2HL7A

Crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
GSHMAIDTYEFASDAERERFRNLTQELRCPKCQNQDIADSNAPIAADLRKQIYGQLQQGKSDGEIVDYMVARYGDFVRYKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome C-type biogenesis protein CcmH
publication title A strategic protein in cytochrome c maturation: three-dimensional structure of CcmH and binding to apocytochrome c
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 29
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.640 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2hl7A00
2KW0A 2HL7A
chains in the Genus database with same CATH superfamily
2L09A 2FFJA 2UUAM 1IXZA 1V92A 1DGGA 3KOWE 4G4RA 2OOAA 4DR3M 2R4EA 2LVPC 1HT1E 2XFTA 5DYIA 4K0KM 2K47A 1FJGM 3VKGA 1RU3A 4LJ8A 2DENA 3VK8A 2DXIA 3B7QA 1CUKA 4GKJM 2N35A 2CE7A 3J27B 3LVWA 2EKFA 2V6ZM 4NSRA 3R8FA 5FSWA 2WSFF 2Y20A 1OAOC 4UN2B 2EA0A 3T6PA 4AI6A 2L6OA 3KOXE 2Y0TA 5BR8M 3ZH9B 1XXHE 2QCUA 4DUYM 1PGYA 1XB2B 2F4VM 2F5OA 1JQJC 1Z5BA 4G3OA 4P17A 2HL7A 4LZJA 2G3QA 4LJAA 1L1TA 2APLA 1T43A 2JNHA 1TDZA 1C1KA 4LF7M 2DWLA 2LH0A 1HT2E 2MR9A 1GO5A 1JR3D 1R4GA 2KNZA 3HU3A 2QBYA 2Z4SA 3SYLA 2JUJA 4G4NA 4KLNA 4BB9A 4LF6M 1Z5CA 2VF7A 2CV1A 4AG5A 4FVMA 2C5RA 4JI7M 1FNNA 1WHCA 2M5ZA 2Z4RA 1S3SA 3BBZA 3T1YM 3L29A 5EXXA 3I51A 1IN8A 3M6AA 1HNWM 2DAKA 1XNRM 1XXHB 1VEKA 4QHTA 3E4RA 2Q2EB 4LF4M 2XEPA 2EKKA 3AOGA 1DO2A 4B3TM 4BBAA 1XNQM 3K1JA 4HL4A 1DGHA 4B7GA 4L15A 2G8LA 3HY5A 1Z59A 3GLGA 4D82A 2UXBM 3M7GA 1BVSA 3D8LA 1OAIA 1AUAA 2CUZA 3CF2A 1SXJD 1HNXM 1G3IA 2C99A 3F92A 5ITUA 1JR3A 1T3TA 4R71A 3LQQA 1Z5AA 2C96A 4PCZA 1QYRA 3M0EA 4XK8F 3SATA 2HHHM 1TF0B 3FD9A 4R3DA 3UZUA 4XBOA 2LBCA 3L26A 4B3RM 2HWJA 1QVRA 4R7GA 2Z3XA 4NL4H 5FTMA 5KPTA 2R6FA 3HX3A 1SG9A 1PRBA 2FE8A 3D8BA 4EIWA 3B9PA 4REZA 3B89A 1P3QQ 4MGKE 3HZJA 1IXSA 2GQFA 4NRVA 2HCBA 4CGYB 4Q7JA 2J7OA 2G5GX 3GLHE 5EXPA 2H1RA 3VLFB 3SAUA 2DHRA 2J7NA 4S12A 2JXNA 2R65A 4LJ4A 4IBDA 4CJ6A 3BXWA 3GRVA 4DUZM 3DFZA 2UU9M 1IY2A 1NV8A 2WSCF 1OFIA 4HLQA 1YE9A 1SXJA 4GKKM 3H4JA 4GEWA 2ZTDA 3AL0C 3DOAA 3CF0A 2JZ1A 3KP1E 3CF6E 1XMQM 3FUTA 2L2DA 2LVNC 4G6ZA 1PM5A 4WW0A 4JI6M 5FLXS 1R2YA 4IBGA 1IN6A 3NBXX 5IWAM 1GL7A 1PJTA 2RGHA 4PD2A 1QQWA 4CISA 4MGIE 2LTUA 3FRIA 3L27A 3NWLA 2JWSA 3GLGE 2EUCA 4X62M 3GLHB 4B08A 4JXJA 1N34M 2DWNA 2HAKA 2YQZA 2FOIC 4II7A 1Q39A 3U6LA 3RFWA 1JR3E 4GC9A 1N36M 1D0LA 1QAQA 1E32A 4FD2A 3FUXA 1G59A 4YHHM 3FUUA 4LJ5A 4DR2M 4LFBM 2H5XA 2X8AA 2HKJA 4LRTA 1XMOM 3K92A 2CWBA 1ORYB 3SAWA 5IZ7D 2V1CA 1NJFA 4A3VB 3C58A 1N32M 5FTNA 1XC8A 1UFZA 4LRSA 1ZAEA 2KNAA 2LWXA 1OJLA 3U61B 3KSXA 3FYDA 4IJEA 1IN7A 4F1IA 3FKEA 3GLGB 3U5ZA 4ZPXA 3QYEA 4B7FA 4MGZE 3U60A 4JI5M 1NJGA 2JY6B 2CV2A 2F5NA 3KFUG 5EXSA 4IBIA 5L8RF 4LJ6A 4DR6M 3AV0A 1KYIA 2Y0QA 1N33M 4GIPA 2ERCA 4QHSA 3VFDA 4L6V6 3GP1A 4RNAA 3J80S 4NOOB 1SXJE 3K9OA 4OX9M 2QSFX 5FTJA 2K6BA 2OOBA 1VEJA 2KEBA 4DV1M 2VF8A 5DNYA 3TQSA 3FUWA 1G71A 2KDLA 1DO0A 2C9OA 4MB7A 4GHLA 2CEAA 1IXSB 3GLIA 1Y8GA 5A2QS 1R5LA 1L1ZA 4OVZA 3SBJA 1I94M 4QOSA 2K9DA 2LVOC 3C3EA 3Q8XA 3QYBA 4NXNM 4RF1A 5ITTA 1YLAA 4AZFA 3SHFA 1TH4A 3ZC7B 1K3XA 1GKIA 3SMPA 1GVNA 1QZEA 4IBEA 2R0IA 4FCWA 2LNHC 2DKLA 4M0DA 3T1HM 5LMUM 1WGLA 1SXJB 1W5SA 1L8QA 1VQ1A 4G4OA 2L7IA 2KRKA 4FWHA 3K2LA 1WXQA 2M60A 2BWEA 2QQ8A 4DV7M 4GITA 2LXEA 4P16A 4LF9M 3FRHA 4KODA 2BJVA 1HJPA 2ZAOA 2JA2A 1IBMM 3HWSA 2UUBM 3AOEA 3MHVC 1OFHA 1KFVA 2DZLA 5ITRA 2L4EA 3J7BA 3FTEA 1QDRA 2Z7JA 2DVWB 4G4QA 2K0BX 2ZM6M 1OIPA 5FTKA 4JI4M 2BNKA 2EJSA 2LHGA 2R62A 2I7NA 4FCVA 3B7NA 3I01M 1R2ZA 4PT5A 3VDUA 4PDIA 1NNJA 1PJIA 1IQPA 3KVWA 