2HL7A

Crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
b'GSHMAIDTYEFASDAERERFRNLTQELRCPKCQNQDIADSNAPIAADLRKQIYGQLQQGKSDGEIVDYMVARYGDFVRYKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome C-type biogenesis protein CcmH
publication title A strategic protein in cytochrome c maturation: three-dimensional structure of CcmH and binding to apocytochrome c
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 29
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.640 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2hl7A00
2KW0A 2HL7A
chains in the Genus database with same CATH superfamily
3UZUA 1BVSA 2L2DA 3HU3A 4NSOB 3FYDA 1HT2E 2H1RA 1QANA 2DAKA 4JI2M 3H4MA 1YLAA 1IN4A 1XMQM 3A42A 3T1HM 2KRUA 1VQ1A 3AOEC 4DV4M 4BBAA 2KNAA 2LHGA 3EIHA 3TQSA 2EKKA 2C98A 1SXJA 4KODA 3SC3A 4LZZA 3VLFB 1ZMWA 2I7NA 3B9PA 5FLXS 2DWMA 4LF7M 2Y0TA 3CF0A 3KOWE 2RGOA 1OFHA 3DOAA 4LFBM 3KOZE 4BB9A 2XEPA 4DV5M 2FS1A 4I81A 4OVZB 3T1YM 2HCBA 1L1ZA 1T3TA 2DNAA 3GPXA 4DR6M 1QUTA 2ZTDA 1DGGA 1NY5A 1F4IA 2C99A 3VK7A 1GKIA 4M0WA 5FSWA 1SXJD 3AFHA 1KYIA 4KLNA 5L8RF 2K0BX 4LJ7A 4Z8XA 3U5ZB 5A2QS 3QYBA 3M0EA 2MR9A 2BWBA 2EO2A 3IECA 1G71A 3U6CA 1PGYA 3KP0E 1FNNA 3L25A 1N34M 4CGYB 4EIWA 1XXHE 2D7HA 4BLCA 2O01F 1N36M 3GLGA 4FCVA 2CV0A 3NWLA 2QPAA 4IBKA 3CGWA 4ZPXA 1K3WA 1KFVA 3LQRA 2XZUA 2JNHA 1GABA 2XZFA 1CUKA 2R6FA 1OKSA 2UUAM 4JI8M 3MJ5A 4QNRA 2VQEM 1IXSA 3I51A 1MN3A 3E21A 2KZSA 5FTKA 2YQZA 3FUTA 4AW4A 1PJTA 1YE9A 4AI6A 4L15A 2L6OA 4NL4H 4B3TM 1N75A 2KA6B 4I5SA 2X49A 4LJ6A 3U6MA 2DZNB 3PFIA 3HHYA 2ZTCA 5FTJA 2BWEA 3AL0C 2WSCF 3K2LA 4IIWA 3MK6A 4MGHA 3SARA 1R6BX 1NHWC 4MGKE 3W0FA 1L1TA 3LMMA 5GKNA 3W68A 4X65M 1C7YA 1GJSA 1HT1E 1QAMA 1Q39A 1QDRA 1QAQA 2JZ0A 2JY8A 2DHYA 2CRUA 1XHBA 4IJFA 2C96A 5JI3E 3BOSA 1QQWA 1J5EM 1Q02A 4CIZA 4KHPM 4MGYE 3FD9A 2YNMD 4G4OA 3Q8XA 4G3OA 4X66M 2L4EA 2QP9X 1ORYB 3DFZA 3T38A 4B3SM 4JI7M 4D82A 3SHFA 4NRWA 4JI4M 1R5LA 1WGLA 2KZUA 4IBFA 3SAVA 1PRBA 1G3IA 2CHQA 4JI5M 4IBGA 1MX0A 1VEKA 3LVWA 4KO8A 4NSRA 5EQTA 4QOZC 2F5QA 5ITRA 4OVZA 3GLIE 3LCUA 2FOIC 2KHHA 3U6SA 1QDTA 2J7OA 3UJNA 5EXSA 4IBBA 3GLHA 2NQ8C 4DV3M 2XLJA 3FYCA 2XSZA 1DGHB 5KPZA 2QBYA 3GP1A 1T6OA 4LF6M 3DA1A 3FTDA 3HX3A 1K82A 1AIPC 2F4VM 4GIPA 3GO8A 5C18A 4LFCM 2V1CA 3C58A 2OPFA 1A5TA 3GLHE 1YUBA 1GJTA 1HR0M 2VF7A 2YR0A 2GQFA 1R7RA 4B7GA 2ZAOA 1NSFA 4LG2A 2JY6B 5IWAM 1N32M 2OOBA 4M9SA 4A3VB 5EP3A 2WSEF 1R4GA 3B74A 1YSYA 1P3QQ 3HU1A 4PD2A 3K8ZA 4B7HA 4GHAA 1DV0A 2EJSA 3EIEA 1N77A 1EIJA 1K3XA 4QNMA 2Z3XA 3GQ3A 1NJGA 4REZA 3A98B 3HHWA 3VKGA 4OU7A 1X37A 4NC6A 2CP8A 1Z5AA 3TWLA 1EFUB 2Y21A 3JR4A 3U6QA 2X4AA 3FUWA 3ZH9B 2X8AA 4RF0A 1IFYA 2FNAA 1TGUA 3GQ4A 3TWKA 1N33M 2M60A 4LFAM 3SMSA 4MGIE 1HJPA 3HJQA 4LY6A 3MHVC 3RGSA 1PJSA 2DZLA 1G4AE 4PCZA 1D0MA 5DFLA 4CJ6A 2LTUA 1G8PA 3GLFB 2DWNA 4NXNM 3TL4X 3I4YA 4DBGB 2V1UA 2J7NA 4YHHM 4LGMA 1IQPA 5H37D 4JYAM 5ITXA 2CUZA 3VK8A 4L6V6 3CTWB 1R2ZA 2CV2A 1IN7A 1S3SA 2OQ4A 2FH0A 2W82A 1SXJE 4HLQA 3L26A 1NV9A 2VDBB 2UUBM 2R44A 3KOXE 1NY6A 3LQQA 5ITXE 1HNZM 1R2YA 3RGPA 4YY3M 3HKPA 3SBJA 4IJEA 2F5SA 5DNYA 4GHLA 2UXBM 2XF3A 3LCVB 4DR7M 3TE6A 3C9PA 1NHGC 2I7PA 4GMQA 4L4UA 2R65A 3I4VA 5EXTA 5KQ8A 4F1IA 3K9PA 1J7KA 1TR8A 2Z8YM 4FCTA 1G41A 2VIIA 4LRSA 4Q7JA 3SYKA 2EA0A 1G59A 4LJ8A 4OX9M 4R3DA 3ZCBB 3KW6A 1DGHA 1VDLA 2R45A 2KEBA 3B89A 3J27B 1WXQA 2HHHM 1D0KA 2MJ5B 3VKHA 2UXCM 4LF5M 2A5YB 4D80A 1DGBA 3SATA 2L09A 4JN6A 5KPRA 3GLGE 4G4RA 2VF8A 1L2BA 2CV1A 4TUWA 3HHXA 1KSFX 4L78A 3T6PA 4AKIA 4LJ5A 4DR3M 1QYRA 2KXEA 2V6ZM 3D8LA 2HKJA 2LBCA 5ITTA 4R7GA 