2HL7A

Crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
GSHMAIDTYEFASDAERERFRNLTQELRCPKCQNQDIADSNAPIAADLRKQIYGQLQQGKSDGEIVDYMVARYGDFVRYKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A strategic protein in cytochrome c maturation: three-dimensional structure of CcmH and binding to apocytochrome c
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Cytochrome C-type biogenesis protein CcmH
total genus 29
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.640 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2hl7A00
2KW0A 2HL7A
chains in the Genus database with same CATH superfamily
1K3WA 2UUCM 5IWAM 4DR4M 2XGNA 2EJSA 3M0EA 1JR3E 3I4YA 1XB2B 1HQCA 4LF8M 3FTDA 2OOBA 4L78A 5A2QS 1XHBA 1ZMUA 3NBXX 3GRUA 3NWLA 5BR8M 1N77A 4DUYM 3FYDA 3ZH9B 2WZJA 3EIHA 3AL0C 1OIPA 2H1RA 1GJSA 1YUBA 1Z6TA 4IIWA 4DV1M 1Y8GA 4CJ6A 4MGIE 2FH0A 4JI1M 2F4VM 4L4UA 1IBLM 5FTJA 3W0FA 3J2PB 4B7GA 3SASA 4AG5A 5EXXA 3TWMA 4GITA 4ANRA 2AHMA 2X8AA 2VF8A 2DWLA 4LGYA 2MH8A 2CEAA 3FKEA 4P17A 4AW4A 5KQDA 1HNXM 1VEGA 2LNHC 1GO5A 4LRTA 1IN8A 3U6CA 2VDBB 2QP9X 4FWDA 4WW0A 2KNZA 1ZQ9A 2MGWA 3H4MA 4R71A 2H5XA 1WR1B 1QDRA 1LV7A 2XH9A 4ZPXA 2X49A 1XXHB 3HWSA 4JI7M 1NJGA 4MH0E 1OTRA 1Z5AA 1N75A 2GNOA 4D80A 1GJTA 3T38A 5EXTA 4GC5A 3U6OA 2KEBA 2QBYA 2DAEA 3HU3A 1DGGA 4LJ5A 3AKZA 2QHOB 5ITTA 3JR5A 5FSWA 5EQTA 3KP0E 1VQ1A 1QAMA 3FUWA 4D81A 3GLFB 3E4RA 3JAMS 2F5NA 3GPPA 2Z4SA 3M7GA 4PT5A 2DHYA 4LCBA 3VDUA 3FUTA 2N35A 2UUAM 4QNRA 2I7PA 4DR3M 3SFZA 4BLCA 4DUZM 3R9XB 4AI6A 4DV7M 2QQ8A 2I7NA 2C9CA 3FRIA 4JXJA 4NRVA 2F5PA 1G71A 2OOAA 4HL4A 3C3DA 2L4FA 3HX3A 4QHTA 4YHHM 3U6DA 1PJTA 1Z5CA 3F92A 3MHVC 3PFIA 2CUZA 3Q8XA 4NC6A 3WHKA 3CGWA 1R6BX 2O5RA 2UXCM 4DR5M 3E9SA 1AIPC 2JY8A 2LXEA 5KPZA 2UUBM 2CWBA 1DO0A 2K6BA 3K9OA 4FW9A 4AZFA 1DGHB 4B3SM 1QYRA 4M0DA 2F5QA 1GVNA 1R5LA 3TL4X 3C3EA 4B08A 5EP4A 5FTNA 3LVVA 3KSXA 2R6FA 2DWZB 4RF0A 1IBMM 2JUJA 4YY3M 1G4AE 2RGHA 1YE9A 1W5SA 4NL4H 3ZQJA 1DGFA 3KOXE 3KSJA 3L25A 3LW5F 5ITXE 3SHGB 1EFUB 1P3QQ 1T3TA 3UGJA 2QNJA 3GLGB 4GIPA 4G6ZA 4L16A 3I51A 1GABA 2CRUA 1WIVA 2FE8A 4DR2M 1NJFA 2KA6B 1E9RA 2UXDM 3B7ZA 3SYLA 2XZFA 2FOIC 3TPZA 2ZM6M 4FCWA 4WP2A 3T15A 3AOEA 4AKGA 3EIEA 4DV3M 1HR0M 3FTEA 3A98B 4FD2A 3SYKA 5LMNM 4DV2M 5IT9S 3KW6A 4LJ6A 3VDPA 3KOYE 1V92A 4X64M 2EUCA 4DV5M 4G4QA 3SATA 4F2LA 2Q2EB 1VDDA 2JY6B 1E9SA 3HJSA 4KT0F 3GLFA 1R4GA 2K0BX 3AOGA 3GLGE 4AKHA 1CUKA 2KNAA 4JI2M 2R4JA 3GRVA 2JP7A 4GMQA 1DO2A 2CHQA 1I4WA 4PDGA 2JNHA 2QBYB 1GKIA 3IECA 3KVWA 5JI2E 1W5TA 4NSRA 4R3DA 2CHGA 2QENA 4DV0M 3FUVA 4LY6A 4QOZC 2DI0A 3HZJA 4L6V6 3SAWA 1NY6A 2D7HA 2JA2A 4DR6M 1Q39A 1XXHA 2J7NA 3IG8A 4M9ZA 4LJ9A 2XZUA 3E46A 1TH4A 2C5RA 5FTMA 2J7OA 3BOSA 2EKKA 1G59A 3B74A 3GPYA 1NNJA 2MJ5B 3GLIB 3DZDA 2FFJA 5F3WA 4A3VB 3U5ZB 1WXQA 1K3XA 4IBBA 1Q3CA 4S12A 4CGYB 3SAUA 3HHYA 1TH3A 3PNYA 4OVZA 2JY7A 3A45A 2BWEA 4GKJM 2DZOB 2HKJA 5C1BA 3UK6A 2LVQD 1AUAA 3PNVA 4ITQA 1SXJE 2CV2A 2ZTCA 1NO1A 3KOWE 2DAMA 3TE6A 2L6OA 4Y28F 2LTUA 1IQPA 1QZMA 2Y0QA 2Y20A 3L2AA 4P16A 3JR4A 1QQWA 2KZUA 3BBZA 4LF5M 5KPTA 1A5TA 2RKOA 3VLFB 4UN2B 1E32A 1HNZM 4X66M 2LVNC 2EKFA 3T1YM 2A5YB 1TF0B 4IBDA 2R46A 1Q02A 1OJLA 3RE8A 4BBAA 4GC9A 1JQJC 4REZA 2VQEM 3HJQA 2YFQA 3GQ3A 4B3TM 2Z7JA 3IHPA 2KXEA 2LHCA 3MK6A 3GQ4A 3K92A 3FYCA 3GRYA 4PCZA 1NY5A 1G3IA 5KO3A 2KW0A 4GHLA 1LTMA 2KNVA 4IBIA 5BPVA 3GLHE 1IXRC 2DXIA 5GKNA 4OU7A 2LHGA 3FD9A 3CF0A 3C9PA 1EE8A 2DAGA 1JB0F 2DAKA 4EIWA 4LFBM 4JV5M 1HQYE 3K8ZA 5C18A 3UMMA 2KHHA 2P5TA 1HT1E 1WHCA 5ITQA 1SG9A 1IXSA 1Z59A 1IY2A 1IXZA 1WJ7A 2EO2A 2R4EA 3KXEC 