2XSZD 1Q02A 1WJ7A 2I7PA 2X49A 2D7HA 5KQDA 1G4AE 2KNVA 4QOZC 4FWGA 2VIIA 3UMMA 4AKGA 4AQYM 1QUTA 3BOSA 2QHOB 2P5TA 3KOZE 3QWLA 1J09A 1TR8A 2FH0A 2J5YA 3KS4A 5EP4A 3J81S 3L25A 2F5QA 3TWLA 4DR1M 3MK6A 4IBCA 2L4FA 1IM2A 5FTLA 2JY7A 4X64M 1L2DA 3GLIE 4I4LA 3C3DA 3GRYA 3I4VA 4LGMA 2EO2A 4MM3B 3U60B 4ITQA 3FYCA 4LGYA 4DR7M 2ZBKB 4OW0A 4LG2A 4DR4M 3T15A 1K82A 4AKIA 3R9XB 3GQ5A 2FS1A 4L16A 4JI1M 3B7ZA 1HNZM 4JV5M 3HGIA 1J5EM 3SARA 2CHQA 1Q3BA 4MGYE 4JI0M 4LCBA 1GABA 1IY1A 2OO9A 2XSZA 2CV0A 1GJTA 1IN5A 3UK6A 2CRUA 5H37D 1PJSA 1LTMA 5EP1A 3SASA 4JI8M 2KA6B 4IBFA 3FTDA 3LCVB 3HHYA 2CHVA 4MGHA 3SYKA 1XWIA 4FCTA 3GLIB 2LVAA 2RRUA 5EP2A 4OVZB 4GH9A 2QBYB 4NRWA 4KHPM 1QDTA 4DV2M 4LFCM 3ZQJA 4NSOB 4LF8M 4DV4M 3RE8A 3A45A 1MJGM 3FUVA 1XXHA 2BWBA 4XGIA 1MN3A 3HHZA 4OU7A 4WURA 4B3SM 2DAGA 1NY6A 3U6CA 3IECA 3E46A 4JYAM 1NSFA 3UGJA 3SMSA 2VQEM 3HJQA 7CATA 3E9SA 5KQ8A 1NVMA 1OQYA 4L4UA 1VEGA 3WHLA 4JI2M 4BLCA 5E6JA 1HR0M 2JY8A 1NY5A 1DGHB 3A42A 3GQ4A 3W0FA 3GPYA 3V76A 4AW4A 4X65M 3LVVA 1K3WA 1Q3CA 3RGPA 4RF0A 1OTRA 2CHGA 2QP9X 2D7GA 4W5WA 5ITXA 2CP8A 2DZOB 3W67A 4L8RC 1DGFA 2XFSA 1GL6A 3Q8GA 4IBJA 3KXEC 1QAOA 5IT9S 1MX0A 1QZMA 2YFQA 2WSEF 4GC5A 3KW6A 4L78A 5ITYA 3IG5A 3U6SA 1NHGC 2UXDM 4GRIA 3U6MA 4TUWA 1SXJC 1NHWC 1TH2A 2OPFA 3KS8A 3HHXA 2C9CA 3JR4A 3THGA 1LV7A 2KRUA 3J2PB 3KSJA 3J7AS 2XF3A 2YR0A 3HJSA 4RKUF 2E5LM 5EP3A 2WZJA 2KW0A 3GLFA 1TGUA 5DFLA 1T6OA 2BJWA 1E9RA 3IHPA 4NC6A 1UM8A 2XH9A 2DNAA 5LMNM 2LVQD 4FW9A 5BPVA 1N78A 2MGWA 1IY0A 1TDHA 1QAMA 2QNJA 1I4WA 3ILKA 4I5SA 1F4IA 2JP7A 2DAEA 3NBIA 1E9SA 1WR1B 1G41A 4Z8XA 4AKHA 2A5YB 4JI3M 3GPPA 4D81A 4LF5M 2QZ4A 4Z6YA 2NQ8C 1IFYA 3MMPA 2Y21A 1HQYE 1GJSA 1YUBA 5EJCA 2DHYA 2ZTCA 2DI0A 3JAMS 3FTCA 3HU2A 2AHMA 4CIZA 1VDLA 2ZAMA 2FNAA 3E21A 3SC3A 1TTEA 4DV0M 4NXMM 3GLHA 3JR5A 5DYGA 1PJQA 4IJFA 3A46A 2R18A 1D0KA 4D80A 4LJ9A 2KZSA 1EIJA 4LJ7A 1W5TA 3KP0E 3DZDA 3K8ZA 3WHKA 3U6OA 1XHBA 3I4YA 3VKHA 1G8PA 2UXCM 2YNMD 1H6UA 2DAIA 4WP2A 1TH3A 5ITXE 3SFZA 2QPAA 3PNYA 5ITQA 2R4JA 4YY3M 4B3MM 1DGBA 2ZANA 5GKNA 2XLJA 1AIPC 2O25A 1ZMUA 4PDGA 2O01F 1GLNA 2Z8YM 3A98B 3U61A 1Z6TA 1QUSA 3IG8A 2F5PA 1EFUB 3LW5F 5JI3E 3LQRA 1OKSA 5C18A 2OQ4A 2MROB 4GMQA 1C7YA 2D7EA 3GRUA 4M9XA 1NO1A 5EXTA 2C98A 2R46A 2O5RA 3B74A 4M9SA 3TWKA 1VDDA 3GLFE 4QNMA 4DBGB 3HHWA 3U5ZB 2KZUA 3I04M 4M0WA 1ZV1A 2VQFM 1VG5A 3HKPA 3SAVA 5E26A 2VDBB 3LCUA 1R6BX 1OIZA 4DR5M 2F5SA 1J7KA 2RGOA 2JY5A 5IREB 3PNVA 3GQ3A 1MU5A 1QANA 1R7RA 4I8OA 4IBKA 3UJNA 3TWMA 4KT0F 2UUCM 2R45A 1D0MA 1D2NA 1NV9A 3CTWB 3U6PA 4X66M 2LHCA 2RKOA 8CATA 3VDPA 4HEOA 1PJJA 1WIVA 3SHGB 1YSYA 3K9PA 1V34A 3L2AA 4LY6A 4GHAA 3U6DA 3GLFB 3H4MA 4M9ZA 3RGSA 2DAMA 1L2BA 2KHHA 2W82A 2QENA 2DWMA 3LMMA 3AKZA 4Y28F 4LZZA 1N75A 4I81A 2CFOA 3AOEC 4F2LA 4CHTB 1V33A 4ANRA 3T38A 3FE3A 1N77A 4DV3M 2XZFA 1E94E 1WGNA 3GO8A 5EQTA 3QAUA 3TL4X 3HJ8A 3W68A 4DV5M 2GNOA 1IN4A 2B3TA 5KPRA 2V1UA 3AJIB 3TE6A 4KO8A 2MH8A 2KXEA 4IBBA 4LFAM 4IIWA 3C9PA 3OTOM 3U6QA 1X37A 3GPXA 2X4AA 5F3WA 1NNUC 3EIEA 3L28A 3KDSE 3MJ5A 5KPZA 5C1BA 3KOYE 3GPUA 2L7HA 4JN6A 2XZUA 1L2CA 3PFIA 4MH0E 3EIHA 1EE8A 3GRRA 5KO3A 4QNRA 3HU1A 1JB0F 3ZCBB 5JI2E 1DV0A 1ZMVA 4AG6A 2DWZB 3VK7A 1ZQ9A 2XGNA 1HQCA 3FTFA 2MJ5B 4B7HA 4DV6M 1A5TA 3CGWA 1IXRC 3PVSA 3PXGA 2DZNB 3W0LB 3U6EA 1KSFX 1IBLM 1IBKM 2R44A 3DA1A 4FWDA 1ZMWA 3AFHA 3TPZA 2JZ0A
chains in the Genus database with same CATH topology
