2HL7A

Crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
GSHMAIDTYEFASDAERERFRNLTQELRCPKCQNQDIADSNAPIAADLRKQIYGQLQQGKSDGEIVDYMVARYGDFVRYKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome C-type biogenesis protein CcmH
publication title A strategic protein in cytochrome c maturation: three-dimensional structure of CcmH and binding to apocytochrome c
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 29
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.640 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2hl7A00
2HL7A 2KW0A
chains in the Genus database with same CATH superfamily
3JR5A 4P17A 1GKIA 5FTMA 3MJ5A 2VF8A 3SBJA 3THGA 1D0LA 2DWMA 2VQFM 2UU9M 2I7PA 4S12A 4AI6A 1OKSA 3HZJA 1V34A 1NNUC 3GLFA 2I7NA 1ZMVA 4G6ZA 2FNAA 1TDHA 3GQ5A 3J81S 1ORYB 3VK7A 1LV7A 4M9ZA 5EQTA 3U6CA 5F3WA 2RGHA 4G4OA 2KRKA 2LBCA 2MH8A 3HHXA 1NSFA 3J7AS 1IFYA 2FH0A 1Q3BA 3RGPA 5IREB 2DNAA 2K6BA 3IG8A 2YR0A 4PDGA 2ZTDA 1NJGA 3W0FA 2V1UA 3PXGA 3J27B 4B7GA 1HQCA 1GJTA 3M6AA 3I04M 1YSYA 3R9XB 4F2LA 3SASA 3SAUA 4DUYM 1J7KA 2JWSA 4B08A 4IBIA 4LJ4A 3U61B 1Z5CA 2R18A 3PFIA 3Q8GA 4R3DA 4X66M 4LF5M 1XMQM 4DR7M 1KFVA 1L1ZA 1E32A 2R45A 2EKKA 2NQ8C 2C9CA 2L7HA 4Z8XA 4AG5A 2QNJA 3A98B 3UJNA 3KP1E 5ITUA 2JA2A 1Z59A 4LF8M 1VDLA 3FUXA 1QAOA 2QBYB 2R46A 3E46A 4DV5M 1TR8A 1W5TA 2DAIA 4OVZB 4IBCA 3GPXA 2VQEM 1MX0A 2JNHA 3FUUA 4YHHM 2HL7A 4BBAA 3UMMA 3T1YM 3B7QA 5EXPA 1DGBA 4NL4H 4X65M 5ITQA 2F5NA 3I01M 1R5LA 2YQZA 3K1JA 4Y28F 1DGFA 3GO8A 2D7HA 4HEOA 2DI0A 3C9PA 1Q3CA 3TPZA 4B3TM 1VEJA 1MJGM 5DYGA 4NSRA 2X4AA 3B89A 3TQSA 1L2BA 1KSFX 3MK6A 4HL4A 2LHGA 2F5PA 1FJGM 2CFOA 4QHTA 5KPZA 4WP2A 1NV8A 3U5ZA 2BNKA 5H37D 1NVMA 1DGHB 1VEGA 4L4UA 4CHTB 3FTEA 5DFLA 3SATA 1IY1A 1TH4A 1Z5BA 3CF6E 1GLNA 4DV2M 1N78A 4FCWA 4LJ5A 1WIVA 4LF7M 2JP7A 2VF7A 3U6PA 3U60A 4MH0E 1BVSA 3U6QA 4G4NA 4JI8M 4IBEA 4DR1M 1JR3D 3F92A 2KNZA 2UUCM 4D80A 1F4IA 2RKOA 3K9OA 4GHLA 2JY8A 2LXEA 1VDDA 3VDPA 5ITRA 1SXJD 3L26A 4LJ9A 5IWAM 1PM5A 4F1IA 2FE8A 4QNRA 2MGWA 3GP1A 1N32M 3FUVA 1R2ZA 4NXMM 1HNXM 3HU1A 2B3TA 1PJJA 3LMMA 3WHLA 4DV3M 4CJ6A 1FNNA 1I4WA 3B7NA 2C99A 2YNMD 5FTKA 1K82A 4K0KM 2XFSA 4JI3M 1PRBA 1IXZA 1NHGC 3PVSA 3KFUG 2DAMA 2XSZD 3GLHA 4YY3M 1N75A 2R62A 4JI2M 3TWKA 2XSZA 3GLIB 1K3WA 3GPYA 4FCTA 4ANRA 4FWHA 1OAOC 4AW4A 2OQ4A 2JZ0A 1HQYE 2JZ1A 4NRVA 4CISA 4TUWA 1E9SA 1L8QA 2LTUA 2ZANA 3AOEC 3K2LA 1XB2B 2L4FA 4MGKE 3TE6A 1A5TA 4BLCA 3ZQJA 2DVWB 2K47A 2MR9A 2QP9X 3C3EA 4MGZE 4DR4M 2K9DA 3BBZA 4XGIA 4DR5M 3U61A 1S3SA 2Z4SA 5EJCA 4XBOA 2DZOB 1DGGA 1AUAA 3HU3A 5KPRA 2G5GX 4GKKM 2JUJA 2OO9A 1XHBA 2J5YA 2Z7JA 4M0WA 3PNVA 3SAWA 1L2CA 5LMUM 1IN7A 1EE8A 4UN2B 3K8ZA 1G4AE 4R71A 1WGLA 1GVNA 1W5SA 2ZBKB 1XXHB 4RF1A 1N77A 2QBYA 4OVZA 1ZV1A 4JN6A 3CF0A 3HKPA 3GLHB 4GKJM 5GKNA 1JB0F 1OIZA 4R7GA 4PDIA 1PJSA 2UXBM 2K0BX 2HCBA 2LVPC 3FRHA 2DAKA 2CV2A 3KOWE 4DUZM 3SYLA 2HAKA 4D81A 2HKJA 1GL7A 2R6FA 3KSXA 4P16A 4MGHA 5EP1A 4IBFA 1T3TA 1QVRA 2KXEA 1WGNA 3K92A 3KW6A 3J80S 4LJ6A 3KS4A 5JI3E 5ITXE 2LVQD 2XGNA 1UFZA 2GQFA 3W0LB 5KO3A 4I8OA 4QOZC 3LQQA 2Z8YM 1TH2A 3M0EA 3MHVC 5C18A 4KHPM 3KXEC 5BR8M 2ZTCA 1N34M 4NC6A 4IBBA 1JR3E 4OW0A 1C1KA 1QANA 1V33A 3K9PA 3SMSA 4RF0A 1YLAA 2YFQA 1DGHA 4Z6YA 4B3RM 5EXXA 4GC5A 3DZDA 3AKZA 3FRIA 1SXJE 4JV5M 3LCVB 3VKGA 4GMQA 1CUKA 4JI4M 2HWJA 2DAGA 2ZAMA 5FTLA 1QQWA 2L4EA 2DWZB 1PGYA 2CP8A 2KDLA 2OOBA 4QNMA 1TF0B 2UUAM 2V6ZM 3I4YA 4DR6M 2F5OA 4B7HA 2XLJA 4II7A 4BB9A 2CV1A 4LG2A 4W5WA 1HT1E 1DV0A 1IXRC 3U6MA 3R8FA 1XC8A 1IY0A 1IXSA 1WJ7A 4LGMA 2QZ4A 1TTEA 3IECA 4MB7A 5ITYA 1EIJA 1N33M 4RKUF 1QAQA 2EKFA 4CIZA 3W68A 3HX3A 2M60A 1NNJA 5EP3A 5ITTA 2O25A 4FVMA 4NOOB 3TL4X 1SG9A 2MROB 3D8LA 3JAMS 4GC9A 4AKHA 2L7IA 4LJAA 2FOIC 3NWLA 1G59A 3LVWA 1OTRA 3KS8A 3FTCA 2QSFX 1YUBA 3GLIA 3U6SA 1XNQM 2KNAA 5KPTA 1ZQ9A 3IHPA 3NBIA 3ZC7B 3ZH9B 4GRIA 4LJ7A 2VIIA 4XK8F 2DENA 2WSFF 3A42A 3SHFA 1QYRA 2FS1A 4OU7A 2KHHA 2LVNC 3GRUA 3V76A 2DAEA 3WHKA 5C1BA 3GLFE 5FLXS 1NHWC 3H4MA 3Q8XA 3B74A 3L29A 3GPPA 2LNHC 3L27A 2CV0A 2F5QA 1R2YA 5IT9S 3FE3A 2DWNA 2XEPA 2CHGA 4G3OA 2XH9A 3U6OA 4B3SM 1VG5A 3M7GA 1HNZM 3W67A 1PJIA 2RRUA 4DV7M 3T6PA 1IXSB 2OPFA 2KA6B 1D0KA 2Z4RA 3AL0C 3QWLA 1IN6A 1QZMA 4IJEA 1KYIA 2XF3A 3HHZA 4KT0F 2E5LM 4AG6A 2P5TA 3DA1A 2G8LA 1G71A 2BJWA 3RFWA 3GLGB 1XXHA 4DV6M 1ZAEA 2CRUA 1NY6A 2DXIA 3VK8A 2UXDM 1RU3A 2O5RA 2XZUA 4DR3M 1IN5A 2ZAOA 1QDRA 3FUTA 4NSOB 1QDTA 1MN3A 2L09A 4IJFA 1T6OA 4IBJA 2OOAA 1NO1A 2J7OA 4JI0M 2X49A 2CEAA 1HNWM 1IBLM 3A45A 4NXNM 3FUWA 1Y8GA 4LRSA 4IBDA 3HGIA 2WSEF 2ERCA 3LW5F 1R7RA 2DWLA 4GHAA 3E4RA 3E21A 3TWLA 1K3XA 5LMNM 1T43A 2KNVA 1UM8A 1IBMM 4I81A 1C7YA 3EIEA 2DHRA 1HJPA 4JYAM 5EP4A 2CHVA 3A46A 4IBKA 4MGYE 5IZ7D 2FFJA 2W82A 4M9XA 4WW0A 2LH0A 3E9SA 7CATA 2BWBA 3D8BA 4DV0M 2R65A 1Q39A 1N36M 1QUTA 2ZM6M 3KDSE 5DNYA 2HHHM 4G4RA 2UXCM 3HJSA 4I4LA 3KOYE 5DYIA 5FTNA 3IG5A 4M0DA 4L15A 3UK6A 2Y20A 3C3DA 3B7ZA 3UZUA 5A2QS 4DR2M 4GIPA 4FCVA 4FWDA 1WR1B 2CUZA 1SXJC 3SC3A 4MGIE 3GLIE 1PJQA 2MJ5B 3HHYA 1E94E 3GQ4A 2KZUA 2J7NA 2N35A 2LVAA 1L2DA 3QYEA 2BWEA 5JI2E 3U6EA 4L6V6 1P3QQ 2APLA 3DOAA 2KEBA 2C9OA 4EIWA 1TH3A 3HU2A 4GH9A 3QAUA 4G4QA 4KODA 1PJTA 1G3IA 1LTMA 4M9SA 3HWSA 1D2NA 1IBKM 3MMPA 3UGJA 3TWMA 4NRWA 1G41A 2M5ZA 4AKGA 1ZMWA 3J7BA 3GRVA 3HY5A 3SMPA 3VLFB 1HT2E 3H4JA 3RGSA 2LWXA 3NBXX 4AKIA 2DKLA 3J2PB 3T38A 4PD2A 1DO0A 1XXHE 2H1RA 3ZCBB 1JQJC 3GPUA 1Z5AA 2QENA 3QYBA 5KQDA 4GITA 3GLHE 1NJFA 2C5RA 4LF9M 1YE9A 1TGUA 2CWBA 4IIWA 3AJIB 3GRRA 1WXQA 5FTJA 3B9PA 4LZZA 3CF2A 4JI5M 2A5YB 2L2DA 2QPAA 4LZJA 3T1HM 4FD2A 3SHGB 1XMOM 2F4VM 2H5XA 4KLNA 3L25A 8CATA 2LHCA 1IM2A 4JI7M 2R4EA 2D7EA 3U6DA 3C58A 3LCUA 4JXJA 4LGYA 4B3MM 4LJ8A 3GLGA 5BPVA 2QQ8A 1IN4A 2UUBM 3L2AA 3GLFB 3FTDA 1GL6A 3FKEA 4WURA 3KVWA 3EIHA 1GABA 3KOXE 4GEWA 3AFHA 3SARA 5EXSA 2CE7A 4RNAA 2R0IA 3FD9A 5E26A 3ILKA 3SAVA 3RE8A 1XWIA 2KW0A 1OFHA 1HR0M 2G3QA 2Q2EB 3DFZA 1L1TA 1QUSA 2QHOB 2F5SA 4AQYM 3HJ8A 4Q7JA 2C98A 2X8AA 3AV0A 2VDBB 3AOEA 4B7FA 1R6BX 1X37A 3SFZA 1NY5A 1DO2A 4KO8A 2Z3XA 3T15A 4JI6M 2XFTA 2O01F 1TDZA 4PCZA 4LY6A 5L8RF 4QOSA 4I5SA 3HHWA 2EUCA 4LFAM 1H6UA 5ITXA 4LCBA 4L78A 1OJLA 4LRTA 4REZA 2EJSA 1IY2A 1AIPC 4CGYB 2XZFA 4PT5A 2Y0TA 4L16A 2L6OA 2KZSA 1JR3A 3OTOM 4A3VB 1NV9A 5FSWA 2LVOC 5KQ8A 2BJVA 3VKHA 2DHYA 4FWGA 5EXTA 3CTWB 2D7GA 4LF6M 1SXJA 3LVVA 3JR4A 2QCUA 2EO2A 2R4JA 3KSJA 1OQYA 1IQPA 1EFUB 1VQ1A 2JY7A 4DBGB 4LFCM 1Q02A 2CHQA 1D0MA 4OX9M 1I94M 2V1CA 2WSCF 4JI1M 4LFBM 2RGOA 1E9RA 3GRYA 4ITQA 3PNYA 3I51A 3SYKA 4D82A 2KRUA 5EP2A 1Z6TA 1J5EM 3U5ZB 3HJQA 4QHSA 1OAIA 1GO5A 4X62M 4DV1M 1QAMA 1GJSA 1XNRM 1V92A 1J09A 1QZEA 3VDUA 1VEKA 2DZNB 2C96A 4IBGA 3GLGE 3LQRA 1WHCA 4FW9A 2JY6B 3BXWA 3I4VA 4ZPXA 3L28A 2EA0A 3U60B 4L8RC 2Y0QA 2GNOA 4HLQA 2AHMA 3U6LA 2DZLA 1R4GA 4AZFA 4X64M 5E6JA 2R44A 3CGWA 4MM3B 2WZJA 3KOZE 1OIPA 3FYDA 3VFDA 1G8PA 4DV4M 3BOSA 3FYCA 1ZMUA 2JXNA 3AOGA 1OFIA 2JY5A 2Y21A 3GQ3A 4LF4M 3KP0E 1SXJB 3FTFA 1IN8A 1MU5A
chains in the Genus database with same CATH topology
