPX A;  1OQY A;  2ZAN A;  4LFB M;  5EP2 A;  3SYL A;  3GLF E;  3KDS E;  2Y0Q A;  4R7G A;  1QVR A;  1H6U A;  4IBG A;  2EKK A;  3KFU G;  3SFZ A;  4FCT A;  2DXI A;  2XFS A;  4DV2 M;  2FFJ A;  1OIZ A;  3GQ3 A;  4BB9 A;  1X37 A;  4QNR A;  1BVS A;  1VEJ A;  3GQ4 A;  4REZ A;  4JI3 M;  1IN8 A;  1LV7 A;  3W67 A;  1G4A E;  3B7N A;  2R4J A;  1IQP A;  1ZMW A;  2BWB A;  5KQD A;  3KP0 E;  1FJG M;  1NJF A;  3I4Y A;  4LJ8 A;  1LTM A;  3U6M A;  1HQY E;  1DO2 A;  2DAM A;  4B3M M;  4YY3 M;  4LFC M;  3SBJ A;  4PDI A;  4L8R C;  5KPT A;  1VQ1 A;  1D0L A;  3DZD A;  4L16 A;  5L8R F;  1NSF A;  1HR0 M;  4LF4 M;  1K82 A;  2MH8 A;  4GIT A;  4OW0 A;  2VQE M;  1DGG A;  3GPP A;  3GLF B;  4MGI E;  2A5Y B;  3K8Z A;  4GRI A;  2CV1 A;  1HQC A;  4MGH A;  3RFW A;  4LCB A;  1V92 A;  3SHG B;  3KXE C;  3W0L B;  4M0D A;  2DZN B;  1K3X A;  2UUC M;  1HNW M;  3HHW A;  3D8L A;  4MB7 A;  4DR2 M;  3PFI A;  1D2N A;  3LW5 F;  3R8F A;  1V34 A;  1E94 E;  3HJS A;  2DAI A;  1RU3 A;  2X8A A;  3ILK A;  1Q3B A;  3FUW A;  3FD9 A;  3U5Z A;  2K6B A;  4F1I A;  3E21 A;  4G4N A;  1R4G A;  2FH0 A;  4CHT B;  2MR9 A;  5ITU A;  2F5O A;  3C3E A;  3A42 A;  2Z4R A;  2WSC F;  3DOA A;  1SXJ D;  4KLN A;  4M9X A;  3JAM S;  3GO8 A;  2FNA A;  1SXJ B;  3H4J A;  2Y20 A;  2R46 A;  2L09 A;  5FLX S;  1KYI A;  4Z6Y A;  2Z8Y M;  2P5T A;  4FWH A;  4G6Z A;  3MJ5 A;  4JYA M;  3C9P A;  3KOX E;  4QNM A;  2ZAO A;  5DYI A;  5KQ8 A;  5DNY A;  3J80 S;  3TPZ A;  4B3T M;  1TTE A;  2HWJ A;  5ITQ A;  2JY5 A;  4JI5 M;  1GJT A;  4Q7J A;  1WXQ A;  3GRR A;  5DFL A;  3AL0 C;  1QAN A;  2LTU A;  5ITR A;  1IBL M;  2DZL A;  4M9Z A;  4LZZ A;  4QHT A;  4S12 A;  4PCZ A;  3KSJ A;  1PJJ A;  3AJI B;  2KNZ A;  5EXT A;  2M60 A;  3HZJ A;  4I81 A;  4IBE A;  1N78 A;  4IBI A;  4FW9 A;  2CHG A;  3ZH9 B;  4B7G A;  3C58 A;  2OOB A;  1TDH A;  3MHV C;  3KS8 A;  2ERC A;  1CUK A;  1NY6 A;  3U6C A;  2W82 A;  4LG2 A;  1Z5A A;  4FCV A;  1DGB A;  4D81 A;  4QOZ C;  1IXR C;  3K92 A;  2YQZ A;  2D7H A;  1NY5 A;  1YE9 A;  2J5Y A;  3U6D A;  3FUV A;  3LVV A;  3CGW A;  2FE8 A;  2L6O A;  3AOE C;  3CF0 A;  3FUU A;  3HGI A;  3TQS A;  3FYC