2L09A 2FFJA 2UUAM 1IXZA 4G4RA 1DGGA 3KOWE 4DR3M 2R4EA 1HT1E 2XFTA 5DYIA 4K0KM 2K47A 1FJGM 3VKGA 1N33M 4LJ8A 2DXIA 3VK8A 4GKJM 2CE7A 3J27B 3LVWA 2V6ZM 4NSRA 3R8FA 5FSWA 2Y20A 2EA0A 4AI6A 2L6OA 3KOXE 2Y0TA 5BR8M 3ZH9B 2QCUA 4DUYM 2F4VM 2F5OA 1JQJC 1Z5BA 2HL7A 4LZJA 4LJAA 1L1TA 1TDZA 1C1KA 4LF7M 2DWLA 2LH0A 1HT2E 1JR3D 3HU3A 2QBYA 2Z4SA 3SYLA 4G4NA 4KLNA 4BB9A 4LF6M 1Z5CA 2CV1A 4AG5A 4FVMA 2C5RA 4JI7M 1FNNA 2M5ZA 2Z4RA 1S3SA 3T1YM 3L29A 5EXXA 3I51A 1IN8A 3M6AA 1HNWM 1XNRM 1XXHB 4QHTA 3E4RA 2Q2EB 4LF4M 2XEPA 3AOGA 1DO2A 4B3TM 4BBAA 1XNQM 3K1JA 4HL4A 1DGHA 4B7GA 4L15A 2G8LA 3GLGA 1Z59A 2UXBM 4D82A 3M7GA 3D8LA 2CUZA 3CF2A 1SXJD 1HNXM 1G3IA 2C99A 5ITUA 1JR3A 1T3TA 3LQQA 1Z5AA 2C96A 4PCZA 1QYRA 3M0EA 3SATA 2HHHM 3FD9A 4R3DA 3UZUA 4XBOA 4B3RM 3L26A 1QVRA 4R7GA 2Z3XA 4NL4H 5FTMA 5KPTA 2FE8A 3D8BA 4EIWA 3B9PA 4REZA 4MGKE 4NRVA 2HCBA 4CGYB 2J7OA 2G5GX 5EXPA 2H1RA 3VLFB 3SAUA 2DHRA 2J7NA 4S12A 2R65A 4LJ4A 4IBDA 3GRVA 4DUZM 3DFZA 2UU9M 1IY2A 1OFIA 4HLQA 1YE9A 1SXJA 4GKKM 3AL0C 3DOAA 3CF0A 3KP1E 1XMQM 3CF6E 1PM5A 3FUTA 4G6ZA 4WW0A 4JI6M 5FLXS 1R2YA 4IBGA 1IN6A 5IWAM 1GL7A 2RGHA 4PD2A 1QQWA 4CISA 4MGIE 3L27A 3NWLA 2EUCA 4X62M 3GLHB 4B08A 4JXJA 1N34M 2DWNA 2YQZA 2FOIC 4II7A 1Q39A 3U6LA 3RFWA 4GC9A 1N36M 1QAQA 1E32A 4FD2A 3FUXA 1G59A 4YHHM 3FUUA 4LJ5A 4DR2M 4LFBM 2X8AA 2HKJA 4LRTA 1XMOM 3K92A 1ORYB 5IZ7D 2V1CA 1NJFA 4A3VB 3C58A 5FTNA 1XC8A 4LRSA 1ZAEA 2LWXA 1OJLA 3U61B 3KSXA 3FYDA 4IJEA 1IN7A 3FKEA 3GLGB 3U5ZA 4ZPXA 4B7FA 4MGZE 3U60A 4JI5M 1NJGA 2CV2A 2F5NA 3KFUG 5EXSA 4IBIA 4LJ6A 4DR6M 3AV0A 1KYIA 2Y0QA 4GIPA 2ERCA 4QHSA 3VFDA 3GP1A 4RNAA 3J80S 4NOOB 1SXJE 4OX9M 5FTJA 2KEBA 4DV1M 5DNYA 3TQSA 3FUWA 1DO0A 2C9OA 4MB7A 4GHLA 2CEAA 1IXSB 3GLIA 5A2QS 1L1ZA 4OVZA 3SBJA 1I94M 4QOSA 4NXNM 3Q8XA 5ITTA 4RF1A 4AZFA 3SHFA 1TH4A 3ZC7B 1K3XA 1GKIA 3SMPA 1GVNA 4IBEA 4FCWA 2LNHC 4M0DA 3T1HM 5LMUM 1SXJB 1W5SA 1L8QA 4G4OA 2L7IA 2KRKA 4FWHA 3K2LA 1WXQA 2M60A 4DV7M 4GITA 2LXEA 4P16A 4LF9M 4KODA 2BJVA 2ZAOA 2JA2A 1IBMM 3HWSA 2UUBM 3AOEA 3MHVC 1OFHA 1KFVA 5ITRA 3J7BA 3FTEA 2Z7JA 2DVWB 4G4QA 2ZM6M 5FTKA 4JI4M 2BNKA 2R62A 4FCVA 2I7NA 1R2ZA 4PT5A 3VDUA 4PDIA 1NNJA 1PJIA 1IQPA 3KVWA 2XSZD 2X49A 2I7PA 2D7HA 5KQDA 1G4AE 4QOZC 4FWGA 2VIIA 3UMMA 4AKGA 4AQYM 3BOSA 3KOZE 2P5TA 3SAWA 3QWLA 1J09A 3J81S 5EP4A 3KS4A 3L25A 2F5QA 3TWLA 4DR1M 3MK6A 4IBCA 1IM2A 5FTLA 4X64M 1L2DA 4I4LA 3GRYA 3I4VA 4LGMA 2EO2A 4MM3B 3U60B 4ITQA 3FYCA 4LGYA 4DR7M 2ZBKB 4OW0A 4LG2A 4DR4M 3T15A 1K82A 4AKIA 3R9XB 3GQ5A 4L16A 4JI1M 1HNZM 4JV5M 3HGIA 1J5EM 3SARA 2CHQA 1Q3BA 4MGYE 4JI0M 4LCBA 1IY1A 2XSZA 2CV0A 1IN5A 3UK6A 5H37D 5EP1A 3SASA 4JI8M 2KA6B 4IBFA 3FTDA 3HHYA 2CHVA 4MGHA 3SYKA 1XWIA 4FCTA 3GLIB 5EP2A 4OVZB 4GH9A 2QBYB 4NRWA 4KHPM 4DV2M 4LFCM 4NSOB 4LF8M 4DV4M 3RE8A 3A45A 3FUVA 1XXHA 4XGIA 3HHZA 4OU7A 4WURA 4B3SM 1NY6A 3U6CA 4JYAM 1NSFA 3UGJA 3SMSA 2VQEM 3HJQA 7CATA 3E9SA 5KQ8A 1NVMA 4L4UA 3WHLA 4JI2M 4BLCA 5E6JA 1HR0M 1NY5A 1DGHB 3A42A 3GQ4A 3W0FA 3GPYA 4AW4A 4X65M 3LVVA 1K3WA 1Q3CA 3RGPA 4RF0A 2CHGA 2QP9X 2D7GA 4W5WA 5ITXA 2DZOB 4L8RC 1DGFA 2XFSA 1GL6A 4IBJA 3KXEC 1QAOA 5IT9S 1MX0A 1QZMA 2YFQA 4GC5A 5ITYA 3KW6A 4L78A 3IG5A 3U6SA 1NHGC 2UXDM 4GRIA 3U6MA 4TUWA 1SXJC 1NHWC 1TH2A 2OPFA 3KS8A 3HHXA 2C9CA 3JR4A 3THGA 1LV7A 2KRUA 3J2PB 3KSJA 3J7AS 2XF3A 2YR0A 3HJSA 2E5LM 5EP3A 2KW0A 3GLFA 1TGUA 2BJWA 1E9RA 1UM8A 2XH9A 5LMNM 4FW9A 5BPVA 1N78A 1IY0A 3ILKA 1QAMA 1TDHA 1I4WA 4I5SA 3NBIA 1E9SA 4AKHA 1G41A 4Z8XA 2A5YB 4JI3M 3GPPA 4D81A 4LF5M 2QZ4A 4Z6YA 2NQ8C 2Y21A 1HQYE 1YUBA 5EJCA 3JAMS 3HU2A 3FTCA 2AHMA 1N32M 2ZAMA 3SC3A 2FNAA 4NXMM 4DV0M 3GLHA 3JR5A 5DYGA 4IJFA 3A46A 2R18A 4D80A 4LJ9A 2KZSA 4LJ7A 1W5TA 3KP0E 3DZDA 3K8ZA 3WHKA 3U6OA 1XHBA 3I4YA 3VKHA 1G8PA 2UXCM 2YNMD 