4X66M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x66M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x66M02
3OTOM 1Q3CA 3T1YM 1L2CA 4G4QA 2EA0A 4JI3M 4NXNM 3SARA 2VQFM 4LFAM 1XNQM 4LF6M 1IBMM 5IWAM 1I94M 5FLXS 3U6SA 3SASA 4DV0M 3U6QA 1Z5BA 2F4VM 1K3XA 3U6DA 1K82A 4KHPM 4LF7M 3GQ5A 4B3RM 4PDGA 1L2BA 2XZUA 1TDZA 1NNJA 4B3SM 2VQEM 4JI4M 4JI7M 1N32M 4DUZM 4LF9M 5ITUA 1R2ZA 3GPUA 1IBLM 4DR3M 4JI5M 4GKKM 3GO8A 2F5SA 5ITYA 3JAMS 4DV1M 1N34M 2UXCM 1J5EM 1XMQM 4DR6M 1R2YA 1Q3BA 1L1TA 4G4NA 4DV3M 3VK8A 3U6OA 3J7AS 3U6LA 3SBJA 1MU5A 2F5OA 4DV7M 4DR1M 3GPXA 2Q2EB 5IT9S 4AQYM 4LF4M 3T1HM 4LFBM 1HNZM 2UU9M 1L1ZA 1HNWM 3A45A 3W0FA 4JI2M 4LF8M 4JI8M 1PM5A 4DR2M 4B3MM 2XZFA 3U6PA 1Z5CA 5A2QS 4GKJM 3GPPA 2F5NA 4NXMM 2UUBM 4PCZA 2UUCM 2F5PA 2UUAM 1N36M 3A42A 3TWLA 3GP1A 5LMNM 1EE8A 1MX0A 1Z59A 1KFVA 4DR5M 3SAWA 4B3TM 3GQ3A 4JI6M 1N33M 4JYAM 1Q39A 4G4OA 4JV5M 1PJJA 3JR5A 1TDHA 4DV4M 2E5LM 2UXDM 5LMUM 4PDIA 1K3WA 4CISA 1PJIA 4PD2A 2UXBM 1HR0M 3GPYA 3SATA 4MB7A 4X66M 2OQ4A 2ZM6M 4JI1M 4ITQA 2OPFA 5ITRA 3TWKA 4JI0M 5ITTA 3J81S 4DR4M 4LF5M 2ZBKB 3A46A 3U6EA 2HKJA 2F5QA 1Z5AA 3C58A 1IBKM 1FJGM 5ITXE 3U6MA 3SAUA 4OX9M 4X62M 4YHHM 1HNXM 3U6CA 4X65M 3J80S 1XMOM 4DR7M 4YY3M 5BR8M 3VK7A 4DUYM 4LFCM 3TWMA 3DOAA 5ITXA 1XNRM 5ITQA 2HHHM 4NRWA 3GQ4A 3JR4A 4G4RA 4DV6M 4NRVA 4X64M 1XC8A 4K0KM 3SAVA 4DV5M 1L2DA 4DV2M
chains in the Genus database with same CATH superfamily
3OTOM 1Q3CA 1F4IA 4FCWA 2LBCA 1VQ1A 2EA0A 1XNQM 4UN2B 4LFAM 1TH3A 3KFUG 2XH9A 2R4EA 1IBMM 2LNHC 5IWAM 5FLXS 2ZAMA 3SASA 3KP1E 4B08A 4DV0M 3W68A 4RNAA 2L2DA 1DO2A 1QAQA 1A5TA 4LY6A 2MJ5B 4WW0A 3K9PA 1T6OA 3E21A 4GEWA 1K82A 4GITA 2B3TA 3GQ5A 3FE3A 4ZPXA 2XZUA 3HWSA 1SXJB 4OU7A 3SC3A 1E9RA 3E9SA 2VQEM 4JI4M 3KXEC 4LZZA 1YUBA 1AUAA 2VDBB 3GLIE 5GKNA 2DAGA 4DR3M 2BJWA 1WXQA 2CHVA 2W82A 2L4FA 3HHWA 3SYLA 2QHOB 1VEKA 4RKUF 5ITYA 5EP2A 3AKZA 3LQQA 2DZOB 3J7BA 3AL0C 1GL6A 2R45A 4G4NA 1DV0A 1P3QQ 4NL4H 1PJSA 3GPXA 2KRUA 1TR8A 3FTDA 3THGA 4D81A 4GC5A 1HNZM 1OQYA 1IN7A 1EFUB 1HNWM 3B9PA 3HY5A 3VLFB 4FCVA 7CATA 2GQFA 3HHXA 1UM8A 5KQ8A 1Z5CA 2FOIC 1Z6TA 3KSXA 3T38A 3GPPA 2F5NA 4AKHA 4QHTA 4I5SA 3HKPA 4FWHA 3TPZA 5C18A 4LCBA 3CF0A 2UUAM 2D7HA 1EE8A 5JI2E 3RE8A 4DR5M 1KSFX 3GQ3A 4TUWA 5IREB 3ZC7B 2KZUA 1G3IA 2QP9X 1V33A 4G4OA 5EP1A 3M0EA 5LMUM 4RF0A 2DI0A 2M5ZA 4PDIA 2FNAA 3GLGB 2EUCA 3AOEA 1WIVA 3DA1A 5IZ7D 3RGPA 3VKHA 4PT5A 2UXBM 1HT2E 3C9PA 1Y8GA 4I81A 3KW6A 5FTKA 2L7IA 1VDDA 2LXEA 8CATA 4R3DA 2Z3XA 2DENA 4QOZC 1UFZA 1ZMUA 3L2AA 3FUTA 3CGWA 1QDRA 2DWNA 1QQWA 4NSRA 3D8BA 4MGZE 4G3OA 4JI0M 5ITTA 1ZQ9A 4LF5M 3NBXX 3BBZA 1QVRA 2RRUA 3D8LA 2HKJA 3UGJA 1Z5AA 1QUTA 1WGNA 4IBJA 3SAUA 1SXJE 1IBKM 1C7YA 4GH9A 1FJGM 2LHCA 4AG5A 4FW9A 4X65M 3LVWA 3HU3A 1IXRC 1NNUC 3RFWA 5BR8M 3HGIA 2XSZD 2Z8YM 3E46A 4Z8XA 1OAIA 2QENA 3DOAA 3LMMA 4GHLA 3HX3A 1JR3A 2EKFA 2RGHA 4L16A 4NRVA 1OJLA 4X64M 2CUZA 3AOEC 3AJIB 3CTWB 2I7NA 3HU1A 1XC8A 3HJSA 1TH2A 1L2DA 4DV2M 4CIZA 1L2CA 5DYGA 2H5XA 4G4QA 2ZAOA 4JI3M 3I51A 4L8RC 2O01F 4MM3B 2AHMA 3GLHB 3IHPA 5DFLA 1WGLA 2DNAA 2YR0A 2OOBA 1WR1B 3HJQA 4W5WA 3DZDA 2KNVA 2F4VM 3K9OA 1D2NA 2QQ8A 4IBIA 2V6ZM 4LJ4A 4P17A 1T3TA 3UK6A 2DKLA 4LF7M 4LJ5A 2MR9A 5EXSA 4B3SM 4JI7M 1XXHA 1N32M 3W0LB 3UZUA 1R2ZA 3FUWA 1KYIA 4ANRA 4JI5M 2YFQA 3I01M 5FSWA 1HQYE 2KW0A 4IBFA 3M6AA 3LVVA 2UXCM 1J5EM 1PJQA 4OW0A 4BBAA 1Q3BA 1L1TA 1GJTA 2JZ0A 4IJFA 2CHQA 2XEPA 1QZEA 4IBCA 3J7AS 3FUVA 2JXNA 2Z7JA 2F5OA 3J2PB 1DGFA 1G4AE 2BJVA 3U60B 5IT9S 2CFOA 3GLGA 3L27A 1IN5A 4WURA 4QNRA 4LGYA 1DGGA 2D7EA 5DNYA 1EIJA 3ZH9B 2R46A 4JI2M 4LF8M 2JY8A 1OAOC 2A5YB 3IECA 3IG5A 1OTRA 4CHTB 2JA2A 3R8FA 5A2QS 2X4AA 3H4JA 3TE6A 4NXMM 1E94E 4MH0E 3KS8A 2UUBM 1N75A 3AV0A 4EIWA 2F5PA 3Q8GA 1Z59A 3RGSA 1KFVA 1DGBA 3VFDA 2Z4RA 2CE7A 1NV9A 1XHBA 4JYAM 2R44A 3IG8A 2WSFF 1Q39A 1ZMVA 5EXXA 5JI3E 2LTUA 3T15A 1TDHA 3JR5A 4DV4M 3U5ZB 2EKKA 3DFZA 2K0BX 3FKEA 