3AOGA 4Y28F 3HJSA 3KP1E 3W67A 3DZDA 4DV7M 1TDZA 2Y20A 1IBLM 3R9XB 1GLNA 1Z5BA 2UUCM 2KDLA 1ZQ9A 1DO0A 4CHTB 4IBJA 1GL6A 2K47A 2L7IA 3HU2A 4JI3M 4NXMM 1WJ7A 3SAUA 2C9OA 3E4RA 5FTLA 1ZAEA 4RKUF 1TH2A 4G4QA 4JI0M 3FRHA 1NNJA 4AG5A 5FTMA 3WHKA 1ZMUA 1NVMA 2JUJA 2WSFF 3AOEA 1GO5A 4QHSA 3PVSA 4GC5A 3B7QA 4DUZM 2DI0A 2CFOA 2EKFA 4Z6YA 2JWSA 4X62M 4DR5M 4G4NA 1V34A 3VDPA 1Q3CA 1HNWM 3THGA 2QHOB 2CHVA 3BXWA 3ZC7B 2LH0A 3FUVA 2R4EA 3HZJA 3FRIA 3GRUA 3AJIB 3I01M 5EXXA 1VEJA 1Z6TA 1J09A 4NOOB 4HL4A 2KNZA 1DO2A 1AUAA 2LVAA 3D8BA 3K9OA 1C1KA 2R0IA 1DGFA 3J7BA 4IBEA 4CISA 1Z5CA 3K92A 1OAOC 2Y0QA 1QAOA 2E5LM 4MB7A 3U60B 2RKOA 3HGIA 2N35A 2HL7A 5E26A 1W5SA 3L29A 3VFDA 3U5ZA 3SAWA 4LJ9A 4AG6A 4DUYM 2G5GX 5FTNA 1IBKM 2DVWB 2ZBKB 4S12A 1NNUC 2D7GA 4IBIA 2VQFM 2CEAA 2LHCA 1WGNA 2LVOC 2ZAMA 4HEOA 2LVPC 2J5YA 2JXNA 5E6JA 3H4JA 2C5RA 4KT0F 1XXHB 3U6EA 1HQCA 5LMUM 1IXRC 3SFZA 3VDUA 4JI6M 2APLA 4B08A 2QCUA 2DAEA 3T15A 4M9XA 4FWGA 3I04M 3F92A 5EXPA 1GVNA 4DV1M 1NO1A 1W5TA 1JQJC 1D2NA 2RGHA 5IREB 4MGZE 3J80S 3IG8A 5EP2A 3CF2A 1JR3A 1IY0A 2OO9A 1TTEA 3KSXA 3KFUG 4DR4M 4AQYM 2DKLA 4AZFA 2M5ZA 3KS8A 1QUSA 1WIVA 4IBCA 3W0LB 4GKJM 3U6DA 4L16A 5F3WA 2QZ4A 1OAIA 1QZMA 3FTEA 5JI2E 3J7AS 4P16A 1OQYA 3KDSE 1JR3D 4B3MM 1VDDA 1XB2B 3UK6A 1MJGM 1QZEA 3U6PA 1IY2A 2O25A 3L28A 4LJAA 3GRRA 4M9ZA 4MH0E 4F2LA 3FUUA 3KXEC 4DR1M 3U6LA 2FE8A 2XFTA 2OOAA 4DV0M 1E9SA 4M0DA 1OIZA 2LNHC 3SHGB 4I8OA 3Q8GA 1L8QA 1TF0B 1V92A 1OIPA 2L4FA 5EP1A 5BPVA 5DYIA 3U6OA 3KOYE 4LGYA 1E9RA 2C9CA 1XNQM 1ZV1A 2Z4RA 3R8FA 1VG5A 4LJ4A 1IN8A 1PJQA 4UN2B 3PNYA 2JZ1A 2R62A 3K1JA 2R18A 3GLIB 2CHGA 1OTRA 2XFSA 3NBXX 4DV2M 2R46A 4XBOA 4GC9A 5KO3A 1L2CA 3E46A 4JXJA 3TWMA 3FTCA 3FUXA 3U60A 3QWLA 3QYEA 2WZJA 3IHPA 1IN6A 2FFJA 3U61B 3B7NA 1OJLA 3GLHB 1FJGM 3LVVA 1Z59A 2QBYB 2KW0A 4FWDA 4PDIA 5BR8M 2G8LA 3RE8A 1HNXM 1QVRA 5KPTA 3M7GA 1XXHA 3J2PB 3HJ8A 5DYGA 5ITQA 4ITQA 3J81S 2O5RA 3OTOM 2DAIA 2B3TA 3KSJA 4FCWA 1OFIA 4GEWA 2DZOB 4PDGA 1PM5A 2D7EA 1Q3BA 2EUCA 2DXIA 4GRIA 4JI1M 1N78A 5C1BA 1XWIA 4K0KM 2LVQD 1TH3A 1H6UA 3A45A 4AKHA 1UM8A 3KVWA 3E9SA 1XMOM 2DWLA 2UU9M 2QQ8A 1T43A 3FE3A 4G6ZA 4W5WA 3HHZA 1NJFA 1IBMM 2F5OA 1VEGA 2Q2EB 2P5TA 4ANRA 2K9DA 2Z7JA 2DENA 2QENA 2R4JA 1TH4A 3ILKA 4QOSA 5IT9S 2MGWA 4AKGA 2QSFX 3JR5A 1TDHA 3UGJA 4FVMA 4B7FA 2ERCA 1Y8GA 4WURA 1IY1A 2GNOA 2KNVA 3L27A 2L7HA 3GPYA 1JB0F 3GLFA 4NRVA 2F5NA 3WHLA 4LF9M 1WR1B 2H5XA 3KS4A 1SXJB 3GLFE 3LW5F 3GQ5A 4P17A 1EE8A 1SXJC 1SG9A 1L2DA 3QAUA 4JV5M 2UXDM 4GH9A 4FW9A 3SYLA 7CATA 2JA2A 4XGIA 4D81A 2DWZB 4XK8F 2Z4SA 1D0LA 2F5PA 3BBZA 3L2AA 2CWBA 3IG5A 2MROB 5EP4A 5KQDA 4DV6M 3GLIA 2MH8A 4LF8M 3MMPA 1V33A 4L8RC 5EJCA 2BJWA 3SMPA 4LCBA 1IM2A 1PJIA 1RU3A 2G3QA 4B3RM 1HQYE 4RNAA 3FTFA 2QNJA 2RRUA 3B7ZA 3GRYA 3RFWA 4GITA 2DHRA 1UFZA 8CATA 3A46A 3C3DA 3HY5A 4LRTA 3ZQJA 4WW0A 1WHCA 1MU5A 2K6BA 2LXEA 3FKEA 2YFQA 4WP2A 5ITUA 3U61A 2CE7A 2BNKA 2ZANA 3GLGB 4MM3B 3GRVA 3PNVA 1XNRM 2JP7A 1GL7A 3TPZA 1LV7A 4DR2M 4FWHA 3GPPA 1PJJA 2DAMA 1I4WA 3C3EA 3HWSA 4II7A 4OW0A 3AV0A 1IXSB 5LMNM 5ITYA 1NV8A 1E94E 1JR3E 2LWXA 4LZJA 1LTMA 2BJVA 3CF6E 2XH9A 3PXGA 4X64M 2ZM6M 1I94M 4QHTA 2XGNA 2HAKA 2AHMA 4LF4M 4I4LA 2HWJA 2KRKA 2XSZD 4R71A 3JAMS 3GPUA 3M6AA 1XC8A 2DAGA 1IN5A 5IZ7D 3SASA 1ZMVA 1IXZA 4RF1A 2JY7A 4FD2A 2LVNC 2JY5A 4GKKM 3AKZA 4PT5A 3V76A 3UMMA 1E32A 3NBIA 4IBDA
chains in the Genus database with same CATH topology