1H6UA 5ITXE 1TH3A 3SFZA 2QPAA 3PNYA 5ITQA 2R4JA 4YY3M 4B3MM 1DGBA 2ZANA 5GKNA 2XLJA 4PDGA 1GLNA 3A98B 3U61A 1Z6TA 3IG8A 2F5PA 5JI3E 3LQRA 5C18A 2OQ4A 4GMQA 2D7EA 3GRUA 4M9XA 5EXTA 2C98A 2R46A 2O5RA 3U5ZB 4M9SA 3TWKA 1VDDA 4QNMA 3HHWA 2KZUA 4M0WA 2VQFM 3HKPA 3SAVA 5E26A 1R6BX 4DR5M 2F5SA 1J7KA 2RGOA 5IREB 3PNVA 3GQ3A 1MU5A 1QANA 1R7RA 4I8OA 4IBKA 3UJNA 3TWMA 2UUCM 2R45A 1D2NA 3CTWB 3U6PA 4X66M 2RKOA 8CATA 3VDPA 1PJJA 3SHGB 1YSYA 3L2AA 4LY6A 4GHAA 3U6DA 3GLFB 3H4MA 4M9ZA 3RGSA 1L2BA 2W82A 2QENA 2DWMA 3LMMA 3AKZA 4LZZA 1N75A 4I81A 2CFOA 3AOEC 4CHTB 1N77A 3T38A 4DV3M 2XZFA 1E94E 3GO8A 5EQTA 3QAUA 3TL4X 3HJ8A 4DV5M 1IN4A 5KPRA 2V1UA 3AJIB 3TE6A 4KO8A 2KXEA 4IBBA 4LFAM 4IIWA 3OTOM 3U6QA 1X37A 3GPXA 2X4AA 5F3WA 1NNUC 3EIEA 3L28A 3KDSE 3MJ5A 5KPZA 5C1BA 3KOYE 3GPUA 2L7HA 4JN6A 2XZUA 1L2CA 3PFIA 4MH0E 3EIHA 1EE8A 3GRRA 5KO3A 4QNRA 3HU1A 3ZCBB 5JI2E 4AG6A 2DWZB 3VK7A 1ZQ9A 2XGNA 1HQCA 3FTFA 4B7HA 4DV6M 1IXRC 3PVSA 3PXGA 2DZNB 3W0LB 3U6EA 1KSFX 1IBLM 1IBKM 3DA1A 4FWDA 3TPZA 3AFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW0 A;  2HL7 A; 
#chains in the Genus database with same CATH topology
 2L09 A;  2FFJ A;  2UUA M;  1IXZ A;  1V92 A;  1DGG A;  3KOW E;  4G4R A;  2OOA A;  4DR3 M;  2R4E A;  2LVP C;  1HT1 E;  2XFT A;  5DYI A;  4K0K M;  2K47 A;  1FJG M;  3VKG A;  1RU3 A;  4LJ8 A;  2DEN A;  3VK8 A;  2DXI A;  3B7Q A;  1CUK A;  4GKJ M;  2N35 A;  2CE7 A;  3J27 B;  3LVW A;  2EKF A;  2V6Z M;  4NSR A;  3R8F A;  5FSW A;  2WSF F;  2Y20 A;  1OAO C;  4UN2 B;  2EA0 A;  3T6P A;  4AI6 A;  2L6O A;  3KOX E;  2Y0T A;  5BR8 M;  3ZH9 B;  1XXH E;  2QCU A;  4DUY M;  1PGY A;  1XB2 B;  2F4V M;  2F5O A;  1JQJ C;  1Z5B A;  4G3O A;  4P17 A;  2HL7 A;  4LZJ A;  2G3Q A;  4LJA A;  1L1T A;  2APL A;  1T43 A;  2JNH A;  1TDZ A;  1C1K A;  4LF7 M;  2DWL A;  2LH0 A;  1HT2 E;  2MR9 A;  1GO5 A;  1JR3 D;  1R4G A;  2KNZ A;  3HU3 A;  2QBY A;  2Z4S A;  3SYL A;  2JUJ A;  4G4N A;  4KLN A;  4BB9 A;  4LF6 M;  1Z5C A;  2VF7 A;  2CV1 A;  4AG5 A;  4FVM A;  2C5R A;  4JI7 M;  1FNN A;  1WHC A;  2M5Z A;  2Z4R A;  1S3S A;  3BBZ A;  3T1Y M;  3L29 A;  5EXX A;  3I51 A;  1IN8 A;  3M6A A;  1HNW M;  2DAK A;  1XNR M;  1XXH B;  1VEK A;  4QHT A;  3E4R A;  2Q2E B;  4LF4 M;  2XEP A;  2EKK A;  3AOG A;  1DO2 A;  4B3T M;  4BBA A;  1XNQ M;  3K1J A;  4HL4 A;  1DGH A;  4B7G A;  4L15 A;  2G8L A;  3HY5 A;  1Z59 A;  3GLG A;  4D82 A;  2UXB M;  3M7G A;  1BVS A;  3D8L A;  1OAI A;  1AUA A;  2CUZ A;  3CF2 A;  1SXJ D;  1HNX M;  1G3I A;  2C99 A;  3F92 A;  5ITU A;  1JR3 A;  1T3T A;  4R71 A;  3LQQ A;  1Z5A A;  2C96 A;  4PCZ A;  1QYR A;  3M0E A;  4XK8 F;  3SAT A;  2HHH M;  1TF0 B;  3FD9 A;  4R3D A;  3UZU A;  4XBO A;  2LBC A;  3L26 A;  4B3R M;  2HWJ A;  1QVR A;  4R7G A;  2Z3X A;  4NL4 H;  5FTM A;  5KPT A;  2R6F A;  3HX3 A;  1SG9 A;  1PRB A;  2FE8 A;  3D8B A;  4EIW A;  3B9P A;  4REZ A;  3B89 A;  1P3Q Q;  4MGK E;  3HZJ A;  1IXS A;  2GQF A;  4NRV A;  2HCB A;  4CGY B;  4Q7J A;  2J7O A;  2G5G X;  3GLH E;  5EXP A;  2H1R A;  3VLF B;  3SAU A;  2DHR A;  2J7N A;  4S12 A;  2JXN A;  2R65 A;  4LJ4 A;  4IBD A;  4CJ6 A;  3BXW A;  3GRV A;  4DUZ M;  3DFZ A;  2UU9 M;  1IY2 A;  1NV8 A;  2WSC F;  1OFI A;  4HLQ A;  1YE9 A;  1SXJ A;  4GKK M;  3H4J A;  4GEW A;  2ZTD A;  3AL0 C;  3DOA A;  3CF0 A;  2JZ1 A;  3KP1 E;  3CF6 E;  1XMQ M;  3FUT A;  2L2D A;  2LVN C;  4G6Z A;  1PM5 A;  4WW0 A;  4JI6 M;  5FLX S;  1R2Y A;  4IBG A;  1IN6 A;  3NBX X;  5IWA M;  1GL7 A;  1PJT A;  2RGH A;  4PD2 A;  1QQW A;  4CIS A;  4MGI E;  2LTU A;  3FRI A;  3L27 A;  3NWL A;  