4HLQA 2Z4SA 1DGHB 2ZTDA 3CF2A 1NJFA 1PJIA 4M0WA 1AIPC 3VDUA 2LVNC 1GLNA 1HR0M 5C1BA 2K47A 4LRSA 3SATA 3FYCA 1R4GA 4MB7A 4X66M 1XXHB 2ZM6M 1QAOA 2LWXA 4GMQA 1TH4A 1TGUA 4M0DA 3SHGB 4XK8F 5ITRA 3TWKA 1R5LA 2KEBA 2WSCF 3K2LA 5L8RF 2LVQD 3GLHA 2ZBKB 2QZ4A 3C58A 2Y0TA 2ZANA 4X62M 3HJ8A 4B7HA 2LVOC 3J80S 3U6CA 3K92A 3M7GA 4DR7M 4B7FA 2VIIA 4YY3M 2Y21A 3KVWA 4F1IA 3NWLA 1LV7A 3PNVA 4L78A 3V76A 5EP4A 3VK7A 2JY6B 4DUYM 1VEGA 2BWEA 1OIZA 4IBBA 1WHCA 4L15A 5ITQA 4RF1A 1I4WA 3GQ4A 1XNRM 4DV6M 3GRRA 2L6OA 3WHKA 1BVSA 4M9ZA 2X49A 1MJGM 1XWIA 2WSEF 2R18A 1IXZA 4LZJA 4CGYB 2I7PA 2DAIA 5KPRA 4DV5M 3T1YM 1R6BX 2DWMA 3H4MA 3A98B 2VQFM 3SARA 5BPVA 2XFTA 4LJ6A 3U6SA 2LHGA 2R62A 3MMPA 4HEOA 2HCBA 4P16A 2G8LA 1PJTA 3U60A 1Z5BA 2YNMD 2L09A 1GABA 1HJPA 1JR3E 2V1CA 4LG2A 3QAUA 4QNMA 4Q7JA 2MH8A 1K3XA 1IFYA 2JP7A 1D0MA 2DAMA 2DHYA 1TDZA 2M60A 1NJGA 4LF9M 1W5TA 5ITUA 4AW4A 4AI6A 1NHWC 3GPUA 1IBLM 4GKKM 3FTEA 2K9DA 1VG5A 3GO8A 3JAMS 4DV1M 1SXJD 1J7KA 2DAKA 1FNNA 4WP2A 1R2YA 3GLIB 3ZQJA 2XSZA 4DV3M 1ZV1A 4LJ9A 4R71A 5F3WA 2C96A 3FYDA 3U6LA 3NBIA 1H6UA 4CJ6A 2Q2EB 4II7A 4MGIE 3U5ZA 4AQYM 1XXHE 2JUJA 2KA6B 4JXJA 2KNZA 1YLAA 3PFIA 1N77A 1JB0F 1DGHA 3KOZE 1VEJA 3A45A 1L1ZA 2CV2A 2EJSA 1GJSA 3PVSA 3QWLA 4LGMA 2J5YA 1IXSA 4JI8M 2KHHA 4DR2M 3B7ZA 4JN6A 1X37A 3AFHA 4NSOB 5DYIA 3B7QA 3SFZA 1IY2A 2H1RA 3FRIA 4AG6A 5H37D 1HT1E 3LCVB 4XGIA 3SMSA 3R9XB 1OFIA 4A3VB 4I4LA 1N78A 5EP3A 2HWJA 2L4EA 4BB9A 1N36M 2C99A 2QSFX 3TWLA 5LMNM 3U61B 3GLGE 4OVZA 1R7RA 4FWDA 3SAWA 4JI6M 1N33M 3B89A 4NOOB 3KS4A 5E26A 4JV5M 2KZSA 1PJJA 1ZMWA 2DAEA 2E5LM 2UXDM 2C9CA 3FD9A 3J27B 4R7GA 5EQTA 3K8ZA 2V1UA 4GIPA 5E6JA 4HL4A 3L26A 1C1KA 2G3QA 2APLA 1IM2A 4IBEA 3T6PA 1LTMA 1DO0A 4Z6YA 2OQ4A 4JI1M 2R0IA 2KXEA 3LCUA 2QBYB 1QZMA 2KDLA 2O25A 2HL7A 1NY5A 1YE9A 5EXPA 1S3SA 3J81S 2JY5A 4DR4M 1IY0A 1QDTA 2CHGA 3FUUA 4AKGA 1QUSA 2K6BA 3U6EA 3GLFA 2F5QA 1RU3A 2XFSA 1V34A 3U6MA 1T43A 4OX9M 3SYKA 2BWBA 4YHHM 4IBKA 1GO5A 1NHGC 2MROB 4LJAA 3L29A 4QOSA 1G41A 1PRBA 5FTMA 1OIPA 2JY7A 3TWMA 4KO8A 3B74A 2HHHM 2RKOA 3ILKA 1IXSB 1QANA 3KOWE 4G4RA 2DVWB 1OKSA 4AZFA 3GLHE 1SG9A 3MHVC 3MJ5A 3WHLA 4FD2A 4M9XA 3SAVA 2LH0A 2LVPC 2CV0A 2KNAA 4NC6A 2QCUA 2WZJA 2FS1A 2RGOA 4NXNM 3BOSA 3GLIA 4LF6M 1MN3A 3W67A 3KP0E 1I94M 4OVZB 1GL7A 4XBOA 1QYRA 2O5RA 3U6QA 1J09A 3GRVA 2Y20A 1NO1A 2Y0QA 1NVMA 1QAMA 2XGNA 1VDLA 4FWGA 2ZTCA 3U6DA 4KHPM 3TQSA 4B3RM 1TTEA 3QYEA 4PDGA 1L2BA 2J7NA 1NNJA 1CUKA 1TF0B 2FFJA 2L7HA 4DUZM 2CV1A 4IJEA 5EXTA 5FTJA 2G5GX 2JWSA 1IQPA 4L6V6 1G59A 4FVMA 1E9SA 1XB2B 2DWZB 4M9SA 5KPTA 2F5SA 3MK6A 3LW5F 1N34M 3I04M 1PGYA 1D0KA 2NQ8C 3I4VA 3U61A 1XMQM 3C3EA 4DR6M 3KOXE 3ZCBB 3VK8A 4L4UA 3U6OA 2VF8A 4LJ7A 2FE8A 2CWBA 3CF6E 2MGWA 3I4YA 3SBJA 1MU5A 3GLFB 2OOAA 3HHYA 1D0LA 5KQDA 3GRUA 3KSJA 3L28A 3HHZA 2C98A 4DV7M 4DR1M 1WJ7A 3T1HM 4LF4M 3FTFA 4LFBM 4FCTA 2UU9M 2HAKA 4MGHA 3W0FA 5EJCA 3UJNA 3HU2A 3Q8XA 3K1JA 2DZNB 1PM5A 1NV8A 4B3MM 4B7GA 2XZFA 3U6PA 1GKIA 1IY1A 2ERCA 2GNOA 4GHAA 4GRIA 4GKJM 3UMMA 3HZJA 2QBYA 1NSFA 3PXGA 3KOYE 4LJ8A 3FTCA 4GC9A 2C9OA 2DHRA 4D80A 1ZAEA 2J7OA 4QHSA 4PCZA 1W5SA 2CP8A 3EIHA 2UUCM 3VKGA 2VF7A 3A42A 2LVAA 3GP1A 2DXIA 1MX0A 1JR3D 3TL4X 3SMPA 4B3TM 2R4JA 2DWLA 2FH0A 2R65A 1OFHA 1Q02A 3QYBA 3E4RA 4LRTA 2XLJA 2JNHA 5FTNA 2R6FA 4IBGA 1JQJC 2XF3A 3GRYA 1K3WA 4KT0F 4CISA 1G8PA 2OO9A 4PD2A 1IN4A 1NY6A 2YQZA 2KRKA 4DBGB 2CRUA 1HQCA 4G6ZA 1SXJA 4KLNA 5KO3A 1G71A 3GPYA 3C3DA 3EIEA 3PNYA 3BXWA 2D7GA 2X8AA 5KPZA 4ITQA 3L25A 3SHFA 3FRHA 1IN6A 2OPFA 2DZLA 4MGYE 3KDSE 2CEAA 3A46A 2C5RA 4Y28F 3LQRA 5ITXE 2JZ1A 3F92A 4KODA 2P5TA 2BNKA 2QPAA 1HNXM 1XMOM 3FUXA 4AKIA 4F2LA 1IN8A 1GVNA 1L8QA 4MGKE 2QNJA 4IIWA 5FTLA 1YSYA 4LFCM 3AOGA 3B7NA 4BLCA 3VDPA 4I8OA 5ITXA 4NRWA 4S12A 4REZA 1V92A 3JR4A 4IBDA 4D82A 2EO2A 4K0KM 1ORYB 2N35A 3GLFE 1E32A 1SXJC
chains in the Genus database with same CATH topology
