4X66M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x66M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x66M02
4G4RA 4B3MM 4JI3M 4B3TM 5ITTA 1K3WA 4LFAM 5ITXE 1L1TA 5BR8M 1PJJA 5IWAM 4X64M 3GPPA 3J7AS 1IBKM 1R2YA 4AQYM 4NRVA 3GP1A 2UXDM 4DV3M 2E5LM 2UUCM 4G4NA 3A46A 2ZBKB 5ITQA 4X66M 3SAUA 1TDHA 1Q39A 2Q2EB 3SBJA 1HNWM 1PJIA 4LF8M 4G4OA 3U6EA 4DR1M 1L2CA 1N32M 4YY3M 1PM5A 1MX0A 4JI6M 3JR4A 3U6OA 3GPUA 2OPFA 5LMUM 4JV5M 3SAVA 4JYAM 4DV2M 4LFBM 1XC8A 3OTOM 4PCZA 4DR5M 4G4QA 4DR4M 2EA0A 3U6MA 4PDIA 3DOAA 3U6CA 1L2DA 3SARA 4B3RM 4X65M 5ITXA 4B3SM 3TWKA 1TDZA 3GPYA 4ITQA 4PDGA 4NRWA 4OX9M 2VQEM 1N36M 3A42A 3VK7A 4LF7M 4X62M 3GQ5A 1XNQM 3U6QA 4DUZM 4LF6M 1EE8A 1FJGM 3W0FA 1N34M 1XMQM 4JI4M 1XNRM 4GKJM 1Z5CA 4MB7A 4NXNM 2ZM6M 1I94M 3SATA 1L2BA 5LMNM 2F5QA 2UXBM 1MU5A 4LF9M 3U6DA 1K3XA 3GQ3A 1XMOM 2UXCM 3SAWA 2VQFM 5FLXS 4DV1M 3A45A 3JR5A 2F5PA 1K82A 2HHHM 3SASA 4CISA 4DR6M 1R2ZA 1N33M 1Z5BA 4DV5M 1Q3CA 1HNXM 5ITRA 4JI2M 3J81S 4DV0M 3U6LA 2UU9M 3JAMS 3TWLA 4JI7M 2F5NA 4YHHM 4GKKM 4DUYM 2F5SA 1HR0M 3T1YM 3C58A 4JI5M 4KHPM 4K0KM 4DV6M 2UUAM 1IBLM 3U6SA 1Z59A 1Z5AA 2XZFA 3GPXA 2F5OA 4NXMM 2UUBM 5ITYA 4DV7M 4DV4M 4DR3M 4JI8M 3GQ4A 1HNZM 2XZUA 2HKJA 5ITUA 3T1HM 1J5EM 3J80S 1Q3BA 4JI0M 4DR2M 1NNJA 1KFVA 4JI1M 4LF5M 4DR7M 2OQ4A 4LFCM 4PD2A 5IT9S 4LF4M 1IBMM 3U6PA 2F4VM 3GO8A 3TWMA 5A2QS 3VK8A 1L1ZA
chains in the Genus database with same CATH superfamily
4G4RA 5BPVA 3PNVA 4L15A 3QYEA 3FKEA 4LFAM 2FFJA 4HL4A 3LVVA 3HHWA 1EFUB 4FCTA 2QBYA 3KDSE 3WHKA 3J7AS 1D2NA 3K8ZA 4EIWA 3FRHA 1F4IA 1D0LA 2ZAMA 4DBGB 2UXDM 3H4MA 2DWLA 2W82A 1ZQ9A 1SXJC 4GMQA 2UUCM 1GO5A 1R5LA 4G4NA 3FUVA 1XWIA 2ZBKB 3DZDA 3FUUA 5F3WA 1TH4A 4R3DA 1D0KA 4IBGA 2R18A 3SYKA 2BJWA 3FD9A 4ZPXA 5FTLA 2C96A 1IXZA 3T15A 2O25A 2KRKA 3Q8GA 1L2CA 3I4YA 2APLA 3IG5A 3ZQJA 1J09A 1IN8A 2VF7A 3Q8XA 2JY7A 3B89A 3GPUA 2H1RA 3LCUA 3EIHA 1X37A 1IY1A 1JQJC 3VLFB 4DV2M 3SC3A 5EXTA 1I4WA 4PCZA 2Z4RA 1J7KA 4QHTA 3CTWB 4ANRA 4G4QA 1QDTA 4LJ9A 1NV9A 5DFLA 5ITXA 1TDZA 4B08A 5L8RF 2ZAOA 1G4AE 1XXHE 2K0BX 1N36M 1JR3D 2LTUA 1DGHA 1W5SA 2EJSA 3L2AA 5EQTA 3FTEA 3AL0C 3GQ5A 2LVQD 1ZMVA 2WSCF 2XFSA 4DUZM 1SXJD 1NSFA 2JP7A 3AOGA 3ILKA 1PJSA 1FJGM 3KOZE 3W0FA 1GLNA 2L2DA 4QNMA 2MGWA 1CUKA 1V34A 1N34M 3E9SA 4JI4M 3TL4X 4NXNM 3SFZA 1I94M 1N75A 2HL7A 3HU1A 1IN7A 1V92A 1T3TA 2DZLA 1QUTA 1OTRA 4AKIA 3HGIA 1E32A 3L27A 3SAWA 2XLJA 2VQFM 5FLXS 2YFQA 1NJGA 3A45A 2F5PA 2HHHM 2FS1A 2J7OA 4CGYB 2HWJA 2MJ5B 3GRVA 1R2ZA 5EXSA 4DR6M 4LRTA 7CATA 1HNXM 1LTMA 4JI2M 3R9XB 4DV0M 2UU9M 2LXEA 4JI7M 1NO1A 4Z6YA 2VIIA 3E4RA 3WHLA 1TR8A 1XB2B 1GABA 4KLNA 1L1ZA 4XGIA 4R7GA 3VDPA 1ZAEA 1PGYA 3TPZA 3D8LA 4S12A 4JI5M 2DAEA 4WW0A 4K0KM 4DV6M 1XXHB 4IBKA 2JNHA 3E21A 2WZJA 2B3TA 2ZTCA 1IXSA 4FW9A 3U6SA 3GLGA 1NVMA 2OO9A 1Z5AA 2O5RA 3B74A 4OU7A 1QANA 2UUBM 4DR3M 4JI8M 4LJ5A 3GLHA 2R65A 3MK6A 5FTJA 4M9XA 3M7GA 2JZ0A 2ZANA 3UMMA 3C9PA 3L28A 3J80S 1TF0B 5C18A 4JI0M 4Z8XA 4DR2M 1MN3A 1NNJA 3FUXA 4LFCM 3QWLA 1GL7A 3J27B 1QAQA 3K9OA 1IBMM 4IBBA 3H4JA 4KO8A 3U6PA 3LMMA 3LQQA 2DAIA 1T43A 3KOWE 3GO8A 4JYAM 5A2QS 3VK8A 4M9ZA 1XHBA 2DAMA 4B3MM 4B3TM 5ITTA 1HT2E 3CF6E 2KEBA 4MM3B 2CE7A 5DYGA 2KNAA 3DFZA 4HLQA 4AQYM 3GLFA 3U5ZA 4L6V6 3B9PA 4MH0E 2LVPC 3BOSA 3RE8A 2XFTA 1G3IA 3FUTA 1EIJA 1IFYA 1PJTA 4NL4H 2KZUA 2DAGA 3L26A 3A46A 1D0MA 4LGMA 2JUJA 2RRUA 4L4UA 3ZC7B 5EJCA 2DXIA 2QNJA 5FSWA 2DHYA 4LRSA 2BNKA 3KXEC 4GRIA 3HY5A 2BJVA 2KZSA 3E46A 1PJIA 2QPAA 3TE6A 4G4OA 3EIEA 3HWSA 4DR1M 4P16A 1C7YA 4TUWA 2R0IA 3I04M 4YY3M 1ZMWA 2EUCA 4WP2A 1OFHA 5KPZA 1PM5A 1HQCA 4D80A 4JI6M 1QAMA 3NBXX 3CF2A 3JR4A 1NY5A 1NY6A 1OAIA 3AKZA 2R4EA 2OPFA 4JV5M 3VKGA 2XH9A 2L7IA 4LZZA 1DO2A 3RGPA 2V1CA 2Y21A 3OTOM 1N77A 1R6BX 2DHRA 2I7PA 4DR4M 2EA0A 2XGNA 4LJAA 4LY6A 3U6CA 1L2DA 3SARA 4B3RM 1SXJB 3C3DA 4NRWA 3CGWA 3HHYA 4OX9M 4NSRA 4LG2A 4I81A 2JY8A 4LF7M 1XNQM 2RKOA 4L16A 4LJ8A 2CV1A 