2HL7A

Crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
b'GSHMAIDTYEFASDAERERFRNLTQELRCPKCQNQDIADSNAPIAADLRKQIYGQLQQGKSDGEIVDYMVARYGDFVRYKPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome C-type biogenesis protein CcmH
molecule tags Oxidoreductase
source organism Pseudomonas aeruginosa
publication title A strategic protein in cytochrome c maturation: three-dimensional structure of CcmH and binding to apocytochrome c
pubmed doi rcsb
total genus 29
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.640 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2hl7A00
2KW0A 2HL7A
chains in the Genus database with same CATH superfamily
3L27A 5DYGA 3FTDA 3I01M 1DV0A 4NRVA 4Z8XA 1FNNA 2XFSA 3FD9A 2G8LA 2J5YA 2WZJA 1SXJD 1OIPA 2C98A 2R62A 2DAMA 2LVQD 1NO1A 4MGYE 1VEJA 1JR3D 2MGWA 2ZBKB 2EJSA 5BPVA 4GKJM 2QPAA 1ZMVA 7CATA 3GRUA 4B3TM 4IBDA 5EXSA 3I51A 4RKUF 4LG2A 3LCUA 4OU7A 1H6UA 2XH9A 1W5TA 4G4NA 5E26A 2MH8A 2BWEA 3K92A 1N34M 3L25A 4LZJA 2DKLA 2Y0TA 2M5ZA 2DVWB 3K8ZA 3LW5F 5EXPA 5IZ7D 4X66M 4R3DA 3L2AA 2HHHM 1XC8A 2JZ1A 2GNOA 2Z7JA 3PNYA 4I4LA 1NY5A 1AUAA 3FUTA 4M0WA 4FCTA 2DWNA 2V1UA 1ZMUA 1D0LA 4DR1M 3LVVA 3U6OA 3R8FA 4OW0A 2JP7A 2BNKA 1Z5BA 1YE9A 1WGNA 3J80S 4FW9A 2M60A 2QSFX 3SYKA 5JI3E 5KPZA 2UXBM 1JR3E 3J7BA 5BR8M 1IBKM 3SARA 1IY2A 4NXMM 1D2NA 4REZA 2LTUA 1QAQA 1V34A 2QENA 2JWSA 4GKKM 4KHPM 3TQSA 3THGA 1IY1A 1Q02A 3ILKA 5C18A 3M0EA 4RF1A 1YSYA 4DV4M 3GLGA 2OPFA 1OTRA 1XXHE 3AFHA 3T6PA 1I94M 1HR0M 2QHOB 3SASA 3HU2A 2D7HA 2G3QA 4G3OA 4CHTB 4IJFA 1PJTA 4KO8A 2X8AA 2EKFA 3ZH9B 5L8RF 3U6SA 2Z4SA 3AOEA 1N75A 2J7NA 3SC3A 1TH4A 4PD2A 2XGNA 4RNAA 3ZC7B 2LH0A 4HLQA 4OVZB 2VQFM 4AG5A 4LFBM 1SG9A 5FTNA 4LJ4A 1IBMM 3SYLA 1IN8A 1Q3CA 4KLNA 2KNAA 2F5QA 2R0IA 2CRUA 4LY6A 3TL4X 4JYAM 2F5NA 4AKIA 3LQRA 4LF6M 3HHXA 2B3TA 4LGYA 3GLIA 1OKSA 4AKGA 3M6AA 2Y0QA 1N77A 2JA2A 3M7GA 3PFIA 4IBIA 2DWMA 2LWXA 3U6QA 2CEAA 4HEOA 3C58A 4LRTA 2KNZA 3U60A 3B89A 1NSFA 2KZSA 2OO9A 2UU9M 4EIWA 2DI0A 4JI4M 4IBGA 1MX0A 3D8LA 2Y20A 4XBOA 2I7NA 4I8OA 4F1IA 3CF6E 1WIVA 5KQDA 2HAKA 4LJ6A 1SXJA 1PM5A 1XB2B 1T6OA 1IN6A 4LJ7A 4L6V6 1R7RA 1G59A 5ITXA 3HX3A 1NJFA 3CF0A 4LJAA 1QUSA 4WP2A 4B7GA 4FCWA 1L1ZA 4DV6M 2OQ4A 2LVNC 3SMSA 5IREB 2UUBM 3SAUA 1QYRA 4IBJA 2E5LM 3MK6A 4QOSA 3GLHE 4DR7M 1N32M 4GC9A 4HL4A 2P5TA 2XZFA 1WHCA 4LF4M 4DBGB 2O25A 1IXSB 3AJIB 5ITXE 2K6BA 1QDRA 3WHLA 3FE3A 2BJVA 2HKJA 4K0KM 2UUAM 1HNWM 2A5YB 3FYDA 2KRKA 3RFWA 1QANA 2KDLA 2RGOA 1GJTA 1SXJE 3KP0E 5FLXS 1GO5A 1YLAA 4JI0M 2QZ4A 1E32A 3PVSA 2H5XA 3J81S 4L78A 5EP1A 3KSXA 3KS4A 5JI2E 4LJ9A 3T15A 3GQ4A 3GRYA 3GLFB 2ZAMA 4LF5M 1I4WA 1L2CA 2F4VM 2C9OA 1K3WA 4M9XA 3W67A 2XLJA 2CV0A 1PGYA 3IECA 4WW0A 1Q39A 4KODA 5ITUA 3VK8A 1VDDA 1LV7A 1MJGM 3DA1A 2FFJA 5ITYA 3IHPA 2RGHA 5EP3A 1PRBA 4QHSA 1E9SA 2ZTCA 3GQ5A 2O01F 1Z59A 3T1HM 2DAKA 1MN3A 2WSEF 1S3SA 2L6OA 3A45A 4I5SA 1ZMWA 1DO0A 3UGJA 3GLHA 3W68A 4X65M 4LFCM 1TH2A 2QNJA 2DXIA 4ZPXA 2LVPC 3EIHA 1L8QA 2DHRA 3JR4A 4LF8M 1NY6A 4NXNM 5FTKA 3NWLA 3F92A 4I81A 1ZV1A 3FUXA 2HCBA 1NNJA 1C1KA 4MB7A 4IJEA 3KS8A 