2JWS A;  3GLG E;  2EUC A;  4X62 M;  3GLH B;  4B08 A;  4JXJ A;  1N34 M;  2DWN A;  2HAK A;  2YQZ A;  2FOI C;  4II7 A;  1Q39 A;  3U6L A;  3RFW A;  1JR3 E;  4GC9 A;  1N36 M;  1D0L A;  1QAQ A;  1E32 A;  4FD2 A;  3FUX A;  1G59 A;  4YHH M;  3FUU A;  4LJ5 A;  4DR2 M;  4LFB M;  2H5X A;  2X8A A;  2HKJ A;  4LRT A;  1XMO M;  3K92 A;  2CWB A;  1ORY B;  3SAW A;  5IZ7 D;  2V1C A;  1NJF A;  4A3V B;  3C58 A;  1N32 M;  5FTN A;  1XC8 A;  1UFZ A;  4LRS A;  1ZAE A;  2KNA A;  2LWX A;  1OJL A;  3U61 B;  3KSX A;  3FYD A;  4IJE A;  1IN7 A;  4F1I A;  3FKE A;  3GLG B;  3U5Z A;  4ZPX A;  3QYE A;  4B7F A;  4MGZ E;  3U60 A;  4JI5 M;  1NJG A;  2JY6 B;  2CV2 A;  2F5N A;  3KFU G;  5EXS A;  4IBI A;  5L8R F;  4LJ6 A;  4DR6 M;  3AV0 A;  1KYI A;  2Y0Q A;  1N33 M;  4GIP A;  2ERC A;  4QHS A;  3VFD A;  4L6V 6;  3GP1 A;  4RNA A;  3J80 S;  4NOO B;  1SXJ E;  3K9O A;  4OX9 M;  2QSF X;  5FTJ A;  2K6B A;  2OOB A;  1VEJ A;  2KEB A;  4DV1 M;  2VF8 A;  5DNY A;  3TQS A;  3FUW A;  1G71 A;  2KDL A;  1DO0 A;  2C9O A;  4MB7 A;  4GHL A;  2CEA A;  1IXS B;  3GLI A;  1Y8G A;  5A2Q S;  1R5L A;  1L1Z A;  4OVZ A;  3SBJ A;  1I94 M;  4QOS A;  2K9D A;  2LVO C;  3C3E A;  3Q8X A;  3QYB A;  4NXN M;  4RF1 A;  5ITT A;  1YLA A;  4AZF A;  3SHF A;  1TH4 A;  3ZC7 B;  1K3X A;  1GKI A;  3SMP A;  1GVN A;  1QZE A;  4IBE A;  2R0I A;  4FCW A;  2LNH C;  2DKL A;  4M0D A;  3T1H M;  5LMU M;  1WGL A;  1SXJ B;  1W5S A;  1L8Q A;  1VQ1 A;  4G4O A;  2L7I A;  2KRK A;  4FWH A;  3K2L A;  1WXQ A;  2M60 A;  2BWE A;  2QQ8 A;  4DV7 M;  4GIT A;  2LXE A;  4P16 A;  4LF9 M;  3FRH A;  4KOD A;  2BJV A;  1HJP A;  2ZAO A;  2JA2 A;  1IBM M;  3HWS A;  2UUB M;  3AOE A;  3MHV C;  1OFH A;  1KFV A;  2DZL A;  5ITR A;  2L4E A;  3J7B A;  3FTE A;  1QDR A;  2Z7J A;  2DVW B;  4G4Q A;  2K0B X;  2ZM6 M;  1OIP A;  5FTK A;  4JI4 M;  2BNK A;  2EJS A;  2LHG A;  2R62 A;  2I7N A;  4FCV A;  3B7N A;  3I01 M;  1R2Z A;  4PT5 A;  3VDU A;  4PDI A;  1NNJ A;  1PJI A;  1IQP A;  3KVW A;  2XSZ D;  1Q02 A;  1WJ7 A;  2I7P A;  2X49 A;  2D7H A;  5KQD A;  1G4A E;  2KNV A;  4QOZ C;  4FWG A;  2VII A;  3UMM A;  4AKG A;  4AQY M;  1QUT A;  3BOS A;  2QHO B;  2P5T A;  3KOZ E;  3QWL A;  1J09 A;  1TR8 A;  2FH0 A;  2J5Y A;  3KS4 A;  5EP4 A;  3J81 S;  3L25 A;  2F5Q A;  3TWL A;  4DR1 M;  3MK6 A;  4IBC A;  2L4F A;  1IM2 A;  5FTL A;  2JY7 A;  4X64 M;  1L2D A;  3GLI E;  4I4L A;  3C3D A;  3GRY A;  3I4V A;  4LGM A;  2EO2 A;  4MM3 B;  3U60 B;  4ITQ A;  3FYC A;  4LGY A;  4DR7 M;  2ZBK B;  4OW0 A;  4LG2 A;  4DR4 M;  3T15 A;  1K82 A;  4AKI A;  3R9X B;  3GQ5 A;  2FS1 A;  4L16 A;  4JI1 M;  3B7Z A;  1HNZ M;  4JV5 M;  3HGI A;  1J5E M;  3SAR A;  2CHQ A;  1Q3B A;  4MGY E;  4JI0 M;  4LCB A;  1GAB A;  1IY1 A;  2OO9 A;  2XSZ A;  2CV0 A;  1GJT A;  1IN5 A;  3UK6 A;  2CRU A;  5H37 D;  1PJS A;  1LTM A;  5EP1 A;  3SAS A;  4JI8 M;  2KA6 B;  4IBF A;  3FTD A;  3LCV B;  3HHY A;  2CHV A;  4MGH A;  3SYK A;  1XWI A;  4FCT A;  3GLI B;  2LVA A;  2RRU A;  5EP2 A;  4OVZ B;  4GH9 A;  2QBY B;  4NRW A;  4KHP M;  1QDT A;  4DV2 M;  4LFC M;  3ZQJ A;  4NSO B;  4LF8 M;  4DV4 M;  3RE8 A;  3A45 A;  1MJG M;  3FUV A;  1XXH A;  2BWB A;  4XGI A;  1MN3 A;  3HHZ A;  4OU7 A;  4WUR A;  4B3S M;  2DAG A;  1NY6 A;  3U6C A;  3IEC A;  3E46 A;  4JYA M;  1NSF A;  3UGJ A;  3SMS A;  2VQE M;  3HJQ A;  7CAT A;  3E9S A;  5KQ8 A;  1NVM A;  1OQY A;  4L4U A;  1VEG A;  3WHL A;  4JI2 M;  4BLC A;  5E6J A;  1HR0 M;  2JY8 A;  1NY5 A;  1DGH B;  3A42 A;  3GQ4 A;  3W0F A;  3GPY A;  3V76 A;  4AW4 A;  4X65 M;  3LVV A;  1K3W A;  1Q3C A;  3RGP A;  4RF0 