3UZUA 3HU3A 4NSOB 3FYDA 1HT2E 2H1RA 1QANA 4JI2M 3H4MA 1IN4A 3A42A 3T1HM 2KRUA 3AOEC 4DV4M 4BBAA 3EIHA 3TQSA 2C98A 1SXJA 4KODA 3SC3A 4LZZA 3VLFB 3B9PA 2I7NA 5FLXS 2DWMA 4LF7M 2Y0TA 3CF0A 3KOWE 2RGOA 1OFHA 3DOAA 4LFBM 3KOZE 4BB9A 2XEPA 4DV5M 4I81A 4OVZB 3T1YM 2HCBA 1L1ZA 1T3TA 3GPXA 4DR6M 1DGGA 1NY5A 2C99A 3VK7A 1GKIA 4M0WA 5FSWA 1SXJD 3AFHA 1KYIA 4KLNA 4LJ7A 4Z8XA 3U5ZB 5A2QS 3M0EA 2EO2A 3U6CA 3KP0E 1FNNA 3L25A 1N34M 4CGYB 4EIWA 2D7HA 4BLCA 1N36M 3GLGA 4FCVA 2CV0A 3NWLA 2QPAA 4IBKA 4ZPXA 1K3WA 1KFVA 3LQRA 2XZUA 2XZFA 4JI8M 2UUAM 3MJ5A 4QNRA 2VQEM 3I51A 2KZSA 5FTKA 2YQZA 3FUTA 4AW4A 1YE9A 4L15A 2L6OA 4NL4H 4B3TM 1N75A 2KA6B 4I5SA 2X49A 4LJ6A 3U6MA 2DZNB 3PFIA 3HHYA 5FTJA 3AL0C 3K2LA 4IIWA 3MK6A 4MGHA 3SARA 1R6BX 1NHWC 4MGKE 3W0FA 1L1TA 3LMMA 5GKNA 4X65M 1HT1E 1QAMA 1Q39A 1QAQA 1XHBA 4IJFA 2C96A 5JI3E 3BOSA 1QQWA 1J5EM 4KHPM 4MGYE 3FD9A 2YNMD 4G4OA 3Q8XA 4X66M 4B3SM 3T38A 2QP9X 1ORYB 3DFZA 4JI7M 4D82A 3SHFA 4NRWA 4JI4M 2KZUA 4IBFA 3SAVA 1G3IA 2CHQA 4JI5M 4IBGA 1MX0A 3LVWA 4KO8A 4NSRA 5EQTA 4QOZC 2F5QA 5ITRA 4OVZA 2FOIC 3U6SA 2J7OA 3UJNA 5EXSA 4IBBA 3GLHA 2NQ8C 4DV3M 2XLJA 3FYCA 2XSZA 1DGHB 5KPZA 2QBYA 3GP1A 4LF6M 3DA1A 3FTDA 1K82A 2F4VM 4GIPA 3GO8A 5C18A 4LFCM 2V1CA 3C58A 2OPFA 1YUBA 1HR0M 2YR0A 1R7RA 4B7GA 2ZAOA 1NSFA 4LG2A 5IWAM 1N32M 4M9SA 4A3VB 5EP3A 1YSYA 3HU1A 4PD2A 3K8ZA 4B7HA 4GHAA 3EIEA 1N77A 1K3XA 4QNMA 2Z3XA 3GQ3A 1NJGA 4REZA 3A98B 3HHWA 3VKGA 4OU7A 1X37A 3TWLA 3JR4A 1Z5AA 2Y21A 3U6QA 2X4AA 3FUWA 3ZH9B 2X8AA 4RF0A 2FNAA 1TGUA 3GQ4A 3TWKA 1N33M 2M60A 4LFAM 3SMSA 4MGIE 3HJQA 4LY6A 3MHVC 3RGSA 1G4AE 4PCZA 3GLFB 1G8PA 2DWNA 4NXNM 3TL4X 3I4YA 2V1UA 2J7NA 4YHHM 4LGMA 1IQPA 5H37D 4JYAM 5ITXA 2CUZA 3VK8A 3CTWB 1R2ZA 2CV2A 1IN7A 1S3SA 2OQ4A 2W82A 1SXJE 4HLQA 3L26A 2UUBM 3KOXE 1NY6A 3LQQA 5ITXE 1HNZM 1R2YA 3RGPA 4YY3M 3HKPA 3SBJA 4IJEA 2F5SA 5DNYA 4GHLA 2UXBM 2XF3A 4DR7M 3TE6A 1NHGC 2I7PA 4GMQA 4L4UA 2R65A 3I4VA 5EXTA 5KQ8A 1J7KA 4FCTA 1G41A 2VIIA 4LRSA 3SYKA 2EA0A 1G59A 4LJ8A 4OX9M 4R3DA 3ZCBB 3KW6A 1DGHA 2R45A 2KEBA 3J27B 1WXQA 2HHHM 3VKHA 2UXCM 4LF5M 2A5YB 4D80A 1DGBA 3SATA 2L09A 4JN6A 5KPRA 4G4RA 1L2BA 2CV1A 4TUWA 3HHXA 1KSFX 4L78A 4AKIA 4LJ5A 4DR3M 1QYRA 2KXEA 2V6ZM 3D8LA 2HKJA 5ITTA 4R7GA 3AOGA 3HJSA 3KP1E 1IBLM 3DZDA 4DV7M 1TDZA 2Y20A 3R9XB 1GLNA 1Z5BA 2UUCM 1ZQ9A 1DO0A 4CHTB 4IBJA 1GL6A 2K47A 2L7IA 3HU2A 4JI3M 4NXMM 3SAUA 2C9OA 3E4RA 5FTLA 1ZAEA 1TH2A 4G4QA 4JI0M 1NNJA 4AG5A 5FTMA 3WHKA 3AOEA 1NVMA 4QHSA 3PVSA 4GC5A 4DUZM 2CFOA 4Z6YA 4X62M 4DR5M 4G4NA 3VDPA 1Q3CA 1HNWM 3THGA 2CHVA 3ZC7B 2LH0A 3FUVA 2R4EA 3GRUA 3AJIB 5EXXA 1Z6TA 1J09A 4NOOB 4HL4A 5KO3A 1DO2A 4LF8M 3D8BA 4AI6A 1C1KA 1DGFA 3J7BA 4IBEA 4CISA 1Z5CA 3K92A 2Y0QA 1QAOA 2E5LM 4MB7A 3U60B 2RKOA 3HGIA 2HL7A 5E26A 1W5SA 3L29A 3VFDA 3U5ZA 3SAWA 4LJ9A 4AG6A 4DUYM 2G5GX 5FTNA 1IBKM 2DVWB 2ZBKB 4S12A 1NNUC 2D7GA 4IBIA 2VQFM 2CEAA 2ZAMA 5E6JA 2C5RA 1XXHB 3U6EA 1HQCA 5LMUM 1IXRC 3SFZA 3VDUA 4JI6M 4B08A 2QCUA 3T15A 4M9XA 4FWGA 5EXPA 1GVNA 4DV1M 1W5TA 1JQJC 1D2NA 2RGHA 5IREB 4MGZE 3J80S 3IG8A 5EP2A 3CF2A 1JR3A 1IY0A 3KSXA 3KFUG 4DR4M 4AQYM 4AZFA 2M5ZA 3KS8A 4IBCA 3W0LB 4GKJM 3U6DA 4L16A 5F3WA 2QZ4A 1QZMA 3FTEA 5JI2E 3J7AS 4P16A 3KDSE 1JR3D 4B3MM 1VDDA 3UK6A 3U6PA 1IY2A 3L28A 4LJAA 3GRRA 4M9ZA 4MH0E 3FUUA 3KXEC 4DR1M 3U6LA 2FE8A 2XFTA 4DV0M 1E9SA 4M0DA 2LNHC 3SHGB 4I8OA 1L8QA 5EP1A 5BPVA 5DYIA 3U6OA 3KOYE 4LGYA 1E9RA 2C9CA 1XNQM 2Z4RA 3R8FA 4LJ4A 1IN8A 3PNYA 3K1JA 2R62A 2R18A 3GLIB 2CHGA 2XFSA 4DV2M 2R46A 4XBOA 4GC9A 1L2CA 4JXJA 3TWMA 3FTCA 3FUXA 3U60A 3QWLA 1IN6A 2FFJA 3U61B 1OJLA 3GLHB 1FJGM 3LVVA 1Z59A 2QBYB 2KW0A 4FWDA 4PDIA 5BR8M 2G8LA 3RE8A 1HNXM 1QVRA 5KPTA 3M7GA 1XXHA 3J2PB 3HJ8A 5DYGA 5ITQA 4ITQA 3J81S 2O5RA 3OTOM 4FCWA 3KSJA 