1YE9A 2K47A 2QSFX 2WSEF 4LCBA 4NSOB 4F2LA 4BLCA 1XMQM 1XNRM 4MB7A 2OOAA 2DI0A 2C98A 1VDDA 2ZM6M 3KP1E 2F5QA 3RGSA 3M6AA 3C3EA 4KT0F 5JI3E 2DENA 3FRIA 4M0WA 2KXEA 2MR9A 4P17A 1NJFA 1G71A 2LNHC 4IIWA 5JI2E 3GLIE 1K82A 4BBAA 3UZUA 3U60B 1Z5BA 4DV5M 1N33M 3J81S 3AJIB 1Y8GA 3MMPA 2LVAA 3CF0A 2HAKA 3LW5F 4LGYA 3HX3A 3SHGB 4F1IA 4GKKM 2GNOA 4GITA 1IXRC 1WGNA 2I7NA 5C1BA 2V1UA 1TTEA 4I4LA 2DVWB 4M0DA 1XXHA 1JB0F 4AW4A 2QBYB 2N35A 2NQ8C 3KS8A 4KODA 5EP4A 4UN2B 3GPXA 2XZFA 3KP0E 2JY5A 3A98B 2EKFA 3PXGA 3PVSA 1S3SA 5ITYA 4DV4M 4DV7M 4QOZC 4RKUF 1HNZM 2CV2A 3GP1A 3HJQA 1E9SA 1Z6TA 1G8PA 3I4VA 3KW6A 5ITUA 3T1HM 2XZUA 3KS4A 2CFOA 1NHGC 4DR7M 2D7GA 4CJ6A 3R8FA 2DWNA 4LF4M 4IBCA 3GLIB 5IZ7D 3HHXA 4A3VB 3AV0A 3GRRA 2LHCA 2VF8A 5KO3A 2RGHA 4JI3M 2MROB 3FYDA 4FCVA 4GHLA 2KNVA 4CHTB 2J7NA 3IECA 5BR8M 5FTMA 5FTNA 1PJJA 3FTFA 3GPPA 1IBKM 4FWDA 1R2YA 1OKSA 2G5GX 1PRBA 2Y0TA 2Z4SA 3KOXE 1IN6A 2ERCA 3IG8A 4FD2A 3K1JA 4LJ6A 5FTKA 2CHQA 2V6ZM 3VDUA 1TH3A 2EKKA 3NBIA 4LJ4A 3RFWA 2X49A 4IBEA 3HU3A 5ITQA 4X66M 1N78A 2DWZB 4IBDA 2L6OA 3T38A 1TDHA 2XEPA 1Q39A 1FNNA 1QAOA 2Q2EB 3SBJA 2OOBA 1HNWM 1IN5A 2M5ZA 3SHFA 4LF8M 1WIVA 4OVZA 2C5RA 4FVMA 4JN6A 1QVRA 2G3QA 3HJ8A 1AUAA 3W68A 1NV8A 2X8AA 2M60A 5E26A 3GRUA 1JR3E 1MX0A 2CUZA 4GC9A 4XK8F 1BVSA 2LWXA 3M0EA 2Y0QA 4REZA 4B7FA 5LMUM 1SXJE 4NC6A 3NWLA 1OQYA 1XC8A 2R6FA 2AHMA 1QZEA 2CRUA 2R4JA 3U61B 1GJSA 3V76A 1SG9A 4PDIA 3DOAA 2QCUA 4QHSA 4X65M 4D82A 1VG5A 4PDGA 1IN4A 3KOYE 2L4EA 3MHVC 4IBFA 3A42A 1WR1B 2Z8YM 3SMSA 3VK7A 4AKHA 1PJQA 3GRYA 1W5TA 2R62A 2XSZA 3U6QA 3B7ZA 1G59A 2CHGA 2MH8A 4LF6M 2CV0A 3KFUG 8CATA 1YSYA 1A5TA 1WXQA 2KHHA 3I51A 1Z5CA 1ORYB 5DYIA 4GHAA 1OAOC 2R44A 3UJNA 2LVNC 2UXBM 1MU5A 1C1KA 2KNZA 2KRUA 3FTDA 3U6DA 2FOIC 1VEJA 3GQ3A 3UK6A 2ZTDA 1XMOM 1K3XA 2UXCM 3JR5A 4B7HA 4Q7JA 3SASA 2L7HA 4CIZA 2FE8A 1QQWA 3JAMS 3ZH9B 4AKGA 1IQPA 2G8LA 1DGBA 2JY6B 4YHHM 4MGYE 3PNYA 4DUYM 2Y20A 2F5SA 3T1YM 3K92A 2X4AA 1RU3A 3W0LB 4WURA 2O01F 2CEAA 4L8RC 1OIZA 1IBLM 3VKHA 5KPTA 2KW0A 2L4FA 1Z59A 5DNYA 2F5OA 1UM8A 4XBOA 3GLFB 1GL6A 4GIPA 3U5ZB 1QDRA 3GQ4A 5EXXA 3W67A 1QUSA 1T6OA 1G41A 2HKJA 2DAKA 4IJFA 4JI1M 3AFHA 2DZOB 1KFVA 4LF5M 4AG6A 2OQ4A 5GKNA 1ZV1A 3J2PB 2LHGA 5IT9S 1V33A 1YLAA 1VDLA 2DNAA 4RNAA 4II7A 2C9CA 2Z3XA 3GLIA 5KPRA 1WGLA 1IM2A 1IY2A 3TWMA 1Q3CA 3VFDA 2H5XA 4G6ZA 3UGJA 4AI6A 4G3OA 1K3WA 1MJGM 3LVWA 1KYIA 2YQZA 5ITXE 2C99A 2DZNB 4GEWA 1L1TA 4NOOB 1OFIA 4OW0A 5IWAM 4X64M 4GC5A 5EP1A 4NRVA 4W5WA 1UFZA 2CP8A 1NHWC 2KDLA 2P5TA 3L29A 4DV3M 2E5LM 3AOEA 4MGIE 2LBCA 3IHPA 2DKLA 2LVOC 1ZMUA 4AG5A 2J5YA 2KA6B 4GH9A 4RF0A 3K9PA 3SAUA 2K6BA 4LZJA 3TQSA 2GQFA 3FE3A 2DWMA 1E94E 3BBZA 3U6EA 3HU2A 1HT1E 1N32M 3ZCBB 2XSZD 3SYLA 3U6OA 2QENA 1GKIA 4I8OA 3SAVA 3D8BA 3HZJA 2YR0A 3HHZA 2JZ1A 4LFBM 1WHCA 2K9DA 2WSFF 3I01M 2D7HA 2BWEA 4DR5M 2RGOA 1AIPC 4RF1A 1DO0A 3U6MA 1DGFA 1E9RA 3U61A 2FH0A 5H37D 5KQ8A 4B3SM 3TWKA 2QHOB 3GPYA 4FWHA 4ITQA 4IJEA 2VQEM 1DGHB 2JWSA 3J7BA 4LJ7A 1QZMA 2YNMD 4R71A 3B7QA 4X62M 4BB9A 3GLGE 4MGKE 2QZ4A 3FYCA 1EE8A 3HKPA 1TGUA 2QP9X 3THGA 4IBIA 3GLHE 4JXJA 4GKJM 2L09A 2A5YB 4B7GA 1P3QQ 3SATA 4Y28F 1L2BA 1NNUC 1GVNA 5EP2A 5LMNM 2FNAA 4MGHA 2C9OA 4LF9M 4M9SA 1QYRA 1DV0A 3KSXA 3KVWA 1H6UA 1VEKA 3AOEC 3KSJA 4FWGA 2XF3A 3QAUA 2QQ8A 4QNRA 1JR3A 5E6JA 5EXPA 4DV1M 3HJSA 2BWBA 2LH0A 1HQYE 4CISA 3LQRA 2JXNA 2EO2A 5ITRA 1SXJA 3U6LA 2JA2A 1WJ7A 1GJTA 3L25A 3TWLA 3SMPA 3QYBA 1L8QA 2F5NA 2R45A 3MJ5A 5KQDA 1IY0A 3F92A 1VQ1A 1OIPA 1HR0M 3DA1A 3C58A 3GLFE 4D81A 4KHPM 1KSFX 1YUBA 2UUAM 1IXSB 1DGGA 3GLGB 2R46A 3FUWA 1LV7A 4NXMM 1VEGA 1OJLA 4FCWA 4AZFA 1R4GA 2Z7JA 3GLHB 2CWBA 4L78A 4HEOA 5EP3A 4PT5A 4MGZE 1J5EM 3FTCA 1Q3BA 2HCBA 2VDBB 4IBJA 4QOSA 1Q02A 2CHVA 3U60A 3B7NA 4PD2A 4I5SA 2D7EA 1TH2A 3BXWA 4OVZB 3T6PA 1HJPA 2F4VM 3K2LA 3LCVB 1R7RA 5IREB 3PFIA
chains in the Genus database with same CATH topology