4I81A 4JI4M 3U6LA 2F5OA 1D0LA 1OAIA 2JWSA 4IBEA 1QAOA 2APLA 3B7NA 5ITXA 3U61A 3NBIA 1TH2A 3LMMA 3KFUG 1OKSA 2WSFF 1IN6A 4LJ7A 2UU9M 1NNUC 1ZMWA 2G8LA 3DFZA 4I5SA 3E21A 3D8BA 1ORYB 3QYBA 1RU3A 4FVMA 5LMUM 1UFZA 3U60A 1H6UA 3MMPA 1MX0A 4Q7JA 3U60B 2R65A 2HAKA 4CISA 2DKLA 2FS1A 4AQYM 3UJNA 1PJJA 3VK7A 4RKUF 3U5ZA 1HT2E 1D0KA 1PRBA 4NXNM 1XMQM 4L8RC 2DHRA 5FTKA 2LBCA 3GLIA 1L2DA 1T43A 3GPXA 2R62A 2LWXA 1K82A 1ZAEA 1VEJA 1DGBA 3IG5A 4NXMM 2QPAA 3KS8A 1L1TA 1IN5A 4FWHA 4LGMA 3WHLA 4XK8F 1IXSB 3BXWA 3FUXA 4LG2A 4BB9A 1XWIA 4FCTA 2KDLA 3B7QA 2ZANA 2L4EA 3J80S 3LVWA 1SXJD 3I01M 4NRWA 3J7AS 2QZ4A 1D0MA 3W68A 5L8RF 3SMPA 1N36M 4K0KM 4CHTB 4IBJA 2Y0TA 1S3SA 5E26A 3GP1A 1E94E 1ZMVA 3GLFE 3GLIE 3K1JA 1J5EM 1I94M 1R7RA 4LFAM 1GL6A 4JYAM 3K9PA 2C98A 3KOZE 4R7GA 5IZ7D 3W67A 1HNWM 4MGYE 1IFYA 1NHGC 1MJGM 2BJWA 3VK8A 2O01F 4QHSA 1KYIA 1FJGM 2L7HA 2D7GA 2V1UA 4JI5M 1TDHA 3L28A 4MB7A 3U6PA 1C7YA 1N33M 2YNMD 2VIIA 4LF9M 1QUTA 4LF7M 1YLAA 2JZ1A 4PDIA 5FTLA 1IN4A 4IBKA 5IREB 1SXJB 4G4RA 2CV1A 4LZZA 3THGA 3RGSA 4B3MM 2C99A 2OPFA 1ZV1A 1GL7A 2Z4RA 4IJEA 1G8PA 3FTFA 1SXJA 4M9SA 1R2YA 2DENA 5DNYA 1PGYA 1UM8A 2LVOC 1L2BA 4MGHA 3D8LA 1J09A 4DV4M 3U6EA 5EJCA 1VG5A 3W0LB 3SAVA 2HHHM 4L15A 2UXBM 4G4OA 2LVAA 4XBOA 2DZLA 1OQYA 4X65M 3AJIB 1N78A 1QAQA 1N32M 4GHAA 2CHVA 1YSYA 2K9DA 4LJAA 1Z5BA 1IBKM 2DAIA 1DGHA 4DV6M 3VFDA 1QZEA 5EXSA 2EA0A 3I04M 3FRHA 3GLHB 5H37D 4IBCA 4LZJA 2HL7A 2R0IA 2DWNA 3SARA 3KDSE 3QWLA 4JI0M 3GO8A 3L26A 4FWGA 2YR0A 2C9OA 3H4JA 4LRSA 2ZAMA 2D7EA 2WSEF 3HGIA 2MROB 2CV0A 1JR3A 2C96A 2L7IA 3HKPA 2JY5A 4IJFA 2RGOA 3HU1A 3M6AA 5FLXS 3VKGA 3GLHA 4OX9M 3B89A 3J7BA 3ZCBB 3HHZA 3FUUA 5EP2A 3VKHA 1TTEA 4KODA 2V1CA 2GQFA 3HU2A 3V76A 1NVMA 2FNAA 1C1KA 1OFIA 5ITUA 1XNQM 1XNRM 3LCVB 2L2DA 2Z3XA 4RNAA 3U6MA 3FE3A 2R45A 2E5LM 3LQRA 1XXHE 4QOSA 2G3QA 4GRIA 1IM2A 2QCUA 4GEWA 4HLQA 4GKKM 3PXGA 2HCBA 4X62M 2R18A 3TWLA 4DR1M 3CF2A 2XEPA 4WURA 3U61B 1FNNA 4FCVA 4DR7M 2HWJA 2Z8YM 4OW0A 5JI3E 3GRRA 1DV0A 3PVSA 1PJQA 3AOEC 5KQ8A 1GLNA 2ZBKB 4NSOB 3J27B 1TGUA 5KPRA 4QNMA 1F4IA 1BVSA 3Q8GA 4LJ4A 3GLGA 3TQSA 2JXNA 2KZSA 3RFWA 4JI6M 1JR3D 4LF4M 4I4LA 1L1ZA 2CFOA 1MU5A 1NHWC 1N34M 3ZC7B 1NSFA 3L29A 5ITRA 4HEOA 1OAOC 8CATA 3ILKA 3KP1E 2XFTA 2V6ZM 1WGLA 2M60A 3FTCA 4G4NA 4Z6YA 5EP3A 3T1HM 1EIJA 1IY1A 1PJIA 4KO8A 2X4AA 1TDZA 2XF3A 4DBGB 3KS4A 3QAUA 4NOOB 3T6PA 3HHXA 2CP8A 4RF1A 4JI8M 1VEKA 1QDTA 2WSCF 2O25A 7CATA 2KRKA 1IY0A 2DVWB 4B7HA 5DYIA 3HHWA 2XLJA 1SXJC 3LCUA 5DYGA 2RRUA 1QVRA 4GH9A 2ERCA 3SBJA 2KRUA 3HJ8A 2DZNB 3K2LA 3A42A 1XMOM 5DFLA 1OIZA 3GPUA 3AFHA 4W5WA 1L2CA 3DOAA 1QANA 2BWBA 2QSFX 4IBGA 4MGKE 1D2NA 1TR8A 1PM5A 2NQ8C 4G3OA 1L8QA 2LH0A 3AV0A 3QYEA 5EP1A 5ITYA 3SMSA 4D82A 4XGIA 2DNAA 3UZUA 4OVZB 2Y21A 2M5ZA 4PD2A 4Z8XA 3U6QA 4AG6A 2OO9A 1KFVA 2BNKA 2L09A 5EXPA 4AKIA 3CF6E 1NV8A 1Q3BA 3L27A 1J7KA 4M0WA 2G5GX 3SC3A 1R2ZA 1X37A 1XC8A 2LVPC 4LF6M 2XSZA 1MN3A 4M9XA 3B9PA 3A46A 1HJPA 3SHFA 4B3RM 3RGPA 2ZAOA 3DA1A 3HY5A 1V33A 2J5YA 2BJVA 4IBFA 3C58A 1WGNA 3R8FA 3LQQA 3J81S 2F5SA 2W82A 4CIZA 4LFCM 4I8OA 1G41A 4F1IA 5E6JA 4TUWA 2VF7A 3OTOM 3GQ5A 2B3TA 4B7FA 2VQFM 4MM3B 1OFHA 1NV9A 1PJSA 4MGZE 2DWMA 2XFSA 1T6OA 2OQ4A 3CTWB 1IN7A 1VDLA 2ZTDA 1QUSA 3I4VA 3MJ5A 4II7A 4JN6A 4JI3M 3TWKA 4KHPM 1V34A 2R44A 2YQZA 3U6SA 2MR9A 1KSFX 4LJ8A 2K47A 2CE7A 2XSZD 2JZ0A 4KLNA
chains in the Genus database with same CATH topology