1OFIA 2DZOB 4PDGA 1PM5A 2D7EA 1Q3BA 2EUCA 2DXIA 4GRIA 4JI1M 1N78A 5C1BA 1XWIA 4K0KM 1TH3A 3A45A 1H6UA 4AKHA 1UM8A 3KVWA 3E9SA 1XMOM 2DWLA 2UU9M 4G6ZA 4W5WA 3HHZA 1NJFA 1IBMM 2F5OA 2Q2EB 2P5TA 2Z7JA 2QENA 3ILKA 2R4JA 1TH4A 4QOSA 5IT9S 4AKGA 3JR5A 1TDHA 3UGJA 4FVMA 4B7FA 2ERCA 4WURA 1IY1A 3L27A 3GLFA 3GPYA 2L7HA 4NRVA 2F5NA 3WHLA 4LF9M 3KS4A 1SXJB 3GQ5A 1EE8A 1SXJC 1L2DA 3QAUA 4JV5M 2UXDM 4GH9A 4FW9A 3SYLA 7CATA 2JA2A 4XGIA 4D81A 2DWZB 2Z4SA 2F5PA 3L2AA 5EP4A 3IG5A 5KQDA 4DV6M 1XMQM 3GLIA 4L8RC 5EJCA 2BJWA 3SMPA 4LCBA 1IM2A 1PJIA 4B3RM 1HQYE 4RNAA 3FTFA 3GRYA 3RFWA 4GITA 2DHRA 8CATA 3A46A 4LRTA 4WW0A 2LXEA 1MU5A 5ITUA 3FKEA 3U61A 2YFQA 2CE7A 2BNKA 2ZANA 3GLGB 4MM3B 3GRVA 3PNVA 1XNRM 1GL7A 3TPZA 1LV7A 4DR2M 4FWHA 3GPPA 1PJJA 1I4WA 3HWSA 4II7A 4OW0A 3AV0A 1IXSB 5LMNM 5ITYA 1E94E 2LWXA 4LZJA 2BJVA 3CF6E 2XH9A 3PXGA 4X64M 2ZM6M 1I94M 4QHTA 2XGNA 2AHMA 4LF4M 4I4LA 2KRKA 2XSZD 3JAMS 3GPUA 3M6AA 1XC8A 1IN5A 5IZ7D 3SASA 1IXZA 4RF1A 4FD2A 4GKKM 3AKZA 4PT5A 3UMMA 1E32A 3NBIA 4IBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW0 A;  2HL7 A; 
#chains in the Genus database with same CATH topology
 3UZU A;  1BVS A;  2L2D A;  3HU3 A;  4NSO B;  3FYD A;  1HT2 E;  2H1R A;  1QAN A;  2DAK A;  4JI2 M;  3H4M A;  1YLA A;  1IN4 A;  1XMQ M;  3A42 A;  3T1H M;  2KRU A;  1VQ1 A;  3AOE C;  4DV4 M;  4BBA A;  2KNA A;  2LHG A;  3EIH A;  3TQS A;  2EKK A;  2C98 A;  1SXJ A;  4KOD A;  3SC3 A;  4LZZ A;  3VLF B;  1ZMW A;  2I7N A;  3B9P A;  5FLX S;  2DWM A;  4LF7 M;  2Y0T A;  3CF0 A;  3KOW E;  2RGO A;  1OFH A;  3DOA A;  4LFB M;  3KOZ E;  4BB9 A;  2XEP A;  4DV5 M;  2FS1 A;  4I81 A;  4OVZ B;  3T1Y M;  2HCB A;  1L1Z A;  1T3T A;  2DNA A;  3GPX A;  4DR6 M;  1QUT A;  2ZTD A;  1DGG A;  1NY5 A;  1F4I A;  2C99 A;  3VK7 A;  1GKI A;  4M0W A;  5FSW A;  1SXJ D;  3AFH A;  1KYI A;  4KLN A;  5L8R F;  2K0B X;  4LJ7 A;  4Z8X A;  3U5Z B;  5A2Q S;  3QYB A;  3M0E A;  2MR9 A;  2BWB A;  2EO2 A;  3IEC A;  1G71 A;  3U6C A;  1PGY A;  3KP0 E;  1FNN A;  3L25 A;  1N34 M;  4CGY B;  4EIW A;  1XXH E;  2D7H A;  4BLC A;  2O01 F;  1N36 M;  3GLG A;  4FCV A;  2CV0 A;  3NWL A;  2QPA A;  4IBK A;  3CGW A;  4ZPX A;  1K3W A;  1KFV A;  3LQR A;  2XZU A;  2JNH A;  1GAB A;  2XZF A;  1CUK A;  2R6F A;  1OKS A;  2UUA M;  4JI8 M;  3MJ5 A;  4QNR A;  2VQE M;  1IXS A;  3I51 A;  1MN3 A;  3E21 A;  2KZS A;  5FTK A;  2YQZ A;  3FUT A;  4AW4 A;  1PJT A;  1YE9 A;  4AI6 A;  4L15 A;  2L6O A;  4NL4 H;  4B3T M;  1N75 A;  2KA6 B;  4I5S A;  2X49 A;  4LJ6 A;  3U6M A;  2DZN B;  3PFI A;  3HHY A;  2ZTC A;  5FTJ A;  2BWE A;  3AL0 C;  2WSC F;  3K2L A;  4IIW A;  3MK6 A;  4MGH A;  3SAR A;  1R6B X;  1NHW C;  4MGK E;  3W0F A;  1L1T A;  3LMM A;  5GKN A;  3W68 A;  4X65 M;  1C7Y A;  1GJS A;  1HT1 E;  1QAM A;  1Q39 A;  1QDR A;  1QAQ A;  2JZ0 A;  2JY8 A;  2DHY A;  2CRU A;  1XHB A;  4IJF A;  2C96 A;  5JI3 E;  3BOS A;  1QQW A;  1J5E M;  1Q02 A;  4CIZ A;  4KHP M;  4MGY E;  3FD9 A;  2YNM D;  4G4O A;  3Q8X A;  4G3O A;  4X66 M;  2L4E A;  2QP9 X;  1ORY B;  3DFZ A;  3T38 A;  4B3S M;  4JI7 M;  4D82 A;  3SHF A;  4NRW A;  4JI4 M;  1R5L A;  1WGL A;  2KZU A;  4IBF A;  3SAV A;  1PRB A;  1G3I A;  2CHQ A;  4JI5 M;  4IBG A;  1MX0 A;  1VEK A;  3LVW A;  4KO8 A;  4NSR A;  5EQT A;  4QOZ C;  2F5Q A;  5ITR A;  4OVZ A;  3GLI E;  3LCU A;  2FOI C;  2KHH A;  3U6S A;  1QDT A;  2J7O A;  3UJN A;  5EXS A;  4IBB A;  3GLH A;  2NQ8 C;  4DV3 M;  2XLJ A;  3FYC A;  2XSZ A;  1DGH B;  5KPZ A;  2QBY A;  3GP1 A;  1T6O A;  4LF6 M;  3DA1 A;  3FTD A;  3HX3 A;  1K82 A;  1AIP C;  2F4V