3U6MA 1G8PA 1OFHA 3RE8A 4D82A 4GMQA 3H4MA 2CFOA 3U61B 1F4IA 1IFYA 1VEGA 5H37D 5EP2A 3GPYA 3TE6A 4TUWA 2L7IA 3H4JA 4CIZA 4WURA 2DHYA 3FUWA 4NSOB 4S12A 1XMOM 1L2BA 1N36M 2R4EA 1XHBA 5EQTA 4AZFA 3VDUA 1YUBA 1NHWC 4XK8F 2KEBA 3U6CA 4YHHM 4JI1M 4LGMA 2EO2A 2R65A 2H1RA 2CV2A 4JI2M 3CGWA 3GP1A 1GVNA 1R4GA 2L09A 2JUJA 4DR5M 5KO3A 1ZQ9A 1VG5A 4LCBA 3V76A 5ITTA 2YNMD 3TWKA 2ERCA 3B74A 3GLGB 4GHAA 2FH0A 2L4EA 3U6PA 4R71A 3VKGA 2FS1A 1Z5AA 2K9DA 2X4AA 2LNHC 4B3SM 1PJIA 2QBYA 2JY8A 1G4AE 3FKEA 3VK7A 2VIIA 3I4VA 3HHWA 4FWDA 2GQFA 1NV8A 3AOGA 3B7QA 3GPXA 3JAMS 2VDBB 4LJ5A 1KYIA 3AV0A 1DGHB 5KPTA 4G6ZA 1WR1B 2Z8YM 1N78A 1OAOC 3VDPA 1HNXM 2BWBA 1IBLM 2KXEA 3BBZA 3CF2A 3HKPA 3TPZA 2N35A 3SATA 2XZUA 1UFZA 3KOZE 5KQ8A 2XEPA 4LRSA 1JQJC 1G3IA 3HGIA 3MJ5A 1TDZA 2R45A 1HQCA 1UM8A 3SBJA 1E9RA 2XSZA 2MROB 2OOBA 1QZMA 1ZAEA 2QQ8A 5DNYA 5EXXA 4IIWA 2D7EA 2Q2EB 3GLFE 3FYCA 2F5SA 4FCVA 1TDHA 3E9SA 4JI7M 3KOYE 3GRVA 4JV5M 3KDSE 1OJLA 3SMPA 1MU5A 1WXQA 4AKHA 1QQWA 1D0KA 5IWAM 3B7NA 3AKZA 1VQ1A 2FE8A 2MR9A 3I04M 4FWHA 2CE7A 4JI8M 3A98B 3SHGB 2CWBA 1TR8A 3FTEA 1X37A 4GH9A 4A3VB 3FTFA 2XF3A 1T3TA 2EKKA 4PCZA 3TWMA 2L2DA 1IQPA 2O5RA 4GHLA 4QNRA 2FOIC 3L28A 2DAEA 2JY5A 2C99A 2RKOA 3HY5A 4QNMA 4B08A 3GLIE 2RRUA 2I7PA 4CGYB 1IXSA 1HQYE 4NL4H 1WJ7A 1L2DA 3MMPA 3FRHA 2YR0A 1HT2E 3L26A 1NJGA 4ANRA 2KA6B 1DO2A 1EE8A 2F5PA 4GRIA 2KHHA 3A46A 1QUTA 4GEWA 1GABA 5A2QS 1DGFA 1NVMA 5FTLA 2X49A 1CUKA 4IBEA 1Y8GA 3FTCA 4NRWA 4G4RA 3J7AS 4DV0M 1XNQM 4DR6M 2DZLA 4JI5M 1Q3BA 2L4FA 5GKNA 2ZANA 4NOOB 1XXHA 2CUZA 1IN5A 2CHVA 2DAGA 4OVZA 2G5GX 2LHCA 3GQ3A 2VF8A 4FVMA 4R7GA 1R6BX 3NBXX 4CJ6A 5LMUM 1QVRA 3VFDA 3OTOM 3QYEA 1K3XA 2V1CA 4X64M 1SXJC 3UMMA 1QAMA 4LFAM 1J09A 3B9PA 4MGHA 3U6DA 5IT9S 1JR3A 3U5ZB 2Z3XA 1GKIA 3GLHB 5DYIA 3EIEA 4PDGA 1FJGM 4MM3B 3U6EA 4GC5A 3LMMA 3QAUA 4DV2M 1IN4A 1DGBA 2CHQA 1QZEA 3U60B 4M0DA 1XNRM 1HJPA 3NBIA 4L4UA 2KZUA 1V92A 3HZJA 3K9OA 3KW6A 2JZ0A 3MHVC 2KRUA 5E6JA 4B3RM 3T1YM 3U61A 1EFUB 1SXJB 4B7FA 3HU1A 4QOZC 2R44A 1G41A 5EP4A 1C7YA 1HNZM 3U6LA 1G71A 4F2LA 4B7HA 3QYBA 4OX9M 2FNAA 1TH3A 4FD2A 1OQYA 2VQEM 1TTEA 3GLGE 4NC6A 3KSJA 2XFTA 3GLIB 2LVOC 4L15A 2W82A 3E46A 3A42A 1JB0F 4D80A 2LVAA 1PJJA 2EUCA 2UXDM 3E21A 4LF9M 1NV9A 2J7OA 1GLNA 1TF0B 2CP8A 4MGKE 5LMNM 1GL7A 2XSZD 2UUCM 3AOEC 3C3DA 3LCVB 4RF0A 3DFZA 1EIJA 3KFUG 4QHTA 1KFVA 4KT0F 1E94E 1AIPC 3BOSA 4B3MM 2Z4RA 4GIPA 1XWIA 3J27B 3IG5A 3HJ8A 2D7GA 2C9CA 3QWLA 1IY0A 4LF7M 2VF7A 4BB9A 2K47A 4AQYM 1HT1E 3D8BA 4AI6A 2K0BX 3HWSA 4JXJA 5KPRA 3TWLA 4DV1M 1V33A 3SAVA 2JNHA 2APLA 4MGZE 2DENA 2DZOB 4DR4M 2KW0A 1OFIA 3SHFA 1IXZA 2NQ8C 1DGGA 3HU3A 3UK6A 2DNAA 3DZDA 1J5EM 1WGLA 3C3EA 1IXRC 2HL7A 3LVWA 3AL0C 4AG6A 2HWJA 4D81A 4XGIA 5F3WA 2C5RA 1A5TA 2Y21A 4IBFA 2R6FA 4LZZA 2DWZB 3B7ZA 4LJ8A 2F5OA 4PDIA 5ITRA 3GO8A 3RGPA 3KOWE 5ITQA 3W0FA 3I4YA 3KOXE 1R2ZA 1QAOA 4DR3M 3PNVA 4Y28F 2R46A 3BXWA 3C9PA 1L1TA 1QDTA 5FSWA 1Z5CA 2L7HA 4DUZM 2OOAA 4L8RC 4GITA 2JXNA 3SAWA 1R2YA 2DWLA 4IBKA 4FWGA 4Q7JA 3E4RA 8CATA 2UXCM 2DAIA 4DV3M 1RU3A 2BJWA 3K2LA 4UN2B 5EJCA 2LBCA 2CV1A 4JI3M 