4G4RA 5BPVA 3PNVA 4L15A 3FKEA 4LFAM 2FFJA 4HL4A 3LVVA 3HHWA 4FCTA 2QBYA 3KDSE 3WHKA 3J7AS 1D2NA 3K8ZA 4EIWA 2ZAMA 2UXDM 3H4MA 2DWLA 2W82A 1ZQ9A 1SXJC 4GMQA 2UUCM 4G4NA 3FUVA 1XWIA 2ZBKB 3DZDA 3FUUA 5F3WA 1TH4A 4R3DA 4IBGA 2R18A 3SYKA 2BJWA 3FD9A 4ZPXA 5FTLA 2C96A 1IXZA 3T15A 2KRKA 1L2CA 3I4YA 3IG5A 1J09A 1IN8A 3Q8XA 3GPUA 2H1RA 3EIHA 1X37A 1IY1A 1JQJC 3VLFB 4DV2M 3SC3A 5EXTA 1I4WA 4PCZA 2Z4RA 1J7KA 4QHTA 3CTWB 4G4QA 4LJ9A 5ITXA 1TDZA 4B08A 2ZAOA 1G4AE 1N36M 1JR3D 1DGHA 1W5SA 3L2AA 5EQTA 3FTEA 3AL0C 3GQ5A 2XFSA 4DUZM 1SXJD 1NSFA 3AOGA 3ILKA 1FJGM 3KOZE 3W0FA 1GLNA 4QNMA 1N34M 3E9SA 4JI4M 3TL4X 4NXNM 3SFZA 1I94M 1N75A 2HL7A 3HU1A 1IN7A 1T3TA 4AKIA 3HGIA 1E32A 3L27A 3SAWA 2XLJA 2VQFM 5FLXS 2YFQA 1NJGA 3A45A 2F5PA 2HHHM 2J7OA 4CGYB 3GRVA 1R2ZA 5EXSA 4DR6M 4LRTA 7CATA 1HNXM 4JI2M 3R9XB 4DV0M 2UU9M 2LXEA 4JI7M 4Z6YA 2VIIA 3E4RA 3WHLA 4KLNA 1L1ZA 4XGIA 4R7GA 3VDPA 1ZAEA 3TPZA 3D8LA 4S12A 4JI5M 4WW0A 4K0KM 4DV6M 1XXHB 4IBKA 4FW9A 3U6SA 3GLGA 1NVMA 1Z5AA 2O5RA 4OU7A 1QANA 2UUBM 4DR3M 4JI8M 4LJ5A 3GLHA 2R65A 3MK6A 5FTJA 4M9XA 3M7GA 3UMMA 2ZANA 3J80S 3L28A 5C18A 4JI0M 4Z8XA 4DR2M 1NNJA 3FUXA 4LFCM 3QWLA 1GL7A 3J27B 1QAQA 1IBMM 4IBBA 4KO8A 3U6PA 3LMMA 3LQQA 3KOWE 3GO8A 4JYAM 5A2QS 3VK8A 4M9ZA 1XHBA 4B3MM 4B3TM 5ITTA 1HT2E 3CF6E 2KEBA 4MM3B 2CE7A 5DYGA 3DFZA 4HLQA 4AQYM 3GLFA 3U5ZA 3B9PA 4MH0E 3BOSA 3RE8A 2XFTA 1G3IA 3FUTA 4NL4H 2KZUA 3L26A 3A46A 2DXIA 4LGMA 4L4UA 3ZC7B 5EJCA 5FSWA 4LRSA 2BNKA 3KXEC 4GRIA 2BJVA 2KZSA 1PJIA 2QPAA 3TE6A 4G4OA 3EIEA 3HWSA 4DR1M 4P16A 4TUWA 4YY3M 2EUCA 5KPZA 1OFHA 1PM5A 1HQCA 4D80A 4JI6M 1QAMA 3JR4A 3CF2A 1NY5A 1NY6A 3AKZA 2OPFA 2R4EA 4JV5M 3VKGA 2XH9A 2L7IA 4LZZA 1DO2A 3RGPA 2V1CA 2Y21A 3OTOM 1N77A 1R6BX 2DHRA 2I7PA 4DR4M 2EA0A 2XGNA 4LJAA 4LY6A 3U6CA 1L2DA 3SARA 4B3RM 1SXJB 4NRWA 4OX9M 3HHYA 4NSRA 4LG2A 4I81A 4LF7M 1XNQM 2RKOA 4L16A 4LJ8A 2CV1A 1YE9A 2K47A 4LCBA 4NSOB 4BLCA 1XMQM 1XNRM 4MB7A 2C98A 1VDDA 2ZM6M 3KP1E 2F5QA 3RGSA 3M6AA 5JI3E 4M0WA 2KXEA 1NJFA 4IIWA 2LNHC 5JI2E 1K82A 4BBAA 3UZUA 3U60B 1Z5BA 4DV5M 1N33M 3J81S 3AJIB 3CF0A 4LGYA 3SHGB 4GKKM 4GITA 1IXRC 2I7NA 5C1BA 2V1UA 4I4LA 2DVWB 4M0DA 1XXHA 4AW4A 2QBYB 2NQ8C 3KS8A 4KODA 5EP4A 2XZFA 3GPXA 3KP0E 3A98B 3PXGA 3PVSA 1S3SA 5ITYA 4DV4M 4DV7M 4QOZC 1HNZM 2CV2A 3HJQA 1E9SA 1Z6TA 1G8PA 3I4VA 3KW6A 5ITUA 3T1HM 2XZUA 3KS4A 2CFOA 1NHGC 4DR7M 2D7GA 3R8FA 2DWNA 4LF4M 4IBCA 3GLIB 5IZ7D 3HHXA 4A3VB 3AV0A 3GRRA 5KO3A 2RGHA 4JI3M 3FYDA 4FCVA 4GHLA 4CHTB 2J7NA 5BR8M 5FTMA 5FTNA 1PJJA 3FTFA 3GPPA 1IBKM 4FWDA 1R2YA 2G5GX 2Y0TA 2Z4SA 3KOXE 4FD2A 1IN6A 2ERCA 3IG8A 4LJ6A 3K1JA 5FTKA 3GP1A 2CHQA 2V6ZM 3VDUA 1TH3A 3NBIA 4LJ4A 3RFWA 2X49A 4IBEA 3HU3A 5ITQA 4X66M 1N78A 2DWZB 4IBDA 2L6OA 3T38A 1TDHA 2XEPA 1Q39A 1FNNA 1QAOA 2Q2EB 3SBJA 1HNWM 1IN5A 2M5ZA 3SHFA 4LF8M 4OVZA 2C5RA 4FVMA 4JN6A 1QVRA 3HJ8A 2X8AA 2M60A 5E26A 3GRUA 1MX0A 2CUZA 4GC9A 4B7FA 2LWXA 4REZA 3M0EA 2Y0QA 5LMUM 1SXJE 3NWLA 1XC8A 2AHMA 2R4JA 3U61B 4PDIA 3DOAA 2QCUA 4QHSA 4X65M 4D82A 4PDGA 1IN4A 3KOYE 3MHVC 4IBFA 3A42A 3SMSA 3VK7A 4AKHA 3GRYA 1W5TA 2R62A 2XSZA 3U6QA 1G59A 2CHGA 4LF6M 2CV0A 3KFUG 8CATA 1YSYA 1WXQA 3I51A 1Z5CA 1ORYB 5DYIA 4GHAA 3UJNA 2UXBM 1MU5A 1C1KA 2KRUA 3FTDA 3U6DA 2FOIC 3GQ3A 1XMOM 3UK6A 1K3XA 2UXCM 3JR5A 4B7HA 3SASA 2L7HA 2FE8A 1QQWA 3JAMS 3ZH9B 4AKGA 1IQPA 2G8LA 1DGBA 4YHHM 4MGYE 3PNYA 4DUYM 2Y20A 2F5SA 3T1YM 3K92A 2X4AA 3W0LB 4WURA 2CEAA 4L8RC 1IBLM 3VKHA 5KPTA 2KW0A 1Z59A 5DNYA 2F5OA 1UM8A 4XBOA 3GLFB 1GL6A 4GIPA 3U5ZB 3GQ4A 5EXXA 1G41A 2HKJA 4IJFA 4JI1M 3AFHA 2DZOB 1KFVA 4LF5M 4AG6A 2OQ4A 5GKNA 3J2PB 5IT9S 4RNAA 4II7A 2C9CA 2Z3XA 3GLIA 5KPRA 1IM2A 1IY2A 3TWMA 1Q3CA 3VFDA 4G6ZA 3UGJA 4AI6A 1K3WA 3LVWA 1KYIA 2YQZA 5ITXE 2C99A 2DZNB 1L1TA 4NOOB 1OFIA 4OW0A 5IWAM 4X64M 4GC5A 5EP1A 4NRVA 4W5WA 1NHWC 2P5TA 3L29A 4DV3M 2E5LM 3AOEA 4MGIE 4AG5A 2KA6B 4GH9A 4RF0A 3SAUA 4LZJA 3TQSA 2DWMA 1E94E 3U6EA 3HU2A 1HT1E 1N32M 3ZCBB 2XSZD 3SYLA 3U6OA 