M;  4GIP A;  3GO8 A;  5C18 A;  4LFC M;  2V1C A;  3C58 A;  2OPF A;  1A5T A;  3GLH E;  1YUB A;  1GJT A;  1HR0 M;  2VF7 A;  2YR0 A;  2GQF A;  1R7R A;  4B7G A;  2ZAO A;  1NSF A;  4LG2 A;  2JY6 B;  5IWA M;  1N32 M;  2OOB A;  4M9S A;  4A3V B;  5EP3 A;  2WSE F;  1R4G A;  3B74 A;  1YSY A;  1P3Q Q;  3HU1 A;  4PD2 A;  3K8Z A;  4B7H A;  4GHA A;  1DV0 A;  2EJS A;  3EIE A;  1N77 A;  1EIJ A;  1K3X A;  4QNM A;  2Z3X A;  3GQ3 A;  1NJG A;  4REZ A;  3A98 B;  3HHW A;  3VKG A;  4OU7 A;  1X37 A;  4NC6 A;  2CP8 A;  1Z5A A;  3TWL A;  1EFU B;  2Y21 A;  3JR4 A;  3U6Q A;  2X4A A;  3FUW A;  3ZH9 B;  2X8A A;  4RF0 A;  1IFY A;  2FNA A;  1TGU A;  3GQ4 A;  3TWK A;  1N33 M;  2M60 A;  4LFA M;  3SMS A;  4MGI E;  1HJP A;  3HJQ A;  4LY6 A;  3MHV C;  3RGS A;  1PJS A;  2DZL A;  1G4A E;  4PCZ A;  1D0M A;  5DFL A;  4CJ6 A;  2LTU A;  1G8P A;  3GLF B;  2DWN A;  4NXN M;  3TL4 X;  3I4Y A;  4DBG B;  2V1U A;  2J7N A;  4YHH M;  4LGM A;  1IQP A;  5H37 D;  4JYA M;  5ITX A;  2CUZ A;  3VK8 A;  4L6V 6;  3CTW B;  1R2Z A;  2CV2 A;  1IN7 A;  1S3S A;  2OQ4 A;  2FH0 A;  2W82 A;  1SXJ E;  4HLQ A;  3L26 A;  1NV9 A;  2VDB B;  2UUB M;  2R44 A;  3KOX E;  1NY6 A;  3LQQ A;  5ITX E;  1HNZ M;  1R2Y A;  3RGP A;  4YY3 M;  3HKP A;  3SBJ A;  4IJE A;  2F5S A;  5DNY A;  4GHL A;  2UXB M;  2XF3 A;  3LCV B;  4DR7 M;  3TE6 A;  3C9P A;  1NHG C;  2I7P A;  4GMQ A;  4L4U A;  2R65 A;  3I4V A;  5EXT A;  5KQ8 A;  4F1I A;  3K9P A;  1J7K A;  1TR8 A;  2Z8Y M;  4FCT A;  1G41 A;  2VII A;  4LRS A;  4Q7J A;  3SYK A;  2EA0 A;  1G59 A;  4LJ8 A;  4OX9 M;  4R3D A;  3ZCB B;  3KW6 A;  1DGH A;  1VDL A;  2R45 A;  2KEB A;  3B89 A;  3J27 B;  1WXQ A;  2HHH M;  1D0K A;  2MJ5 B;  3VKH A;  2UXC M;  4LF5 M;  2A5Y B;  4D80 A;  1DGB A;  3SAT A;  2L09 A;  4JN6 A;  5KPR A;  3GLG E;  4G4R A;  2VF8 A;  1L2B A;  2CV1 A;  4TUW A;  3HHX A;  1KSF X;  4L78 A;  3T6P A;  4AKI A;  4LJ5 A;  4DR3 M;  1QYR A;  2KXE A;  2V6Z M;  3D8L A;  2HKJ A;  2LBC A;  5ITT A;  4R7G A;  3AOG A;  4Y28 F;  3HJS A;  3KP1 E;  3W67 A;  3DZD A;  4DV7 M;  1TDZ A;  2Y20 A;  1IBL M;  3R9X B;  1GLN A;  1Z5B A;  2UUC M;  2KDL A;  1ZQ9 A;  1DO0 A;  4CHT B;  4IBJ A;  1GL6 A;  2K47 A;  2L7I A;  3HU2 A;  4JI3 M;  4NXM M;  1WJ7 A;  3SAU A;  2C9O A;  3E4R A;  5FTL A;  1ZAE A;  4RKU F;  1TH2 A;  4G4Q A;  4JI0 M;  3FRH A;  1NNJ A;  4AG5 A;  5FTM A;  3WHK A;  1ZMU A;  1NVM A;  2JUJ A;  2WSF F;  3AOE A;  1GO5 A;  4QHS A;  3PVS A;  4GC5 A;  3B7Q A;  4DUZ M;  2DI0 A;  2CFO A;  2EKF A;  4Z6Y A;  2JWS A;  4X62 M;  4DR5 M;  4G4N A;  1V34 A;  3VDP A;  1Q3C A;  1HNW M;  3THG A;  2QHO B;  2CHV A;  3BXW A;  3ZC7 B;  2LH0 A;  3FUV A;  2R4E A;  3HZJ A;  3FRI A;  3GRU A;  3AJI B;  3I01 M;  5EXX A;  1VEJ A;  1Z6T A;  1J09 A;  4NOO B;  4HL4 A;  2KNZ A;  1DO2 A;  1AUA A;  2LVA A;  3D8B A;  3K9O A;  1C1K A;  2R0I A;  1DGF A;  3J7B A;  4IBE A;  4CIS A;  1Z5C A;  3K92 A;  1OAO C;  2Y0Q A;  1QAO A;  2E5L M;  4MB7 A;  3U60 B;  2RKO A;  3HGI A;  2N35 A;  2HL7 A;  5E26 A;  1W5S A;  3L29 A;  3VFD A;  3U5Z A;  3SAW A;  4LJ9 A;  4AG6 A;  4DUY M;  2G5G X;  5FTN A;  1IBK M;  2DVW B;  2ZBK B;  4S12 A;  1NNU C;  2D7G A;  4IBI A;  2VQF M;  2CEA A;  2LHC A;  1WGN A;  2LVO C;  2ZAM A;  4HEO A;  2LVP C;  2J5Y A;  2JXN A;  5E6J A;  3H4J A;  2C5R A;  4KT0 F;  1XXH B;  3U6E A;  1HQC A;  5LMU M;  1IXR C;  3SFZ A;  3VDU A;  4JI6 M;  2APL A;  4B08 A;  2QCU A;  2DAE A;  3T15 A;  4M9X A;  4FWG A;  3I04 M;  3F92 A;  5EXP A;  1GVN A;  4DV1 M;  1NO1 A;  1W5T A;  1JQJ C;  1D2N A;  2RGH A;  5IRE B;  4MGZ E;  3J80 S;  3IG8 A;  5EP2 