3OTOM 1Q3CA 4FCWA 2EA0A 1XNQM 4LFAM 1TH3A 3KFUG 2XH9A 2R4EA 1IBMM 2LNHC 5IWAM 5FLXS 2ZAMA 3SASA 3KP1E 4B08A 4DV0M 4RNAA 1DO2A 1QAQA 4LY6A 4WW0A 1K82A 4GITA 3GQ5A 4ZPXA 2XZUA 3HWSA 1SXJB 4OU7A 3SC3A 1E9RA 3E9SA 2VQEM 4JI4M 3KXEC 4LZZA 1YUBA 5GKNA 4DR3M 2BJWA 1WXQA 2CHVA 2W82A 3HHWA 3SYLA 5ITYA 5EP2A 3AKZA 3LQQA 2DZOB 3J7BA 3AL0C 1GL6A 2R45A 4G4NA 4NL4H 3GPXA 2KRUA 3FTDA 3THGA 4D81A 4GC5A 1HNZM 1IN7A 1HNWM 3B9PA 3VLFB 4FCVA 7CATA 3HHXA 1UM8A 5KQ8A 1Z5CA 2FOIC 1Z6TA 3KSXA 3T38A 3GPPA 2F5NA 4AKHA 4QHTA 4I5SA 3HKPA 4FWHA 3TPZA 5C18A 4LCBA 3CF0A 2UUAM 2D7HA 1EE8A 5JI2E 3RE8A 4DR5M 1KSFX 3GQ3A 4TUWA 5IREB 3ZC7B 2KZUA 1G3IA 2QP9X 4G4OA 5EP1A 3M0EA 5LMUM 4RF0A 2M5ZA 4PDIA 3GLGB 2FNAA 2EUCA 3AOEA 3DA1A 5IZ7D 3RGPA 3VKHA 4PT5A 2UXBM 1HT2E 5FTKA 4I81A 3KW6A 2L7IA 1VDDA 2LXEA 8CATA 4R3DA 2Z3XA 4QOZC 3L2AA 3FUTA 2DWNA 1QQWA 4NSRA 3D8BA 4MGZE 4JI0M 5ITTA 1ZQ9A 4LF5M 1QVRA 3D8LA 2HKJA 3UGJA 1Z5AA 1IBKM 1FJGM 4IBJA 3SAUA 1SXJE 4GH9A 4AG5A 4FW9A 4X65M 3LVWA 3HU3A 1IXRC 1NNUC 3RFWA 5BR8M 3HGIA 2XSZD 4Z8XA 2QENA 3DOAA 3LMMA 4GHLA 1JR3A 4L16A 2RGHA 4NRVA 1OJLA 4X64M 2CUZA 3AOEC 3AJIB 3CTWB 2I7NA 3HU1A 1XC8A 3HJSA 1TH2A 1L2DA 4DV2M 1L2CA 5DYGA 4G4QA 2ZAOA 4JI3M 3I51A 4L8RC 4MM3B 2AHMA 3GLHB 2YR0A 3HJQA 4W5WA 3DZDA 2F4VM 1D2NA 3UK6A 4IBIA 2V6ZM 4LJ4A 1T3TA 4LF7M 4LJ5A 5EXSA 4B3SM 4JI7M 1N32M 1XXHA 3W0LB 3UZUA 1R2ZA 3FUWA 1KYIA 4JI5M 2YFQA 5FSWA 1HQYE 2KW0A 4IBFA 3M6AA 3LVVA 2UXCM 1J5EM 4OW0A 4BBAA 1Q3BA 1L1TA 4IJFA 2CHQA 2XEPA 4IBCA 3J7AS 3FUVA 2Z7JA 2F5OA 3J2PB 1DGFA 1G4AE 2BJVA 3U60B 5IT9S 2CFOA 3GLGA 3L27A 1IN5A 4WURA 4QNRA 4LGYA 1DGGA 2D7EA 5DNYA 3ZH9B 2R46A 4JI2M 4LF8M 2A5YB 3IG5A 4CHTB 2JA2A 3R8FA 5A2QS 2X4AA 3TE6A 4NXMM 1E94E 4MH0E 3KS8A 2UUBM 1N75A 3AV0A 4EIWA 2F5PA 1Z59A 3RGSA 1KFVA 1DGBA 3VFDA 2Z4RA 2CE7A 1XHBA 4JYAM 3IG8A 1Q39A 5EXXA 5JI3E 3T15A 1TDHA 3JR5A 4DV4M 3U5ZB 3DFZA 3FKEA 4HLQA 2Z4SA 1DGHB 3CF2A 1PJIA 1NJFA 4M0WA 3VDUA 1GLNA 1HR0M 5C1BA 2K47A 4LRSA 3SATA 3FYCA 4MB7A 4X66M 1XXHB 2ZM6M 1QAOA 2LWXA 4GMQA 1TH4A 1TGUA 4M0DA 3SHGB 5ITRA 3TWKA 2KEBA 3K2LA 3GLHA 2ZBKB 2QZ4A 3C58A 2Y0TA 2ZANA 4X62M 3HJ8A 4B7HA 3U6CA 3J80S 3K92A 3M7GA 4DR7M 4B7FA 2VIIA 4YY3M 2Y21A 3KVWA 3NWLA 1LV7A 3PNVA 4L78A 3VK7A 5EP4A 4DUYM 4IBBA 4L15A 5ITQA 1XNRM 4RF1A 1I4WA 3GQ4A 4DV6M 3GRRA 2L6OA 3WHKA 4M9ZA 2X49A 1XWIA 4LZJA 2R18A 1IXZA 4CGYB 4DV5M 2I7PA 2DWMA 5KPRA 3T1YM 1R6BX 3H4MA 3A98B 2VQFM 3SARA 5BPVA 2XFTA 4LJ6A 3U6SA 2R62A 4P16A 2HCBA 2G8LA 3U60A 1Z5BA 2YNMD 2L09A 2V1CA 4LG2A 3QAUA 4QNMA 1K3XA 1TDZA 2M60A 1NJGA 4LF9M 1W5TA 5ITUA 4AW4A 4AI6A 1NHWC 3GPUA 1IBLM 4GKKM 3FTEA 3GO8A 3JAMS 4DV1M 1SXJD 1J7KA 1FNNA 1R2YA 3GLIB 2XSZA 4DV3M 4LJ9A 5F3WA 2C96A 3FYDA 3U6LA 3NBIA 1H6UA 2Q2EB 4II7A 4MGIE 3U5ZA 4AQYM 2KA6B 4JXJA 1N77A 3PFIA 1L1ZA 1DGHA 3KOZE 3A45A 2CV2A 3PVSA 3QWLA 4LGMA 4JI8M 4DR2M 4JN6A 4NSOB 1X37A 3AFHA 5DYIA 3SFZA 1IY2A 2H1RA 4AG6A 5H37D 1HT1E 4XGIA 3SMSA 3R9XB 1OFIA 4A3VB 4I4LA 1N78A 5EP3A 4BB9A 1N36M 2C99A 3TWLA 3U61B 5LMNM 4OVZA 1R7RA 4FWDA 3SAWA 4JI6M 1N33M 4NOOB 3KS4A 5E26A 4JV5M 2KZSA 1PJJA 2E5LM 2UXDM 2C9CA 3FD9A 3J27B 4R7GA 5EQTA 3K8ZA 2V1UA 4GIPA 5E6JA 4HL4A 3L26A 1C1KA 1IM2A 4IBEA 1DO0A 4Z6YA 2OQ4A 4JI1M 2KXEA 2QBYB 1QZMA 2HL7A 1NY5A 1YE9A 5EXPA 1S3SA 3J81S 4DR4M 1IY0A 2CHGA 3FUUA 4AKGA 3U6EA 3GLFA 2F5QA 2XFSA 3U6MA 4OX9M 3SYKA 4YHHM 4IBKA 1NHGC 4LJAA 3L29A 4QOSA 1G41A 5FTMA 3TWMA 4KO8A 2HHHM 2RKOA 3ILKA 1IXSB 1QANA 3KOWE 4G4RA 2DVWB 4AZFA 3MHVC 3MJ5A 3WHLA 4FD2A 4M9XA 3SAVA 2LH0A 2CV0A 2QCUA 4NXNM 2RGOA 3GLIA 3BOSA 4LF6M 3KP0E 1I94M 4OVZB 1GL7A 4XBOA 1QYRA 2O5RA 3U6QA 1J09A 3GRVA 2Y20A 2Y0QA 1NVMA 1QAMA 2XGNA 4FWGA 3U6DA 4KHPM 3TQSA 4B3RM 4PDGA 1L2BA 2J7NA 1NNJA 2FFJA 2L7HA 4DUZM 2CV1A 4IJEA 5EXTA 5FTJA 2G5GX 1IQPA 1G59A 4FVMA 1E9SA 2DWZB 4M9SA 5KPTA 2F5SA 3MK6A 1N34M 3I4VA 2NQ8C 3U61A 1XMQM 4DR6M 3KOXE 3ZCBB 3VK8A 4L4UA 3U6OA 4LJ7A 2FE8A 3CF6E 3SBJA 3I4YA 1MU5A 3GLFB 3HHYA 5KQDA 3HHZA 