1K3WA 2UUCM 5IWAM 4DR4M 2XGNA 3M0EA 3I4YA 1HQCA 4LF8M 3FTDA 5A2QS 4L78A 1XHBA 3GRUA 3NWLA 5BR8M 4DUYM 3FYDA 3ZH9B 3EIHA 3AL0C 2H1RA 1YUBA 1Z6TA 4IIWA 4DV1M 4MGIE 4JI1M 2F4VM 4L4UA 1IBLM 5FTJA 3W0FA 3J2PB 4B7GA 3SASA 4AG5A 5EXXA 3TWMA 4GITA 2AHMA 2X8AA 2DWLA 4LGYA 2CEAA 3FKEA 4AW4A 5KQDA 1HNXM 2LNHC 4LRTA 1IN8A 3U6CA 2QP9X 4FWDA 4WW0A 1ZQ9A 3H4MA 2XH9A 1LV7A 4ZPXA 2X49A 1XXHB 3HWSA 4JI7M 1NJGA 4MH0E 1Z5AA 1N75A 4D80A 3T38A 5EXTA 4GC5A 3U6OA 2KEBA 2QBYA 3HU3A 1DGGA 4LJ5A 3AKZA 5ITTA 3JR5A 5FSWA 5EQTA 3KP0E 1QAMA 3FUWA 4D81A 3GLFB 3E4RA 3JAMS 2F5NA 3GPPA 2Z4SA 3M7GA 4PT5A 4LCBA 3VDUA 2UUAM 3FUTA 4QNRA 2I7PA 4DR3M 3SFZA 4BLCA 4DUZM 3R9XB 4AI6A 4DV7M 2I7NA 2C9CA 4JXJA 4NRVA 2F5PA 4HL4A 4QHTA 4YHHM 3U6DA 1Z5CA 3MHVC 3PFIA 2CUZA 3Q8XA 3WHKA 1R6BX 2O5RA 2UXCM 4DR5M 3E9SA 5KPZA 2LXEA 2UUBM 1DO0A 4FW9A 4AZFA 1DGHB 4B3SM 1QYRA 4M0DA 2F5QA 1GVNA 4B08A 3TL4X 5EP4A 5FTNA 3LVVA 3KSXA 4RF0A 2DWZB 1IBMM 4YY3M 1G4AE 2RGHA 1YE9A 1W5SA 4NL4H 1DGFA 3KOXE 3KSJA 3L25A 5ITXE 3SHGB 1T3TA 3UGJA 3GLGB 4GIPA 4G6ZA 4L16A 3I51A 2FE8A 4DR2M 1NJFA 2KA6B 1E9RA 2UXDM 3SYLA 2XZFA 2FOIC 3TPZA 2ZM6M 4FCWA 3T15A 3AOEA 4AKGA 3EIEA 4DV3M 1HR0M 3FTEA 3A98B 4FD2A 3SYKA 5LMNM 4DV2M 5IT9S 3KW6A 4LJ6A 3VDPA 3KOYE 4DV5M 4X64M 2EUCA 4G4QA 3SATA 1N77A 2Q2EB 1VDDA 4JI5M 1E9SA 3HJSA 3GLFA 3AOGA 4AKHA 4JI2M 2R4JA 3GRVA 4GMQA 1DO2A 2CHQA 1I4WA 4PDGA 2QBYB 1GKIA 5JI2E 3KVWA 1W5TA 4NSRA 4R3DA 2CHGA 2QENA 4DV0M 3FUVA 4LY6A 4QOZC 3SAWA 1NY6A 2D7HA 2JA2A 4DR6M 1Q39A 1XXHA 2J7NA 3IG8A 4LJ9A 2XZUA 1TH4A 2C5RA 5FTMA 2J7OA 3BOSA 1G59A 3GPYA 1NNJA 3GLIB 3DZDA 2FFJA 5F3WA 4A3VB 3U5ZB 1WXQA 1K3XA 4IBBA 1Q3CA 4S12A 4CGYB 3SAUA 3HHYA 1TH3A 3PNYA 4OVZA 3A45A 4GKJM 2DZOB 2HKJA 5C1BA 3UK6A 3PNVA 4ITQA 1SXJE 3KOWE 3TE6A 2L6OA 1IQPA 1QZMA 2Y0QA 2Y20A 3L2AA 4P16A 3JR4A 1QQWA 2KZUA 4LF5M 5KPTA 2RKOA 1HNZM 3VLFB 1E32A 4X66M 3T1YM 2A5YB 4IBDA 2R46A 3RE8A 1OJLA 4BBAA 4GC9A 1JQJC 4REZA 2VQEM 3HJQA 2YFQA 3GQ3A 4B3TM 2Z7JA 2KXEA 3MK6A 3GQ4A 3K92A 3FYCA 3GRYA 4PCZA 1NY5A 1G3IA 5KO3A 2KW0A 4GHLA 4IBIA 5BPVA 1IXRC 2DXIA 5GKNA 4OU7A 3FD9A 3CF0A 1EE8A 4EIWA 4LFBM 4JV5M 1HQYE 3K8ZA 5C18A 3UMMA 2P5TA 1HT1E 5ITQA 1Z59A 1IY2A 1IXZA 2R4EA 2EO2A 3KXEC 4I81A 4JI4M 3U6LA 2F5OA 4IBEA 1QAOA 5ITXA 3U61A 3NBIA 1TH2A 3LMMA 3KFUG 1IN6A 4LJ7A 2UU9M 1NNUC 2G8LA 3DFZA 4I5SA 3D8BA 1ORYB 4FVMA 5LMUM 3U60A 1H6UA 1MX0A 3U60B 2R65A 4CISA 4AQYM 3UJNA 1PJJA 3VK7A 3U5ZA 1HT2E 4NXNM 1XMQM 4L8RC 2DHRA 5FTKA 3GLIA 1L2DA 3GPXA 2R62A 2LWXA 1K82A 1ZAEA 1DGBA 3IG5A 4NXMM 2QPAA 3KS8A 1L1TA 1IN5A 4FWHA 4LGMA 3WHLA 1IXSB 3FUXA 4LG2A 4BB9A 1XWIA 4FCTA 2ZANA 3J80S 3LVWA 1SXJD 4NRWA 2QZ4A 3SMPA 1N36M 4K0KM 4CHTB 4IBJA 2Y0TA 1S3SA 5E26A 3GP1A 1E94E 1J5EM 3J7AS 4JYAM 3K1JA 1I94M 1R7RA 4LFAM 1GL6A 2C98A 3KOZE 4R7GA 5IZ7D 1HNWM 4MGYE 1NHGC 3VK8A 2BJWA 4QHSA 1FJGM 1KYIA 2L7HA 2D7GA 2V1UA 1N33M 1TDHA 3L28A 4MB7A 3U6PA 2YNMD 2VIIA 4LF9M 4LF7M 4PDIA 5FTLA 1IN4A 4IBKA 5IREB 1SXJB 4G4RA 2CV1A 4LZZA 3THGA 3RGSA 4B3MM 2C99A 2OPFA 1GL7A 2Z4RA 4IJEA 1G8PA 3FTFA 1SXJA 4M9SA 1R2YA 5DNYA 1UM8A 1L2BA 4MGHA 3D8LA 1J09A 4DV4M 3U6EA 5EJCA 3W0LB 3SAVA 2HHHM 4L15A 2UXBM 4G4OA 4XBOA 4X65M 3AJIB 1N78A 1QAQA 1N32M 4GHAA 2CHVA 1YSYA 4LJAA 1Z5BA 1IBKM 1DGHA 4DV6M 3VFDA 5EXSA 2EA0A 3GLHB 5H37D 4IBCA 4LZJA 2HL7A 2DWNA 3SARA 3KDSE 3QWLA 4JI0M 3GO8A 3L26A 4FWGA 2YR0A 2C9OA 4LRSA 2ZAMA 2D7EA 2CV0A 3HGIA 1JR3A 2C96A 2L7IA 3HKPA 4IJFA 5FLXS 2RGOA 3M6AA 3HU1A 2CV2A 3VKGA 3GLHA 4OX9M 3J7BA 3ZCBB 3HHZA 3FUUA 5EP2A 3VKHA 4KODA 2V1CA 3HU2A 1NVMA 2FNAA 1C1KA 1OFIA 5ITUA 1XNQM 1XNRM 2Z3XA 3U6MA 4RNAA 2R45A 2E5LM 3LQRA 4QOSA 4GRIA 1IM2A 2QCUA 4HLQA 4GKKM 3PXGA 2HCBA 4X62M 2R18A 3TWLA 4DR1M 3CF2A 2XEPA 4WURA 3U61B 1FNNA 4FCVA 4DR7M 4OW0A 5JI3E 3GRRA 