A;  3CF2 A;  1JR3 A;  1IY0 A;  2OO9 A;  1TTE A;  3KSX A;  3KFU G;  4DR4 M;  4AQY M;  2DKL A;  4AZF A;  2M5Z A;  3KS8 A;  1QUS A;  1WIV A;  4IBC A;  3W0L B;  4GKJ M;  3U6D A;  4L16 A;  5F3W A;  2QZ4 A;  1OAI A;  1QZM A;  3FTE A;  5JI2 E;  3J7A S;  4P16 A;  1OQY A;  3KDS E;  1JR3 D;  4B3M M;  1VDD A;  1XB2 B;  3UK6 A;  1MJG M;  1QZE A;  3U6P A;  1IY2 A;  2O25 A;  3L28 A;  4LJA A;  3GRR A;  4M9Z A;  4MH0 E;  4F2L A;  3FUU A;  3KXE C;  4DR1 M;  3U6L A;  2FE8 A;  2XFT A;  2OOA A;  4DV0 M;  1E9S A;  4M0D A;  1OIZ A;  2LNH C;  3SHG B;  4I8O A;  3Q8G A;  1L8Q A;  1TF0 B;  1V92 A;  1OIP A;  2L4F A;  5EP1 A;  5BPV A;  5DYI A;  3U6O A;  3KOY E;  4LGY A;  1E9R A;  2C9C A;  1XNQ M;  1ZV1 A;  2Z4R A;  3R8F A;  1VG5 A;  4LJ4 A;  1IN8 A;  1PJQ A;  4UN2 B;  3PNY A;  2JZ1 A;  2R62 A;  3K1J A;  2R18 A;  3GLI B;  2CHG A;  1OTR A;  2XFS A;  3NBX X;  4DV2 M;  2R46 A;  4XBO A;  4GC9 A;  5KO3 A;  1L2C A;  3E46 A;  4JXJ A;  3TWM A;  3FTC A;  3FUX A;  3U60 A;  3QWL A;  3QYE A;  2WZJ A;  3IHP A;  1IN6 A;  2FFJ A;  3U61 B;  3B7N A;  1OJL A;  3GLH B;  1FJG M;  3LVV A;  1Z59 A;  2QBY B;  2KW0 A;  4FWD A;  4PDI A;  5BR8 M;  2G8L A;  3RE8 A;  1HNX M;  1QVR A;  5KPT A;  3M7G A;  1XXH A;  3J2P B;  3HJ8 A;  5DYG A;  5ITQ A;  4ITQ A;  3J81 S;  2O5R A;  3OTO M;  2DAI A;  2B3T A;  3KSJ A;  4FCW A;  1OFI A;  4GEW A;  2DZO B;  4PDG A;  1PM5 A;  2D7E A;  1Q3B A;  2EUC A;  2DXI A;  4GRI A;  4JI1 M;  1N78 A;  5C1B A;  1XWI A;  4K0K M;  2LVQ D;  1TH3 A;  1H6U A;  3A45 A;  4AKH A;  1UM8 A;  3KVW A;  3E9S A;  1XMO M;  2DWL A;  2UU9 M;  2QQ8 A;  1T43 A;  3FE3 A;  4G6Z A;  4W5W A;  3HHZ A;  1NJF A;  1IBM M;  2F5O A;  1VEG A;  2Q2E B;  2P5T A;  4ANR A;  2K9D A;  2Z7J A;  2DEN A;  2QEN A;  2R4J A;  1TH4 A;  3ILK A;  4QOS A;  5IT9 S;  2MGW A;  4AKG A;  2QSF X;  3JR5 A;  1TDH A;  3UGJ A;  4FVM A;  4B7F A;  2ERC A;  1Y8G A;  4WUR A;  1IY1 A;  2GNO A;  2KNV A;  3L27 A;  2L7H A;  3GPY A;  1JB0 F;  3GLF A;  4NRV A;  2F5N A;  3WHL A;  4LF9 M;  1WR1 B;  2H5X A;  3KS4 A;  1SXJ B;  3GLF E;  3LW5 F;  3GQ5 A;  4P17 A;  1EE8 A;  1SXJ C;  1SG9 A;  1L2D A;  3QAU A;  4JV5 M;  2UXD M;  4GH9 A;  4FW9 A;  3SYL A;  7CAT A;  2JA2 A;  4XGI A;  4D81 A;  2DWZ B;  4XK8 F;  2Z4S A;  1D0L A;  2F5P A;  3BBZ A;  3L2A A;  2CWB A;  3IG5 A;  2MRO B;  5EP4 A;  5KQD A;  4DV6 M;  3GLI A;  2MH8 A;  4LF8 M;  3MMP A;  1V33 A;  4L8R C;  5EJC A;  2BJW A;  3SMP A;  4LCB A;  1IM2 A;  1PJI A;  1RU3 A;  2G3Q A;  4B3R M;  1HQY E;  4RNA A;  3FTF A;  2QNJ A;  2RRU A;  3B7Z A;  3GRY A;  3RFW A;  4GIT A;  2DHR A;  1UFZ A;  8CAT A;  3A46 A;  3C3D A;  3HY5 A;  4LRT A;  3ZQJ A;  4WW0 A;  1WHC A;  1MU5 A;  2K6B A;  2LXE A;  3FKE A;  2YFQ A;  4WP2 A;  5ITU A;  3U61 A;  2CE7 A;  2BNK A;  2ZAN A;  3GLG B;  4MM3 B;  3GRV A;  3PNV A;  1XNR M;  2JP7 A;  1GL7 A;  3TPZ A;  1LV7 A;  4DR2 M;  4FWH A;  3GPP A;  1PJJ A;  2DAM A;  1I4W A;  3C3E A;  3HWS A;  4II7 A;  4OW0 A;  3AV0 A;  1IXS B;  5LMN M;  5ITY A;  1NV8 A;  1E94 E;  1JR3 E;  2LWX A;  4LZJ A;  1LTM A;  2BJV A;  3CF6 E;  2XH9 A;  3PXG A;  4X64 M;  2ZM6 M;  1I94 M;  4QHT A;  2XGN A;  2HAK A;  2AHM A;  4LF4 M;  4I4L A;  2HWJ A;  2KRK A;  2XSZ D;  4R71 A;  3JAM S;  3GPU A;  3M6A A;  1XC8 A;  2DAG A;  1IN5 A;  5IZ7 D;  3SAS A;  1ZMV A;  1IXZ A;  4RF1 A;  2JY7 A;  4FD2 A;  2LVN C;  2JY5 A;  4GKK M;  3AKZ A;  4PT5 A;  3V76 A;  3UMM A;  1E32 A;  3NBI A;  4IBD A; 
#chains in the Genus database with same CATH homology