2QENA 1GKIA 4I8OA 3SAVA 3D8BA 2YR0A 3HHZA 4LFBM 2D7HA 4DR5M 2RGOA 4RF1A 1DO0A 3U6MA 1DGFA 1E9RA 3U61A 5H37D 5KQ8A 4B3SM 3TWKA 3GPYA 4FWHA 4ITQA 4IJEA 2VQEM 1DGHB 4LJ7A 3J7BA 1QZMA 2YNMD 4X62M 4BB9A 4MGKE 2QZ4A 3FYCA 1EE8A 3HKPA 1TGUA 2QP9X 3THGA 4IBIA 4JXJA 4GKJM 2L09A 2A5YB 4B7GA 3SATA 1L2BA 1NNUC 1GVNA 5EP2A 5LMNM 2FNAA 4MGHA 2C9OA 4LF9M 4M9SA 1QYRA 3KSXA 3KVWA 1H6UA 3AOEC 3KSJA 4FWGA 2XF3A 3QAUA 4QNRA 5EXPA 1JR3A 5E6JA 4DV1M 3HJSA 2LH0A 4CISA 1HQYE 3LQRA 2EO2A 5ITRA 1SXJA 3U6LA 2JA2A 3L25A 3TWLA 3SMPA 2F5NA 1L8QA 2R45A 3MJ5A 5KQDA 1IY0A 1HR0M 3DA1A 3C58A 4D81A 4KHPM 1KSFX 1YUBA 2UUAM 1IXSB 1DGGA 3GLGB 2R46A 3FUWA 1LV7A 4NXMM 1OJLA 4FCWA 4AZFA 2Z7JA 3GLHB 4L78A 5EP3A 4PT5A 4MGZE 1J5EM 3FTCA 1Q3BA 2HCBA 4QOSA 4IBJA 2CHVA 3U60A 4PD2A 4I5SA 2D7EA 1TH2A 4OVZB 2F4VM 3K2LA 1R7RA 5IREB 3PFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4R A;  4B3M M;  4JI3 M;  4B3T M;  5ITT A;  1K3W A;  4LFA M;  5ITX E;  1L1T A;  5BR8 M;  1PJJ A;  5IWA M;  4X64 M;  3GPP A;  3J7A S;  1IBK M;  1R2Y A;  4AQY M;  4NRV A;  3GP1 A;  2UXD M;  4DV3 M;  2E5L M;  2UUC M;  4G4N A;  3A46 A;  2ZBK B;  5ITQ A;  4X66 M;  3SAU A;  1TDH A;  1Q39 A;  2Q2E B;  3SBJ A;  1HNW M;  1PJI A;  4LF8 M;  4G4O A;  3U6E A;  4DR1 M;  1L2C A;  1N32 M;  4YY3 M;  1PM5 A;  1MX0 A;  4JI6 M;  3JR4 A;  3U6O A;  3GPU A;  2OPF A;  5LMU M;  4JV5 M;  3SAV A;  4JYA M;  4DV2 M;  4LFB M;  1XC8 A;  3OTO M;  4PCZ A;  4DR5 M;  4G4Q A;  4DR4 M;  2EA0 A;  3U6M A;  4PDI A;  3DOA A;  3U6C A;  1L2D A;  3SAR A;  4B3R M;  4X65 M;  5ITX A;  4B3S M;  3TWK A;  1TDZ A;  3GPY A;  4ITQ A;  4PDG A;  4NRW A;  4OX9 M;  2VQE M;  1N36 M;  3A42 A;  3VK7 A;  4LF7 M;  4X62 M;  3GQ5 A;  1XNQ M;  3U6Q A;  4DUZ M;  4LF6 M;  1EE8 A;  1FJG M;  3W0F A;  1N34 M;  1XMQ M;  4JI4 M;  1XNR M;  4GKJ M;  1Z5C A;  4MB7 A;  4NXN M;  2ZM6 M;  1I94 M;  3SAT A;  1L2B A;  5LMN M;  2F5Q A;  2UXB M;  1MU5 A;  4LF9 M;  3U6D A;  1K3X A;  3GQ3 A;  1XMO M;  2UXC M;  3SAW A;  2VQF M;  5FLX S;  4DV1 M;  3A45 A;  3JR5 A;  2F5P A;  1K82 A;  2HHH M;  3SAS A;  4CIS A;  4DR6 M;  1R2Z A;  1N33 M;  1Z5B A;  4DV5 M;  1Q3C A;  1HNX M;  5ITR A;  4JI2 M;  3J81 S;  4DV0 M;  3U6L A;  2UU9 M;  3JAM S;  3TWL A;  4JI7 M;  2F5N A;  4YHH M;  4GKK M;  4DUY M;  2F5S A;  1HR0 M;  3T1Y M;  3C58 A;  4JI5 M;  4KHP M;  4K0K M;  4DV6 M;  2UUA M;  1IBL M;  3U6S A;  1Z59 A;  1Z5A A;  2XZF A;  3GPX A;  2F5O A;  4NXM M;  2UUB M;  5ITY A;  4DV7 M;  4DV4 M;  4DR3 M;  4JI8 M;  3GQ4 A;  1HNZ M;  2XZU A;  2HKJ A;  5ITU A;  3T1H M;  1J5E M;  3J80 S;  1Q3B A;  4JI0 M;  4DR2 M;  1NNJ A;  1KFV A;  4JI1 M;  4LF5 M;  4DR7 M;  2OQ4 A;  4LFC M;  4PD2 A;  5IT9 S;  4LF4 M;  1IBM M;  3U6P A;  2F4V M;  3GO8 A;  3TWM A;  5A2Q S;  3VK8 A;  1L1Z A; 
#chains in the Genus database with same CATH topology
 4G4R A;  5BPV A;  3PNV A;  4L15 A;  3QYE A;  3FKE A;  4LFA M;  2FFJ A;  4HL4 A;  3LVV A;  3HHW A;  1EFU B;  4FCT A;  2QBY A;  3KDS E;  3WHK A;  3J7A S;  1D2N A;  3K8Z A;  4EIW A;  3FRH A;  1F4I A;  1D0L A;  2ZAM A;  4DBG B;  2UXD M;  3H4M A;  2DWL A;  2W82 A;  1ZQ9 A;  1SXJ C;  4GMQ A;  2UUC M;  1GO5 A;  1R5L A;  4G4N A;  3FUV A;  1XWI A;  2ZBK B;  3DZD A;  3FUU A;  5F3W A;  1TH4 A;  4R3D A;  1D0K A;  4IBG A;  2R18 A;  3SYK A;  2BJW A;  3FD9 A;  4ZPX A;  5FTL A;  2C96 A;  1IXZ A;  3T15 A;  2O25 A;  2KRK A;  3Q8G A;  1L2C A;  3I4Y A;  2APL A;  3IG5 A;  3ZQJ A;  1J09 A;  1IN8 A;  2VF7 A;  3Q8X A;  2JY7 A;  3B89 A;  3GPU A;  2H1R A;  3LCU A;  3EIH A;  1X37 A;  1IY1 A;  1JQJ C;  3VLF B;  4DV2 M;  3SC3 A;  5EXT A;  1I4W A;  4PCZ A;  2Z4R A;  1J7K A;  4QHT A;  3CTW B;  4ANR A;  4G4Q A;  1QDT A;  4LJ9 A;  1NV9 A;  5DFL A;  5ITX A;  1TDZ A;  4B08 A;  5L8R F;  2ZAO A;  1G4A E;  1XXH E;  2K0B X;  1N36 M;  1JR3 D;  2LTU A;  1DGH A;  1W5S A;  2EJS A;  3L2A A;  5EQT A;  3FTE A;  3AL0 C;  3GQ5 A;  2LVQ D;  1ZMV A;  