3T38A 4X62M 5DFLA 4G4OA 4IBCA 3FUVA 1LTMA 2QP9X 3WHKA 2V6ZM 3FRIA 3J2PB 1J7KA 4CISA 2R18A 4AW4A 3UJNA 3JR5A 2LHGA 1NNUC 3GRRA 3SFZA 4G4QA 4DR2M 4JN6A 2QCUA 3HHZA 1XMQM 1VEKA 4M9SA 3HHYA 4P16A 3KP1E 4P17A 3VLFB 3KVWA 1OIZA 4L16A 4MGIE 3CTWB 4II7A 3W0LB 1R5LA 3HJQA 1OAIA 1D0MA 1N33M 1PJQA 1GJSA 2MJ5B 1Z6TA 4Z6YA 1GL6A 4MH0E 2ZTDA 4BBAA 1IM2A 4PT5A 3Q8GA 4ITQA 5FTJA 5FTMA 3LQQA 4M9ZA 3L29A 1TGUA 1XXHB 2JY7A 3K9PA 3ZCBB 3K1JA 2WSCF 2WSFF 4IBBA 3R9XB 1DGHA 4DV5M 3VKHA 1T43A 4JI6M 2R4JA 3HJSA 3FUUA 3IG8A 3Q8XA 1K82A 1NHGC 3U5ZA 3ZQJA 3GPUA 1PJSA 2CHGA 5C1BA 3GPPA 1W5SA 2JY6B 4BLCA 4YY3M 2ZM6M 1IN7A 1ORYB 1P3QQ 2DZNB 2YQZA 2EA0A 3KXEC 1BVSA 3UZUA 1VDLA 1KSFX 3RGSA 4DV7M 3PXGA 4W5WA 4DUYM 2C96A 3DOAA 2AHMA 2ZAOA 5EXTA 3GLFA 2LXEA 2QBYB 2YFQA 4NSRA 2KNVA
chains in the Genus database with same CATH topology
3L27A 5DYGA 3FTDA 4NRVA 4Z8XA 1FNNA 2XFSA 3FD9A 2G8LA 1SXJD 2C98A 2R62A 4MGYE 2ZBKB 1JR3D 5BPVA 4GKJM 2QPAA 7CATA 3GRUA 4B3TM 4IBDA 5EXSA 3I51A 4LG2A 4OU7A 1H6UA 2XH9A 1W5TA 4G4NA 5E26A 3K92A 1N34M 3L25A 4LZJA 2Y0TA 2M5ZA 2DVWB 3K8ZA 5EXPA 5IZ7D 4X66M 4R3DA 3L2AA 2HHHM 1XC8A 2Z7JA 3PNYA 4I4LA 1NY5A 3FUTA 4M0WA 4FCTA 2DWNA 2V1UA 4DR1M 3LVVA 3U6OA 3R8FA 4OW0A 2BNKA 1Z5BA 1YE9A 3J80S 3SYKA 4FW9A 2M60A 5JI3E 5KPZA 2UXBM 3J7BA 5BR8M 3SARA 1IBKM 1IY2A 4NXMM 1D2NA 4REZA 1QAQA 2QENA 4GKKM 4KHPM 3TQSA 3THGA 1IY1A 3ILKA 5C18A 3M0EA 4RF1A 1YSYA 4DV4M 3GLGA 2OPFA 1I94M 3AFHA 1HR0M 3SASA 3HU2A 2D7HA 4CHTB 4IJFA 4KO8A 2X8AA 3ZH9B 3U6SA 2Z4SA 3AOEA 1N75A 2J7NA 1TH4A 4PD2A 2XGNA 4RNAA 3ZC7B 2LH0A 4HLQA 4OVZB 2VQFM 4AG5A 4LFBM 5FTNA 4LJ4A 1IBMM 3SYLA 1IN8A 1Q3CA 4KLNA 2F5QA 4JYAM 4LY6A 3TL4X 2F5NA 4AKIA 3LQRA 4LF6M 3HHXA 4LGYA 3GLIA 4AKGA 3M6AA 2Y0QA 1N77A 2JA2A 3M7GA 3PFIA 4IBIA 2DWMA 2LWXA 3U6QA 2CEAA 3C58A 4LRTA 3U60A 1NSFA 2KZSA 2UU9M 4EIWA 4JI4M 4IBGA 1MX0A 3D8LA 2Y20A 4XBOA 2I7NA 4I8OA 3CF6E 5KQDA 4LJ6A 1SXJA 1PM5A 4LJ7A 1IN6A 1R7RA 1G59A 5ITXA 1NJFA 3CF0A 4LJAA 4B7GA 4FCWA 1L1ZA 4DV6M 2OQ4A 3SMSA 5IREB 2UUBM 3SAUA 1QYRA 4IBJA 2E5LM 3MK6A 4QOSA 4DR7M 1N32M 4GC9A 4HL4A 2P5TA 2XZFA 4LF4M 5ITXE 1IXSB 3AJIB 3WHLA 2BJVA 2HKJA 4K0KM 2UUAM 1HNWM 2A5YB 3FYDA 2KRKA 3RFWA 1QANA 2RGOA 1SXJE 3KP0E 5FLXS 4JI0M 1E32A 2QZ4A 3PVSA 3J81S 4L78A 5EP1A 3KSXA 3KS4A 5JI2E 4LJ9A 3T15A 3GQ4A 3GRYA 3GLFB 2ZAMA 4LF5M 1I4WA 1L2CA 2F4VM 2C9OA 1K3WA 4M9XA 2CV0A 2XLJA 4WW0A 3VK8A 1Q39A 4KODA 5ITUA 1VDDA 1LV7A 3DA1A 2FFJA 5ITYA 2RGHA 5EP3A 4QHSA 1E9SA 3GQ5A 1Z59A 3T1HM 1S3SA 2L6OA 3A45A 4I5SA 3UGJA 1DO0A 3GLHA 4X65M 4LFCM 1TH2A 2DXIA 4ZPXA 3EIHA 1L8QA 2DHRA 3JR4A 4LF8M 1NY6A 4NXNM 5FTKA 3NWLA 4I81A 3FUXA 2HCBA 1NNJA 1C1KA 4MB7A 4IJEA 3KS8A 3U6MA 1G8PA 1OFHA 3RE8A 4D82A 4GMQA 3H4MA 2CFOA 3U61B 5H37D 5EP2A 3GPYA 3TE6A 4TUWA 2L7IA 4WURA 3FUWA 4NSOB 4S12A 1XMOM 1L2BA 1N36M 2R4EA 1XHBA 5EQTA 4AZFA 3VDUA 1YUBA 1NHWC 2KEBA 3U6CA 4YHHM 4JI1M 4LGMA 2EO2A 2R65A 2H1RA 2CV2A 4JI2M 3GP1A 1GVNA 2L09A 4DR5M 5KO3A 1ZQ9A 4LCBA 5ITTA 2YNMD 3TWKA 2ERCA 3GLGB 4GHAA 3VKGA 3U6PA 1Z5AA 4B3SM 2X4AA 2LNHC 1PJIA 2QBYA 1G4AE 3FKEA 3VK7A 2VIIA 3I4VA 3HHWA 