3JR5A 1GKIA 5FTMA 3MJ5A 3SBJA 3THGA 2DWMA 2UU9M 2VQFM 2I7PA 4S12A 4AI6A 1NNUC 3GLFA 2I7NA 4G6ZA 2FNAA 1TDHA 3GQ5A 3J81S 1ORYB 3VK7A 1LV7A 4M9ZA 5EQTA 3U6CA 5F3WA 2RGHA 4G4OA 2KRKA 3HHXA 1NSFA 3J7AS 1Q3BA 3RGPA 5IREB 4PDGA 2V1UA 3IG8A 2YR0A 1NJGA 3W0FA 3PXGA 3J27B 4B7GA 1HQCA 3M6AA 1YSYA 3R9XB 3SASA 3SAUA 4DUYM 1J7KA 4B08A 4IBIA 4LJ4A 3U61B 1Z5CA 2R18A 3PFIA 4R3DA 4X66M 4LF5M 1XMQM 4DR7M 1KFVA 1L1ZA 1E32A 2R45A 2NQ8C 2C9CA 2L7HA 4Z8XA 4AG5A 3A98B 3UJNA 3KP1E 5ITUA 2JA2A 1Z59A 4LF8M 3FUXA 1QAOA 2QBYB 2R46A 4DV5M 1W5TA 4OVZB 4IBCA 3GPXA 2VQEM 1MX0A 4YHHM 3FUUA 3T1YM 2HL7A 4BBAA 3UMMA 5EXPA 1DGBA 4NL4H 4X65M 5ITQA 2F5NA 2YQZA 3K1JA 1DGFA 3GO8A 2D7HA 1Q3CA 3TPZA 4B3TM 5DYGA 4NSRA 2X4AA 1L2BA 3TQSA 1KSFX 3MK6A 4HL4A 2F5PA 2CFOA 4QHTA 5KPZA 3U5ZA 2BNKA 5H37D 1NVMA 1DGHB 4L4UA 4CHTB 3FTEA 3SATA 1IY1A 1TH4A 1Z5BA 3CF6E 1GLNA 4DV2M 1N78A 4FCWA 4LJ5A 4LF7M 3U6PA 3U60A 4MH0E 3U6QA 4JI8M 4G4NA 4IBEA 4DR1M 1JR3D 2UUCM 4D80A 2RKOA 4GHLA 2LXEA 1VDDA 3VDPA 5ITRA 1SXJD 3L26A 4LJ9A 5IWAM 1PM5A 2FE8A 4QNRA 3GP1A 1N32M 3FUVA 1R2ZA 4NXMM 1HNXM 3HU1A 1PJJA 3LMMA 3WHLA 4DV3M 1FNNA 1I4WA 2C99A 2YNMD 5FTKA 1K82A 4K0KM 2XFSA 4JI3M 1IXZA 1NHGC 3PVSA 3KFUG 2XSZD 3GLHA 4YY3M 1N75A 2R62A 4JI2M 3TWKA 2XSZA 3GLIB 1K3WA 3GPYA 4FCTA 4FWHA 4AW4A 2OQ4A 1HQYE 4NRVA 4CISA 4TUWA 1E9SA 1L8QA 2ZANA 3AOEC 3K2LA 4MGKE 3TE6A 4BLCA 2DVWB 2K47A 4MGZE 2QP9X 4DR4M 4XGIA 4DR5M 3U61A 1S3SA 2Z4SA 5EJCA 4XBOA 2DZOB 1DGGA 5KPRA 3HU3A 2G5GX 4GKKM 1XHBA 2Z7JA 4M0WA 1L2CA 3PNVA 3SAWA 5LMUM 1IN7A 1EE8A 5KPTA 3K8ZA 1G4AE 1N77A 2QBYA 1GVNA 1W5SA 2ZBKB 1XXHB 4RF1A 4OVZA 4JN6A 3CF0A 3HKPA 3GLHB 4GKJM 5GKNA 4PDIA 4R7GA 2UXBM 2HCBA 2CV2A 3KOWE 4DUZM 3SYLA 4D81A 2HKJA 1GL7A 3KSXA 4P16A 4MGHA 5EP1A 4IBFA 1T3TA 1QVRA 2KXEA 3K92A 3KW6A 3J80S 5JI3E 4LJ6A 3KS4A 5ITXE 2XGNA 5KO3A 3W0LB 4I8OA 4QOZC 3LQQA 3MHVC 1TH2A 3M0EA 5C18A 4KHPM 3KXEC 5BR8M 1N34M 4IBBA 4OW0A 1C1KA 1QANA 3SMSA 4Z6YA 4RF0A 2YFQA 1DGHA 4B3RM 5EXXA 4GC5A 3DZDA 3AKZA 1SXJE 4JV5M 3VKGA 4GMQA 4JI4M 2ZAMA 5FTLA 1QQWA 2DWZB 4QNMA 2UUAM 2V6ZM 3I4YA 4DR6M 2F5OA 4B7HA 2XLJA 4II7A 4BB9A 2CV1A 4LG2A 4W5WA 1HT1E 1IXRC 3U6MA 3R8FA 1XC8A 1IY0A 4LGMA 2QZ4A 4MB7A 5ITYA 1N33M 1QAQA 2M60A 1NNJA 5EP3A 5ITTA 4FVMA 4NOOB 3TL4X 3D8LA 3JAMS 4GC9A 4AKHA 2L7IA 4LJAA 2FOIC 3NWLA 1G59A 3LVWA 3KS8A 3FTCA 1YUBA 3GLIA 3U6SA 1XNQM 1ZQ9A 3ZC7B 3NBIA 3ZH9B 4GRIA 4LJ7A 2VIIA 3A42A 3SHFA 1QYRA 4OU7A 3GRUA 3WHKA 5C1BA 5FLXS 1NHWC 3H4MA 3Q8XA 3L29A 3GPPA 2LNHC 3L27A 2CV0A 2F5QA 1R2YA 5IT9S 2DWNA 2XEPA 2CHGA 3U6OA 2XH9A 4B3SM 1HNZM 3M7GA 1PJIA 4DV7M 1IXSB 2OPFA 2KA6B 2Z4RA 3AL0C 3QWLA 1IN6A 1QZMA 4IJEA 1KYIA 2XF3A 3HHZA 2E5LM 4AG6A 2P5TA 3DA1A 2G8LA 2BJWA 3RFWA 3GLGB 4DV6M 1XXHA 1ZAEA 1NY6A 2DXIA 3VK8A 2UXDM 2O5RA 2XZUA 4DR3M 1IN5A 2ZAOA 3FUTA 4NSOB 4IJFA 2L09A 4IBJA 2J7OA 4JI0M 2X49A 2CEAA 1HNWM 1IBLM 3A45A 4NXNM 3FUWA 4LRSA 4IBDA 3HGIA 2ERCA 1R7RA 2DWLA 4GHAA 3E4RA 1IBMM 3TWLA 1K3XA 5LMNM 1UM8A 4I81A 3EIEA 2DHRA 4JYAM 5EP4A 2CHVA 3A46A 4IBKA 4MGYE 5IZ7D 2FFJA 2W82A 4M9XA 4WW0A 2LH0A 3E9SA 7CATA 3D8BA 4DV0M 1N36M 2R65A 1Q39A 2HHHM 1FJGM 2ZM6M 3KDSE 5DNYA 4G4RA 2UXCM 3HJSA 4I4LA 3KOYE 5DYIA 5FTNA 3IG5A 4M0DA 4L15A 3UK6A 2Y20A 5A2QS 3UZUA 4DR2M 4GIPA 4FCVA 4FWDA 2CUZA 1SXJC 3SC3A 4MGIE 3HHYA 1E94E 3GQ4A 2KZUA 2J7NA 1L2DA 3U6EA 5JI2E 3DOAA 2KEBA 2C9OA 4EIWA 1TH3A 3HU2A 4GH9A 3QAUA 4G4QA 4KODA 1G3IA 4M9SA 3HWSA 1D2NA 1IBKM 3UGJA 3TWMA 4NRWA 1G41A 2M5ZA 4AKGA 3J7BA 3GRVA 3SMPA 3VLFB 1HT2E 3RGSA 4AKIA 2LWXA 3J2PB 3T38A 4PD2A 1DO0A 2H1RA 3ZCBB 1JQJC 3GPUA 1Z5AA 2QENA 5KQDA 4GITA 1NJFA 2C5RA 4LF9M 1YE9A 1TGUA 4IIWA 3AJIB 3GRRA 1WXQA 5FTJA 3B9PA 4LZZA 3CF2A 4JI5M 2A5YB 2QPAA 4LZJA 3T1HM 4FD2A 3SHGB 1XMOM 2F4VM 4KLNA 3L25A 8CATA 1IM2A 