2WSC F;  2XFS A;  4DUZ M;  1SXJ D;  1NSF A;  2JP7 A;  3AOG A;  3ILK A;  1PJS A;  1FJG M;  3KOZ E;  3W0F A;  1GLN A;  2L2D A;  4QNM A;  2MGW A;  1CUK A;  1V34 A;  1N34 M;  3E9S A;  4JI4 M;  3TL4 X;  4NXN M;  3SFZ A;  1I94 M;  1N75 A;  2HL7 A;  3HU1 A;  1IN7 A;  1V92 A;  1T3T A;  2DZL A;  1QUT A;  1OTR A;  4AKI A;  3HGI A;  1E32 A;  3L27 A;  3SAW A;  2XLJ A;  2VQF M;  5FLX S;  2YFQ A;  1NJG A;  3A45 A;  2F5P A;  2HHH M;  2FS1 A;  2J7O A;  4CGY B;  2HWJ A;  2MJ5 B;  3GRV A;  1R2Z A;  5EXS A;  4DR6 M;  4LRT A;  7CAT A;  1HNX M;  1LTM A;  4JI2 M;  3R9X B;  4DV0 M;  2UU9 M;  2LXE A;  4JI7 M;  1NO1 A;  4Z6Y A;  2VII A;  3E4R A;  3WHL A;  1TR8 A;  1XB2 B;  1GAB A;  4KLN A;  1L1Z A;  4XGI A;  4R7G A;  3VDP A;  1ZAE A;  1PGY A;  3TPZ A;  3D8L A;  4S12 A;  4JI5 M;  2DAE A;  4WW0 A;  4K0K M;  4DV6 M;  1XXH B;  4IBK A;  2JNH A;  3E21 A;  2WZJ A;  2B3T A;  2ZTC A;  1IXS A;  4FW9 A;  3U6S A;  3GLG A;  1NVM A;  2OO9 A;  1Z5A A;  2O5R A;  3B74 A;  4OU7 A;  1QAN A;  2UUB M;  4DR3 M;  4JI8 M;  4LJ5 A;  3GLH A;  2R65 A;  3MK6 A;  5FTJ A;  4M9X A;  3M7G A;  2JZ0 A;  2ZAN A;  3UMM A;  3C9P A;  3L28 A;  3J80 S;  1TF0 B;  5C18 A;  4JI0 M;  4Z8X A;  4DR2 M;  1MN3 A;  1NNJ A;  3FUX A;  4LFC M;  3QWL A;  1GL7 A;  3J27 B;  1QAQ A;  3K9O A;  1IBM M;  4IBB A;  3H4J A;  4KO8 A;  3U6P A;  3LMM A;  3LQQ A;  2DAI A;  1T43 A;  3KOW E;  3GO8 A;  4JYA M;  5A2Q S;  3VK8 A;  4M9Z A;  1XHB A;  2DAM A;  4B3M M;  4B3T M;  5ITT A;  1HT2 E;  3CF6 E;  2KEB A;  4MM3 B;  2CE7 A;  5DYG A;  2KNA A;  3DFZ A;  4HLQ A;  4AQY M;  3GLF A;  3U5Z A;  4L6V 6;  3B9P A;  4MH0 E;  2LVP C;  3BOS A;  3RE8 A;  2XFT A;  1G3I A;  3FUT A;  1EIJ A;  1IFY A;  1PJT A;  4NL4 H;  2KZU A;  2DAG A;  3L26 A;  3A46 A;  1D0M A;  4LGM A;  2JUJ A;  2RRU A;  4L4U A;  3ZC7 B;  5EJC A;  2DXI A;  2QNJ A;  5FSW A;  2DHY A;  4LRS A;  2BNK A;  3KXE C;  4GRI A;  3HY5 A;  2BJV A;  2KZS A;  3E46 A;  1PJI A;  2QPA A;  3TE6 A;  4G4O A;  3EIE A;  3HWS A;  4DR1 M;  4P16 A;  1C7Y A;  4TUW A;  2R0I A;  3I04 M;  4YY3 M;  1ZMW A;  2EUC A;  4WP2 A;  1OFH A;  5KPZ A;  1PM5 A;  1HQC A;  4D80 A;  4JI6 M;  1QAM A;  3NBX X;  3CF2 A;  3JR4 A;  1NY5 A;  1NY6 A;  1OAI A;  3AKZ A;  2R4E A;  2OPF A;  4JV5 M;  3VKG A;  2XH9 A;  2L7I A;  4LZZ A;  1DO2 A;  3RGP A;  2V1C A;  2Y21 A;  3OTO M;  1N77 A;  1R6B X;  2DHR A;  2I7P A;  4DR4 M;  2EA0 A;  2XGN A;  4LJA A;  4LY6 A;  3U6C A;  1L2D A;  3SAR A;  4B3R M;  1SXJ B;  3C3D A;  4NRW A;  3CGW A;  3HHY A;  4OX9 M;  4NSR A;  4LG2 A;  4I81 A;  2JY8 A;  4LF7 M;  1XNQ M;  2RKO A;  4L16 A;  4LJ8 A;  2CV1 A;  1YE9 A;  2K47 A;  2QSF X;  2WSE F;  4LCB A;  4NSO B;  4F2L A;  4BLC A;  1XMQ M;  1XNR M;  4MB7 A;  2OOA A;  2DI0 A;  2C98 A;  1VDD A;  2ZM6 M;  3KP1 E;  2F5Q A;  3RGS A;  3M6A A;  3C3E A;  4KT0 F;  5JI3 E;  2DEN A;  3FRI A;  4M0W A;  2KXE A;  2MR9 A;  4P17 A;  1NJF A;  1G71 A;  2LNH C;  4IIW A;  5JI2 E;  3GLI E;  1K82 A;  4BBA A;  3UZU A;  3U60 B;  1Z5B A;  4DV5 M;  1N33 M;  3J81 S;  3AJI B;  1Y8G A;  3MMP A;  2LVA A;  3CF0 A;  2HAK A;  3LW5 F;  4LGY A;  3HX3 A;  3SHG B;  4F1I A;  4GKK M;  2GNO A;  4GIT A;  1IXR C;  1WGN A;  2I7N A;  5C1B A;  2V1U A;  1TTE A;  4I4L A;  2DVW B;  4M0D A;  1XXH A;  1JB0 F;  4AW4 A;  2QBY B;  2N35 A;  2NQ8 C;  3KS8 A;  4KOD A;  5EP4 A;  4UN2 B;  3GPX A;  2XZF A;  3KP0 E;  2JY5 A;  3A98 B;  2EKF A;  3PXG A;  3PVS A;  1S3S A;  5ITY A;  4DV4 M;  4DV7 M;  4QOZ C;  4RKU F;  1HNZ M;  2CV2 A;  3GP1 A;  3HJQ A;  1E9S A;  1Z6T A;  1G8P A;  3I4V A;  3KW6 A;  5ITU A;  3T1H M;  2XZU A;  3KS4 A;  2CFO A;  1NHG C;  4DR7 M;  2D7G A;  4CJ6 A;  3R8F A;  2DWN A;  4LF4 M;  4IBC A;  3GLI B;  5IZ7 D;  3HHX A;  4A3V B;  3AV0 A;  3GRR A;  2LHC A;  2VF8 A;  5KO3 A;  2RGH A;  4JI3 M;  2MRO B;  3FYD A;  4FCV A;  4GHL A;  2KNV A;  4CHT B;  2J7N A;  3IEC A;  5BR8 M;  5FTM A;  5FTN A;  1PJJ A;  3FTF A;  