A;  1XNQ M;  2XFT A;  2DWZ B;  2DHR A;  1C1K A;  3FE3 A;  1IN7 A;  4PD2 A;  3THG A;  2RGO A;  2WSF F;  1S3S A;  3IG5 A;  1KSF X;  3LCV B;  3VK8 A;  1L2B A;  1PJT A;  3RGP A;  4L4U A;  2CV2 A;  1AUA A;  3VDU A;  3KP1 E;  1SG9 A;  2D7G A;  1UM8 A;  1E9S A;  1MN3 A;  5BR8 M;  3M0E A;  4IBD A;  1VDL A;  3VKG A;  1SXJ A;  4DV5 M;  2CHQ A;  4X64 M;  4DV6 M;  1NHG C;  2KRU A;  2L4E A;  1K3W A;  1Q02 A;  1R6B X;  2JY6 B;  2DEN A;  3OTO M;  3FTC A;  2JZ1 A;  3GRV A;  4EIW A;  5FTL A;  2EA0 A;  3SAT A;  1VEK A;  4NRV A;  1I94 M;  5EP4 A;  2KNA A;  1JR3 D;  1GL7 A;  2QQ8 A;  4IIW A;  3KSX A;  2YNM D;  4FCW A;  3NWL A;  5DYG A;  5IWA M;  2Z3X A;  2H5X A;  2F5Q A;  1EE8 A;  2JWS A;  3HU3 A;  5FTJ A;  3PVS A;  2VF8 A;  1GL6 A;  1XB2 B;  4OX9 M;  4GC5 A;  1NJG A;  4DR1 M;  1W5S A;  1GAB A;  2OQ4 A;  3GPU A;  4DR5 M;  2F4V M;  1XWI A;  1N34 M;  1D0M A;  1JQJ C;  1OFH A;  2R45 A;  4NL4 H;  4QHS A;  4F2L A;  2LVN C;  3SAU A;  4WP2 A;  4W5W A;  1ORY B;  3QAU A;  4RNA A;  2AHM A;  5EP3 A;  3A46 A;  4G4R A;  1XHB A;  5JI3 E;  2UUB M;  2R4E A;  2X49 A;  3HU1 A;  1FNN A;  2DI0 A;  2JA2 A;  4Z8X A;  4B08 A;  1A5T A;  4IBJ A;  2KDL A;  1MU5 A;  2Y0T A;  1XMO M;  4NRW A;  3TWL A;  4LJ9 A;  4LF6 M;  4IJE A;  2L2D A;  1SXJ E;  4NC6 A; 
#chains in the Genus database with same CATH homology
 4IBB A;  3CTW B;  2VII A;  3L25 A;  5FSW A;  3PXG A;  3U60 B;  4OVZ B;  3UGJ A;  4FWG A;  5ITY A;  4K0K M;  3LVW A;  4AI6 A;  2CE7 A;  4G4Q A;  3RGS A;  3VLF B;  2F5N A;  2C5R A;  5EQT A;  2QPA A;  1IN5 A;  2EUC A;  3M7G A;  1J7K A;  2ZM6 M;  1N36 M;  3KW6 A;  4JI8 M;  3KS4 A;  5EJC A;  2DWM A;  4LF9 M;  4GKK M;  5E26 A;  3BOS A;  5JI2 E;  3WHK A;  4IBK A;  2OPF A;  4NSR A;  1J5E M;  1IN6 A;  3FYD A;  2C98 A;  1I4W A;  3CF2 A;  2QP9 X;  4HL4 A;  1DGH B;  3PNV A;  5GKN A;  1JR3 A;  2X4A A;  1IM2 A;  5IT9 S;  3LQQ A;  5LMN M;  3MK6 A;  2LXE A;  3VDP A;  4MH0 E;  3GLG A;  2FOI C;  3AFH A;  2KW0 A;  5EXS A;  3FUX A;  4B7H A;  3H4M A;  4DV0 M;  3TL4 X;  2XGN A;  4LJ7 A;  4JV5 M;  2KZS A;  1QQW A;  4JN6 A;  3E4R A;  1XC8 A;  2BJW A;  4LF8 M;  3I51 