4JI7M 2R4EA 2D7EA 3U6DA 3C58A 4JXJA 4LGYA 4B3MM 4LJ8A 3GLGA 5BPVA 1IN4A 2UUBM 3L2AA 3GLFB 3FTDA 1GL6A 3FKEA 4WURA 3KVWA 3EIHA 3KOXE 3AFHA 3SARA 5EXSA 2CE7A 4RNAA 3FD9A 5E26A 3ILKA 3SAVA 3RE8A 1XWIA 2KW0A 1OFHA 1HR0M 2Q2EB 3DFZA 1L1TA 2F5SA 4AQYM 3HJ8A 2C98A 2X8AA 3AV0A 3AOEA 4B7FA 1R6BX 1X37A 3SFZA 1NY5A 1DO2A 4KO8A 2Z3XA 3T15A 4JI6M 2XFTA 1TDZA 4PCZA 4LY6A 4QOSA 4I5SA 3HHWA 2EUCA 4LFAM 1H6UA 5ITXA 4LCBA 4L78A 1OJLA 4LRTA 4REZA 1IY2A 4CGYB 2XZFA 4PT5A 2Y0TA 4L16A 2L6OA 2KZSA 1JR3A 3OTOM 4A3VB 5FSWA 5KQ8A 2BJVA 3VKHA 4FWGA 5EXTA 3CTWB 2D7GA 4LF6M 1SXJA 3LVVA 3JR4A 2QCUA 2EO2A 2R4JA 3KSJA 1IQPA 4LFCM 2CHQA 4OX9M 1I94M 2V1CA 4JI1M 4LFBM 2RGOA 1E9RA 3GRYA 4ITQA 3PNYA 3I51A 3SYKA 4D82A 2KRUA 5EP2A 1Z6TA 1J5EM 3U5ZB 3HJQA 4QHSA 4X62M 4DV1M 1QAMA 1XNRM 1J09A 3VDUA 2DZNB 2C96A 4IBGA 3LQRA 4FW9A 3I4VA 4ZPXA 3U60B 3L28A 2EA0A 4L8RC 2Y0QA 4HLQA 2AHMA 3U6LA 4AZFA 4X64M 5E6JA 4MM3B 3KOZE 3FYDA 3VFDA 1G8PA 4DV4M 3BOSA 3FYCA 3AOGA 1OFIA 4LF4M 2Y21A 3GQ3A 3FTFA 3KP0E 1SXJB 1IN8A 1MU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL7 A;  2KW0 A; 
#chains in the Genus database with same CATH topology
 3JR5 A;  4P17 A;  1GKI A;  5FTM A;  3MJ5 A;  2VF8 A;  3SBJ A;  3THG A;  1D0L A;  2DWM A;  2VQF M;  2UU9 M;  2I7P A;  4S12 A;  4AI6 A;  1OKS A;  3HZJ A;  1V34 A;  1NNU C;  3GLF A;  2I7N A;  1ZMV A;  4G6Z A;  2FNA A;  1TDH A;  3GQ5 A;  3J81 S;  1ORY B;  3VK7 A;  1LV7 A;  4M9Z A;  5EQT A;  3U6C A;  5F3W A;  2RGH A;  4G4O A;  2KRK A;  2LBC A;  2MH8 A;  3HHX A;  1NSF A;  3J7A S;  1IFY A;  2FH0 A;  1Q3B A;  3RGP A;  5IRE B;  2DNA A;  2K6B A;  3IG8 A;  2YR0 A;  4PDG A;  2ZTD A;  1NJG A;  3W0F A;  2V1U A;  3PXG A;  3J27 B;  4B7G A;  1HQC A;  1GJT A;  3M6A A;  3I04 M;  1YSY A;  3R9X B;  4F2L A;  3SAS A;  3SAU A;  4DUY M;  1J7K A;  2JWS A;  4B08 A;  4IBI A;  4LJ4 A;  3U61 B;  1Z5C A;  2R18 A;  3PFI A;  3Q8G A;  4R3D A;  4X66 M;  4LF5 M;  1XMQ M;  4DR7 M;  1KFV A;  1L1Z A;  1E32 A;  2R45 A;  2EKK A;  2NQ8 C;  2C9C A;  2L7H A;  4Z8X A;  4AG5 A;  2QNJ A;  3A98 B;  3UJN A;  3KP1 E;  5ITU A;  2JA2 A;  1Z59 A;  4LF8 M;  1VDL A;  3FUX A;  1QAO A;  2QBY B;  2R46 A;  3E46 A;  4DV5 M;  1TR8 A;  1W5T A;  2DAI A;  4OVZ B;  4IBC A;  3GPX A;  2VQE M;  1MX0 A;  2JNH A;  3FUU A;  4YHH M;  2HL7 A;  4BBA A;  3UMM A;  3T1Y M;  3B7Q A;  5EXP A;  1DGB A;  4NL4 H;  4X65 M;  5ITQ A;  2F5N A;  3I01 M;  1R5L A;  2YQZ A;  3K1J A;  4Y28 F;  1DGF A;  3GO8 A;  2D7H A;  4HEO A;  2DI0 A;  3C9P A;  1Q3C A;  3TPZ A;  4B3T M;  1VEJ A;  1MJG M;  5DYG A;  4NSR A;  2X4A A;  3B89 A;  3TQS A;  1L2B A;  1KSF X;  3MK6 A;  4HL4 A;  2LHG A;  2F5P A;  1FJG M;  2CFO A;  4QHT A;  5KPZ A;  4WP2 A;  1NV8 A;  3U5Z A;  2BNK A;  5H37 D;  1NVM A;  1DGH B;  1VEG A;  4L4U A;  4CHT B;  3FTE A;  5DFL A;  3SAT A;  1IY1 A;  1TH4 A;  1Z5B A;  3CF6 E;  1GLN A;  4DV2 M;  1N78 A;  4FCW A;  4LJ5 A;  1WIV A;  4LF7 M;  2JP7 A;  2VF7 A;  3U6P A;  3U60 A;  4MH0 E;  1BVS A;  3U6Q A;  4G4N A;  4JI8 M;  4IBE A;  4DR1 M;  1JR3 D;  3F92 A;  2KNZ A;  2UUC M;  4D80 A;  1F4I A;  2RKO A;  3K9O A;  4GHL A;  2JY8 A;  2LXE A;  1VDD A;  3VDP A;  5ITR A;  1SXJ D;  3L26 A;  4LJ9 A;  5IWA M;  1PM5 A;  4F1I A;  2FE8 A;  4QNR A;  2MGW A;  3GP1 A;  1N32 M;  3FUV A;  1R2Z A;  4NXM M;  1HNX M;  3HU1 A;  2B3T A;  1PJJ A;  3LMM A;  3WHL A;  4DV3 M;  4CJ6 A;  1FNN A;  1I4W A;  3B7N A;  2C99 A;  2YNM D;  5FTK A;  1K82 A;  4K0K M;  2XFS A;  4JI3 M;  1PRB A;  1IXZ A;  1NHG C;  3PVS A;  3KFU G;  2DAM A;  2XSZ D;  3GLH A;  4YY3 M;  1N75 A;  2R62 A;  