3PVSA 3AOEC 5KQ8A 1GLNA 2ZBKB 4NSOB 3J27B 1TGUA 5KPRA 4QNMA 3GLGA 4LJ4A 4JI6M 3TQSA 2KZSA 3RFWA 4LF4M 1JR3D 4I4LA 1L1ZA 2CFOA 1MU5A 1NHWC 1N34M 3ZC7B 1NSFA 3L29A 5ITRA 8CATA 3ILKA 3KP1E 2XFTA 2V6ZM 3T1HM 2M60A 3FTCA 4G4NA 4Z6YA 5EP3A 1IY1A 1PJIA 4KO8A 2X4AA 1TDZA 2XF3A 3KS4A 3QAUA 4NOOB 3HHXA 4RF1A 4JI8M 7CATA 2KRKA 1IY0A 2DVWB 4B7HA 5DYIA 3HHWA 2XLJA 1SXJC 5DYGA 1QVRA 4GH9A 2ERCA 3SBJA 2KRUA 3HJ8A 2DZNB 3K2LA 3A42A 1XMOM 1L2CA 3GPUA 3AFHA 4W5WA 3DOAA 1QANA 4MGKE 4IBGA 1D2NA 1PM5A 2NQ8C 1L8QA 2LH0A 3AV0A 5EP1A 5ITYA 3SMSA 4D82A 4XGIA 3UZUA 4OVZB 2Y21A 2M5ZA 4PD2A 4Z8XA 3U6QA 4AG6A 1KFVA 2BNKA 2L09A 5EXPA 4AKIA 3CF6E 1Q3BA 3L27A 1J7KA 4M0WA 2G5GX 3SC3A 1R2ZA 1X37A 1XC8A 4LF6M 2XSZA 4M9XA 3B9PA 3A46A 3SHFA 4B3RM 3RGPA 2ZAOA 3DA1A 3R8FA 2BJVA 4IBFA 3C58A 3LQQA 3J81S 2F5SA 2W82A 4LFCM 4I8OA 1G41A 5E6JA 4TUWA 3OTOM 3GQ5A 4B7FA 2VQFM 4MM3B 1OFHA 4MGZE 2DWMA 2XFSA 2OQ4A 3CTWB 1IN7A 4II7A 3MJ5A 4JN6A 3I4VA 3TWKA 4JI3M 4KHPM 2YQZA 3U6SA 1KSFX 4LJ8A 2K47A 2CE7A 2XSZD 4M9ZA 4KLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW0 A;  2HL7 A; 
#chains in the Genus database with same CATH topology
 1K3W A;  2UUC M;  5IWA M;  4DR4 M;  2XGN A;  2EJS A;  3M0E A;  1JR3 E;  3I4Y A;  1XB2 B;  1HQC A;  4LF8 M;  3FTD A;  2OOB A;  4L78 A;  5A2Q S;  1XHB A;  1ZMU A;  3NBX X;  3GRU A;  3NWL A;  5BR8 M;  1N77 A;  4DUY M;  3FYD A;  3ZH9 B;  2WZJ A;  3EIH A;  3AL0 C;  1OIP A;  2H1R A;  1GJS A;  1YUB A;  1Z6T A;  4IIW A;  4DV1 M;  1Y8G A;  4CJ6 A;  4MGI E;  2FH0 A;  4JI1 M;  2F4V M;  4L4U A;  1IBL M;  5FTJ A;  3W0F A;  3J2P B;  4B7G A;  3SAS A;  4AG5 A;  5EXX A;  3TWM A;  4GIT A;  4ANR A;  2AHM A;  2X8A A;  2VF8 A;  2DWL A;  4LGY A;  2MH8 A;  2CEA A;  3FKE A;  4P17 A;  4AW4 A;  5KQD A;  1HNX M;  1VEG A;  2LNH C;  1GO5 A;  4LRT A;  1IN8 A;  3U6C A;  2VDB B;  2QP9 X;  4FWD A;  4WW0 A;  2KNZ A;  1ZQ9 A;  2MGW A;  3H4M A;  4R71 A;  2H5X A;  1WR1 B;  1QDR A;  1LV7 A;  2XH9 A;  4ZPX A;  2X49 A;  1XXH B;  3HWS A;  4JI7 M;  1NJG A;  4MH0 E;  1OTR A;  1Z5A A;  1N75 A;  2GNO A;  4D80 A;  1GJT A;  3T38 A;  5EXT A;  4GC5 A;  3U6O A;  2KEB A;  2QBY A;  2DAE A;  3HU3 A;  1DGG A;  4LJ5 A;  3AKZ A;  2QHO B;  5ITT A;  3JR5 A;  5FSW A;  5EQT A;  3KP0 E;  1VQ1 A;  1QAM A;  3FUW A;  4D81 A;  3GLF B;  3E4R A;  3JAM S;  2F5N A;  3GPP A;  2Z4S A;  3M7G A;  4PT5 A;  2DHY A;  4LCB A;  3VDU A;  3FUT A;  2N35 A;  2UUA M;  4QNR A;  2I7P A;  4DR3 M;  3SFZ A;  4BLC A;  4DUZ M;  3R9X B;  4AI6 A;  4DV7 M;  2QQ8 A;  2I7N A;  2C9C A;  3FRI A;  4JXJ A;  4NRV A;  2F5P A;  1G71 A;  2OOA A;  4HL4 A;  3C3D A;  2L4F A;  3HX3 A;  4QHT A;  4YHH M;  3U6D A;  1PJT A;  1Z5C A;  3F92 A;  3MHV C;  3PFI A;  2CUZ A;  3Q8X A;  4NC6 A;  3WHK A;  3CGW A;  1R6B X;  2O5R A;  2UXC M;  4DR5 M;  3E9S A;  1AIP C;  2JY8 A;  2LXE A;  5KPZ A;  2UUB M;  2CWB A;  1DO0 A;  2K6B A;  3K9O A;  4FW9 A;  4AZF A;  1DGH B;  4B3S M;  1QYR A;  4M0D A;  2F5Q A;  1GVN A;  1R5L A;  3TL4 X;  3C3E A;  4B08 A;  5EP4 A;  5FTN A;  3LVV A;  3KSX A;  2R6F A;  2DWZ B;  4RF0 A;  1IBM M;  2JUJ A;  4YY3 M;  1G4A E;  2RGH A;  1YE9 A;  1W5S A;  4NL4 H;  3ZQJ A;  1DGF A;  3KOX E;  3KSJ A;  3L25 A;  3LW5 F;  5ITX E;  3SHG B;  1EFU B;  1P3Q Q;  1T3T A;  3UGJ A;  2QNJ A;  3GLG B;  4GIP A;  4G6Z A;  4L16 A;  3I51 A;  1GAB A;  2CRU A;  1WIV A;  2FE8 A;  4DR2 M;  1NJF A;  2KA6 B;  1E9R A;  2UXD M;  3B7Z A;  3SYL A;  2XZF A;  2FOI C;  3TPZ A;  2ZM6 M;  4FCW A;  4WP2 A;  3T15 A;  3AOE A;  4AKG A;  3EIE A;  4DV3 M;  1HR0 M;  3FTE A;  3A98 B;  4FD2 A;  