A;  1OTR A;  2CHG A;  2QP9 X;  2D7G A;  4W5W A;  5ITX A;  2CP8 A;  2DZO B;  3W67 A;  4L8R C;  1DGF A;  2XFS A;  1GL6 A;  3Q8G A;  4IBJ A;  3KXE C;  1QAO A;  5IT9 S;  1MX0 A;  1QZM A;  2YFQ A;  2WSE F;  4GC5 A;  3KW6 A;  4L78 A;  5ITY A;  3IG5 A;  3U6S A;  1NHG C;  2UXD M;  4GRI A;  3U6M A;  4TUW A;  1SXJ C;  1NHW C;  1TH2 A;  2OPF A;  3KS8 A;  3HHX A;  2C9C A;  3JR4 A;  3THG A;  1LV7 A;  2KRU A;  3J2P B;  3KSJ A;  3J7A S;  2XF3 A;  2YR0 A;  3HJS A;  4RKU F;  2E5L M;  5EP3 A;  2WZJ A;  2KW0 A;  3GLF A;  1TGU A;  5DFL A;  1T6O A;  2BJW A;  1E9R A;  3IHP A;  4NC6 A;  1UM8 A;  2XH9 A;  2DNA A;  5LMN M;  2LVQ D;  4FW9 A;  5BPV A;  1N78 A;  2MGW A;  1IY0 A;  1TDH A;  1QAM A;  2QNJ A;  1I4W A;  3ILK A;  4I5S A;  1F4I A;  2JP7 A;  2DAE A;  3NBI A;  1E9S A;  1WR1 B;  1G41 A;  4Z8X A;  4AKH A;  2A5Y B;  4JI3 M;  3GPP A;  4D81 A;  4LF5 M;  2QZ4 A;  4Z6Y A;  2NQ8 C;  1IFY A;  3MMP A;  2Y21 A;  1HQY E;  1GJS A;  1YUB A;  5EJC A;  2DHY A;  2ZTC A;  2DI0 A;  3JAM S;  3FTC A;  3HU2 A;  2AHM A;  4CIZ A;  1VDL A;  2ZAM A;  2FNA A;  3E21 A;  3SC3 A;  1TTE A;  4DV0 M;  4NXM M;  3GLH A;  3JR5 A;  5DYG A;  1PJQ A;  4IJF A;  3A46 A;  2R18 A;  1D0K A;  4D80 A;  4LJ9 A;  2KZS A;  1EIJ A;  4LJ7 A;  1W5T A;  3KP0 E;  3DZD A;  3K8Z A;  3WHK A;  3U6O A;  1XHB A;  3I4Y A;  3VKH A;  1G8P A;  2UXC M;  2YNM D;  1H6U A;  2DAI A;  4WP2 A;  1TH3 A;  5ITX E;  3SFZ A;  2QPA A;  3PNY A;  5ITQ A;  2R4J A;  4YY3 M;  4B3M M;  1DGB A;  2ZAN A;  5GKN A;  2XLJ A;  1AIP C;  2O25 A;  1ZMU A;  4PDG A;  2O01 F;  1GLN A;  2Z8Y M;  3A98 B;  3U61 A;  1Z6T A;  1QUS A;  3IG8 A;  2F5P A;  1EFU B;  3LW5 F;  5JI3 E;  3LQR A;  1OKS A;  5C18 A;  2OQ4 A;  2MRO B;  4GMQ A;  1C7Y A;  2D7E A;  3GRU A;  4M9X A;  1NO1 A;  5EXT A;  2C98 A;  2R46 A;  2O5R A;  3B74 A;  4M9S A;  3TWK A;  1VDD A;  3GLF E;  4QNM A;  4DBG B;  3HHW A;  3U5Z B;  2KZU A;  3I04 M;  4M0W A;  1ZV1 A;  2VQF M;  1VG5 A;  3HKP A;  3SAV A;  5E26 A;  2VDB B;  3LCU A;  1R6B X;  1OIZ A;  4DR5 M;  2F5S A;  1J7K A;  2RGO A;  2JY5 A;  5IRE B;  3PNV A;  3GQ3 A;  1MU5 A;  1QAN A;  1R7R A;  4I8O A;  4IBK A;  3UJN A;  3TWM A;  4KT0 F;  2UUC M;  2R45 A;  1D0M A;  1D2N A;  1NV9 A;  3CTW B;  3U6P A;  4X66 M;  2LHC A;  2RKO A;  8CAT A;  3VDP A;  4HEO A;  1PJJ A;  1WIV A;  3SHG B;  1YSY A;  3K9P A;  1V34 A;  3L2A A;  4LY6 A;  4GHA A;  3U6D A;  3GLF B;  3H4M A;  4M9Z A;  3RGS A;  2DAM A;  1L2B A;  2KHH A;  2W82 A;  2QEN A;  2DWM A;  3LMM A;  3AKZ A;  4Y28 F;  4LZZ A;  1N75 A;  4I81 A;  2CFO A;  3AOE C;  4F2L A;  4CHT B;  1V33 A;  4ANR A;  3T38 A;  3FE3 A;  1N77 A;  4DV3 M;  2XZF A;  1E94 E;  1WGN A;  3GO8 A;  5EQT A;  3QAU A;  3TL4 X;  3HJ8 A;  3W68 A;  4DV5 M;  2GNO A;  1IN4 A;  2B3T A;  5KPR A;  2V1U A;  3AJI B;  3TE6 A;  4KO8 A;  2MH8 A;  2KXE A;  4IBB A;  4LFA M;  4IIW A;  3C9P A;  3OTO M;  3U6Q A;  1X37 A;  3GPX A;  2X4A A;  5F3W A;  1NNU C;  3EIE A;  3L28 A;  3KDS E;  3MJ5 A;  5KPZ A;  5C1B A;  3KOY E;  3GPU A;  2L7H A;  4JN6 A;  2XZU A;  1L2C A;  3PFI A;  4MH0 E;  3EIH A;  1EE8 A;  3GRR A;  5KO3 A;  4QNR A;  3HU1 A;  1JB0 F;  3ZCB B;  5JI2 E;  1DV0 A;  1ZMV A;  4AG6 A;  2DWZ B;  3VK7 A;  1ZQ9 A;  2XGN A;  1HQC A;  3FTF A;  2MJ5 B;  4B7H A;  4DV6 M;  1A5T A;  3CGW A;  1IXR C;  3PVS A;  3PXG A;  2DZN B;  3W0L B;  3U6E A;  1KSF X;  1IBL M;  1IBK M;  2R44 A;  3DA1 A;  4FWD A;  1ZMW A;  3AFH A;  3TPZ A;  2JZ0 A; 
#chains in the Genus database with same CATH homology