4JI2 M;  3TWK A;  2XSZ A;  3GLI B;  1K3W A;  3GPY A;  4FCT A;  4ANR A;  4FWH A;  1OAO C;  4AW4 A;  2OQ4 A;  2JZ0 A;  1HQY E;  2JZ1 A;  4NRV A;  4CIS A;  4TUW A;  1E9S A;  1L8Q A;  2LTU A;  2ZAN A;  3AOE C;  3K2L A;  1XB2 B;  2L4F A;  4MGK E;  3TE6 A;  1A5T A;  4BLC A;  3ZQJ A;  2DVW B;  2K47 A;  2MR9 A;  2QP9 X;  3C3E A;  4MGZ E;  4DR4 M;  2K9D A;  3BBZ A;  4XGI A;  4DR5 M;  3U61 A;  1S3S A;  2Z4S A;  5EJC A;  4XBO A;  2DZO B;  1DGG A;  1AUA A;  3HU3 A;  5KPR A;  2G5G X;  4GKK M;  2JUJ A;  2OO9 A;  1XHB A;  2J5Y A;  2Z7J A;  4M0W A;  3PNV A;  3SAW A;  1L2C A;  5LMU M;  1IN7 A;  1EE8 A;  4UN2 B;  3K8Z A;  1G4A E;  4R71 A;  1WGL A;  1GVN A;  1W5S A;  2ZBK B;  1XXH B;  4RF1 A;  1N77 A;  2QBY A;  4OVZ A;  1ZV1 A;  4JN6 A;  3CF0 A;  3HKP A;  3GLH B;  4GKJ M;  5GKN A;  1JB0 F;  1OIZ A;  4R7G A;  4PDI A;  1PJS A;  2UXB M;  2K0B X;  2HCB A;  2LVP C;  3FRH A;  2DAK A;  2CV2 A;  3KOW E;  4DUZ M;  3SYL A;  2HAK A;  4D81 A;  2HKJ A;  1GL7 A;  2R6F A;  3KSX A;  4P16 A;  4MGH A;  5EP1 A;  4IBF A;  1T3T A;  1QVR A;  2KXE A;  1WGN A;  3K92 A;  3KW6 A;  3J80 S;  4LJ6 A;  3KS4 A;  5JI3 E;  5ITX E;  2LVQ D;  2XGN A;  1UFZ A;  2GQF A;  3W0L B;  5KO3 A;  4I8O A;  4QOZ C;  3LQQ A;  2Z8Y M;  1TH2 A;  3M0E A;  3MHV C;  5C18 A;  4KHP M;  3KXE C;  5BR8 M;  2ZTC A;  1N34 M;  4NC6 A;  4IBB A;  1JR3 E;  4OW0 A;  1C1K A;  1QAN A;  1V33 A;  3K9P A;  3SMS A;  4RF0 A;  1YLA A;  2YFQ A;  1DGH A;  4Z6Y A;  4B3R M;  5EXX A;  4GC5 A;  3DZD A;  3AKZ A;  3FRI A;  1SXJ E;  4JV5 M;  3LCV B;  3VKG A;  4GMQ A;  1CUK A;  4JI4 M;  2HWJ A;  2DAG A;  2ZAM A;  5FTL A;  1QQW A;  2L4E A;  2DWZ B;  1PGY A;  2CP8 A;  2KDL A;  2OOB A;  4QNM A;  1TF0 B;  2UUA M;  2V6Z M;  3I4Y A;  4DR6 M;  2F5O A;  4B7H A;  2XLJ A;  4II7 A;  4BB9 A;  2CV1 A;  4LG2 A;  4W5W A;  1HT1 E;  1DV0 A;  1IXR C;  3U6M A;  3R8F A;  1XC8 A;  1IY0 A;  1IXS A;  1WJ7 A;  4LGM A;  2QZ4 A;  1TTE A;  3IEC A;  4MB7 A;  5ITY A;  1EIJ A;  1N33 M;  4RKU F;  1QAQ A;  2EKF A;  4CIZ A;  3W68 A;  3HX3 A;  2M60 A;  1NNJ A;  5EP3 A;  5ITT A;  2O25 A;  4FVM A;  4NOO B;  3TL4 X;  1SG9 A;  2MRO B;  3D8L A;  3JAM S;  4GC9 A;  4AKH A;  2L7I A;  4LJA A;  2FOI C;  3NWL A;  1G59 A;  3LVW A;  1OTR A;  3KS8 A;  3FTC A;  2QSF X;  1YUB A;  3GLI A;  3U6S A;  1XNQ M;  2KNA A;  5KPT A;  1ZQ9 A;  3IHP A;  3NBI A;  3ZC7 B;  3ZH9 B;  4GRI A;  4LJ7 A;  2VII A;  4XK8 F;  2DEN A;  2WSF F;  3A42 A;  3SHF A;  1QYR A;  2FS1 A;  4OU7 A;  2KHH A;  2LVN C;  3GRU A;  3V76 A;  2DAE A;  3WHK A;  5C1B A;  3GLF E;  5FLX S;  1NHW C;  3H4M A;  3Q8X A;  3B74 A;  3L29 A;  3GPP A;  2LNH C;  3L27 A;  2CV0 A;  2F5Q A;  1R2Y A;  5IT9 S;  3FE3 A;  2DWN A;  2XEP A;  2CHG A;  4G3O A;  2XH9 A;  3U6O A;  4B3S M;  1VG5 A;  3M7G A;  1HNZ M;  3W67 A;  1PJI A;  2RRU A;  4DV7 M;  3T6P A;  1IXS B;  2OPF A;  2KA6 B;  1D0K A;  2Z4R A;  3AL0 C;  3QWL A;  1IN6 A;  1QZM A;  4IJE A;  1KYI A;  2XF3 A;  3HHZ A;  4KT0 F;  2E5L M;  4AG6 A;  2P5T A;  3DA1 A;  2G8L A;  1G71 A;  2BJW A;  3RFW A;  3GLG B;  1XXH A;  4DV6 M;  1ZAE A;  2CRU A;  1NY6 A;  2DXI A;  3VK8 A;  2UXD M;  1RU3 A;  2O5R A;  2XZU A;  4DR3 M;  1IN5 A;  2ZAO A;  1QDR A;  3FUT A;  4NSO B;  1QDT A;  1MN3 A;  2L09 A;  4IJF A;  1T6O A;  4IBJ A;  2OOA A;  1NO1 A;  2J7O A;  4JI0 M;  2X49 A;  2CEA A;  1HNW M;  1IBL M;  3A45 A;  4NXN M;  3FUW A;  1Y8G A;  4LRS A;  4IBD A;  3HGI A;  2WSE F;  2ERC A;  3LW5 F;  1R7R A;  2DWL A;  4GHA A;  3E4R A;  3E21 A;  3TWL A;  1K3X A;  5LMN M;  1T43 A;  2KNV A;  1UM8 A;  1IBM M;  4I81 A;  1C7Y