4FWDA 3AOGA 3GPXA 3JAMS 4LJ5A 1KYIA 3AV0A 1DGHB 5KPTA 4G6ZA 1N78A 3VDPA 1HNXM 1IBLM 2KXEA 3CF2A 3HKPA 3TPZA 3SATA 2XZUA 3KOZE 5KQ8A 2XEPA 4LRSA 1JQJC 3HGIA 1G3IA 3MJ5A 1TDZA 2R45A 1HQCA 1UM8A 3SBJA 1E9RA 2XSZA 1QZMA 1ZAEA 5DNYA 5EXXA 4IIWA 2D7EA 2Q2EB 3FYCA 2F5SA 4FCVA 1TDHA 3E9SA 4JI7M 3KOYE 3GRVA 4JV5M 3KDSE 1OJLA 3SMPA 1MU5A 1WXQA 4AKHA 1QQWA 5IWAM 3AKZA 2FE8A 4JI8M 4FWHA 2CE7A 3A98B 3SHGB 3FTEA 1X37A 4GH9A 4A3VB 3FTFA 2XF3A 1T3TA 4PCZA 1IQPA 2O5RA 4GHLA 4QNRA 2FOIC 3L28A 2RKOA 4QNMA 2C99A 4B08A 3TWMA 4CGYB 2I7PA 1HQYE 4NL4H 1L2DA 2YR0A 1HT2E 3L26A 1NJGA 2KA6B 1DO2A 1EE8A 2F5PA 4GRIA 3A46A 5A2QS 1DGFA 1NVMA 5FTLA 2X49A 4IBEA 3FTCA 4NRWA 4G4RA 3J7AS 4DV0M 1XNQM 4DR6M 4JI5M 1Q3BA 5GKNA 2ZANA 4NOOB 1XXHA 2CUZA 1IN5A 2CHVA 4OVZA 2G5GX 3GQ3A 4R7GA 4FVMA 5LMUM 1R6BX 1QVRA 3VFDA 3OTOM 1K3XA 2V1CA 4X64M 1SXJC 3UMMA 1QAMA 4LFAM 1J09A 3B9PA 4MGHA 3U6DA 5IT9S 1JR3A 3U5ZB 2Z3XA 1GKIA 3GLHB 5DYIA 3EIEA 4PDGA 1FJGM 4MM3B 3U6EA 4GC5A 3LMMA 3QAUA 4DV2M 1IN4A 1DGBA 2CHQA 3U60B 4M0DA 1XNRM 3NBIA 4L4UA 2KZUA 3KW6A 3MHVC 2KRUA 5E6JA 4B3RM 3T1YM 3U61A 4B7FA 1SXJB 3HU1A 4QOZC 1G41A 5EP4A 1HNZM 3U6LA 4B7HA 4OX9M 2FNAA 1TH3A 4FD2A 2VQEM 3KSJA 2XFTA 3GLIB 4L15A 2W82A 3A42A 2UXDM 4D80A 1PJJA 2EUCA 4LF9M 2J7OA 1GLNA 4MGKE 5LMNM 1GL7A 2XSZD 2UUCM 3AOEC 4RF0A 3DFZA 3KFUG 4QHTA 1KFVA 1E94E 4B3MM 3BOSA 2Z4RA 4GIPA 1XWIA 3J27B 3IG5A 3HJ8A 2D7GA 2C9CA 3QWLA 1IY0A 4LF7M 4BB9A 2K47A 4AQYM 1HT1E 3D8BA 4AI6A 3HWSA 4JXJA 5KPRA 3SAVA 3TWLA 4DV1M 4MGZE 2DZOB 4DR4M 2KW0A 1OFIA 3SHFA 1IXZA 2NQ8C 1DGGA 3HU3A 3UK6A 3DZDA 1J5EM 3AL0C 3LVWA 1IXRC 2HL7A 4AG6A 4D81A 4XGIA 5F3WA 2C5RA 2Y21A 4IBFA 4LZZA 2DWZB 4LJ8A 2F5OA 4PDIA 5ITRA 3GO8A 3RGPA 3KOWE 5ITQA 3W0FA 3I4YA 3KOXE 1R2ZA 1QAOA 4DR3M 3PNVA 2R46A 1L1TA 5FSWA 1Z5CA 2L7HA 4DUZM 4L8RC 4GITA 3SAWA 1R2YA 2DWLA 4IBKA 4FWGA 8CATA 3E4RA 2UXCM 4DV3M 2BJWA 5EJCA 3K2LA 2CV1A 4JI3M 3T38A 4X62M 4G4OA 4IBCA 3FUVA 2QP9X 3WHKA 3J2PB 2V6ZM 1J7KA 4CISA 2R18A 4AW4A 3UJNA 3JR5A 3GRRA 1NNUC 3SFZA 4G4QA 4DR2M 4JN6A 2QCUA 3HHZA 1XMQM 4M9SA 3HHYA 4P16A 3KP1E 3VLFB 3KVWA 4L16A 4MGIE 3CTWB 4II7A 3W0LB 3HJQA 1N33M 1Z6TA 4Z6YA 1GL6A 4MH0E 4BBAA 1IM2A 4PT5A 4ITQA 5FTJA 5FTMA 3LQQA 4M9ZA 3L29A 1TGUA 1XXHB 3ZCBB 3K1JA 4IBBA 3R9XB 1DGHA 4DV5M 3VKHA 4JI6M 2R4JA 3HJSA 3FUUA 3IG8A 3Q8XA 1K82A 1NHGC 3U5ZA 3GPUA 2CHGA 5C1BA 3GPPA 1W5SA 4BLCA 2ZM6M 4YY3M 1IN7A 1ORYB 2DZNB 2YQZA 2EA0A 3KXEC 3UZUA 1KSFX 3RGSA 4DV7M 3PXGA 4W5WA 4DUYM 2C96A 3DOAA 2AHMA 2ZAOA 5EXTA 3GLFA 2LXEA 2QBYB 2YFQA 4NSRA 3SC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW0 A;  2HL7 A; 
#chains in the Genus database with same CATH topology