4DV7M 3GRUA 3KSJA 3L28A 4DR1M 2C98A 4LF4M 3T1HM 4LFBM 3FTFA 4FCTA 2UU9M 4MGHA 3W0FA 5EJCA 3UJNA 3HU2A 3Q8XA 3K1JA 2DZNB 1PM5A 4B3MM 4B7GA 2XZFA 3U6PA 1GKIA 1IY1A 2ERCA 4GHAA 4GRIA 4GKJM 3UMMA 2QBYA 1NSFA 3PXGA 3KOYE 4LJ8A 3FTCA 4GC9A 2C9OA 2DHRA 4D80A 1ZAEA 2J7OA 4QHSA 4PCZA 1W5SA 3EIHA 2UUCM 3VKGA 3A42A 3GP1A 2DXIA 1MX0A 1JR3D 3TL4X 3SMPA 4B3TM 2R4JA 2DWLA 2R65A 1OFHA 4LRTA 3E4RA 2XLJA 5FTNA 4IBGA 1JQJC 2XF3A 3GRYA 1K3WA 4CISA 1G8PA 4PD2A 1IN4A 1NY6A 2YQZA 2KRKA 4G6ZA 1HQCA 4KLNA 1SXJA 5KO3A 3GPYA 3EIEA 3PNYA 2D7GA 2X8AA 5KPZA 4ITQA 3L25A 3SHFA 1IN6A 2OPFA 4MGYE 3KDSE 2CEAA 3A46A 2C5RA 3LQRA 5ITXE 4KODA 2P5TA 2BNKA 2QPAA 1HNXM 1XMOM 3FUXA 4AKIA 1IN8A 1GVNA 1L8QA 4MGKE 5FTLA 4IIWA 1YSYA 4LFCM 3AOGA 4BLCA 3VDPA 4I8OA 5ITXA 4NRWA 4S12A 4REZA 3JR4A 4IBDA 4D82A 2EO2A 4K0KM 1ORYB 1E32A 1SXJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO M;  1Q3C A;  3T1Y M;  1L2C A;  4G4Q A;  2EA0 A;  4JI3 M;  4NXN M;  3SAR A;  2VQF M;  4LFA M;  1XNQ M;  4LF6 M;  1IBM M;  5IWA M;  1I94 M;  5FLX S;  3U6S A;  3SAS A;  4DV0 M;  3U6Q A;  1Z5B A;  2F4V M;  1K3X A;  3U6D A;  1K82 A;  4KHP M;  4LF7 M;  3GQ5 A;  4B3R M;  4PDG A;  1L2B A;  2XZU A;  1TDZ A;  1NNJ A;  4B3S M;  2VQE M;  4JI4 M;  4JI7 M;  1N32 M;  4DUZ M;  4LF9 M;  5ITU A;  1R2Z A;  3GPU A;  1IBL M;  4DR3 M;  4JI5 M;  4GKK M;  3GO8 A;  2F5S A;  5ITY A;  3JAM S;  4DV1 M;  1N34 M;  2UXC M;  1J5E M;  1XMQ M;  4DR6 M;  1R2Y A;  1Q3B A;  1L1T A;  4G4N A;  4DV3 M;  3VK8 A;  3U6O A;  3J7A S;  3U6L A;  3SBJ A;  1MU5 A;  2F5O A;  4DV7 M;  4DR1 M;  3GPX A;  2Q2E B;  5IT9 S;  4AQY M;  4LF4 M;  3T1H M;  4LFB M;  1HNZ M;  2UU9 M;  1L1Z A;  1HNW M;  3A45 A;  3W0F A;  4JI2 M;  4LF8 M;  4JI8 M;  1PM5 A;  4DR2 M;  4B3M M;  2XZF A;  3U6P A;  1Z5C A;  5A2Q S;  4GKJ M;  3GPP A;  2F5N A;  4NXM M;  2UUB M;  4PCZ A;  2UUC M;  2F5P A;  2UUA M;  1N36 M;  3A42 A;  3TWL A;  3GP1 A;  5LMN M;  1EE8 A;  1MX0 A;  1Z59 A;  1KFV A;  4DR5 M;  3SAW A;  4B3T M;  3GQ3 A;  4JI6 M;  1N33 M;  4JYA M;  1Q39 A;  4G4O A;  4JV5 M;  1PJJ A;  3JR5 A;  1TDH A;  4DV4 M;  2E5L M;  2UXD M;  5LMU M;  4PDI A;  1K3W A;  4CIS A;  1PJI A;  4PD2 A;  2UXB M;  1HR0 M;  3GPY A;  3SAT A;  4MB7 A;  4X66 M;  2OQ4 A;  2ZM6 M;  4JI1 M;  4ITQ A;  2OPF A;  5ITR A;  3TWK A;  4JI0 M;  5ITT A;  3J81 S;  4DR4 M;  4LF5 M;  2ZBK B;  3A46 A;  3U6E A;  2HKJ A;  2F5Q A;  1Z5A A;  3C58 A;  1IBK M;  1FJG M;  5ITX E;  3U6M A;  3SAU A;  4OX9 M;  4X62 M;  4YHH M;  1HNX M;  3U6C A;  4X65 M;  3J80 S;  1XMO M;  4DR7 M;  4YY3 M;  5BR8 M;  3VK7 A;  4DUY M;  4LFC M;  3TWM A;  3DOA A;  5ITX A;  1XNR M;  5ITQ A;  2HHH M;  4NRW A;  3GQ4 A;  3JR4 A;  4G4R A;  4DV6 M;  4NRV A;  4X64 M;  1XC8 A;  4K0K M;  3SAV A;  4DV5 M;  1L2D A;  4DV2 M; 
#chains in the Genus database with same CATH topology
 3OTO M;  1Q3C A;  1F4I A;  4FCW A;  2LBC A;  1VQ1 A;  2EA0 A;  1XNQ M;  4UN2 B;  4LFA M;  1TH3 A;  3KFU G;  2XH9 A;  2R4E A;  1IBM M;  2LNH C;  5IWA M;  5FLX S;  2ZAM A;  3SAS A;  3KP1 E;  4B08 A;  4DV0 M;  3W68 A;  4RNA A;  2L2D A;  1DO2 A;  1QAQ A;  1A5T A;  4LY6 A;  2MJ5 B;  4WW0 A;  3K9P A;  1T6O A;  3E21 A;  4GEW A;  1K82 A;  4GIT A;  2B3T A;  3GQ5 A;  3FE3 A;  4ZPX A;  2XZU A;  3HWS A;  1SXJ B;  4OU7 A;  3SC3 A;  1E9R A;  3E9S A;  2VQE M;  4JI4 M;  3KXE C;  4LZZ A;  1YUB A;  1AUA A;  2VDB B;  3GLI E;  5GKN A;  2DAG A;  4DR3 M;  2BJW A;  1WXQ A;  2CHV A;  2W82 A;  2L4F A;  3HHW A;  3SYL A;  2QHO B;  1VEK A;  4RKU F;  5ITY A;  5EP2 A;  3AKZ A;  3LQQ A;  2DZO B;  3J7B A;  3AL0 C;  1GL6 A;  2R45 A;  4G4N A;  1DV0 A;  1P3Q Q;  4NL4 H;  1PJS A;  3GPX A;  2KRU A;  1TR8 A;  3FTD A;  3THG A;  4D81 A;  4GC5 A;  1HNZ M;  1OQY A;  1IN7 A;  1EFU B;  1HNW M;  3B9P A;  3HY5 A;  3VLF B;  4FCV A;  7CAT A;  2GQF A;  3HHX A;  1UM8 A;  5KQ8 A;  1Z5C A;  2FOI C;  1Z6T A;  3KSX A;  3T38 A;  3GPP A;  2F5N A;  4AKH A;  