A;  3EIE A;  2DHR A;  1HJP A;  4JYA M;  5EP4 A;  2CHV A;  3A46 A;  4IBK A;  4MGY E;  5IZ7 D;  2FFJ A;  2W82 A;  4M9X A;  4WW0 A;  2LH0 A;  3E9S A;  7CAT A;  2BWB A;  3D8B A;  4DV0 M;  2R65 A;  1Q39 A;  1N36 M;  1QUT A;  2ZM6 M;  3KDS E;  5DNY A;  2HHH M;  4G4R A;  2UXC M;  3HJS A;  4I4L A;  3KOY E;  5DYI A;  5FTN A;  3IG5 A;  4M0D A;  4L15 A;  3UK6 A;  2Y20 A;  3C3D A;  3B7Z A;  3UZU A;  5A2Q S;  4DR2 M;  4GIP A;  4FCV A;  4FWD A;  1WR1 B;  2CUZ A;  1SXJ C;  3SC3 A;  4MGI E;  3GLI E;  1PJQ A;  2MJ5 B;  3HHY A;  1E94 E;  3GQ4 A;  2KZU A;  2J7N A;  2N35 A;  2LVA A;  1L2D A;  3QYE A;  2BWE A;  5JI2 E;  3U6E A;  4L6V 6;  1P3Q Q;  2APL A;  3DOA A;  2KEB A;  2C9O A;  4EIW A;  1TH3 A;  3HU2 A;  4GH9 A;  3QAU A;  4G4Q A;  4KOD A;  1PJT A;  1G3I A;  1LTM A;  4M9S A;  3HWS A;  1D2N A;  1IBK M;  3MMP A;  3UGJ A;  3TWM A;  4NRW A;  1G41 A;  2M5Z A;  4AKG A;  1ZMW A;  3J7B A;  3GRV A;  3HY5 A;  3SMP A;  3VLF B;  1HT2 E;  3H4J A;  3RGS A;  2LWX A;  3NBX X;  4AKI A;  2DKL A;  3J2P B;  3T38 A;  4PD2 A;  1DO0 A;  1XXH E;  2H1R A;  3ZCB B;  1JQJ C;  3GPU A;  1Z5A A;  2QEN A;  3QYB A;  5KQD A;  4GIT A;  3GLH E;  1NJF A;  2C5R A;  4LF9 M;  1YE9 A;  1TGU A;  2CWB A;  4IIW A;  3AJI B;  3GRR A;  1WXQ A;  5FTJ A;  3B9P A;  4LZZ A;  3CF2 A;  4JI5 M;  2A5Y B;  2L2D A;  2QPA A;  4LZJ A;  3T1H M;  4FD2 A;  3SHG B;  1XMO M;  2F4V M;  2H5X A;  4KLN A;  3L25 A;  8CAT A;  2LHC A;  1IM2 A;  4JI7 M;  2R4E A;  2D7E A;  3U6D A;  3C58 A;  3LCU A;  4JXJ A;  4LGY A;  4B3M M;  4LJ8 A;  3GLG A;  5BPV A;  2QQ8 A;  1IN4 A;  2UUB M;  3L2A A;  3GLF B;  3FTD A;  1GL6 A;  3FKE A;  4WUR A;  3KVW A;  3EIH A;  1GAB A;  3KOX E;  4GEW A;  3AFH A;  3SAR A;  5EXS A;  2CE7 A;  4RNA A;  2R0I A;  3FD9 A;  5E26 A;  3ILK A;  3SAV A;  3RE8 A;  1XWI A;  2KW0 A;  1OFH A;  1HR0 M;  2G3Q A;  2Q2E B;  3DFZ A;  1L1T A;  1QUS A;  2QHO B;  2F5S A;  4AQY M;  3HJ8 A;  4Q7J A;  2C98 A;  2X8A A;  3AV0 A;  2VDB B;  3AOE A;  4B7F A;  1R6B X;  1X37 A;  3SFZ A;  1NY5 A;  1DO2 A;  4KO8 A;  2Z3X A;  3T15 A;  4JI6 M;  2XFT A;  2O01 F;  1TDZ A;  4PCZ A;  4LY6 A;  5L8R F;  4QOS A;  4I5S A;  3HHW A;  2EUC A;  4LFA M;  1H6U A;  5ITX A;  4LCB A;  4L78 A;  1OJL A;  4LRT A;  4REZ A;  2EJS A;  1IY2 A;  1AIP C;  4CGY B;  2XZF A;  4PT5 A;  2Y0T A;  4L16 A;  2L6O A;  2KZS A;  1JR3 A;  3OTO M;  4A3V B;  1NV9 A;  5FSW A;  2LVO C;  5KQ8 A;  2BJV A;  3VKH A;  2DHY A;  4FWG A;  5EXT A;  3CTW B;  2D7G A;  4LF6 M;  1SXJ A;  3LVV A;  3JR4 A;  2QCU A;  2EO2 A;  2R4J A;  3KSJ A;  1OQY A;  1IQP A;  1EFU B;  1VQ1 A;  2JY7 A;  4DBG B;  4LFC M;  1Q02 A;  2CHQ A;  1D0M A;  4OX9 M;  1I94 M;  2V1C A;  2WSC F;  4JI1 M;  4LFB M;  2RGO A;  1E9R A;  3GRY A;  4ITQ A;  3PNY A;  3I51 A;  3SYK A;  4D82 A;  2KRU A;  5EP2 A;  1Z6T A;  1J5E M;  3U5Z B;  3HJQ A;  4QHS A;  1OAI A;  1GO5 A;  4X62 M;  4DV1 M;  1QAM A;  1GJS A;  1XNR M;  1V92 A;  1J09 A;  1QZE A;  3VDU A;  1VEK A;  2DZN B;  2C96 A;  4IBG A;  3GLG E;  3LQR A;  1WHC A;  4FW9 A;  2JY6 B;  3BXW A;  3I4V A;  4ZPX A;  3L28 A;  2EA0 A;  3U60 B;  4L8R C;  2Y0Q A;  2GNO A;  4HLQ A;  2AHM A;  3U6L A;  2DZL A;  1R4G A;  4AZF A;  4X64 M;  5E6J A;  2R44 A;  3CGW A;  4MM3 B;  2WZJ A;  3KOZ E;  1OIP A;  3FYD A;  3VFD A;  1G8P A;  4DV4 M;  3BOS A;  3FYC A;  1ZMU A;  2JXN A;  3AOG A;  1OFI A;  2JY5 A;  2Y21 A;  3GQ3 A;  4LF4 M;  3KP0 E;  1SXJ B;  3FTF A;  1IN8 A;  1MU5 A; 
#chains in the Genus database with same CATH homology