3SYK A;  5LMN M;  4DV2 M;  5IT9 S;  3KW6 A;  4LJ6 A;  3VDP A;  3KOY E;  1V92 A;  4X64 M;  2EUC A;  4DV5 M;  4G4Q A;  3SAT A;  4F2L A;  2Q2E B;  1VDD A;  2JY6 B;  1E9S A;  3HJS A;  4KT0 F;  3GLF A;  1R4G A;  2K0B X;  3AOG A;  3GLG E;  4AKH A;  1CUK A;  2KNA A;  4JI2 M;  2R4J A;  3GRV A;  2JP7 A;  4GMQ A;  1DO2 A;  2CHQ A;  1I4W A;  4PDG A;  2JNH A;  2QBY B;  1GKI A;  3IEC A;  3KVW A;  5JI2 E;  1W5T A;  4NSR A;  4R3D A;  2CHG A;  2QEN A;  4DV0 M;  3FUV A;  4LY6 A;  4QOZ C;  2DI0 A;  3HZJ A;  4L6V 6;  3SAW A;  1NY6 A;  2D7H A;  2JA2 A;  4DR6 M;  1Q39 A;  1XXH A;  2J7N A;  3IG8 A;  4M9Z A;  4LJ9 A;  2XZU A;  3E46 A;  1TH4 A;  2C5R A;  5FTM A;  2J7O A;  3BOS A;  2EKK A;  1G59 A;  3B74 A;  3GPY A;  1NNJ A;  2MJ5 B;  3GLI B;  3DZD A;  2FFJ A;  5F3W A;  4A3V B;  3U5Z B;  1WXQ A;  1K3X A;  4IBB A;  1Q3C A;  4S12 A;  4CGY B;  3SAU A;  3HHY A;  1TH3 A;  3PNY A;  4OVZ A;  2JY7 A;  3A45 A;  2BWE A;  4GKJ M;  2DZO B;  2HKJ A;  5C1B A;  3UK6 A;  2LVQ D;  1AUA A;  3PNV A;  4ITQ A;  1SXJ E;  2CV2 A;  2ZTC A;  1NO1 A;  3KOW E;  2DAM A;  3TE6 A;  2L6O A;  4Y28 F;  2LTU A;  1IQP A;  1QZM A;  2Y0Q A;  2Y20 A;  3L2A A;  4P16 A;  3JR4 A;  1QQW A;  2KZU A;  3BBZ A;  4LF5 M;  5KPT A;  1A5T A;  2RKO A;  3VLF B;  4UN2 B;  1E32 A;  1HNZ M;  4X66 M;  2LVN C;  2EKF A;  3T1Y M;  2A5Y B;  1TF0 B;  4IBD A;  2R46 A;  1Q02 A;  1OJL A;  3RE8 A;  4BBA A;  4GC9 A;  1JQJ C;  4REZ A;  2VQE M;  3HJQ A;  2YFQ A;  3GQ3 A;  4B3T M;  2Z7J A;  3IHP A;  2KXE A;  2LHC A;  3MK6 A;  3GQ4 A;  3K92 A;  3FYC A;  3GRY A;  4PCZ A;  1NY5 A;  1G3I A;  5KO3 A;  2KW0 A;  4GHL A;  1LTM A;  2KNV A;  4IBI A;  5BPV A;  3GLH E;  1IXR C;  2DXI A;  5GKN A;  4OU7 A;  2LHG A;  3FD9 A;  3CF0 A;  3C9P A;  1EE8 A;  2DAG A;  1JB0 F;  2DAK A;  4EIW A;  4LFB M;  4JV5 M;  1HQY E;  3K8Z A;  5C18 A;  3UMM A;  2KHH A;  2P5T A;  1HT1 E;  1WHC A;  5ITQ A;  1SG9 A;  1IXS A;  1Z59 A;  1IY2 A;  1IXZ A;  1WJ7 A;  2EO2 A;  2R4E A;  3KXE C;  4I81 A;  4JI4 M;  3U6L A;  2F5O A;  1D0L A;  1OAI A;  2JWS A;  4IBE A;  1QAO A;  2APL A;  3B7N A;  5ITX A;  3U61 A;  3NBI A;  1TH2 A;  3LMM A;  3KFU G;  1OKS A;  2WSF F;  1IN6 A;  4LJ7 A;  2UU9 M;  1NNU C;  1ZMW A;  2G8L A;  3DFZ A;  4I5S A;  3E21 A;  3D8B A;  1ORY B;  3QYB A;  1RU3 A;  4FVM A;  5LMU M;  1UFZ A;  3U60 A;  1H6U A;  3MMP A;  1MX0 A;  4Q7J A;  3U60 B;  2R65 A;  2HAK A;  4CIS A;  2DKL A;  2FS1 A;  4AQY M;  3UJN A;  1PJJ A;  3VK7 A;  4RKU F;  3U5Z A;  1HT2 E;  1D0K A;  1PRB A;  4NXN M;  1XMQ M;  4L8R C;  2DHR A;  5FTK A;  2LBC A;  3GLI A;  1L2D A;  1T43 A;  3GPX A;  2R62 A;  2LWX A;  1K82 A;  1ZAE A;  1VEJ A;  1DGB A;  3IG5 A;  4NXM M;  2QPA A;  3KS8 A;  1L1T A;  1IN5 A;  4FWH A;  4LGM A;  3WHL A;  4XK8 F;  1IXS B;  3BXW A;  3FUX A;  4LG2 A;  4BB9 A;  1XWI A;  4FCT A;  2KDL A;  3B7Q A;  2ZAN A;  2L4E A;  3J80 S;  3LVW A;  1SXJ D;  3I01 M;  4NRW A;  3J7A S;  2QZ4 A;  1D0M A;  3W68 A;  5L8R F;  3SMP A;  1N36 M;  4K0K M;  4CHT B;  4IBJ A;  2Y0T A;  1S3S A;  5E26 A;  3GP1 A;  1E94 E;  1ZMV A;  3GLF E;  3GLI E;  3K1J A;  1J5E M;  1I94 M;  1R7R A;  4LFA M;  1GL6 A;  4JYA M;  3K9P A;  2C98 A;  3KOZ E;  4R7G A;  5IZ7 D;  3W67 A;  1HNW M;  4MGY E;  1IFY A;  1NHG C;  1MJG M;  2BJW A;  3VK8 A;  2O01 F;  4QHS A;  1KYI A;  1FJG M;  2L7H A;  2D7G A;  2V1U A;  4JI5 M;  1TDH A;  3L28 A;  4MB7 A;  3U6P A;  1C7Y A;  1N33 M;  2YNM D;  2VII A;  4LF9 M;  1QUT A;  4LF7 M;  1YLA A;  2JZ1 A;  4PDI A;  5FTL A;  1IN4 A;  4IBK A;  5IRE B;  1SXJ B;  4G4R A;  2CV1 A;  4LZZ A;  3THG A;  3RGS