4QHT A;  4I5S A;  3HKP A;  4FWH A;  3TPZ A;  5C18 A;  4LCB A;  3CF0 A;  2UUA M;  2D7H A;  1EE8 A;  5JI2 E;  3RE8 A;  4DR5 M;  1KSF X;  3GQ3 A;  4TUW A;  5IRE B;  3ZC7 B;  2KZU A;  1G3I A;  2QP9 X;  1V33 A;  4G4O A;  5EP1 A;  3M0E A;  5LMU M;  4RF0 A;  2DI0 A;  2M5Z A;  4PDI A;  2FNA A;  3GLG B;  2EUC A;  3AOE A;  1WIV A;  3DA1 A;  5IZ7 D;  3RGP A;  3VKH A;  4PT5 A;  2UXB M;  1HT2 E;  3C9P A;  1Y8G A;  4I81 A;  3KW6 A;  5FTK A;  2L7I A;  1VDD A;  2LXE A;  8CAT A;  4R3D A;  2Z3X A;  2DEN A;  4QOZ C;  1UFZ A;  1ZMU A;  3L2A A;  3FUT A;  3CGW A;  1QDR A;  2DWN A;  1QQW A;  4NSR A;  3D8B A;  4MGZ E;  4G3O A;  4JI0 M;  5ITT A;  1ZQ9 A;  4LF5 M;  3NBX X;  3BBZ A;  1QVR A;  2RRU A;  3D8L A;  2HKJ A;  3UGJ A;  1Z5A A;  1QUT A;  1WGN A;  4IBJ A;  3SAU A;  1SXJ E;  1IBK M;  1C7Y A;  4GH9 A;  1FJG M;  2LHC A;  4AG5 A;  4FW9 A;  4X65 M;  3LVW A;  3HU3 A;  1IXR C;  1NNU C;  3RFW A;  5BR8 M;  3HGI A;  2XSZ D;  2Z8Y M;  3E46 A;  4Z8X A;  1OAI A;  2QEN A;  3DOA A;  3LMM A;  4GHL A;  3HX3 A;  1JR3 A;  2EKF A;  2RGH A;  4L16 A;  4NRV A;  1OJL A;  4X64 M;  2CUZ A;  3AOE C;  3AJI B;  3CTW B;  2I7N A;  3HU1 A;  1XC8 A;  3HJS A;  1TH2 A;  1L2D A;  4DV2 M;  4CIZ A;  1L2C A;  5DYG A;  2H5X A;  4G4Q A;  2ZAO A;  4JI3 M;  3I51 A;  4L8R C;  2O01 F;  4MM3 B;  2AHM A;  3GLH B;  3IHP A;  5DFL A;  1WGL A;  2DNA A;  2YR0 A;  2OOB A;  1WR1 B;  3HJQ A;  4W5W A;  3DZD A;  2KNV A;  2F4V M;  3K9O A;  1D2N A;  2QQ8 A;  4IBI A;  2V6Z M;  4LJ4 A;  4P17 A;  1T3T A;  3UK6 A;  2DKL A;  4LF7 M;  4LJ5 A;  2MR9 A;  5EXS A;  4B3S M;  4JI7 M;  1XXH A;  1N32 M;  3W0L B;  3UZU A;  1R2Z A;  3FUW A;  1KYI A;  4ANR A;  4JI5 M;  2YFQ A;  3I01 M;  5FSW A;  1HQY E;  2KW0 A;  4IBF A;  3M6A A;  3LVV A;  2UXC M;  1J5E M;  1PJQ A;  4OW0 A;  4BBA A;  1Q3B A;  1L1T A;  1GJT A;  2JZ0 A;  4IJF A;  2CHQ A;  2XEP A;  1QZE A;  4IBC A;  3J7A S;  3FUV A;  2JXN A;  2Z7J A;  2F5O A;  3J2P B;  1DGF A;  1G4A E;  2BJV A;  3U60 B;  5IT9 S;  2CFO A;  3GLG A;  3L27 A;  1IN5 A;  4WUR A;  4QNR A;  4LGY A;  1DGG A;  2D7E A;  5DNY A;  1EIJ A;  3ZH9 B;  2R46 A;  4JI2 M;  4LF8 M;  2JY8 A;  1OAO C;  2A5Y B;  3IEC A;  3IG5 A;  1OTR A;  4CHT B;  2JA2 A;  3R8F A;  5A2Q S;  2X4A A;  3H4J A;  3TE6 A;  4NXM M;  1E94 E;  4MH0 E;  3KS8 A;  2UUB M;  1N75 A;  3AV0 A;  4EIW A;  2F5P A;  3Q8G A;  1Z59 A;  3RGS A;  1KFV A;  1DGB A;  3VFD A;  2Z4R A;  2CE7 A;  1NV9 A;  1XHB A;  4JYA M;  2R44 A;  3IG8 A;  2WSF F;  1Q39 A;  1ZMV A;  5EXX A;  5JI3 E;  2LTU A;  3T15 A;  1TDH A;  3JR5 A;  4DV4 M;  3U5Z B;  2EKK A;  3DFZ A;  2K0B X;  3FKE A;  4HLQ A;  2Z4S A;  1DGH B;  2ZTD A;  3CF2 A;  1NJF A;  1PJI A;  4M0W A;  1AIP C;  3VDU A;  2LVN C;  1GLN A;  1HR0 M;  5C1B A;  2K47 A;  4LRS A;  3SAT A;  3FYC A;  1R4G A;  4MB7 A;  4X66 M;  1XXH B;  2ZM6 M;  1QAO A;  2LWX A;  4GMQ A;  1TH4 A;  1TGU A;  4M0D A;  3SHG B;  4XK8 F;  5ITR A;  3TWK A;  1R5L A;  2KEB A;  2WSC F;  3K2L A;  5L8R F;  2LVQ D;  3GLH A;  2ZBK B;  2QZ4 A;  3C58 A;  2Y0T A;  2ZAN A;  4X62 M;  3HJ8 A;  4B7H A;  2LVO C;  3J80 S;  3U6C A;  3K92 A;  3M7G A;  4DR7 M;  4B7F A;  2VII A;  4YY3 M;  2Y21 A;  3KVW A;  4F1I A;  3NWL A;  1LV7 A;  3PNV A;  4L78 A;  3V76 A;  5EP4 A;  3VK7 A;  2JY6 B;  4DUY M;  1VEG A;  2BWE A;  1OIZ A;  4IBB A;  1WHC A;  4L15 A;  5ITQ A;  4RF1 A;  1I4W A;  3GQ4 A;  1XNR M;  4DV6 M;  3GRR A;  2L6O A;  3WHK A;  1BVS A;  4M9Z A;  2X49 A;  1MJG M;  1XWI A;  2WSE F;  2R18 A;  1IXZ A;  4LZJ A;  4CGY B;  2I7P A;  2DAI A;  5KPR A;  4DV5 M;  3T1Y M;  1R6B X;  2DWM A;  3H4M A;  3A98 B;  2VQF M;  3SAR A;  5BPV A;  2XFT A;  4LJ6 A;  3U6S A;  2LHG A;  2R62 A;  3MMP A;  4HEO A;  2HCB A;  4P16 A;  2G8L A;  1PJT A;  3U60 A;  1Z5B A;  2YNM D;  2L09 A;  1GAB A;  1HJP A;  1JR3 E;  2V1C A;  4LG2 A;  3QAU A;  4QNM A;  4Q7J A;  2MH8 A;  1K3X A;  1IFY A;  2JP7 A;  1D0M A;  2DAM A;  2DHY A;  