 3L27 A;  5DYG A;  3FTD A;  3I01 M;  1DV0 A;  4NRV A;  4Z8X A;  1FNN A;  2XFS A;  3FD9 A;  2G8L A;  2J5Y A;  2WZJ A;  1SXJ D;  1OIP A;  2C98 A;  2R62 A;  2DAM A;  2LVQ D;  1NO1 A;  4MGY E;  1VEJ A;  1JR3 D;  2MGW A;  2ZBK B;  2EJS A;  5BPV A;  4GKJ M;  2QPA A;  1ZMV A;  7CAT A;  3GRU A;  4B3T M;  4IBD A;  5EXS A;  3I51 A;  4RKU F;  4LG2 A;  3LCU A;  4OU7 A;  1H6U A;  2XH9 A;  1W5T A;  4G4N A;  5E26 A;  2MH8 A;  2BWE A;  3K92 A;  1N34 M;  3L25 A;  4LZJ A;  2DKL A;  2Y0T A;  2M5Z A;  2DVW B;  3K8Z A;  3LW5 F;  5EXP A;  5IZ7 D;  4X66 M;  4R3D A;  3L2A A;  2HHH M;  1XC8 A;  2JZ1 A;  2GNO A;  2Z7J A;  3PNY A;  4I4L A;  1NY5 A;  1AUA A;  3FUT A;  4M0W A;  4FCT A;  2DWN A;  2V1U A;  1ZMU A;  1D0L A;  4DR1 M;  3LVV A;  3U6O A;  3R8F A;  4OW0 A;  2JP7 A;  2BNK A;  1Z5B A;  1YE9 A;  1WGN A;  3J80 S;  4FW9 A;  2M60 A;  2QSF X;  3SYK A;  5JI3 E;  5KPZ A;  2UXB M;  1JR3 E;  3J7B A;  5BR8 M;  1IBK M;  3SAR A;  1IY2 A;  4NXM M;  1D2N A;  4REZ A;  2LTU A;  1QAQ A;  1V34 A;  2QEN A;  2JWS A;  4GKK M;  4KHP M;  3TQS A;  3THG A;  1IY1 A;  1Q02 A;  3ILK A;  5C18 A;  3M0E A;  4RF1 A;  1YSY A;  4DV4 M;  3GLG A;  2OPF A;  1OTR A;  1XXH E;  3AFH A;  3T6P A;  1I94 M;  1HR0 M;  2QHO B;  3SAS A;  3HU2 A;  2D7H A;  2G3Q A;  4G3O A;  4CHT B;  4IJF A;  1PJT A;  4KO8 A;  2X8A A;  2EKF A;  3ZH9 B;  5L8R F;  3U6S A;  2Z4S A;  3AOE A;  1N75 A;  2J7N A;  3SC3 A;  1TH4 A;  4PD2 A;  2XGN A;  4RNA A;  3ZC7 B;  2LH0 A;  4HLQ A;  4OVZ B;  2VQF M;  4AG5 A;  4LFB M;  1SG9 A;  5FTN A;  4LJ4 A;  1IBM M;  3SYL A;  1IN8 A;  1Q3C A;  4KLN A;  2KNA A;  2F5Q A;  2R0I A;  2CRU A;  4LY6 A;  3TL4 X;  4JYA M;  2F5N A;  4AKI A;  3LQR A;  4LF6 M;  3HHX A;  2B3T A;  4LGY A;  3GLI A;  1OKS A;  4AKG A;  3M6A A;  2Y0Q A;  1N77 A;  2JA2 A;  3M7G A;  3PFI A;  4IBI A;  2DWM A;  2LWX A;  3U6Q A;  2CEA A;  4HEO A;  3C58 A;  4LRT A;  2KNZ A;  3U60 A;  3B89 A;  1NSF A;  2KZS A;  2OO9 A;  2UU9 M;  4EIW A;  2DI0 A;  4JI4 M;  4IBG A;  1MX0 A;  3D8L A;  2Y20 A;  4XBO A;  2I7N A;  4I8O A;  4F1I A;  3CF6 E;  1WIV A;  5KQD A;  2HAK A;  4LJ6 A;  1SXJ A;  1PM5 A;  1XB2 B;  1T6O A;  1IN6 A;  4LJ7 A;  4L6V 6;  1R7R A;  1G59 A;  5ITX A;  3HX3 A;  1NJF A;  3CF0 A;  4LJA A;  1QUS A;  4WP2 A;  4B7G A;  4FCW A;  1L1Z A;  4DV6 M;  2OQ4 A;  2LVN C;  3SMS A;  5IRE B;  2UUB M;  3SAU A;  1QYR A;  4IBJ A;  2E5L M;  3MK6 A;  4QOS A;  3GLH E;  4DR7 M;  1N32 M;  4GC9 A;  4HL4 A;  2P5T A;  2XZF A;  1WHC A;  4LF4 M;  4DBG B;  2O25 A;  1IXS B;  3AJI B;  5ITX E;  2K6B A;  1QDR A;  3WHL A;  3FE3 A;  2BJV A;  2HKJ A;  4K0K M;  2UUA M;  1HNW M;  2A5Y B;  3FYD A;  2KRK A;  3RFW A;  1QAN A;  2KDL A;  2RGO A;  1GJT A;  1SXJ E;  3KP0 E;  5FLX S;  1GO5 A;  1YLA A;  4JI0 M;  2QZ4 A;  1E32 A;  3PVS A;  2H5X A;  3J81 S;  4L78 A;  5EP1 A;  3KSX A;  3KS4 A;  5JI2 E;  4LJ9 A;  3T15 A;  3GQ4 A;  3GRY A;  3GLF B;  2ZAM A;  4LF5 M;  1I4W A;  1L2C A;  2F4V M;  2C9O A;  1K3W A;  4M9X A;  3W67 A;  2XLJ A;  2CV0 A;  1PGY A;  3IEC A;  4WW0 A;  1Q39 A;  4KOD A;  5ITU A;  3VK8 A;  1VDD A;  1LV7 A;  1MJG M;  3DA1 A;  2FFJ A;  5ITY A;  3IHP A;  2RGH A;  5EP3 A;  1PRB A;  4QHS A;  1E9S A;  2ZTC A;  3GQ5 A;  2O01 F;  1Z59 A;  3T1H M;  2DAK A;  1MN3 A;  2WSE F;  1S3S A;  2L6O A;  3A45 A;  4I5S A;  1ZMW A;  1DO0 A;  3UGJ A;  3GLH A;  3W68 A;  4X65 M;  4LFC M;  1TH2 A;  2QNJ A;  2DXI A;  4ZPX A;  2LVP C;  3EIH A;  1L8Q A;  2DHR A;  3JR4 A;  4LF8 M;  1NY6 A;  4NXN M;  5FTK A;  3NWL A;  