 2L09 A;  2FFJ A;  2UUA M;  1IXZ A;  4G4R A;  1DGG A;  3KOW E;  4DR3 M;  2R4E A;  1HT1 E;  2XFT A;  5DYI A;  4K0K M;  2K47 A;  1FJG M;  3VKG A;  1N33 M;  4LJ8 A;  2DXI A;  3VK8 A;  4GKJ M;  2CE7 A;  3J27 B;  3LVW A;  2V6Z M;  4NSR A;  3R8F A;  5FSW A;  2Y20 A;  2EA0 A;  4AI6 A;  2L6O A;  3KOX E;  2Y0T A;  5BR8 M;  3ZH9 B;  2QCU A;  4DUY M;  2F4V M;  2F5O A;  1JQJ C;  1Z5B A;  2HL7 A;  4LZJ A;  4LJA A;  1L1T A;  1TDZ A;  1C1K A;  4LF7 M;  2DWL A;  2LH0 A;  1HT2 E;  1JR3 D;  3HU3 A;  2QBY A;  2Z4S A;  3SYL A;  4G4N A;  4KLN A;  4BB9 A;  4LF6 M;  1Z5C A;  2CV1 A;  4AG5 A;  4FVM A;  2C5R A;  4JI7 M;  1FNN A;  2M5Z A;  2Z4R A;  1S3S A;  3T1Y M;  3L29 A;  5EXX A;  3I51 A;  1IN8 A;  3M6A A;  1HNW M;  1XNR M;  1XXH B;  4QHT A;  3E4R A;  2Q2E B;  4LF4 M;  2XEP A;  3AOG A;  1DO2 A;  4B3T M;  4BBA A;  1XNQ M;  3K1J A;  4HL4 A;  1DGH A;  4B7G A;  4L15 A;  2G8L A;  3GLG A;  1Z59 A;  2UXB M;  4D82 A;  3M7G A;  3D8L A;  2CUZ A;  3CF2 A;  1SXJ D;  1HNX M;  1G3I A;  2C99 A;  5ITU A;  1JR3 A;  1T3T A;  3LQQ A;  1Z5A A;  2C96 A;  4PCZ A;  1QYR A;  3M0E A;  3SAT A;  2HHH M;  3FD9 A;  4R3D A;  3UZU A;  4XBO A;  4B3R M;  3L26 A;  1QVR A;  4R7G A;  2Z3X A;  4NL4 H;  5FTM A;  5KPT A;  2FE8 A;  3D8B A;  4EIW A;  3B9P A;  4REZ A;  4MGK E;  4NRV A;  2HCB A;  4CGY B;  2J7O A;  2G5G X;  5EXP A;  2H1R A;  3VLF B;  3SAU A;  2DHR A;  2J7N A;  4S12 A;  2R65 A;  4LJ4 A;  4IBD A;  3GRV A;  4DUZ M;  3DFZ A;  2UU9 M;  1IY2 A;  1OFI A;  4HLQ A;  1YE9 A;  1SXJ A;  4GKK M;  3AL0 C;  3DOA A;  3CF0 A;  3KP1 E;  1XMQ M;  3CF6 E;  1PM5 A;  3FUT A;  4G6Z A;  4WW0 A;  4JI6 M;  5FLX S;  1R2Y A;  4IBG A;  1IN6 A;  5IWA M;  1GL7 A;  2RGH A;  4PD2 A;  1QQW A;  4CIS A;  4MGI E;  3L27 A;  3NWL A;  2EUC A;  4X62 M;  3GLH B;  4B08 A;  4JXJ A;  1N34 M;  2DWN A;  2YQZ A;  2FOI C;  4II7 A;  1Q39 A;  3U6L A;  3RFW A;  4GC9 A;  1N36 M;  1QAQ A;  1E32 A;  4FD2 A;  3FUX A;  1G59 A;  4YHH M;  3FUU A;  4LJ5 A;  4DR2 M;  4LFB M;  2X8A A;  2HKJ A;  4LRT A;  1XMO M;  3K92 A;  1ORY B;  5IZ7 D;  2V1C A;  1NJF A;  4A3V B;  3C58 A;  5FTN A;  1XC8 A;  4LRS A;  1ZAE A;  2LWX A;  1OJL A;  3U61 B;  3KSX A;  3FYD A;  4IJE A;  1IN7 A;  3FKE A;  3GLG B;  3U5Z A;  4ZPX A;  4B7F A;  4MGZ E;  3U60 A;  4JI5 M;  1NJG A;  2CV2 A;  2F5N A;  3KFU G;  5EXS A;  4IBI A;  4LJ6 A;  4DR6 M;  3AV0 A;  1KYI A;  2Y0Q A;  4GIP A;  2ERC A;  4QHS A;  3VFD A;  3GP1 A;  4RNA A;  3J80 S;  4NOO B;  1SXJ E;  4OX9 M;  5FTJ A;  2KEB A;  4DV1 M;  5DNY A;  3TQS A;  3FUW A;  1DO0 A;  2C9O A;  4MB7 A;  4GHL A;  2CEA A;  1IXS B;  3GLI A;  5A2Q S;  1L1Z A;  4OVZ A;  3SBJ A;  1I94 M;  4QOS A;  4NXN M;  3Q8X A;  5ITT A;  4RF1 A;  4AZF A;  3SHF A;  1TH4 A;  3ZC7 B;  1K3X A;  1GKI A;  3SMP A;  1GVN A;  4IBE A;  4FCW A;  2LNH C;  4M0D A;  3T1H M;  5LMU M;  1SXJ B;  1W5S A;  1L8Q A;  4G4O A;  2L7I A;  2KRK A;  4FWH A;  3K2L A;  1WXQ A;  2M60 A;  4DV7 M;  4GIT A;  2LXE A;  4P16 A;  4LF9 M;  4KOD A;  2BJV A;  2ZAO A;  2JA2 A;  1IBM M;  3HWS A;  2UUB M;  3AOE A;  3MHV C;  1OFH A;  1KFV A;  5ITR A;  3J7B A;  3FTE A;  2Z7J A;  2DVW B;  4G4Q A;  2ZM6 M;  5FTK A;  4JI4 M;  2BNK A;  2R62 A;  4FCV A;  2I7N A;  1R2Z A;  4PT5 A;  3VDU A;  4PDI A;  1NNJ A;  1PJI A;  1IQP A;  3KVW A;  2XSZ D;  2X49 A;  2I7P A;  2D7H A;  5KQD A;  1G4A E;  4QOZ C;  4FWG A;  2VII A;  3UMM A;  4AKG A;  4AQY M;  3BOS A;  3KOZ E;  2P5T A;  3SAW A;  3QWL A;  1J09 A;  3J81 S;  5EP4 A;  3KS4 A;  3L25 A;  2F5Q A;  3TWL A;  4DR1 M;  3MK6 A;  4IBC A;  1IM2 A;  5FTL A;  4X64 M;  1L2D A;  4I4L A;  3GRY A;  3I4V A;  4LGM A;  2EO2 A;  4MM3 B;  3U60 B;  4ITQ A;  