 3UZU A;  3HU3 A;  4NSO B;  3FYD A;  1HT2 E;  2H1R A;  1QAN A;  4JI2 M;  3H4M A;  1IN4 A;  3A42 A;  3T1H M;  2KRU A;  3AOE C;  4DV4 M;  4BBA A;  3EIH A;  3TQS A;  2C98 A;  1SXJ A;  4KOD A;  3SC3 A;  4LZZ A;  3VLF B;  3B9P A;  2I7N A;  5FLX S;  2DWM A;  4LF7 M;  2Y0T A;  3CF0 A;  3KOW E;  2RGO A;  1OFH A;  3DOA A;  4LFB M;  3KOZ E;  4BB9 A;  2XEP A;  4DV5 M;  4I81 A;  4OVZ B;  3T1Y M;  2HCB A;  1L1Z A;  1T3T A;  3GPX A;  4DR6 M;  1DGG A;  1NY5 A;  2C99 A;  3VK7 A;  1GKI A;  4M0W A;  5FSW A;  1SXJ D;  3AFH A;  1KYI A;  4KLN A;  4LJ7 A;  4Z8X A;  3U5Z B;  5A2Q S;  3M0E A;  2EO2 A;  3U6C A;  3KP0 E;  1FNN A;  3L25 A;  1N34 M;  4CGY B;  4EIW A;  2D7H A;  4BLC A;  1N36 M;  3GLG A;  4FCV A;  2CV0 A;  3NWL A;  2QPA A;  4IBK A;  4ZPX A;  1K3W A;  1KFV A;  3LQR A;  2XZU A;  2XZF A;  4JI8 M;  2UUA M;  3MJ5 A;  4QNR A;  2VQE M;  3I51 A;  2KZS A;  5FTK A;  2YQZ A;  3FUT A;  4AW4 A;  1YE9 A;  4L15 A;  2L6O A;  4NL4 H;  4B3T M;  1N75 A;  2KA6 B;  4I5S A;  2X49 A;  4LJ6 A;  3U6M A;  2DZN B;  3PFI A;  3HHY A;  5FTJ A;  3AL0 C;  3K2L A;  4IIW A;  3MK6 A;  4MGH A;  3SAR A;  1R6B X;  1NHW C;  4MGK E;  3W0F A;  1L1T A;  3LMM A;  5GKN A;  4X65 M;  1HT1 E;  1QAM A;  1Q39 A;  1QAQ A;  1XHB A;  4IJF A;  2C96 A;  5JI3 E;  3BOS A;  1QQW A;  1J5E M;  4KHP M;  4MGY E;  3FD9 A;  2YNM D;  4G4O A;  3Q8X A;  4X66 M;  4B3S M;  3T38 A;  2QP9 X;  1ORY B;  3DFZ A;  4JI7 M;  4D82 A;  3SHF A;  4NRW A;  4JI4 M;  2KZU A;  4IBF A;  3SAV A;  1G3I A;  2CHQ A;  4JI5 M;  4IBG A;  1MX0 A;  3LVW A;  4KO8 A;  4NSR A;  5EQT A;  4QOZ C;  2F5Q A;  5ITR A;  4OVZ A;  2FOI C;  3U6S A;  2J7O A;  3UJN A;  5EXS A;  4IBB A;  3GLH A;  2NQ8 C;  4DV3 M;  2XLJ A;  3FYC A;  2XSZ A;  1DGH B;  5KPZ A;  2QBY A;  3GP1 A;  4LF6 M;  3DA1 A;  3FTD A;  1K82 A;  2F4V M;  4GIP A;  3GO8 A;  5C18 A;  4LFC M;  2V1C A;  3C58 A;  2OPF A;  1YUB A;  1HR0 M;  2YR0 A;  1R7R A;  4B7G A;  2ZAO A;  1NSF A;  4LG2 A;  5IWA M;  1N32 M;  4M9S A;  4A3V B;  5EP3 A;  1YSY A;  3HU1 A;  4PD2 A;  3K8Z A;  4B7H A;  4GHA A;  3EIE A;  1N77 A;  1K3X A;  4QNM A;  2Z3X A;  3GQ3 A;  1NJG A;  4REZ A;  3A98 B;  3HHW A;  3VKG A;  4OU7 A;  1X37 A;  3TWL A;  3JR4 A;  1Z5A A;  2Y21 A;  3U6Q A;  2X4A A;  3FUW A;  3ZH9 B;  2X8A A;  4RF0 A;  2FNA A;  1TGU A;  3GQ4 A;  3TWK A;  1N33 M;  2M60 A;  4LFA M;  3SMS A;  4MGI E;  3HJQ A;  4LY6 A;  3MHV C;  3RGS A;  1G4A E;  4PCZ A;  3GLF B;  1G8P A;  2DWN A;  4NXN M;  3TL4 X;  3I4Y A;  2V1U A;  2J7N A;  4YHH M;  4LGM A;  1IQP A;  5H37 D;  4JYA M;  5ITX A;  2CUZ A;  3VK8 A;  3CTW B;  1R2Z A;  2CV2 A;  1IN7 A;  1S3S A;  2OQ4 A;  2W82 A;  1SXJ E;  4HLQ A;  3L26 A;  2UUB M;  3KOX E;  1NY6 A;  3LQQ A;  5ITX E;  1HNZ M;  1R2Y A;  3RGP A;  4YY3 M;  3HKP A;  3SBJ A;  4IJE A;  2F5S A;  5DNY A;  4GHL A;  2UXB M;  2XF3 A;  4DR7 M;  3TE6 A;  1NHG C;  2I7P A;  4GMQ A;  4L4U A;  2R65 A;  3I4V A;  5EXT A;  5KQ8 A;  1J7K A;  4FCT A;  1G41 A;  2VII A;  4LRS A;  3SYK A;  2EA0 A;  1G59 A;  4LJ8 A;  4OX9 M;  4R3D A;  3ZCB B;  3KW6 A;  1DGH A;  2R45 A;  2KEB A;  3J27 B;  1WXQ A;  2HHH M;  3VKH A;  2UXC M;  4LF5 M;  2A5Y B;  4D80 A;  1DGB A;  3SAT A;  2L09 A;  4JN6 A;  5KPR A;  4G4R A;  1L2B A;  2CV1 A;  4TUW A;  3HHX A;  1KSF X;  4L78 A;  4AKI A;  4LJ5 A;  4DR3 M;  1QYR A;  2KXE A;  2V6Z M;  3D8L A;  2HKJ A;  5ITT A;  4R7G A;  3AOG A;  3HJS A;  3KP1 E;  1IBL M;  3DZD A;  4DV7 M;  1TDZ A;  2Y20 A;  3R9X B;  1GLN A;  1Z5B A;  2UUC M;  1ZQ9 A;  1DO0 A;  4CHT B;  4IBJ A;  1GL6 A;  2K47 A;  2L7I A;  3HU2 A;  4JI3 M;  4NXM M;  3SAU A;  2C9O A;  3E4R A;  5FTL A;  1ZAE A;  1TH2 A;  4G4Q A;  4JI0 M;  