3F92 A;  4I81 A;  1ZV1 A;  3FUX A;  2HCB A;  1NNJ A;  1C1K A;  4MB7 A;  4IJE A;  3KS8 A;  3U6M A;  1G8P A;  1OFH A;  3RE8 A;  4D82 A;  4GMQ A;  3H4M A;  2CFO A;  3U61 B;  1F4I A;  1IFY A;  1VEG A;  5H37 D;  5EP2 A;  3GPY A;  3TE6 A;  4TUW A;  2L7I A;  3H4J A;  4CIZ A;  4WUR A;  2DHY A;  3FUW A;  4NSO B;  4S12 A;  1XMO M;  1L2B A;  1N36 M;  2R4E A;  1XHB A;  5EQT A;  4AZF A;  3VDU A;  1YUB A;  1NHW C;  4XK8 F;  2KEB A;  3U6C A;  4YHH M;  4JI1 M;  4LGM A;  2EO2 A;  2R65 A;  2H1R A;  2CV2 A;  4JI2 M;  3CGW A;  3GP1 A;  1GVN A;  1R4G A;  2L09 A;  2JUJ A;  4DR5 M;  5KO3 A;  1ZQ9 A;  1VG5 A;  4LCB A;  3V76 A;  5ITT A;  2YNM D;  3TWK A;  2ERC A;  3B74 A;  3GLG B;  4GHA A;  2FH0 A;  2L4E A;  3U6P A;  4R71 A;  3VKG A;  2FS1 A;  1Z5A A;  2K9D A;  2X4A A;  2LNH C;  4B3S M;  1PJI A;  2QBY A;  2JY8 A;  1G4A E;  3FKE A;  3VK7 A;  2VII A;  3I4V A;  3HHW A;  4FWD A;  2GQF A;  1NV8 A;  3AOG A;  3B7Q A;  3GPX A;  3JAM S;  2VDB B;  4LJ5 A;  1KYI A;  3AV0 A;  1DGH B;  5KPT A;  4G6Z A;  1WR1 B;  2Z8Y M;  1N78 A;  1OAO C;  3VDP A;  1HNX M;  2BWB A;  1IBL M;  2KXE A;  3BBZ A;  3CF2 A;  3HKP A;  3TPZ A;  2N35 A;  3SAT A;  2XZU A;  1UFZ A;  3KOZ E;  5KQ8 A;  2XEP A;  4LRS A;  1JQJ C;  1G3I A;  3HGI A;  3MJ5 A;  1TDZ A;  2R45 A;  1HQC A;  1UM8 A;  3SBJ A;  1E9R A;  2XSZ A;  2MRO B;  2OOB A;  1QZM A;  1ZAE A;  2QQ8 A;  5DNY A;  5EXX A;  4IIW A;  2D7E A;  2Q2E B;  3GLF E;  3FYC A;  2F5S A;  4FCV A;  1TDH A;  3E9S A;  4JI7 M;  3KOY E;  3GRV A;  4JV5 M;  3KDS E;  1OJL A;  3SMP A;  1MU5 A;  1WXQ A;  4AKH A;  1QQW A;  1D0K A;  5IWA M;  3B7N A;  3AKZ A;  1VQ1 A;  2FE8 A;  2MR9 A;  3I04 M;  4FWH A;  2CE7 A;  4JI8 M;  3A98 B;  3SHG B;  2CWB A;  1TR8 A;  3FTE A;  1X37 A;  4GH9 A;  4A3V B;  3FTF A;  2XF3 A;  1T3T A;  2EKK A;  4PCZ A;  3TWM A;  2L2D A;  1IQP A;  2O5R A;  4GHL A;  4QNR A;  2FOI C;  3L28 A;  2DAE A;  2JY5 A;  2C99 A;  2RKO A;  3HY5 A;  4QNM A;  4B08 A;  3GLI E;  2RRU A;  2I7P A;  4CGY B;  1IXS A;  1HQY E;  4NL4 H;  1WJ7 A;  1L2D A;  3MMP A;  3FRH A;  2YR0 A;  1HT2 E;  3L26 A;  1NJG A;  4ANR A;  2KA6 B;  1DO2 A;  1EE8 A;  2F5P A;  4GRI A;  2KHH A;  3A46 A;  1QUT A;  4GEW A;  1GAB A;  5A2Q S;  1DGF A;  1NVM A;  5FTL A;  2X49 A;  1CUK A;  4IBE A;  1Y8G A;  3FTC A;  4NRW A;  4G4R A;  3J7A S;  4DV0 M;  1XNQ M;  4DR6 M;  2DZL A;  4JI5 M;  1Q3B A;  2L4F A;  5GKN A;  2ZAN A;  4NOO B;  1XXH A;  2CUZ A;  1IN5 A;  2CHV A;  2DAG A;  4OVZ A;  2G5G X;  2LHC A;  3GQ3 A;  2VF8 A;  4FVM A;  4R7G A;  1R6B X;  3NBX X;  4CJ6 A;  5LMU M;  1QVR A;  3VFD A;  3OTO M;  3QYE A;  1K3X A;  2V1C A;  4X64 M;  1SXJ C;  3UMM A;  1QAM A;  4LFA M;  1J09 A;  3B9P A;  4MGH A;  3U6D A;  5IT9 S;  1JR3 A;  3U5Z B;  2Z3X A;  1GKI A;  3GLH B;  5DYI A;  3EIE A;  4PDG A;  1FJG M;  4MM3 B;  3U6E A;  4GC5 A;  3LMM A;  3QAU A;  4DV2 M;  1IN4 A;  1DGB A;  2CHQ A;  1QZE A;  3U60 B;  4M0D A;  1XNR M;  1HJP A;  3NBI A;  4L4U A;  2KZU A;  1V92 A;  3HZJ A;  3K9O A;  3KW6 A;  2JZ0 A;  3MHV C;  2KRU A;  5E6J A;  4B3R M;  3T1Y M;  3U61 A;  1EFU B;  1SXJ B;  4B7F A;  3HU1 A;  4QOZ C;  2R44 A;  1G41 A;  5EP4 A;  1C7Y A;  1HNZ M;  3U6L A;  1G71 A;  4F2L A;  4B7H A;  3QYB A;  4OX9 M;  2FNA A;  1TH3 A;  4FD2 A;  1OQY A;  2VQE M;  1TTE A;  3GLG E;  4NC6 A;  3KSJ A;  2XFT A;  3GLI B;  2LVO C;  4L15 A;  2W82 A;  3E46 A;  3A42 A;  1JB0 F;  4D80 A;  2LVA A;  1PJJ A;  2EUC A;  2UXD M;  3E21 A;  4LF9 M;  1NV9 A;  2J7O A;  1GLN A;  1TF0 B;  2CP8 A;  4MGK E;  5LMN M;  1GL7 A;  2XSZ D;  2UUC M;  3AOE C;  3C3D A;  3LCV B;  4RF0 A;  3DFZ A;  1EIJ A;  3KFU G;  4QHT A;  1KFV A;  4KT0 F;  1E94 E;  1AIP C;  3BOS A;  4B3M M;  2Z4R A;  4GIP A;  1XWI A;  3J27 B;  3IG5 A;  3HJ8 A;  2D7G A;  2C9C A;  3QWL A;  1IY0 A;  4LF7 M;  2VF7 A;  4BB9 A;  2K47 A;  4AQY M;  1HT1 E;  3D8B A;  4AI6 A;  2K0B X;  3HWS A;  4JXJ A;  5KPR A;  3TWL A;  4DV1 M;  1V33 A;  3SAV A;  2JNH A;  2APL A;  4MGZ E;  2DEN A;  2DZO B;  4DR4 M;  2KW0 A;  1OFI A;  3SHF A;  1IXZ A;  2NQ8 C;  1DGG A;  3HU3 A;  3UK6 A;  2DNA A;  3DZD A;  1J5E M;  1WGL A;  3C3E A;  1IXR C;  2HL7 A;  3LVW A;  3AL0 C;  4AG6 A;  2HWJ A;  4D81 A;  4XGI A;  5F3W A;  2C5R A;  1A5T A;  2Y21 A;  4IBF A;  2R6F A;  4LZZ A;  2DWZ B;  3B7Z A;  4LJ8 A;  2F5O A;  4PDI A;  5ITR A;  3GO8 A;  3RGP A;  3KOW E;  5ITQ A;  3W0F A;  3I4Y A;  3KOX E;  1R2Z A;  1QAO A;  4DR3 M;  3PNV A;  4Y28 F;  2R46 A;  3BXW A;  3C9P A;  1L1T A;  1QDT A;  5FSW A;  1Z5C A;  2L7H A;  4DUZ M;  2OOA A;  4L8R C;  4GIT A;  2JXN A;  3SAW A;  1R2Y A;  2DWL A;  4IBK A;  4FWG A;  4Q7J A;  3E4R A;  8CAT A;  2UXC M;  2DAI A;  4DV3 M;  1RU3 A;  2BJW A;  3K2L A;  4UN2 B;  5EJC A;  2LBC A;  2CV1 A;  4JI3 M;  3T38 A;  4X62 M;  5DFL A;  4G4O A;  4IBC A;  3FUV A;  1LTM A;  2QP9 X;  3WHK A;  2V6Z M;  3FRI A;  3J2P B;  1J7K A;  4CIS A;  2R18 A;  4AW4 A;  3UJN A;  3JR5 A;  2LHG A;  1NNU C;  3GRR A;  3SFZ A;  4G4Q A;  4DR2 M;  4JN6 A;  2QCU A;  3HHZ A;  1XMQ M;  1VEK A;  4M9S A;  3HHY A;  4P16 A;  3KP1 E;  4P17 A;  3VLF B;  3KVW A;  1OIZ A;  4L16 A;  4MGI E;  3CTW B;  4II7 A;  3W0L B;  1R5L A;  3HJQ A;  1OAI A;  1D0M A;  1N33 M;  1PJQ A;  1GJS A;  2MJ5 B;  1Z6T A;  4Z6Y A;  1GL6 A;  4MH0 E;  2ZTD A;  4BBA A;  1IM2 A;  4PT5 A;  3Q8G A;  4ITQ A;  5FTJ A;  5FTM A;  3LQQ A;  4M9Z A;  3L29 A;  1TGU A;  1XXH B;  2JY7 A;  3K9P A;  3ZCB B;  3K1J A;  2WSC F;  2WSF F;  4IBB A;  3R9X B;  1DGH A;  4DV5 M;  3VKH A;  1T43 A;  4JI6 M;  2R4J A;  3HJS A;  3FUU A;  3IG8 A;  3Q8X A;  1K82 A;  1NHG C;  3U5Z A;  3ZQJ A;  3GPU A;  1PJS A;  2CHG A;  5C1B A;  3GPP A;  1W5S A;  2JY6 B;  4BLC A;  4YY3 M;  2ZM6 M;  1IN7 A;  1ORY B;  1P3Q Q;  2DZN B;  2YQZ A;  2EA0 A;  3KXE C;  1BVS A;  3UZU A;  1VDL A;  1KSF X;  3RGS A;  4DV7 M;  3PXG A;  4W5W A;  4DUY M;  2C96 A;  3DOA A;  2AHM A;  2ZAO A;  5EXT A;  3GLF A;  2LXE A;  2QBY B;  2YFQ A;  4NSR A;  2KNV A; 
#chains in the Genus database with same CATH homology