 3JR5 A;  1GKI A;  5FTM A;  3MJ5 A;  3SBJ A;  3THG A;  2DWM A;  2UU9 M;  2VQF M;  2I7P A;  4S12 A;  4AI6 A;  1NNU C;  3GLF A;  2I7N A;  4G6Z A;  2FNA A;  1TDH A;  3GQ5 A;  3J81 S;  1ORY B;  3VK7 A;  1LV7 A;  4M9Z A;  5EQT A;  3U6C A;  5F3W A;  2RGH A;  4G4O A;  2KRK A;  3HHX A;  1NSF A;  3J7A S;  1Q3B A;  3RGP A;  5IRE B;  4PDG A;  2V1U A;  3IG8 A;  2YR0 A;  1NJG A;  3W0F A;  3PXG A;  3J27 B;  4B7G A;  1HQC A;  3M6A A;  1YSY A;  3R9X B;  3SAS A;  3SAU A;  4DUY M;  1J7K A;  4B08 A;  4IBI A;  4LJ4 A;  3U61 B;  1Z5C A;  2R18 A;  3PFI A;  4R3D A;  4X66 M;  4LF5 M;  1XMQ M;  4DR7 M;  1KFV A;  1L1Z A;  1E32 A;  2R45 A;  2NQ8 C;  2C9C A;  2L7H A;  4Z8X A;  4AG5 A;  3A98 B;  3UJN A;  3KP1 E;  5ITU A;  2JA2 A;  1Z59 A;  4LF8 M;  3FUX A;  1QAO A;  2QBY B;  2R46 A;  4DV5 M;  1W5T A;  4OVZ B;  4IBC A;  3GPX A;  2VQE M;  1MX0 A;  4YHH M;  3FUU A;  3T1Y M;  2HL7 A;  4BBA A;  3UMM A;  5EXP A;  1DGB A;  4NL4 H;  4X65 M;  5ITQ A;  2F5N A;  2YQZ A;  3K1J A;  1DGF A;  3GO8 A;  2D7H A;  1Q3C A;  3TPZ A;  4B3T M;  5DYG A;  4NSR A;  2X4A A;  1L2B A;  3TQS A;  1KSF X;  3MK6 A;  4HL4 A;  2F5P A;  2CFO A;  4QHT A;  5KPZ A;  3U5Z A;  2BNK A;  5H37 D;  1NVM A;  1DGH B;  4L4U A;  4CHT B;  3FTE A;  3SAT A;  1IY1 A;  1TH4 A;  1Z5B A;  3CF6 E;  1GLN A;  4DV2 M;  1N78 A;  4FCW A;  4LJ5 A;  4LF7 M;  3U6P A;  3U60 A;  4MH0 E;  3U6Q A;  4JI8 M;  4G4N A;  4IBE A;  4DR1 M;  1JR3 D;  2UUC M;  4D80 A;  2RKO A;  4GHL A;  2LXE A;  1VDD A;  3VDP A;  5ITR A;  1SXJ D;  3L26 A;  4LJ9 A;  5IWA M;  1PM5 A;  2FE8 A;  4QNR A;  3GP1 A;  1N32 M;  3FUV A;  1R2Z A;  4NXM M;  1HNX M;  3HU1 A;  1PJJ A;  3LMM A;  3WHL A;  4DV3 M;  1FNN A;  1I4W A;  2C99 A;  2YNM D;  5FTK A;  1K82 A;  4K0K M;  2XFS A;  4JI3 M;  1IXZ A;  1NHG C;  3PVS A;  3KFU G;  2XSZ D;  3GLH A;  4YY3 M;  1N75 A;  2R62 A;  4JI2 M;  3TWK A;  2XSZ A;  3GLI B;  1K3W A;  3GPY A;  4FCT A;  4FWH A;  4AW4 A;  2OQ4 A;  1HQY E;  4NRV A;  4CIS A;  4TUW A;  1E9S A;  1L8Q A;  2ZAN A;  3AOE C;  3K2L A;  4MGK E;  3TE6 A;  4BLC A;  2DVW B;  2K47 A;  4MGZ E;  2QP9 X;  4DR4 M;  4XGI A;  4DR5 M;  3U61 A;  1S3S A;  2Z4S A;  5EJC A;  4XBO A;  2DZO B;  1DGG A;  5KPR A;  3HU3 A;  2G5G X;  4GKK M;  1XHB A;  2Z7J A;  4M0W A;  1L2C A;  3PNV A;  3SAW A;  5LMU M;  1IN7 A;  1EE8 A;  5KPT A;  3K8Z A;  1G4A E;  1N77 A;  2QBY A;  1GVN A;  1W5S A;  2ZBK B;  1XXH B;  4RF1 A;  4OVZ A;  4JN6 A;  3CF0 A;  3HKP A;  3GLH B;  4GKJ M;  5GKN A;  4PDI A;  4R7G A;  2UXB M;  2HCB A;  2CV2 A;  3KOW E;  4DUZ M;  3SYL A;  4D81 A;  2HKJ A;  1GL7 A;  3KSX A;  4P16 A;  4MGH A;  5EP1 A;  4IBF A;  1T3T A;  1QVR A;  2KXE A;  3K92 A;  3KW6 A;  3J80 S;  5JI3 E;  4LJ6 A;  3KS4 A;  5ITX E;  2XGN A;  5KO3 A;  3W0L B;  4I8O A;  4QOZ C;  3LQQ A;  3MHV C;  1TH2 A;  3M0E A;  5C18 A;  4KHP M;  3KXE C;  5BR8 M;  1N34 M;  4IBB A;  4OW0 A;  1C1K A;  1QAN A;  3SMS A;  4Z6Y A;  4RF0 A;  2YFQ A;  1DGH A;  4B3R M;  5EXX A;  4GC5 A;  3DZD A;  3AKZ A;  1SXJ E;  4JV5 M;  3VKG A;  4GMQ A;  4JI4 M;  2ZAM A;  5FTL A;  1QQW A;  2DWZ B;  4QNM A;  2UUA M;  2V6Z M;  3I4Y A;  4DR6 M;  2F5O A;  4B7H A;  2XLJ A;  4II7 A;  4BB9 A;  2CV1 A;  4LG2 A;  4W5W A;  1HT1 E;  1IXR C;  3U6M A;  3R8F A;  1XC8 A;  1IY0 A;  4LGM A;  2QZ4 A;  4MB7 A;  5ITY A;  1N33 M;  1QAQ A;  2M60 A;  1NNJ A;  5EP3 A;  5ITT A;  4FVM A;  4NOO B;  3TL4 X;  3D8L A;  3JAM S;  4GC9 A;  4AKH A;  2L7I A;  4LJA A;  2FOI C;  3NWL A;  1G59 A;  3LVW A;  3KS8 A;  3FTC A;  1YUB A;  3GLI A;  3U6S A;  1XNQ M;  1ZQ9 A;  3ZC7 B;  3NBI A;  3ZH9 B;  4GRI A;  4LJ7 A;  2VII A;  3A42 A;  3SHF A;  1QYR A;  4OU7 A;  3GRU A;  