3GPP A;  1IBK M;  4FWD A;  1R2Y A;  1OKS A;  2G5G X;  1PRB A;  2Y0T A;  2Z4S A;  3KOX E;  1IN6 A;  2ERC A;  3IG8 A;  4FD2 A;  3K1J A;  4LJ6 A;  5FTK A;  2CHQ A;  2V6Z M;  3VDU A;  1TH3 A;  2EKK A;  3NBI A;  4LJ4 A;  3RFW A;  2X49 A;  4IBE A;  3HU3 A;  5ITQ A;  4X66 M;  1N78 A;  2DWZ B;  4IBD A;  2L6O A;  3T38 A;  1TDH A;  2XEP A;  1Q39 A;  1FNN A;  1QAO A;  2Q2E B;  3SBJ A;  2OOB A;  1HNW M;  1IN5 A;  2M5Z A;  3SHF A;  4LF8 M;  1WIV A;  4OVZ A;  2C5R A;  4FVM A;  4JN6 A;  1QVR A;  2G3Q A;  3HJ8 A;  1AUA A;  3W68 A;  1NV8 A;  2X8A A;  2M60 A;  5E26 A;  3GRU A;  1JR3 E;  1MX0 A;  2CUZ A;  4GC9 A;  4XK8 F;  1BVS A;  2LWX A;  3M0E A;  2Y0Q A;  4REZ A;  4B7F A;  5LMU M;  1SXJ E;  4NC6 A;  3NWL A;  1OQY A;  1XC8 A;  2R6F A;  2AHM A;  1QZE A;  2CRU A;  2R4J A;  3U61 B;  1GJS A;  3V76 A;  1SG9 A;  4PDI A;  3DOA A;  2QCU A;  4QHS A;  4X65 M;  4D82 A;  1VG5 A;  4PDG A;  1IN4 A;  3KOY E;  2L4E A;  3MHV C;  4IBF A;  3A42 A;  1WR1 B;  2Z8Y M;  3SMS A;  3VK7 A;  4AKH A;  1PJQ A;  3GRY A;  1W5T A;  2R62 A;  2XSZ A;  3U6Q A;  3B7Z A;  1G59 A;  2CHG A;  2MH8 A;  4LF6 M;  2CV0 A;  3KFU G;  8CAT A;  1YSY A;  1A5T A;  1WXQ A;  2KHH A;  3I51 A;  1Z5C A;  1ORY B;  5DYI A;  4GHA A;  1OAO C;  2R44 A;  3UJN A;  2LVN C;  2UXB M;  1MU5 A;  1C1K A;  2KNZ A;  2KRU A;  3FTD A;  3U6D A;  2FOI C;  1VEJ A;  3GQ3 A;  3UK6 A;  2ZTD A;  1XMO M;  1K3X A;  2UXC M;  3JR5 A;  4B7H A;  4Q7J A;  3SAS A;  2L7H A;  4CIZ A;  2FE8 A;  1QQW A;  3JAM S;  3ZH9 B;  4AKG A;  1IQP A;  2G8L A;  1DGB A;  2JY6 B;  4YHH M;  4MGY E;  3PNY A;  4DUY M;  2Y20 A;  2F5S A;  3T1Y M;  3K92 A;  2X4A A;  1RU3 A;  3W0L B;  4WUR A;  2O01 F;  2CEA A;  4L8R C;  1OIZ A;  1IBL M;  3VKH A;  5KPT A;  2KW0 A;  2L4F A;  1Z59 A;  5DNY A;  2F5O A;  1UM8 A;  4XBO A;  3GLF B;  1GL6 A;  4GIP A;  3U5Z B;  1QDR A;  3GQ4 A;  5EXX A;  3W67 A;  1QUS A;  1T6O A;  1G41 A;  2HKJ A;  2DAK A;  4IJF A;  4JI1 M;  3AFH A;  2DZO B;  1KFV A;  4LF5 M;  4AG6 A;  2OQ4 A;  5GKN A;  1ZV1 A;  3J2P B;  2LHG A;  5IT9 S;  1V33 A;  1YLA A;  1VDL A;  2DNA A;  4RNA A;  4II7 A;  2C9C A;  2Z3X A;  3GLI A;  5KPR A;  1WGL A;  1IM2 A;  1IY2 A;  3TWM A;  1Q3C A;  3VFD A;  2H5X A;  4G6Z A;  3UGJ A;  4AI6 A;  4G3O A;  1K3W A;  1MJG M;  3LVW A;  1KYI A;  2YQZ A;  5ITX E;  2C99 A;  2DZN B;  4GEW A;  1L1T A;  4NOO B;  1OFI A;  4OW0 A;  5IWA M;  4X64 M;  4GC5 A;  5EP1 A;  4NRV A;  4W5W A;  1UFZ A;  2CP8 A;  1NHW C;  2KDL A;  2P5T A;  3L29 A;  4DV3 M;  2E5L M;  3AOE A;  4MGI E;  2LBC A;  3IHP A;  2DKL A;  2LVO C;  1ZMU A;  4AG5 A;  2J5Y A;  2KA6 B;  4GH9 A;  4RF0 A;  3K9P A;  3SAU A;  2K6B A;  4LZJ A;  3TQS A;  2GQF A;  3FE3 A;  2DWM A;  1E94 E;  3BBZ A;  3U6E A;  3HU2 A;  1HT1 E;  1N32 M;  3ZCB B;  2XSZ D;  3SYL A;  3U6O A;  2QEN A;  1GKI A;  4I8O A;  3SAV A;  3D8B A;  3HZJ A;  2YR0 A;  3HHZ A;  2JZ1 A;  4LFB M;  1WHC A;  2K9D A;  2WSF F;  3I01 M;  2D7H A;  2BWE A;  4DR5 M;  2RGO A;  1AIP C;  4RF1 A;  1DO0 A;  3U6M A;  1DGF A;  1E9R A;  3U61 A;  2FH0 A;  5H37 D;  5KQ8 A;  4B3S M;  3TWK A;  2QHO B;  3GPY A;  4FWH A;  4ITQ A;  4IJE A;  2VQE M;  1DGH B;  2JWS A;  3J7B A;  4LJ7 A;  1QZM A;  2YNM D;  4R71 A;  3B7Q A;  4X62 M;  4BB9 A;  3GLG E;  4MGK E;  2QZ4 A;  3FYC A;  1EE8 A;  3HKP A;  1TGU A;  2QP9 X;  3THG A;  4IBI A;  3GLH E;  4JXJ A;  4GKJ M;  2L09 A;  2A5Y B;  4B7G A;  1P3Q Q;  3SAT A;  4Y28 F;  1L2B A;  1NNU C;  1GVN A;  5EP2 A;  5LMN M;  2FNA A;  4MGH A;  2C9O A;  4LF9 M;  4M9S A;  1QYR A;  1DV0 A;  3KSX A;  3KVW A;  1H6U A;  1VEK A;  3AOE C;  3KSJ A;  4FWG A;  2XF3 A;  3QAU A;  2QQ8 A;  4QNR A;  1JR3 A;  5E6J A;  5EXP A;  4DV1 M;  3HJS A;  2BWB A;  2LH0 A;  1HQY E;  4CIS A;  3LQR A;  2JXN A;  2EO2 A;  5ITR A;  1SXJ A;  3U6L A;  2JA2 A;  1WJ7 A;  1GJT A;  3L25 A;  3TWL A;  3SMP A;  3QYB A;  1L8Q A;  2F5N A;  2R45 A;  3MJ5 A;  5KQD A;  1IY0 A;  3F92 A;  1VQ1 A;  1OIP A;  1HR0 M;  3DA1 A;  3C58 A;  3GLF E;  4D81 A;  4KHP M;  1KSF X;  1YUB A;  2UUA M;  1IXS B;  1DGG A;  3GLG B;  2R46 A;  3FUW A;  1LV7 A;  4NXM M;  1VEG A;  1OJL A;  4FCW A;  4AZF A;  1R4G A;  2Z7J A;  3GLH B;  2CWB A;  4L78 A;  4HEO A;  5EP3 A;  4PT5 A;  4MGZ E;  1J5E M;  3FTC A;  1Q3B A;  2HCB A;  2VDB B;  4IBJ A;  4QOS A;  1Q02 A;  2CHV A;  3U60 A;  3B7N A;  4PD2 A;  4I5S A;  2D7E A;  1TH2 A;  3BXW A;  4OVZ B;  3T6P A;  1HJP A;  2F4V M;  3K2L A;  3LCV B;  1R7R A;  5IRE B;  3PFI A; 