1TDZ A;  2M60 A;  1NJG A;  4LF9 M;  1W5T A;  5ITU A;  4AW4 A;  4AI6 A;  1NHW C;  3GPU A;  1IBL M;  4GKK M;  3FTE A;  2K9D A;  1VG5 A;  3GO8 A;  3JAM S;  4DV1 M;  1SXJ D;  1J7K A;  2DAK A;  1FNN A;  4WP2 A;  1R2Y A;  3GLI B;  3ZQJ A;  2XSZ A;  4DV3 M;  1ZV1 A;  4LJ9 A;  4R71 A;  5F3W A;  2C96 A;  3FYD A;  3U6L A;  3NBI A;  1H6U A;  4CJ6 A;  2Q2E B;  4II7 A;  4MGI E;  3U5Z A;  4AQY M;  1XXH E;  2JUJ A;  2KA6 B;  4JXJ A;  2KNZ A;  1YLA A;  3PFI A;  1N77 A;  1JB0 F;  1DGH A;  3KOZ E;  1VEJ A;  3A45 A;  1L1Z A;  2CV2 A;  2EJS A;  1GJS A;  3PVS A;  3QWL A;  4LGM A;  2J5Y A;  1IXS A;  4JI8 M;  2KHH A;  4DR2 M;  3B7Z A;  4JN6 A;  1X37 A;  3AFH A;  4NSO B;  5DYI A;  3B7Q A;  3SFZ A;  1IY2 A;  2H1R A;  3FRI A;  4AG6 A;  5H37 D;  1HT1 E;  3LCV B;  4XGI A;  3SMS A;  3R9X B;  1OFI A;  4A3V B;  4I4L A;  1N78 A;  5EP3 A;  2HWJ A;  2L4E A;  4BB9 A;  1N36 M;  2C99 A;  2QSF X;  3TWL A;  5LMN M;  3U61 B;  3GLG E;  4OVZ A;  1R7R A;  4FWD A;  3SAW A;  4JI6 M;  1N33 M;  3B89 A;  4NOO B;  3KS4 A;  5E26 A;  4JV5 M;  2KZS A;  1PJJ A;  1ZMW A;  2DAE A;  2E5L M;  2UXD M;  2C9C A;  3FD9 A;  3J27 B;  4R7G A;  5EQT A;  3K8Z A;  2V1U A;  4GIP A;  5E6J A;  4HL4 A;  3L26 A;  1C1K A;  2G3Q A;  2APL A;  1IM2 A;  4IBE A;  3T6P A;  1LTM A;  1DO0 A;  4Z6Y A;  2OQ4 A;  4JI1 M;  2R0I A;  2KXE A;  3LCU A;  2QBY B;  1QZM A;  2KDL A;  2O25 A;  2HL7 A;  1NY5 A;  1YE9 A;  5EXP A;  1S3S A;  3J81 S;  2JY5 A;  4DR4 M;  1IY0 A;  1QDT A;  2CHG A;  3FUU A;  4AKG A;  1QUS A;  2K6B A;  3U6E A;  3GLF A;  2F5Q A;  1RU3 A;  2XFS A;  1V34 A;  3U6M A;  1T43 A;  4OX9 M;  3SYK A;  2BWB A;  4YHH M;  4IBK A;  1GO5 A;  1NHG C;  2MRO B;  4LJA A;  3L29 A;  4QOS A;  1G41 A;  1PRB A;  5FTM A;  1OIP A;  2JY7 A;  3TWM A;  4KO8 A;  3B74 A;  2HHH M;  2RKO A;  3ILK A;  1IXS B;  1QAN A;  3KOW E;  4G4R A;  2DVW B;  1OKS A;  4AZF A;  3GLH E;  1SG9 A;  3MHV C;  3MJ5 A;  3WHL A;  4FD2 A;  4M9X A;  3SAV A;  2LH0 A;  2LVP C;  2CV0 A;  2KNA A;  4NC6 A;  2QCU A;  2WZJ A;  2FS1 A;  2RGO A;  4NXN M;  3BOS A;  3GLI A;  4LF6 M;  1MN3 A;  3W67 A;  3KP0 E;  1I94 M;  4OVZ B;  1GL7 A;  4XBO A;  1QYR A;  2O5R A;  3U6Q A;  1J09 A;  3GRV A;  2Y20 A;  1NO1 A;  2Y0Q A;  1NVM A;  1QAM A;  2XGN A;  1VDL A;  4FWG A;  2ZTC A;  3U6D A;  4KHP M;  3TQS A;  4B3R M;  1TTE A;  3QYE A;  4PDG A;  1L2B A;  2J7N A;  1NNJ A;  1CUK A;  1TF0 B;  2FFJ A;  2L7H A;  4DUZ M;  2CV1 A;  4IJE A;  5EXT A;  5FTJ A;  2G5G X;  2JWS A;  1IQP A;  4L6V 6;  1G59 A;  4FVM A;  1E9S A;  1XB2 B;  2DWZ B;  4M9S A;  5KPT A;  2F5S A;  3MK6 A;  3LW5 F;  1N34 M;  3I04 M;  1PGY A;  1D0K A;  2NQ8 C;  3I4V A;  3U61 A;  1XMQ M;  3C3E A;  4DR6 M;  3KOX E;  3ZCB B;  3VK8 A;  4L4U A;  3U6O A;  2VF8 A;  4LJ7 A;  2FE8 A;  2CWB A;  3CF6 E;  2MGW A;  3I4Y A;  3SBJ A;  1MU5 A;  3GLF B;  2OOA A;  3HHY A;  1D0L A;  5KQD A;  3GRU A;  3KSJ A;  3L28 A;  3HHZ A;  2C98 A;  4DV7 M;  4DR1 M;  1WJ7 A;  3T1H M;  4LF4 M;  3FTF A;  4LFB M;  4FCT A;  2UU9 M;  2HAK A;  4MGH A;  3W0F A;  5EJC A;  3UJN A;  3HU2 A;  3Q8X A;  3K1J A;  2DZN B;  1PM5 A;  1NV8 A;  4B3M M;  4B7G A;  2XZF A;  3U6P A;  1GKI A;  1IY1 A;  2ERC A;  2GNO A;  4GHA A;  4GRI A;  4GKJ M;  3UMM A;  3HZJ A;  2QBY A;  1NSF A;  3PXG A;  3KOY E;  4LJ8 A;  3FTC A;  4GC9 A;  2C9O A;  2DHR A;  4D80 A;  1ZAE A;  2J7O A;  4QHS A;  4PCZ A;  1W5S A;  2CP8 A;  3EIH A;  2UUC M;  3VKG A;  2VF7 A;  3A42 A;  2LVA A;  3GP1 A;  2DXI A;  1MX0 A;  1JR3 D;  3TL4 X;  3SMP A;  4B3T M;  2R4J A;  2DWL A;  2FH0 A;  2R65 A;  1OFH A;  1Q02 A;  3QYB A;  3E4R A;  4LRT A;  2XLJ A;  2JNH A;  5FTN A;  2R6F A;  4IBG A;  1JQJ C;  2XF3 A;  3GRY A;  1K3W A;  4KT0 F;  4CIS A;  1G8P A;  2OO9 A;  4PD2 A;  1IN4 A;  1NY6 A;  2YQZ A;  2KRK A;  4DBG B;  2CRU A;  1HQC A;  4G6Z A;  1SXJ A;  4KLN A;  5KO3 A;  1G71 A;  3GPY A;  3C3D A;  3EIE A;  3PNY A;  3BXW A;  2D7G A;  2X8A A;  5KPZ A;  4ITQ A;  3L25 A;  3SHF A;  3FRH A;  1IN6 A;  2OPF A;  2DZL A;  4MGY E;  3KDS E;  2CEA A;  3A46 A;  2C5R A;  4Y28 F;  3LQR A;  5ITX E;  2JZ1 A;  3F92 A;  4KOD A;  2P5T A;  2BNK A;  2QPA A;  1HNX M;  1XMO M;  3FUX A;  4AKI A;  4F2L A;  1IN8 A;  1GVN A;  1L8Q A;  4MGK E;  2QNJ A;  4IIW A;  5FTL A;  1YSY A;  4LFC M;  3AOG A;  3B7N A;  4BLC A;  3VDP A;  4I8O A;  5ITX A;  4NRW A;  4S12 A;  4REZ A;  1V92 A;  3JR4 A;  4IBD A;  4D82 A;  2EO2 A;  4K0K M;  1ORY B;  2N35 A;  3GLF E;  1E32 A;  1SXJ C; 