A;  4B3M M;  2C99 A;  2OPF A;  1ZV1 A;  1GL7 A;  2Z4R A;  4IJE A;  1G8P A;  3FTF A;  1SXJ A;  4M9S A;  1R2Y A;  2DEN A;  5DNY A;  1PGY A;  1UM8 A;  2LVO C;  1L2B A;  4MGH A;  3D8L A;  1J09 A;  4DV4 M;  3U6E A;  5EJC A;  1VG5 A;  3W0L B;  3SAV A;  2HHH M;  4L15 A;  2UXB M;  4G4O A;  2LVA A;  4XBO A;  2DZL A;  1OQY A;  4X65 M;  3AJI B;  1N78 A;  1QAQ A;  1N32 M;  4GHA A;  2CHV A;  1YSY A;  2K9D A;  4LJA A;  1Z5B A;  1IBK M;  2DAI A;  1DGH A;  4DV6 M;  3VFD A;  1QZE A;  5EXS A;  2EA0 A;  3I04 M;  3FRH A;  3GLH B;  5H37 D;  4IBC A;  4LZJ A;  2HL7 A;  2R0I A;  2DWN A;  3SAR A;  3KDS E;  3QWL A;  4JI0 M;  3GO8 A;  3L26 A;  4FWG A;  2YR0 A;  2C9O A;  3H4J A;  4LRS A;  2ZAM A;  2D7E A;  2WSE F;  3HGI A;  2MRO B;  2CV0 A;  1JR3 A;  2C96 A;  2L7I A;  3HKP A;  2JY5 A;  4IJF A;  2RGO A;  3HU1 A;  3M6A A;  5FLX S;  3VKG A;  3GLH A;  4OX9 M;  3B89 A;  3J7B A;  3ZCB B;  3HHZ A;  3FUU A;  5EP2 A;  3VKH A;  1TTE A;  4KOD A;  2V1C A;  2GQF A;  3HU2 A;  3V76 A;  1NVM A;  2FNA A;  1C1K A;  1OFI A;  5ITU A;  1XNQ M;  1XNR M;  3LCV B;  2L2D A;  2Z3X A;  4RNA A;  3U6M A;  3FE3 A;  2R45 A;  2E5L M;  3LQR A;  1XXH E;  4QOS A;  2G3Q A;  4GRI A;  1IM2 A;  2QCU A;  4GEW A;  4HLQ A;  4GKK M;  3PXG A;  2HCB A;  4X62 M;  2R18 A;  3TWL A;  4DR1 M;  3CF2 A;  2XEP A;  4WUR A;  3U61 B;  1FNN A;  4FCV A;  4DR7 M;  2HWJ A;  2Z8Y M;  4OW0 A;  5JI3 E;  3GRR A;  1DV0 A;  3PVS A;  1PJQ A;  3AOE C;  5KQ8 A;  1GLN A;  2ZBK B;  4NSO B;  3J27 B;  1TGU A;  5KPR A;  4QNM A;  1F4I A;  1BVS A;  3Q8G A;  4LJ4 A;  3GLG A;  3TQS A;  2JXN A;  2KZS A;  3RFW A;  4JI6 M;  1JR3 D;  4LF4 M;  4I4L A;  1L1Z A;  2CFO A;  1MU5 A;  1NHW C;  1N34 M;  3ZC7 B;  1NSF A;  3L29 A;  5ITR A;  4HEO A;  1OAO C;  8CAT A;  3ILK A;  3KP1 E;  2XFT A;  2V6Z M;  1WGL A;  2M60 A;  3FTC A;  4G4N A;  4Z6Y A;  5EP3 A;  3T1H M;  1EIJ A;  1IY1 A;  1PJI A;  4KO8 A;  2X4A A;  1TDZ A;  2XF3 A;  4DBG B;  3KS4 A;  3QAU A;  4NOO B;  3T6P A;  3HHX A;  2CP8 A;  4RF1 A;  4JI8 M;  1VEK A;  1QDT A;  2WSC F;  2O25 A;  7CAT A;  2KRK A;  1IY0 A;  2DVW B;  4B7H A;  5DYI A;  3HHW A;  2XLJ A;  1SXJ C;  3LCU A;  5DYG A;  2RRU A;  1QVR A;  4GH9 A;  2ERC A;  3SBJ A;  2KRU A;  3HJ8 A;  2DZN B;  3K2L A;  3A42 A;  1XMO M;  5DFL A;  1OIZ A;  3GPU A;  3AFH A;  4W5W A;  1L2C A;  3DOA A;  1QAN A;  2BWB A;  2QSF X;  4IBG A;  4MGK E;  1D2N A;  1TR8 A;  1PM5 A;  2NQ8 C;  4G3O A;  1L8Q A;  2LH0 A;  3AV0 A;  3QYE A;  5EP1 A;  5ITY A;  3SMS A;  4D82 A;  4XGI A;  2DNA A;  3UZU A;  4OVZ B;  2Y21 A;  2M5Z A;  4PD2 A;  4Z8X A;  3U6Q A;  4AG6 A;  2OO9 A;  1KFV A;  2BNK A;  2L09 A;  5EXP A;  4AKI A;  3CF6 E;  1NV8 A;  1Q3B A;  3L27 A;  1J7K A;  4M0W A;  2G5G X;  3SC3 A;  1R2Z A;  1X37 A;  1XC8 A;  2LVP C;  4LF6 M;  2XSZ A;  1MN3 A;  4M9X A;  3B9P A;  3A46 A;  1HJP A;  3SHF A;  4B3R M;  3RGP A;  2ZAO A;  3DA1 A;  3HY5 A;  1V33 A;  2J5Y A;  2BJV A;  4IBF A;  3C58 A;  1WGN A;  3R8F A;  3LQQ A;  3J81 S;  2F5S A;  2W82 A;  4CIZ A;  4LFC M;  4I8O A;  1G41 A;  4F1I A;  5E6J A;  4TUW A;  2VF7 A;  3OTO M;  3GQ5 A;  2B3T A;  4B7F A;  2VQF M;  4MM3 B;  1OFH A;  1NV9 A;  1PJS A;  4MGZ E;  2DWM A;  2XFS A;  1T6O A;  2OQ4 A;  3CTW B;  1IN7 A;  1VDL A;  2ZTD A;  1QUS A;  3I4V A;  3MJ5 A;  4II7 A;  4JN6 A;  4JI3 M;  3TWK A;  4KHP M;  1V34 A;  2R44 A;  2YQZ A;  3U6S A;  2MR9 A;  1KSF X;  4LJ8 A;  2K47 A;  2CE7 A;  2XSZ D;  2JZ0 A;  4KLN A; 
#chains in the Genus database with same CATH homology