A;  3U61 B;  2BNK A;  5H37 D;  4IBC A;  4KO8 A;  3L29 A;  3RE8 A;  4BLC A;  2KXE A;  3GRY A;  5FTM A;  2XH9 A;  1IY2 A;  4JI1 M;  2LH0 A;  4JXJ A;  1R2Z A;  4LJ5 A;  2QBY B;  3J81 S;  1TGU A;  2HL7 A;  5ITX A;  4JI2 M;  2LWX A;  3U60 A;  4OVZ A;  4JI7 M;  1E9R A;  2BJV A;  4AW4 A;  4MM3 B;  4A3V B;  1DGF A;  5F3W A;  4NXN M;  3SAR A;  1N32 M;  2HCB A;  3UK6 A;  2UU9 M;  2UUA M;  1L1Z A;  2KZU A;  5C18 A;  2CEA A;  4I8O A;  2J7N A;  4L78 A;  3HU2 A;  4R3D A;  2K47 A;  2J7O A;  1OJL A;  1ZAE A;  1QAM A;  3GPY A;  3KOZ E;  1TH4 A;  1IY0 A;  3E9S A;  1XXH B;  3GLH B;  2F5P A;  2ZBK B;  3HHX A;  3FKE A;  4FWD A;  2KA6 B;  1DGH A;  1G41 A;  3AOE A;  3D8B A;  3L27 A;  2HKJ A;  2L7H A;  4FD2 A;  5C1B A;  2QEN A;  4IJF A;  2CHV A;  3HHZ A;  2R65 A;  3SAV A;  4NXM M;  2QCU A;  2RKO A;  3T1Y M;  1NNU C;  2QZ4 A;  4KOD A;  2V1U A;  5ITX E;  3ZC7 B;  2C9C A;  3AKZ A;  4P16 A;  4JI6 M;  3EIE A;  4LGM A;  1TDZ A;  5BPV A;  1G8P A;  1Z5C A;  4NOO B;  1G3I A;  3GLG B;  3ZCB B;  1IXZ A;  3U61 A;  1G59 A;  1N33 M;  3J2P B;  1HNX M;  3U6L A;  3KVW A;  2C99 A;  3EIH A;  4HLQ A;  1TH2 A;  4DV4 M;  4X66 M;  3A45 A;  2DVW B;  4GIP A;  5FTN A;  2LNH C;  3SMS A;  4AQY M;  5KO3 A;  2HHH M;  4DR6 M;  2Z7J A;  4AZF A;  1R2Y A;  2QBY A;  3CF6 E;  4JI4 M;  4ITQ A;  4LRS A;  4LF5 M;  4LJ4 A;  7CAT A;  1DO0 A;  2XSZ D;  5A2Q S;  3KOW E;  5IZ7 D;  1IBM M;  4GKJ M;  4X62 M;  3VFD A;  3JR5 A;  2CV0 A;  4RF0 A;  2I7N A;  2EO2 A;  3Q8X A;  5FTK A;  3J7B A;  2UXD M;  4GMQ A;  1YUB A;  3T1H M;  3I4V A;  2YFQ A;  2G5G X;  2DWN A;  4LJ6 A;  4LJA A;  4GHA A;  1GVN A;  2R62 A;  3JR4 A;  2XZU A;  3VKH A;  3GLH A;  1Z6T A;  5EP1 A;  1XXH A;  5EXX A;  4II7 A;  3PNY A;  2RGH A;  1N75 A;  5IRE B;  4CIS A;  3GRU A;  1IN4 A;  1HNZ M;  2C96 A;  4QOS A;  3J27 B;  4AKI A;  4D82 A;  1E32 A;  1TH3 A;  3GLI A;  3FTD A;  2G8L A;  4JI0 M;  4M0W A;  4MGK E;  3SMP A;  3W0F A;  1Z59 A;  3UZU A;  3U6S A;  4BBA A;  2CUZ A;  3A98 B;  1PJI A;  3GPX A;  4RF1 A;  1L8Q A;  4LF7 M;  4AKH A;  4FVM A;  3U6P A;  1MX0 A;  1XNR M;  4WUR A;  3UMM A;  1PM5 A;  3M6A A;  3SYK