#chains in the Genus database with same CATH homology
 4G4R A;  5BPV A;  3PNV A;  4L15 A;  3FKE A;  4LFA M;  2FFJ A;  4HL4 A;  3LVV A;  3HHW A;  4FCT A;  2QBY A;  3KDS E;  3WHK A;  3J7A S;  1D2N A;  3K8Z A;  4EIW A;  2ZAM A;  2UXD M;  3H4M A;  2DWL A;  2W82 A;  1ZQ9 A;  1SXJ C;  4GMQ A;  2UUC M;  4G4N A;  3FUV A;  1XWI A;  2ZBK B;  3DZD A;  3FUU A;  5F3W A;  1TH4 A;  4R3D A;  4IBG A;  2R18 A;  3SYK A;  2BJW A;  3FD9 A;  4ZPX A;  5FTL A;  2C96 A;  1IXZ A;  3T15 A;  2KRK A;  1L2C A;  3I4Y A;  3IG5 A;  1J09 A;  1IN8 A;  3Q8X A;  3GPU A;  2H1R A;  3EIH A;  1X37 A;  1IY1 A;  1JQJ C;  3VLF B;  4DV2 M;  3SC3 A;  5EXT A;  1I4W A;  4PCZ A;  2Z4R A;  1J7K A;  4QHT A;  3CTW B;  4G4Q A;  4LJ9 A;  5ITX A;  1TDZ A;  4B08 A;  2ZAO A;  1G4A E;  1N36 M;  1JR3 D;  1DGH A;  1W5S A;  3L2A A;  5EQT A;  3FTE A;  3AL0 C;  3GQ5 A;  2XFS A;  4DUZ M;  1SXJ D;  1NSF A;  3AOG A;  3ILK A;  1FJG M;  3KOZ E;  3W0F A;  1GLN A;  4QNM A;  1N34 M;  3E9S A;  4JI4 M;  3TL4 X;  4NXN M;  3SFZ A;  1I94 M;  1N75 A;  2HL7 A;  3HU1 A;  1IN7 A;  1T3T A;  4AKI A;  3HGI A;  1E32 A;  3L27 A;  3SAW A;  2XLJ A;  2VQF M;  5FLX S;  2YFQ A;  1NJG A;  3A45 A;  2F5P A;  2HHH M;  2J7O A;  4CGY B;  3GRV A;  1R2Z A;  5EXS A;  4DR6 M;  4LRT A;  7CAT A;  1HNX M;  4JI2 M;  3R9X B;  4DV0 M;  2UU9 M;  2LXE A;  4JI7 M;  4Z6Y A;  2VII A;  3E4R A;  3WHL A;  4KLN A;  1L1Z A;  4XGI A;  4R7G A;  3VDP A;  1ZAE A;  3TPZ A;  3D8L A;  4S12 A;  4JI5 M;  4WW0 A;  4K0K M;  4DV6 M;  1XXH B;  4IBK A;  4FW9 A;  3U6S A;  3GLG A;  1NVM A;  1Z5A A;  2O5R A;  4OU7 A;  1QAN A;  2UUB M;  4DR3 M;  4JI8 M;  4LJ5 A;  3GLH A;  2R65 A;  3MK6 A;  5FTJ A;  4M9X A;  3M7G A;  3UMM A;  2ZAN A;  3J80 S;  3L28 A;  5C18 A;  4JI0 M;  4Z8X A;  4DR2 M;  1NNJ A;  3FUX A;  4LFC M;  3QWL A;  1GL7 A;  3J27 B;  1QAQ A;  1IBM M;  4IBB A;  4KO8 A;  3U6P A;  3LMM A;  3LQQ A;  3KOW E;  3GO8 A;  4JYA M;  5A2Q S;  3VK8 A;  4M9Z A;  1XHB A;  4B3M M;  4B3T M;  5ITT A;  1HT2 E;  3CF6 E;  2KEB A;  4MM3 B;  2CE7 A;  5DYG A;  3DFZ A;  4HLQ A;  4AQY M;  3GLF A;  3U5Z A;  3B9P A;  4MH0 E;  3BOS A;  3RE8 A;  2XFT A;  1G3I A;  3FUT A;  4NL4 H;  2KZU A;  3L26 A;  3A46 A;  2DXI A;  4LGM A;  4L4U A;  3ZC7 B;  5EJC A;  5FSW A;  4LRS A;  2BNK A;  3KXE C;  4GRI A;  2BJV A;  2KZS A;  1PJI A;  2QPA A;  3TE6 A;  4G4O A;  3EIE A;  3HWS A;  4DR1 M;  4P16 A;  4TUW A;  4YY3 M;  2EUC A;  5KPZ A;  1OFH A;  1PM5 A;  1HQC A;  4D80 A;  4JI6 M;  1QAM A;  3JR4 A;  3CF2 A;  1NY5 A;  1NY6 A;  3AKZ A;  2OPF A;  2R4E A;  4JV5 M;  3VKG A;  2XH9 A;  2L7I A;  4LZZ A;  1DO2 A;  3RGP A;  2V1C A;  2Y21 A;  3OTO M;  1N77 A;  1R6B X;  2DHR A;  2I7P A;  4DR4 M;  2EA0 A;  2XGN A;  4LJA A;  4LY6 A;  3U6C A;  1L2D A;  3SAR A;  4B3R M;  1SXJ B;  4NRW A;  4OX9 M;  3HHY A;  4NSR A;  4LG2 A;  4I81 A;  4LF7 M;  1XNQ M;  2RKO A;  4L16 A;  4LJ8 A;  2CV1 A;  1YE9 A;  2K47 A;  4LCB A;  4NSO B;  4BLC A;  1XMQ M;  1XNR M;  4MB7 A;  2C98 A;  1VDD A;  2ZM6 M;  3KP1 E;  2F5Q A;  3RGS A;  3M6A A;  5JI3 E;  4M0W A;  2KXE A;  1NJF A;  4IIW A;  2LNH C;  5JI2 E;  1K82 A;  4BBA A;  3UZU A;  3U60 B;  1Z5B A;  4DV5 M;  1N33 M;  3J81 S;  3AJI B;  3CF0 A;  4LGY A;  3SHG B;  4GKK M;  4GIT A;  1IXR C;  2I7N A;  5C1B A;  2V1U A;  4I4L A;  2DVW B;  4M0D A;  1XXH A;  4AW4 A;  2QBY B;  2NQ8 C;  3KS8 A;  4KOD A;  5EP4 A;  2XZF