 1K3W A;  2UUC M;  5IWA M;  4DR4 M;  2XGN A;  3M0E A;  3I4Y A;  1HQC A;  4LF8 M;  3FTD A;  5A2Q S;  4L78 A;  1XHB A;  3GRU A;  3NWL A;  5BR8 M;  4DUY M;  3FYD A;  3ZH9 B;  3EIH A;  3AL0 C;  2H1R A;  1YUB A;  1Z6T A;  4IIW A;  4DV1 M;  4MGI E;  4JI1 M;  2F4V M;  4L4U A;  1IBL M;  5FTJ A;  3W0F A;  3J2P B;  4B7G A;  3SAS A;  4AG5 A;  5EXX A;  3TWM A;  4GIT A;  2AHM A;  2X8A A;  2DWL A;  4LGY A;  2CEA A;  3FKE A;  4AW4 A;  5KQD A;  1HNX M;  2LNH C;  4LRT A;  1IN8 A;  3U6C A;  2QP9 X;  4FWD A;  4WW0 A;  1ZQ9 A;  3H4M A;  2XH9 A;  1LV7 A;  4ZPX A;  2X49 A;  1XXH B;  3HWS A;  4JI7 M;  1NJG A;  4MH0 E;  1Z5A A;  1N75 A;  4D80 A;  3T38 A;  5EXT A;  4GC5 A;  3U6O A;  2KEB A;  2QBY A;  3HU3 A;  1DGG A;  4LJ5 A;  3AKZ A;  5ITT A;  3JR5 A;  5FSW A;  5EQT A;  3KP0 E;  1QAM A;  3FUW A;  4D81 A;  3GLF B;  3E4R A;  3JAM S;  2F5N A;  3GPP A;  2Z4S A;  3M7G A;  4PT5 A;  4LCB A;  3VDU A;  2UUA M;  3FUT A;  4QNR A;  2I7P A;  4DR3 M;  3SFZ A;  4BLC A;  4DUZ M;  3R9X B;  4AI6 A;  4DV7 M;  2I7N A;  2C9C A;  4JXJ A;  4NRV A;  2F5P A;  4HL4 A;  4QHT A;  4YHH M;  3U6D A;  1Z5C A;  3MHV C;  3PFI A;  2CUZ A;  3Q8X A;  3WHK A;  1R6B X;  2O5R A;  2UXC M;  4DR5 M;  3E9S A;  5KPZ A;  2LXE A;  2UUB M;  1DO0 A;  4FW9 A;  4AZF A;  1DGH B;  4B3S M;  1QYR A;  4M0D A;  2F5Q A;  1GVN A;  4B08 A;  3TL4 X;  5EP4 A;  5FTN A;  3LVV A;  3KSX A;  4RF0 A;  2DWZ B;  1IBM M;  4YY3 M;  1G4A E;  2RGH A;  1YE9 A;  1W5S A;  4NL4 H;  1DGF A;  3KOX E;  3KSJ A;  3L25 A;  5ITX E;  3SHG B;  1T3T A;  3UGJ A;  3GLG B;  4GIP A;  4G6Z A;  4L16 A;  3I51 A;  2FE8 A;  4DR2 M;  1NJF A;  2KA6 B;  1E9R A;  2UXD M;  3SYL A;  2XZF A;  2FOI C;  3TPZ A;  2ZM6 M;  4FCW A;  3T15 A;  3AOE A;  4AKG A;  3EIE A;  4DV3 M;  1HR0 M;  3FTE A;  3A98 B;  4FD2 A;  3SYK A;  5LMN M;  4DV2 M;  5IT9 S;  3KW6 A;  4LJ6 A;  3VDP A;  3KOY E;  4DV5 M;  4X64 M;  2EUC A;  4G4Q A;  3SAT A;  1N77 A;  2Q2E B;  1VDD A;  4JI5 M;  1E9S A;  3HJS A;  3GLF A;  3AOG A;  4AKH A;  4JI2 M;  2R4J A;  3GRV A;  4GMQ A;  1DO2 A;  2CHQ A;  1I4W A;  4PDG A;  2QBY B;  1GKI A;  5JI2 E;  3KVW A;  1W5T A;  4NSR A;  4R3D A;  2CHG A;  2QEN A;  4DV0 M;  3FUV A;  4LY6 A;  4QOZ C;  3SAW A;  1NY6 A;  2D7H A;  2JA2 A;  4DR6 M;  1Q39 A;  1XXH A;  2J7N A;  3IG8 A;  4LJ9 A;  2XZU A;  1TH4 A;  2C5R A;  5FTM A;  2J7O A;  3BOS A;  1G59 A;  3GPY A;  1NNJ A;  3GLI B;  3DZD A;  2FFJ A;  5F3W A;  4A3V B;  3U5Z B;  1WXQ A;  1K3X A;  4IBB A;  1Q3C A;  4S12 A;  4CGY B;  3SAU A;  3HHY A;  1TH3 A;  3PNY A;  4OVZ A;  3A45 A;  4GKJ M;  2DZO B;  2HKJ A;  5C1B A;  3UK6 A;  3PNV A;  4ITQ A;  1SXJ E;  3KOW E;  3TE6 A;  2L6O A;  1IQP A;  1QZM A;  2Y0Q A;  2Y20 A;  3L2A A;  4P16 A;  3JR4 A;  1QQW A;  2KZU A;  4LF5 M;  5KPT A;  2RKO A;  1HNZ M;  3VLF B;  1E32 A;  4X66 M;  3T1Y M;  2A5Y B;  4IBD A;  2R46 A;  3RE8 A;  1OJL A;  4BBA A;  4GC9 A;  1JQJ C;  4REZ A;  2VQE M;  3HJQ A;  2YFQ A;  3GQ3 A;  4B3T M;  2Z7J A;  2KXE A;  3MK6 A;  3GQ4 A;  3K92 A;  3FYC A;  3GRY A;  4PCZ A;  1NY5 A;  1G3I A;  5KO3 A;  2KW0 A;  4GHL A;  4IBI A;  5BPV A;  1IXR C;  2DXI A;  5GKN A;  4OU7 A;  3FD9 A;  3CF0 A;  1EE8 A;  4EIW A;  4LFB M;  4JV5 M;  1HQY E;  3K8Z A;  5C18 A;  3UMM A;  2P5T A;  1HT1 E;  5ITQ A;  1Z59 A;  1IY2 A;  1IXZ A;  2R4E A;  2EO2 A;  3KXE C;  4I81 A;  4JI4 M;  3U6L A;  2F5O A;  4IBE A;  1QAO A;  5ITX A;  3U61 A;  3NBI A;  1TH2 A;  3LMM A;  3KFU G;  1IN6 A;  4LJ7 A;  2UU9 M;  1NNU C;  2G8L A;  3DFZ A;  4I5S A;  3D8B A;  1ORY B;  4FVM A;  5LMU M;  3U60 A;  1H6U A;  1MX0 A;  3U60 B;  2R65 A;  4CIS A;  4AQY M;  3UJN A;  1PJJ A;  3VK7 A;  3U5Z A;  1HT2 E;  