A;  4OU7 A;  3U6Q A;  4D80 A;  3R9X B;  2H1R A;  4DUY M;  2XF3 A;  2NQ8 C;  4GHL A;  3FUT A;  3GP1 A;  1XMQ M;  1QZM A;  1Q39 A;  1L1T A;  4DR7 M;  3HWS A;  2V1C A;  1YSY A;  3LMM A;  3NBI A;  4MGZ E;  4DR3 M;  1N77 A;  2DZO B;  2O5R A;  2XZF A;  5ITT A;  1OFI A;  1T3T A;  2KRK A;  3T15 A;  3SAW A;  2D7E A;  2R18 A;  1L2D A;  4AG5 A;  2XSZ A;  1IBK M;  4I5S A;  2KEB A;  4LZJ A;  1Q3C A;  1GLN A;  4LGY A;  2XEP A;  1ZQ9 A;  3DFZ A;  3HKP A;  2Y21 A;  3TWM A;  1NNJ A;  3DA1 A;  3GQ5 A;  4DV3 M;  2VQF M;  1IXS B;  3AV0 A;  3WHL A;  4KHP M;  3HHY A;  1NVM A;  3L26 A;  4CGY B;  2XLJ A;  4B3S M;  3FTE A;  3IG8 A;  5E6J A;  3AOG A;  1W5T A;  1QAO A;  4MGY E;  4X65 M;  2L7I A;  4B7F A;  5LMU M;  4L15 A;  4GH9 A;  3SAS A;  4YHH M;  5KPR A;  4TUW A;  4WW0 A;  4NSO B;  2Z4S A;  3QWL A;  1QYR A;  2C9O A;  4LFA M;  4DR4 M;  3U6O A;  4GC9 A;  3GLF A;  3VK7 A;  3HJQ A;  2CFO A;  4M9S A;  1HT1 E;  2YR0 A;  1NHW C;  2Q2E B;  3B9P A;  3L2A A;  3GLI B;  3T38 A;  3FTF A;  1VDD A;  2V6Z M;  3HJ8 A;  4AKG A;  3KOY E;  4XBO A;  1SXJ C;  2DWL A;  4PT5 A;  3SC3 A;  3U6E A;  4B3R M;  4LRT A;  4XGI A;  1R7R A;  2I7P A;  3UJN A;  4DUZ M;  4DV1 M;  4AG6 A;  3K1J A;  4LY6 A;  3TWK A;  3J7A S;  1IY1 A;  2M5Z A;  3L28 A;  2UXB M;  4PDG A;  4G4O A;  3SHF A;  2UXC M;  4IBF A;  3K2L A;  1J09 A;  3U5Z B;  1HT2 E;  1L2C A;  5KPZ A;  2F5S A;  4I4L A;  2E5L M;  3LQR A;  1GKI A;  3TE6 A;  1KFV A;  5EXP A;  2ZAM A;  8CAT A;  4DV7 M;  1Z5B A;  1QAQ A;  4ZPX A;  2ZAN A;  4LFB M;  5EP2 A;  3SYL A;  3KDS E;  2Y0Q A;  4R7G A;  1QVR A;  1H6U A;  4IBG A;  3KFU G;  3SFZ A;  4FCT A;  2DXI A;  2XFS A;  4DV2 M;  2FFJ A;  3GQ3 A;  4BB9 A;  1X37 A;  4QNR A;  3GQ4 A;  4REZ A;  4JI3 M;  1IN8 A;  1LV7 A;  1G4A E;  2R4J A;  1IQP A;  5KQD A;  1FJG M;  3KP0 E;  1NJF A;  3I4Y A;  4LJ8 A;  3U6M A;  1HQY E;  1DO2 A;  4B3M M;  4LFC M;  4YY3 M;  3SBJ A;  4PDI A;  4L8R C;  5KPT A;  3DZD A;  4L16 A;  1NSF A;  1HR0 M;  4LF4 M;  1K82 A;  4GIT A;  4OW0 A;  2VQE M;  1DGG A;  3GPP A;  3GLF B;  4MGI E;  2A5Y B;  3K8Z A;  4GRI A;  2CV1 A;  1HQC A;  4MGH A;  3RFW A;  4LCB