3WHK A;  5C1B A;  5FLX S;  1NHW C;  3H4M A;  3Q8X A;  3L29 A;  3GPP A;  2LNH C;  3L27 A;  2CV0 A;  2F5Q A;  1R2Y A;  5IT9 S;  2DWN A;  2XEP A;  2CHG A;  3U6O A;  2XH9 A;  4B3S M;  1HNZ M;  3M7G A;  1PJI A;  4DV7 M;  1IXS B;  2OPF A;  2KA6 B;  2Z4R A;  3AL0 C;  3QWL A;  1IN6 A;  1QZM A;  4IJE A;  1KYI A;  2XF3 A;  3HHZ A;  2E5L M;  4AG6 A;  2P5T A;  3DA1 A;  2G8L A;  2BJW A;  3RFW A;  3GLG B;  4DV6 M;  1XXH A;  1ZAE A;  1NY6 A;  2DXI A;  3VK8 A;  2UXD M;  2O5R A;  2XZU A;  4DR3 M;  1IN5 A;  2ZAO A;  3FUT A;  4NSO B;  4IJF A;  2L09 A;  4IBJ A;  2J7O A;  4JI0 M;  2X49 A;  2CEA A;  1HNW M;  1IBL M;  3A45 A;  4NXN M;  3FUW A;  4LRS A;  4IBD A;  3HGI A;  2ERC A;  1R7R A;  2DWL A;  4GHA A;  3E4R A;  1IBM M;  3TWL A;  1K3X A;  5LMN M;  1UM8 A;  4I81 A;  3EIE A;  2DHR A;  4JYA M;  5EP4 A;  2CHV A;  3A46 A;  4IBK A;  4MGY E;  5IZ7 D;  2FFJ A;  2W82 A;  4M9X A;  4WW0 A;  2LH0 A;  3E9S A;  7CAT A;  3D8B A;  4DV0 M;  1N36 M;  2R65 A;  1Q39 A;  2HHH M;  1FJG M;  2ZM6 M;  3KDS E;  5DNY A;  4G4R A;  2UXC M;  3HJS A;  4I4L A;  3KOY E;  5DYI A;  5FTN A;  3IG5 A;  4M0D A;  4L15 A;  3UK6 A;  2Y20 A;  5A2Q S;  3UZU A;  4DR2 M;  4GIP A;  4FCV A;  4FWD A;  2CUZ A;  1SXJ C;  3SC3 A;  4MGI E;  3HHY A;  1E94 E;  3GQ4 A;  2KZU A;  2J7N A;  1L2D A;  3U6E A;  5JI2 E;  3DOA A;  2KEB A;  2C9O A;  4EIW A;  1TH3 A;  3HU2 A;  4GH9 A;  3QAU A;  4G4Q A;  4KOD A;  1G3I A;  4M9S A;  3HWS A;  1D2N A;  1IBK M;  3UGJ A;  3TWM A;  4NRW A;  1G41 A;  2M5Z A;  4AKG A;  3J7B A;  3GRV A;  3SMP A;  3VLF B;  1HT2 E;  3RGS A;  4AKI A;  2LWX A;  3J2P B;  3T38 A;  4PD2 A;  1DO0 A;  2H1R A;  3ZCB B;  1JQJ C;  3GPU A;  1Z5A A;  2QEN A;  5KQD A;  4GIT A;  1NJF A;  2C5R A;  4LF9 M;  1YE9 A;  1TGU A;  4IIW A;  3AJI B;  3GRR A;  1WXQ A;  5FTJ A;  3B9P A;  4LZZ A;  3CF2 A;  4JI5 M;  2A5Y B;  2QPA A;  4LZJ A;  3T1H M;  4FD2 A;  3SHG B;  1XMO M;  2F4V M;  4KLN A;  3L25 A;  8CAT A;  1IM2 A;  4JI7 M;  2R4E A;  2D7E A;  3U6D A;  3C58 A;  4JXJ A;  4LGY A;  4B3M M;  4LJ8 A;  3GLG A;  5BPV A;  1IN4 A;  2UUB M;  3L2A A;  3GLF B;  3FTD A;  1GL6 A;  3FKE A;  4WUR A;  3KVW A;  3EIH A;  3KOX E;  3AFH A;  3SAR A;  5EXS A;  2CE7 A;  4RNA A;  3FD9 A;  5E26 A;  3ILK A;  3SAV A;  3RE8 A;  1XWI A;  2KW0 A;  1OFH A;  1HR0 M;  2Q2E B;  3DFZ A;  1L1T A;  2F5S A;  4AQY M;  3HJ8 A;  2C98 A;  2X8A A;  3AV0 A;  3AOE A;  4B7F A;  1R6B X;  1X37 A;  3SFZ A;  1NY5 A;  1DO2 A;  4KO8 A;  2Z3X A;  3T15 A;  4JI6 M;  2XFT A;  1TDZ A;  4PCZ A;  4LY6 A;  4QOS A;  4I5S A;  3HHW A;  2EUC A;  4LFA M;  1H6U A;  5ITX A;  4LCB A;  4L78 A;  1OJL A;  4LRT A;  4REZ A;  1IY2 A;  4CGY B;  2XZF A;  4PT5 A;  2Y0T A;  4L16 A;  2L6O A;  2KZS A;  1JR3 A;  3OTO M;  4A3V B;  5FSW A;  5KQ8 A;  2BJV A;  3VKH A;  4FWG A;  5EXT A;  3CTW B;  2D7G A;  4LF6 M;  1SXJ A;  3LVV A;  3JR4 A;  2QCU A;  2EO2 A;  2R4J A;  3KSJ A;  1IQP A;  4LFC M;  2CHQ A;  4OX9 M;  1I94 M;  2V1C A;  4JI1 M;  4LFB M;  2RGO A;  1E9R A;  3GRY A;  4ITQ A;  3PNY A;  3I51 A;  3SYK A;  4D82 A;  2KRU A;  5EP2 A;  1Z6T A;  1J5E M;  3U5Z B;  3HJQ A;  4QHS A;  4X62 M;  4DV1 M;  1QAM A;  1XNR M;  1J09 A;  3VDU A;  2DZN B;  2C96 A;  4IBG A;  3LQR A;  4FW9 A;  3I4V A;  4ZPX A;  3U60 B;  3L28 A;  2EA0 A;  4L8R C;  2Y0Q A;  4HLQ A;  2AHM A;  3U6L A;  4AZF A;  4X64 M;  5E6J A;  4MM3 B;  3KOZ E;  3FYD A;  3VFD A;  1G8P A;  4DV4 M;  3BOS A;  3FYC A;  3AOG A;  1OFI A;  4LF4 M;  2Y21 A;  3GQ3 A;  3FTF A;  3KP0 E;  1SXJ B;  1IN8 A;  1MU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...