4NXN M;  1XMQ M;  4L8R C;  2DHR A;  5FTK A;  3GLI A;  1L2D A;  3GPX A;  2R62 A;  2LWX A;  1K82 A;  1ZAE A;  1DGB A;  3IG5 A;  4NXM M;  2QPA A;  3KS8 A;  1L1T A;  1IN5 A;  4FWH A;  4LGM A;  3WHL A;  1IXS B;  3FUX A;  4LG2 A;  4BB9 A;  1XWI A;  4FCT A;  2ZAN A;  3J80 S;  3LVW A;  1SXJ D;  4NRW A;  2QZ4 A;  3SMP A;  1N36 M;  4K0K M;  4CHT B;  4IBJ A;  2Y0T A;  1S3S A;  5E26 A;  3GP1 A;  1E94 E;  1J5E M;  3J7A S;  4JYA M;  3K1J A;  1I94 M;  1R7R A;  4LFA M;  1GL6 A;  2C98 A;  3KOZ E;  4R7G A;  5IZ7 D;  1HNW M;  4MGY E;  1NHG C;  3VK8 A;  2BJW A;  4QHS A;  1FJG M;  1KYI A;  2L7H A;  2D7G A;  2V1U A;  1N33 M;  1TDH A;  3L28 A;  4MB7 A;  3U6P A;  2YNM D;  2VII A;  4LF9 M;  4LF7 M;  4PDI A;  5FTL A;  1IN4 A;  4IBK A;  5IRE B;  1SXJ B;  4G4R A;  2CV1 A;  4LZZ A;  3THG A;  3RGS A;  4B3M M;  2C99 A;  2OPF A;  1GL7 A;  2Z4R A;  4IJE A;  1G8P A;  3FTF A;  1SXJ A;  4M9S A;  1R2Y A;  5DNY A;  1UM8 A;  1L2B A;  4MGH A;  3D8L A;  1J09 A;  4DV4 M;  3U6E A;  5EJC A;  3W0L B;  3SAV A;  2HHH M;  4L15 A;  2UXB M;  4G4O A;  4XBO A;  4X65 M;  3AJI B;  1N78 A;  1QAQ A;  1N32 M;  4GHA A;  2CHV A;  1YSY A;  4LJA A;  1Z5B A;  1IBK M;  1DGH A;  4DV6 M;  3VFD A;  5EXS A;  2EA0 A;  3GLH B;  5H37 D;  4IBC A;  4LZJ A;  2HL7 A;  2DWN A;  3SAR A;  3KDS E;  3QWL A;  4JI0 M;  3GO8 A;  3L26 A;  4FWG A;  2YR0 A;  2C9O A;  4LRS A;  2ZAM A;  2D7E A;  2CV0 A;  3HGI A;  1JR3 A;  2C96 A;  2L7I A;  3HKP A;  4IJF A;  5FLX S;  2RGO A;  3M6A A;  3HU1 A;  2CV2 A;  3VKG A;  3GLH A;  4OX9 M;  3J7B A;  3ZCB B;  3HHZ A;  3FUU A;  5EP2 A;  3VKH A;  4KOD A;  2V1C A;  3HU2 A;  1NVM A;  2FNA A;  1C1K A;  1OFI A;  5ITU A;  1XNQ M;  1XNR M;  2Z3X A;  3U6M A;  4RNA A;  2R45 A;  2E5L M;  3LQR A;  4QOS A;  4GRI A;  1IM2 A;  2QCU A;  4HLQ A;  4GKK M;  3PXG A;  2HCB A;  4X62 M;  2R18 A;  3TWL A;  4DR1 M;  3CF2 A;  2XEP A;  4WUR A;  3U61 B;  1FNN A;  4FCV A;  4DR7 M;  4OW0 A;  5JI3 E;  3GRR A;  3PVS A;  3AOE C;  5KQ8 A;  1GLN A;  2ZBK B;  4NSO B;  3J27 B;  1TGU A;  5KPR A;  4QNM A;  3GLG A;  4LJ4 A;  4JI6 M;  3TQS A;  2KZS A;  3RFW A;  4LF4 M;  1JR3 D;  4I4L A;  1L1Z A;  2CFO A;  1MU5 A;  1NHW C;  1N34 M;  3ZC7 B;  1NSF A;  3L29 A;  5ITR A;  8CAT A;  3ILK A;  3KP1 E;  2XFT A;  2V6Z M;  3T1H M;  2M60 A;  3FTC A;  4G4N A;  4Z6Y A;  5EP3 A;  1IY1 A;  1PJI A;  4KO8 A;  2X4A A;  1TDZ A;  2XF3 A;  3KS4 A;  3QAU A;  4NOO B;  3HHX A;  4RF1 A;  4JI8 M;  7CAT A;  2KRK A;  1IY0 A;  2DVW B;  4B7H A;  5DYI A;  3HHW A;  2XLJ A;  1SXJ C;  5DYG A;  1QVR A;  4GH9 A;  2ERC A;  3SBJ A;  2KRU A;  3HJ8 A;  2DZN B;  3K2L A;  3A42 A;  1XMO M;  1L2C A;  3GPU A;  3AFH A;  4W5W A;  3DOA A;  1QAN A;  4MGK E;  4IBG A;  1D2N A;  1PM5 A;  2NQ8 C;  1L8Q A;  2LH0 A;  3AV0 A;  5EP1 A;  5ITY A;  3SMS A;  4D82 A;  4XGI A;  3UZU A;  4OVZ B;  2Y21 A;  2M5Z A;  4PD2 A;  4Z8X A;  3U6Q A;  4AG6 A;  1KFV A;  2BNK A;  2L09 A;  5EXP A;  4AKI A;  3CF6 E;  1Q3B A;  3L27 A;  1J7K A;  4M0W A;  2G5G X;  3SC3 A;  1R2Z A;  1X37 A;  1XC8 A;  4LF6 M;  2XSZ A;  4M9X A;  3B9P A;  3A46 A;  3SHF A;  4B3R M;  3RGP A;  2ZAO A;  3DA1 A;  3R8F A;  2BJV A;  4IBF A;  3C58 A;  3LQQ A;  3J81 S;  2F5S A;  2W82 A;  4LFC M;  4I8O A;  1G41 A;  5E6J A;  4TUW A;  3OTO M;  3GQ5 A;  4B7F A;  2VQF M;  4MM3 B;  1OFH A;  4MGZ E;  2DWM A;  2XFS A;  2OQ4 A;  3CTW B;  1IN7 A;  4II7 A;  3MJ5 A;  4JN6 A;  3I4V A;  3TWK A;  4JI3 M;  4KHP M;  2YQZ A;  3U6S A;  1KSF X;  4LJ8 A;  2K47 A;  2CE7 A;  2XSZ D;  4M9Z A;  4KLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...