A;  3SHG B;  3KXE C;  3W0L B;  4M0D A;  2DZN B;  1K3X A;  2UUC M;  1HNW M;  3HHW A;  3D8L A;  4MB7 A;  4DR2 M;  3PFI A;  1D2N A;  3R8F A;  1E94 E;  3HJS A;  2X8A A;  3ILK A;  1Q3B A;  3FUW A;  3FD9 A;  3U5Z A;  4G4N A;  2F5O A;  4CHT B;  5ITU A;  3A42 A;  2Z4R A;  3JAM S;  3DOA A;  1SXJ D;  4KLN A;  4M9X A;  3GO8 A;  2FNA A;  1SXJ B;  2Y20 A;  2R46 A;  2L09 A;  5FLX S;  1KYI A;  4Z6Y A;  2P5T A;  4FWH A;  4G6Z A;  3MJ5 A;  4JYA M;  3KOX E;  4QNM A;  2ZAO A;  5DYI A;  5KQ8 A;  5DNY A;  3J80 S;  3TPZ A;  4B3T M;  5ITQ A;  4JI5 M;  3AL0 C;  1WXQ A;  3GRR A;  1QAN A;  5ITR A;  1IBL M;  4M9Z A;  4LZZ A;  4QHT A;  4S12 A;  4PCZ A;  3KSJ A;  1PJJ A;  3AJI B;  5EXT A;  2M60 A;  4I81 A;  4IBE A;  1N78 A;  4IBI A;  4FW9 A;  2CHG A;  3ZH9 B;  4B7G A;  3C58 A;  1TDH A;  3MHV C;  3KS8 A;  2ERC A;  1NY6 A;  3U6C A;  2W82 A;  4LG2 A;  1Z5A A;  4FCV A;  1DGB A;  4D81 A;  4QOZ C;  1IXR C;  3K92 A;  2YQZ A;  2D7H A;  1NY5 A;  1YE9 A;  3U6D A;  3FUV A;  3LVV A;  3FUU A;  2FE8 A;  2L6O A;  3AOE C;  3CF0 A;  3HGI A;  3TQS A;  3FYC A;  1XNQ M;  2XFT A;  2DWZ B;  2DHR A;  1C1K A;  1IN7 A;  4PD2 A;  3THG A;  2RGO A;  1S3S A;  3IG5 A;  1KSF X;  3VK8 A;  1L2B A;  3RGP A;  4L4U A;  2CV2 A;  3VDU A;  3KP1 E;  2D7G A;  1UM8 A;  1E9S A;  5BR8 M;  3M0E A;  4IBD A;  3VKG A;  1SXJ A;  4DV5 M;  2CHQ A;  4X64 M;  4DV6 M;  1NHG C;  2KRU A;  1K3W A;  1R6B X;  3OTO M;  3FTC A;  4EIW A;  3GRV A;  5FTL A;  2EA0 A;  3SAT A;  4NRV A;  1I94 M;  5EP4 A;  1JR3 D;  1GL7 A;  4IIW A;  3KSX A;  2YNM D;  4FCW A;  3NWL A;  5DYG A;  5IWA M;  2Z3X A;  2F5Q A;  1EE8 A;  3HU3 A;  5FTJ A;  3PVS A;  1GL6 A;  4OX9 M;  4GC5 A;  1NJG A;  4DR1 M;  1W5S A;  2OQ4 A;  3GPU A;  4DR5 M;  2F4V M;  1XWI A;  1N34 M;  1JQJ C;  1OFH A;  2R45 A;  4NL4 H;  4QHS A;  3SAU A;  4W5W A;  1ORY B;  3QAU A;  4RNA A;  2AHM A;  5EP3 A;  3A46 A;  4G4R A;  1XHB A;  5JI3 E;  2UUB M;  2R4E A;  2X49 A;  3HU1 A;  1FNN A;  2JA2 A;  4Z8X A;  4B08 A;  4IBJ A;  1MU5 A;  2Y0T A;  1XMO M;  4NRW A;  3TWL A;  4LJ9 A;  4LF6 M;  4IJE A;  1SXJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...