#chains in the Genus database with same CATH homology
 3OTO M;  1Q3C A;  4FCW A;  2EA0 A;  1XNQ M;  4LFA M;  1TH3 A;  3KFU G;  2XH9 A;  2R4E A;  1IBM M;  2LNH C;  5IWA M;  5FLX S;  2ZAM A;  3SAS A;  3KP1 E;  4B08 A;  4DV0 M;  4RNA A;  1DO2 A;  1QAQ A;  4LY6 A;  4WW0 A;  1K82 A;  4GIT A;  3GQ5 A;  4ZPX A;  2XZU A;  3HWS A;  1SXJ B;  4OU7 A;  3SC3 A;  1E9R A;  3E9S A;  2VQE M;  4JI4 M;  3KXE C;  4LZZ A;  1YUB A;  5GKN A;  4DR3 M;  2BJW A;  1WXQ A;  2CHV A;  2W82 A;  3HHW A;  3SYL A;  5ITY A;  5EP2 A;  3AKZ A;  3LQQ A;  2DZO B;  3J7B A;  3AL0 C;  1GL6 A;  2R45 A;  4G4N A;  4NL4 H;  3GPX A;  2KRU A;  3FTD A;  3THG A;  4D81 A;  4GC5 A;  1HNZ M;  1IN7 A;  1HNW M;  3B9P A;  3VLF B;  4FCV A;  7CAT A;  3HHX A;  1UM8 A;  5KQ8 A;  1Z5C A;  2FOI C;  1Z6T A;  3KSX A;  3T38 A;  3GPP A;  2F5N A;  4AKH A;  4QHT A;  4I5S A;  3HKP A;  4FWH A;  3TPZ A;  5C18 A;  4LCB A;  3CF0 A;  2UUA M;  2D7H A;  1EE8 A;  5JI2 E;  3RE8 A;  4DR5 M;  1KSF X;  3GQ3 A;  4TUW A;  5IRE B;  3ZC7 B;  2KZU A;  1G3I A;  2QP9 X;  4G4O A;  5EP1 A;  3M0E A;  5LMU M;  4RF0 A;  2M5Z A;  4PDI A;  3GLG B;  2FNA A;  2EUC A;  3AOE A;  3DA1 A;  5IZ7 D;  3RGP A;  3VKH A;  4PT5 A;  2UXB M;  1HT2 E;  5FTK A;  4I81 A;  3KW6 A;  2L7I A;  1VDD A;  2LXE A;  8CAT A;  4R3D A;  2Z3X A;  4QOZ C;  3L2A A;  3FUT A;  2DWN A;  1QQW A;  4NSR A;  3D8B A;  4MGZ E;  4JI0 M;  5ITT A;  1ZQ9 A;  4LF5 M;  1QVR A;  3D8L A;  2HKJ A;  3UGJ A;  1Z5A A;  1IBK M;  1FJG M;  4IBJ A;  3SAU A;  1SXJ E;  4GH9 A;  4AG5 A;  4FW9 A;  4X65 M;  3LVW A;  3HU3 A;  1IXR C;  1NNU C;  3RFW A;  5BR8 M;  3HGI A;  2XSZ D;  4Z8X A;  2QEN A;  3DOA A;  3LMM A;  4GHL A;  1JR3 A;  4L16 A;  2RGH A;  4NRV A;  1OJL A;  4X64 M;  2CUZ A;  3AOE C;  3AJI B;  3CTW B;  2I7N A;  3HU1 A;  1XC8 A;  3HJS A;  1TH2 A;  1L2D A;  4DV2 M;  1L2C A;  5DYG A;  4G4Q A;  2ZAO A;  4JI3 M;  3I51 A;  4L8R C;  4MM3 B;  2AHM A;  3GLH B;  2YR0 A;  3HJQ A;  4W5W A;  3DZD A;  2F4V M;  1D2N A;  3UK6 A;  4IBI A;  2V6Z M;  4LJ4 A;  1T3T A;  4LF7 M;  4LJ5 A;  5EXS A;  4B3S M;  4JI7 M;  1N32 M;  1XXH A;  3W0L B;  3UZU A;  1R2Z A;  3FUW A;  1KYI A;  4JI5 M;  2YFQ A;  5FSW A;  1HQY E;  2KW0 A;  4IBF A;  3M6A A;  3LVV A;  2UXC M;  1J5E M;  4OW0 A;  4BBA A;  1Q3B A;  1L1T A;  4IJF A;  2CHQ A;  2XEP A;  4IBC A;  3J7A S;  3FUV A;  2Z7J A;  2F5O A;  3J2P B;  1DGF A;  1G4A E;  2BJV A;  3U60 B;  5IT9 S;  2CFO A;  3GLG A;  3L27 A;  1IN5 A;  4WUR A;  4QNR A;  4LGY A;  1DGG A;  2D7E A;  5DNY A;  3ZH9 B;  2R46 A;  4JI2 M;  4LF8 M;  2A5Y B;  3IG5 A;  4CHT B;  2JA2 A;  3R8F A;  5A2Q S;  2X4A A;  3TE6 A;  4NXM M;  1E94 E;  4MH0 E;  3KS8 A;  2UUB M;  1N75 A;  3AV0 A;  4EIW A;  2F5P A;  1Z59 A;  3RGS A;  1KFV A;  1DGB A;  3VFD A;  2Z4R A;  2CE7 A;  1XHB A;  4JYA M;  3IG8 A;  1Q39 A;  5EXX A;  5JI3 E;  3T15 A;  1TDH A;  3JR5 A;  4DV4 M;  3U5Z B;  3DFZ A;  3FKE A;  4HLQ A;  2Z4S A;  1DGH B;  3CF2 A;  1PJI A;  1NJF A;  4M0W A;  3VDU A;  1GLN A;  1HR0 M;  5C1B A;  2K47 A;  4LRS A;  3SAT A;  3FYC A;  4MB7 A;  4X66 M;  1XXH B;  2ZM6 M;  1QAO A;  2LWX A;  4GMQ A;  1TH4 A;  1TGU A;  4M0D A;  3SHG B;  5ITR A;  3TWK A;  2KEB A;  3K2L A;  3GLH A;  2ZBK B;  2QZ4 A;  3C58 A;  2Y0T A;  2ZAN A;  4X62 M;  3HJ8 A;  4B7H A;  3U6C A;  3J80 S;  3K92 A;  3M7G A;  4DR7 M;  4B7F A;  2VII A;  4YY3 M;  2Y21 A;  3KVW A;  3NWL