1NNJ A;  4AG5 A;  5FTM A;  3WHK A;  3AOE A;  1NVM A;  4QHS A;  3PVS A;  4GC5 A;  4DUZ M;  2CFO A;  4Z6Y A;  4X62 M;  4DR5 M;  4G4N A;  3VDP A;  1Q3C A;  1HNW M;  3THG A;  2CHV A;  3ZC7 B;  2LH0 A;  3FUV A;  2R4E A;  3GRU A;  3AJI B;  5EXX A;  1Z6T A;  1J09 A;  4NOO B;  4HL4 A;  5KO3 A;  1DO2 A;  4LF8 M;  3D8B A;  4AI6 A;  1C1K A;  1DGF A;  3J7B A;  4IBE A;  4CIS A;  1Z5C A;  3K92 A;  2Y0Q A;  1QAO A;  2E5L M;  4MB7 A;  3U60 B;  2RKO A;  3HGI A;  2HL7 A;  5E26 A;  1W5S A;  3L29 A;  3VFD A;  3U5Z A;  3SAW A;  4LJ9 A;  4AG6 A;  4DUY M;  2G5G X;  5FTN A;  1IBK M;  2DVW B;  2ZBK B;  4S12 A;  1NNU C;  2D7G A;  4IBI A;  2VQF M;  2CEA A;  2ZAM A;  5E6J A;  2C5R A;  1XXH B;  3U6E A;  1HQC A;  5LMU M;  1IXR C;  3SFZ A;  3VDU A;  4JI6 M;  4B08 A;  2QCU A;  3T15 A;  4M9X A;  4FWG A;  5EXP A;  1GVN A;  4DV1 M;  1W5T A;  1JQJ C;  1D2N A;  2RGH A;  5IRE B;  4MGZ E;  3J80 S;  3IG8 A;  5EP2 A;  3CF2 A;  1JR3 A;  1IY0 A;  3KSX A;  3KFU G;  4DR4 M;  4AQY M;  4AZF A;  2M5Z A;  3KS8 A;  4IBC A;  3W0L B;  4GKJ M;  3U6D A;  4L16 A;  5F3W A;  2QZ4 A;  1QZM A;  3FTE A;  5JI2 E;  3J7A S;  4P16 A;  3KDS E;  1JR3 D;  4B3M M;  1VDD A;  3UK6 A;  3U6P A;  1IY2 A;  3L28 A;  4LJA A;  3GRR A;  4M9Z A;  4MH0 E;  3FUU A;  3KXE C;  4DR1 M;  3U6L A;  2FE8 A;  2XFT A;  4DV0 M;  1E9S A;  4M0D A;  2LNH C;  3SHG B;  4I8O A;  1L8Q A;  5EP1 A;  5BPV A;  5DYI A;  3U6O A;  3KOY E;  4LGY A;  1E9R A;  2C9C A;  1XNQ M;  2Z4R A;  3R8F A;  4LJ4 A;  1IN8 A;  3PNY A;  3K1J A;  2R62 A;  2R18 A;  3GLI B;  2CHG A;  2XFS A;  4DV2 M;  2R46 A;  4XBO A;  4GC9 A;  1L2C A;  4JXJ A;  3TWM A;  3FTC A;  3FUX A;  3U60 A;  3QWL A;  1IN6 A;  2FFJ A;  3U61 B;  1OJL A;  3GLH B;  1FJG M;  3LVV A;  1Z59 A;  2QBY B;  2KW0 A;  4FWD A;  4PDI A;  5BR8 M;  2G8L A;  3RE8 A;  1HNX M;  1QVR A;  5KPT A;  3M7G A;  1XXH A;  3J2P B;  3HJ8 A;  5DYG A;  5ITQ A;  4ITQ A;  3J81 S;  2O5R A;  3OTO M;  4FCW A;  3KSJ A;  1OFI A;  2DZO B;  4PDG A;  1PM5 A;  2D7E A;  1Q3B A;  2EUC A;  2DXI A;  4GRI A;  4JI1 M;  1N78 A;  5C1B A;  1XWI A;  4K0K M;  1TH3 A;  3A45 A;  1H6U A;  4AKH A;  1UM8 A;  3KVW A;  3E9S A;  1XMO M;  2DWL A;  2UU9 M;  4G6Z A;  4W5W A;  3HHZ A;  1NJF A;  1IBM M;  2F5O A;  2Q2E B;  2P5T A;  2Z7J A;  2QEN A;  3ILK A;  2R4J A;  1TH4 A;  4QOS A;  5IT9 S;  4AKG A;  3JR5 A;  1TDH A;  3UGJ A;  4FVM A;  4B7F A;  2ERC A;  4WUR A;  1IY1 A;  3L27 A;  3GLF A;  3GPY A;  2L7H A;  4NRV A;  2F5N A;  3WHL A;  4LF9 M;  3KS4 A;  1SXJ B;  3GQ5 A;  1EE8 A;  1SXJ C;  1L2D A;  3QAU A;  4JV5 M;  2UXD M;  4GH9 A;  4FW9 A;  3SYL A;  7CAT A;  2JA2 A;  4XGI A;  4D81 A;  2DWZ B;  2Z4S A;  2F5P A;  3L2A A;  5EP4 A;  3IG5 A;  5KQD A;  4DV6 M;  1XMQ M;  3GLI A;  4L8R C;  5EJC A;  2BJW A;  3SMP A;  4LCB A;  1IM2 A;  1PJI A;  4B3R M;  1HQY E;  4RNA A;  3FTF A;  3GRY A;  3RFW A;  4GIT A;  2DHR A;  8CAT A;  3A46 A;  4LRT A;  4WW0 A;  2LXE A;  1MU5 A;  5ITU A;  3FKE A;  3U61 A;  2YFQ A;  2CE7 A;  2BNK A;  2ZAN A;  3GLG B;  4MM3 B;  3GRV A;  3PNV A;  1XNR M;  1GL7 A;  3TPZ A;  1LV7 A;  4DR2 M;  4FWH A;  3GPP A;  1PJJ A;  1I4W A;  3HWS A;  4II7 A;  4OW0 A;  3AV0 A;  1IXS B;  5LMN M;  5ITY A;  1E94 E;  2LWX A;  4LZJ A;  2BJV A;  3CF6 E;  2XH9 A;  3PXG A;  4X64 M;  2ZM6 M;  1I94 M;  4QHT A;  2XGN A;  2AHM A;  4LF4 M;  4I4L A;  2KRK A;  2XSZ D;  3JAM S;  3GPU A;  3M6A A;  1XC8 A;  1IN5 A;  5IZ7 D;  3SAS A;  1IXZ A;  4RF1 A;  4FD2 A;  4GKK M;  3AKZ A;  4PT5 A;  3UMM A;  1E32 A;  3NBI A;  4IBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...