A;  3GPX A;  3KP0 E;  3A98 B;  3PXG A;  3PVS A;  1S3S A;  5ITY A;  4DV4 M;  4DV7 M;  4QOZ C;  1HNZ M;  2CV2 A;  3HJQ A;  1E9S A;  1Z6T A;  1G8P A;  3I4V A;  3KW6 A;  5ITU A;  3T1H M;  2XZU A;  3KS4 A;  2CFO A;  1NHG C;  4DR7 M;  2D7G A;  3R8F A;  2DWN A;  4LF4 M;  4IBC A;  3GLI B;  5IZ7 D;  3HHX A;  4A3V B;  3AV0 A;  3GRR A;  5KO3 A;  2RGH A;  4JI3 M;  3FYD A;  4FCV A;  4GHL A;  4CHT B;  2J7N A;  5BR8 M;  5FTM A;  5FTN A;  1PJJ A;  3FTF A;  3GPP A;  1IBK M;  4FWD A;  1R2Y A;  2G5G X;  2Y0T A;  2Z4S A;  3KOX E;  4FD2 A;  1IN6 A;  2ERC A;  3IG8 A;  4LJ6 A;  3K1J A;  5FTK A;  3GP1 A;  2CHQ A;  2V6Z M;  3VDU A;  1TH3 A;  3NBI A;  4LJ4 A;  3RFW A;  2X49 A;  4IBE A;  3HU3 A;  5ITQ A;  4X66 M;  1N78 A;  2DWZ B;  4IBD A;  2L6O A;  3T38 A;  1TDH A;  2XEP A;  1Q39 A;  1FNN A;  1QAO A;  2Q2E B;  3SBJ A;  1HNW M;  1IN5 A;  2M5Z A;  3SHF A;  4LF8 M;  4OVZ A;  2C5R A;  4FVM A;  4JN6 A;  1QVR A;  3HJ8 A;  2X8A A;  2M60 A;  5E26 A;  3GRU A;  1MX0 A;  2CUZ A;  4GC9 A;  4B7F A;  2LWX A;  4REZ A;  3M0E A;  2Y0Q A;  5LMU M;  1SXJ E;  3NWL A;  1XC8 A;  2AHM A;  2R4J A;  3U61 B;  4PDI A;  3DOA A;  2QCU A;  4QHS A;  4X65 M;  4D82 A;  4PDG A;  1IN4 A;  3KOY E;  3MHV C;  4IBF A;  3A42 A;  3SMS A;  3VK7 A;  4AKH A;  3GRY A;  1W5T A;  2R62 A;  2XSZ A;  3U6Q A;  1G59 A;  2CHG A;  4LF6 M;  2CV0 A;  3KFU G;  8CAT A;  1YSY A;  1WXQ A;  3I51 A;  1Z5C A;  1ORY B;  5DYI A;  4GHA A;  3UJN A;  2UXB M;  1MU5 A;  1C1K A;  2KRU A;  3FTD A;  3U6D A;  2FOI C;  3GQ3 A;  1XMO M;  3UK6 A;  1K3X A;  2UXC M;  3JR5 A;  4B7H A;  3SAS A;  2L7H A;  2FE8 A;  1QQW A;  3JAM S;  3ZH9 B;  4AKG A;  1IQP A;  2G8L A;  1DGB A;  4YHH M;  4MGY E;  3PNY A;  4DUY M;  2Y20 A;  2F5S A;  3T1Y M;  3K92 A;  2X4A A;  3W0L B;  4WUR A;  2CEA A;  4L8R C;  1IBL M;  3VKH A;  5KPT A;  2KW0 A;  1Z59 A;  5DNY A;  2F5O A;  1UM8 A;  4XBO A;  3GLF B;  1GL6 A;  4GIP A;  3U5Z B;  3GQ4 A;  5EXX A;  1G41 A;  2HKJ A;  4IJF A;  4JI1 M;  3AFH A;  2DZO B;  1KFV A;  4LF5 M;  4AG6 A;  2OQ4 A;  5GKN A;  3J2P B;  5IT9 S;  4RNA A;  4II7 A;  2C9C A;  2Z3X A;  3GLI A;  5KPR A;  1IM2 A;  1IY2 A;  3TWM A;  1Q3C A;  3VFD A;  4G6Z A;  3UGJ A;  4AI6 A;  1K3W A;  3LVW A;  1KYI A;  2YQZ A;  5ITX E;  2C99 A;  2DZN B;  1L1T A;  4NOO B;  1OFI A;  4OW0 A;  5IWA M;  4X64 M;  4GC5 A;  5EP1 A;  4NRV A;  4W5W A;  1NHW C;  2P5T A;  3L29 A;  4DV3 M;  2E5L M;  3AOE A;  4MGI E;  4AG5 A;  2KA6 B;  4GH9 A;  4RF0 A;  3SAU A;  4LZJ A;  3TQS A;  2DWM A;  1E94 E;  3U6E A;  3HU2 A;  1HT1 E;  1N32 M;  3ZCB B;  2XSZ D;  3SYL A;  3U6O A;  2QEN A;  1GKI A;  4I8O A;  3SAV A;  3D8B A;  2YR0 A;  3HHZ A;  4LFB M;  2D7H A;  4DR5 M;  2RGO A;  4RF1 A;  1DO0 A;  3U6M A;  1DGF A;  1E9R A;  3U61 A;  5H37 D;  5KQ8 A;  4B3S M;  3TWK A;  3GPY A;  4FWH A;  4ITQ A;  4IJE A;  2VQE M;  1DGH B;  4LJ7 A;  3J7B A;  1QZM A;  2YNM D;  4X62 M;  4BB9 A;  4MGK E;  2QZ4 A;  3FYC A;  1EE8 A;  3HKP A;  1TGU A;  2QP9 X;  3THG A;  4IBI A;  4JXJ A;  4GKJ M;  2L09 A;  2A5Y B;  4B7G A;  3SAT A;  1L2B A;  1NNU C;  1GVN A;  5EP2 A;  5LMN M;  2FNA A;  4MGH A;  2C9O A;  4LF9 M;  4M9S A;  1QYR A;  3KSX A;  3KVW A;  1H6U A;  3AOE C;  3KSJ A;  4FWG A;  2XF3 A;  3QAU A;  4QNR A;  5EXP A;  1JR3 A;  5E6J A;  4DV1 M;  3HJS A;  2LH0 A;  4CIS A;  1HQY E;  3LQR A;  2EO2 A;  5ITR A;  1SXJ A;  3U6L A;  2JA2 A;  3L25 A;  3TWL A;  3SMP A;  2F5N A;  1L8Q A;  2R45 A;  3MJ5 A;  5KQD A;  1IY0 A;  1HR0 M;  3DA1 A;  3C58 A;  4D81 A;  4KHP M;  1KSF X;  1YUB A;  2UUA M;  1IXS B;  1DGG A;  3GLG B;  2R46 A;  3FUW A;  1LV7 A;  4NXM M;  1OJL A;  4FCW A;  4AZF A;  2Z7J A;  3GLH B;  4L78 A;  5EP3 A;  4PT5 A;  4MGZ E;  1J5E M;  3FTC A;  1Q3B A;  2HCB A;  4QOS A;  4IBJ A;  2CHV A;  3U60 A;  4PD2 A;  4I5S A;  2D7E A;  1TH2 A;  4OVZ B;  2F4V M;  3K2L A;  1R7R A;  5IRE B;  3PFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...