A;  1LV7 A;  3PNV A;  4L78 A;  3VK7 A;  5EP4 A;  4DUY M;  4IBB A;  4L15 A;  5ITQ A;  1XNR M;  4RF1 A;  1I4W A;  3GQ4 A;  4DV6 M;  3GRR A;  2L6O A;  3WHK A;  4M9Z A;  2X49 A;  1XWI A;  4LZJ A;  2R18 A;  1IXZ A;  4CGY B;  4DV5 M;  2I7P A;  2DWM A;  5KPR A;  3T1Y M;  1R6B X;  3H4M A;  3A98 B;  2VQF M;  3SAR A;  5BPV A;  2XFT A;  4LJ6 A;  3U6S A;  2R62 A;  4P16 A;  2HCB A;  2G8L A;  3U60 A;  1Z5B A;  2YNM D;  2L09 A;  2V1C A;  4LG2 A;  3QAU A;  4QNM A;  1K3X A;  1TDZ A;  2M60 A;  1NJG A;  4LF9 M;  1W5T A;  5ITU A;  4AW4 A;  4AI6 A;  1NHW C;  3GPU A;  1IBL M;  4GKK M;  3FTE A;  3GO8 A;  3JAM S;  4DV1 M;  1SXJ D;  1J7K A;  1FNN A;  1R2Y A;  3GLI B;  2XSZ A;  4DV3 M;  4LJ9 A;  5F3W A;  2C96 A;  3FYD A;  3U6L A;  3NBI A;  1H6U A;  2Q2E B;  4II7 A;  4MGI E;  3U5Z A;  4AQY M;  2KA6 B;  4JXJ A;  1N77 A;  3PFI A;  1L1Z A;  1DGH A;  3KOZ E;  3A45 A;  2CV2 A;  3PVS A;  3QWL A;  4LGM A;  4JI8 M;  4DR2 M;  4JN6 A;  4NSO B;  1X37 A;  3AFH A;  5DYI A;  3SFZ A;  1IY2 A;  2H1R A;  4AG6 A;  5H37 D;  1HT1 E;  4XGI A;  3SMS A;  3R9X B;  1OFI A;  4A3V B;  4I4L A;  1N78 A;  5EP3 A;  4BB9 A;  1N36 M;  2C99 A;  3TWL A;  3U61 B;  5LMN M;  4OVZ A;  1R7R A;  4FWD A;  3SAW A;  4JI6 M;  1N33 M;  4NOO B;  3KS4 A;  5E26 A;  4JV5 M;  2KZS A;  1PJJ A;  2E5L M;  2UXD M;  2C9C A;  3FD9 A;  3J27 B;  4R7G A;  5EQT A;  3K8Z A;  2V1U A;  4GIP A;  5E6J A;  4HL4 A;  3L26 A;  1C1K A;  1IM2 A;  4IBE A;  1DO0 A;  4Z6Y A;  2OQ4 A;  4JI1 M;  2KXE A;  2QBY B;  1QZM A;  2HL7 A;  1NY5 A;  1YE9 A;  5EXP A;  1S3S A;  3J81 S;  4DR4 M;  1IY0 A;  2CHG A;  3FUU A;  4AKG A;  3U6E A;  3GLF A;  2F5Q A;  2XFS A;  3U6M A;  4OX9 M;  3SYK A;  4YHH M;  4IBK A;  1NHG C;  4LJA A;  3L29 A;  4QOS A;  1G41 A;  5FTM A;  3TWM A;  4KO8 A;  2HHH M;  2RKO A;  3ILK A;  1IXS B;  1QAN A;  3KOW E;  4G4R A;  2DVW B;  4AZF A;  3MHV C;  3MJ5 A;  3WHL A;  4FD2 A;  4M9X A;  3SAV A;  2LH0 A;  2CV0 A;  2QCU A;  4NXN M;  2RGO A;  3GLI A;  3BOS A;  4LF6 M;  3KP0 E;  1I94 M;  4OVZ B;  1GL7 A;  4XBO A;  1QYR A;  2O5R A;  3U6Q A;  1J09 A;  3GRV A;  2Y20 A;  2Y0Q A;  1NVM A;  1QAM A;  2XGN A;  4FWG A;  3U6D A;  4KHP M;  3TQS A;  4B3R M;  4PDG A;  1L2B A;  2J7N A;  1NNJ A;  2FFJ A;  2L7H A;  4DUZ M;  2CV1 A;  4IJE A;  5EXT A;  5FTJ A;  2G5G X;  1IQP A;  1G59 A;  4FVM A;  1E9S A;  2DWZ B;  4M9S A;  5KPT A;  2F5S A;  3MK6 A;  1N34 M;  3I4V A;  2NQ8 C;  3U61 A;  1XMQ M;  4DR6 M;  3KOX E;  3ZCB B;  3VK8 A;  4L4U A;  3U6O A;  4LJ7 A;  2FE8 A;  3CF6 E;  3SBJ A;  3I4Y A;  1MU5 A;  3GLF B;  3HHY A;  5KQD A;  3HHZ A;  4DV7 M;  3GRU A;  3KSJ A;  3L28 A;  4DR1 M;  2C98 A;  4LF4 M;  3T1H M;  4LFB M;  3FTF A;  4FCT A;  2UU9 M;  4MGH A;  3W0F A;  5EJC A;  3UJN A;  3HU2 A;  3Q8X A;  3K1J A;  2DZN B;  1PM5 A;  4B3M M;  4B7G A;  2XZF A;  3U6P A;  1GKI A;  1IY1 A;  2ERC A;  4GHA A;  4GRI A;  4GKJ M;  3UMM A;  2QBY A;  1NSF A;  3PXG A;  3KOY E;  4LJ8 A;  3FTC A;  4GC9 A;  2C9O A;  2DHR A;  4D80 A;  1ZAE A;  2J7O A;  4QHS A;  4PCZ A;  1W5S A;  3EIH A;  2UUC M;  3VKG A;  3A42 A;  3GP1 A;  2DXI A;  1MX0 A;  1JR3 D;  3TL4 X;  3SMP A;  4B3T M;  2R4J A;  2DWL A;  2R65 A;  1OFH A;  4LRT A;  3E4R A;  2XLJ A;  5FTN A;  4IBG A;  1JQJ C;  2XF3 A;  3GRY A;  1K3W A;  4CIS A;  1G8P A;  4PD2 A;  1IN4 A;  1NY6 A;  2YQZ A;  2KRK A;  4G6Z A;  1HQC A;  4KLN A;  1SXJ A;  5KO3 A;  3GPY A;  3EIE A;  3PNY A;  2D7G A;  2X8A A;  5KPZ A;  4ITQ A;  3L25 A;  3SHF A;  1IN6 A;  2OPF A;  4MGY E;  3KDS E;  2CEA A;  3A46 A;  2C5R A;  3LQR A;  5ITX E;  4KOD A;  2P5T A;  2BNK A;  2QPA A;  1HNX M;  1XMO M;  3FUX A;  4AKI A;  1IN8 A;  1GVN A;  1L8Q A;  4MGK E;  5FTL A;  4IIW A;  1YSY A;  4LFC M;  3AOG A;  4BLC A;  3VDP A;  4I8O A;  5ITX A;  4NRW A;  4S12 A;  4REZ A;  3JR4 A;  4IBD A;  4D82 A;  2EO2 A;  4K0K M;  1ORY B;  1E32 A;  1SXJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...