3FYC A;  4LGY A;  4DR7 M;  2ZBK B;  4OW0 A;  4LG2 A;  4DR4 M;  3T15 A;  1K82 A;  4AKI A;  3R9X B;  3GQ5 A;  4L16 A;  4JI1 M;  1HNZ M;  4JV5 M;  3HGI A;  1J5E M;  3SAR A;  2CHQ A;  1Q3B A;  4MGY E;  4JI0 M;  4LCB A;  1IY1 A;  2XSZ A;  2CV0 A;  1IN5 A;  3UK6 A;  5H37 D;  5EP1 A;  3SAS A;  4JI8 M;  2KA6 B;  4IBF A;  3FTD A;  3HHY A;  2CHV A;  4MGH A;  3SYK A;  1XWI A;  4FCT A;  3GLI B;  5EP2 A;  4OVZ B;  4GH9 A;  2QBY B;  4NRW A;  4KHP M;  4DV2 M;  4LFC M;  4NSO B;  4LF8 M;  4DV4 M;  3RE8 A;  3A45 A;  3FUV A;  1XXH A;  4XGI A;  3HHZ A;  4OU7 A;  4WUR A;  4B3S M;  1NY6 A;  3U6C A;  4JYA M;  1NSF A;  3UGJ A;  3SMS A;  2VQE M;  3HJQ A;  7CAT A;  3E9S A;  5KQ8 A;  1NVM A;  4L4U A;  3WHL A;  4JI2 M;  4BLC A;  5E6J A;  1HR0 M;  1NY5 A;  1DGH B;  3A42 A;  3GQ4 A;  3W0F A;  3GPY A;  4AW4 A;  4X65 M;  3LVV A;  1K3W A;  1Q3C A;  3RGP A;  4RF0 A;  2CHG A;  2QP9 X;  2D7G A;  4W5W A;  5ITX A;  2DZO B;  4L8R C;  1DGF A;  2XFS A;  1GL6 A;  4IBJ A;  3KXE C;  1QAO A;  5IT9 S;  1MX0 A;  1QZM A;  2YFQ A;  4GC5 A;  5ITY A;  3KW6 A;  4L78 A;  3IG5 A;  3U6S A;  1NHG C;  2UXD M;  4GRI A;  3U6M A;  4TUW A;  1SXJ C;  1NHW C;  1TH2 A;  2OPF A;  3KS8 A;  3HHX A;  2C9C A;  3JR4 A;  3THG A;  1LV7 A;  2KRU A;  3J2P B;  3KSJ A;  3J7A S;  2XF3 A;  2YR0 A;  3HJS A;  2E5L M;  5EP3 A;  2KW0 A;  3GLF A;  1TGU A;  2BJW A;  1E9R A;  1UM8 A;  2XH9 A;  5LMN M;  4FW9 A;  5BPV A;  1N78 A;  1IY0 A;  3ILK A;  1QAM A;  1TDH A;  1I4W A;  4I5S A;  3NBI A;  1E9S A;  4AKH A;  1G41 A;  4Z8X A;  2A5Y B;  4JI3 M;  3GPP A;  4D81 A;  4LF5 M;  2QZ4 A;  4Z6Y A;  2NQ8 C;  2Y21 A;  1HQY E;  1YUB A;  5EJC A;  3JAM S;  3HU2 A;  3FTC A;  2AHM A;  1N32 M;  2ZAM A;  3SC3 A;  2FNA A;  4NXM M;  4DV0 M;  3GLH A;  3JR5 A;  5DYG A;  4IJF A;  3A46 A;  2R18 A;  4D80 A;  4LJ9 A;  2KZS A;  4LJ7 A;  1W5T A;  3KP0 E;  3DZD A;  3K8Z A;  3WHK A;  3U6O A;  1XHB A;  3I4Y A;  3VKH A;  1G8P A;  2UXC M;  2YNM D;  1H6U A;  5ITX E;  1TH3 A;  3SFZ A;  2QPA A;  3PNY A;  5ITQ A;  2R4J A;  4YY3 M;  4B3M M;  1DGB A;  2ZAN A;  5GKN A;  2XLJ A;  4PDG A;  1GLN A;  3A98 B;  3U61 A;  1Z6T A;  3IG8 A;  2F5P A;  5JI3 E;  3LQR A;  5C18 A;  2OQ4 A;  4GMQ A;  2D7E A;  3GRU A;  4M9X A;  5EXT A;  2C98 A;  2R46 A;  2O5R A;  3U5Z B;  4M9S A;  3TWK A;  1VDD A;  4QNM A;  3HHW A;  2KZU A;  4M0W A;  2VQF M;  3HKP A;  3SAV A;  5E26 A;  1R6B X;  4DR5 M;  2F5S A;  1J7K A;  2RGO A;  5IRE B;  3PNV A;  3GQ3 A;  1MU5 A;  1QAN A;  1R7R A;  4I8O A;  4IBK A;  3UJN A;  3TWM A;  2UUC M;  2R45 A;  1D2N A;  3CTW B;  3U6P A;  4X66 M;  2RKO A;  8CAT A;  3VDP A;  1PJJ A;  3SHG B;  1YSY A;  3L2A A;  4LY6 A;  4GHA A;  3U6D A;  3GLF B;  3H4M A;  4M9Z A;  3RGS A;  1L2B A;  2W82 A;  2QEN A;  2DWM A;  3LMM A;  3AKZ A;  4LZZ A;  1N75 A;  4I81 A;  2CFO A;  3AOE C;  4CHT B;  1N77 A;  3T38 A;  4DV3 M;  2XZF A;  1E94 E;  3GO8 A;  5EQT A;  3QAU A;  3TL4 X;  3HJ8 A;  4DV5 M;  1IN4 A;  5KPR A;  2V1U A;  3AJI B;  3TE6 A;  4KO8 A;  2KXE A;  4IBB A;  4LFA M;  4IIW A;  3OTO M;  3U6Q A;  1X37 A;  3GPX A;  2X4A A;  5F3W A;  1NNU C;  3EIE A;  3L28 A;  3KDS E;  3MJ5 A;  5KPZ A;  5C1B A;  3KOY E;  3GPU A;  2L7H A;  4JN6 A;  2XZU A;  1L2C A;  3PFI A;  4MH0 E;  3EIH A;  1EE8 A;  3GRR A;  5KO3 A;  4QNR A;  3HU1 A;  3ZCB B;  5JI2 E;  4AG6 A;  2DWZ B;  3VK7 A;  1ZQ9 A;  2XGN A;  1HQC A;  3FTF A;  4B7H A;  4DV6 M;  1IXR C;  3PVS A;  3PXG A;  2DZN B;  3W0L B;  3U6E A;  1KSF X;  1IBL M;  1IBK M;  3DA1 A;  4FWD A;  3TPZ A;  3AFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...