 3L27 A;  5DYG A;  3FTD A;  4NRV A;  4Z8X A;  1FNN A;  2XFS A;  3FD9 A;  2G8L A;  1SXJ D;  2C98 A;  2R62 A;  4MGY E;  2ZBK B;  1JR3 D;  5BPV A;  4GKJ M;  2QPA A;  7CAT A;  3GRU A;  4B3T M;  4IBD A;  5EXS A;  3I51 A;  4LG2 A;  4OU7 A;  1H6U A;  2XH9 A;  1W5T A;  4G4N A;  5E26 A;  3K92 A;  1N34 M;  3L25 A;  4LZJ A;  2Y0T A;  2M5Z A;  2DVW B;  3K8Z A;  5EXP A;  5IZ7 D;  4X66 M;  4R3D A;  3L2A A;  2HHH M;  1XC8 A;  2Z7J A;  3PNY A;  4I4L A;  1NY5 A;  3FUT A;  4M0W A;  4FCT A;  2DWN A;  2V1U A;  4DR1 M;  3LVV A;  3U6O A;  3R8F A;  4OW0 A;  2BNK A;  1Z5B A;  1YE9 A;  3J80 S;  3SYK A;  4FW9 A;  2M60 A;  5JI3 E;  5KPZ A;  2UXB M;  3J7B A;  5BR8 M;  3SAR A;  1IBK M;  1IY2 A;  4NXM M;  1D2N A;  4REZ A;  1QAQ A;  2QEN A;  4GKK M;  4KHP M;  3TQS A;  3THG A;  1IY1 A;  3ILK A;  5C18 A;  3M0E A;  4RF1 A;  1YSY A;  4DV4 M;  3GLG A;  2OPF A;  1I94 M;  3AFH A;  1HR0 M;  3SAS A;  3HU2 A;  2D7H A;  4CHT B;  4IJF A;  4KO8 A;  2X8A A;  3ZH9 B;  3U6S A;  2Z4S A;  3AOE A;  1N75 A;  2J7N A;  1TH4 A;  4PD2 A;  2XGN A;  4RNA A;  3ZC7 B;  2LH0 A;  4HLQ A;  4OVZ B;  2VQF M;  4AG5 A;  4LFB M;  5FTN A;  4LJ4 A;  1IBM M;  3SYL A;  1IN8 A;  1Q3C A;  4KLN A;  2F5Q A;  4JYA M;  4LY6 A;  3TL4 X;  2F5N A;  4AKI A;  3LQR A;  4LF6 M;  3HHX A;  4LGY A;  3GLI A;  4AKG A;  3M6A A;  2Y0Q A;  1N77 A;  2JA2 A;  3M7G A;  3PFI A;  4IBI A;  2DWM A;  2LWX A;  3U6Q A;  2CEA A;  3C58 A;  4LRT A;  3U60 A;  1NSF A;  2KZS A;  2UU9 M;  4EIW A;  4JI4 M;  4IBG A;  1MX0 A;  3D8L A;  2Y20 A;  4XBO A;  2I7N A;  4I8O A;  3CF6 E;  5KQD A;  4LJ6 A;  1SXJ A;  1PM5 A;  4LJ7 A;  1IN6 A;  1R7R A;  1G59 A;  5ITX A;  1NJF A;  3CF0 A;  4LJA A;  4B7G A;  4FCW A;  1L1Z A;  4DV6 M;  2OQ4 A;  3SMS A;  5IRE B;  2UUB M;  3SAU A;  1QYR A;  4IBJ A;  2E5L M;  3MK6 A;  4QOS A;  4DR7 M;  1N32 M;  4GC9 A;  4HL4 A;  2P5T A;  2XZF A;  4LF4 M;  5ITX E;  1IXS B;  3AJI B;  3WHL A;  2BJV A;  2HKJ A;  4K0K M;  2UUA M;  1HNW M;  2A5Y B;  3FYD A;  2KRK A;  3RFW A;  1QAN A;  2RGO A;  1SXJ E;  3KP0 E;  5FLX S;  4JI0 M;  1E32 A;  2QZ4 A;  3PVS A;  3J81 S;  4L78 A;  5EP1 A;  3KSX A;  3KS4 A;  5JI2 E;  4LJ9 A;  3T15 A;  3GQ4 A;  3GRY A;  3GLF B;  2ZAM A;  4LF5 M;  1I4W A;  1L2C A;  2F4V M;  2C9O A;  1K3W A;  4M9X A;  2CV0 A;  2XLJ A;  4WW0 A;  3VK8 A;  1Q39 A;  4KOD A;  5ITU A;  1VDD A;  1LV7 A;  3DA1 A;  2FFJ A;  5ITY A;  2RGH A;  5EP3 A;  4QHS A;  1E9S A;  3GQ5 A;  1Z59 A;  3T1H M;  1S3S A;  2L6O A;  3A45 A;  4I5S A;  3UGJ A;  1DO0 A;  3GLH A;  4X65 M;  4LFC M;  1TH2 A;  2DXI A;  4ZPX A;  3EIH A;  1L8Q A;  2DHR A;  3JR4 A;  4LF8 M;  1NY6 A;  4NXN M;  5FTK A;  3NWL A;  4I81 A;  3FUX A;  2HCB A;  1NNJ A;  1C1K A;  4MB7 A;  4IJE A;  3KS8 A;  3U6M A;  1G8P A;  1OFH A;  3RE8 A;  4D82 A;  4GMQ A;  3H4M A;  2CFO A;  3U61 B;  5H37 D;  5EP2 A;  3GPY A;  3TE6 A;  4TUW A;  2L7I A;  4WUR A;  3FUW A;  4NSO B;  4S12 A;  1XMO M;  1L2B A;  1N36 M;  2R4E A;  1XHB A;  5EQT A;  4AZF A;  3VDU A;  1YUB A;  1NHW C;  2KEB A;  3U6C A;  4YHH M;  4JI1 M;  4LGM A;  2EO2 A;  2R65 A;  2H1R A;  2CV2 A;  4JI2 M;  3GP1 A;  1GVN A;  2L09 A;  4DR5 M;  5KO3 A;  1ZQ9 A;  4LCB A;  5ITT A;  2YNM D;  3TWK A;  2ERC A;  3GLG B;  4GHA A;  3VKG A;  3U6P A;  1Z5A A;  4B3S M;  2X4A A;  2LNH C;  1PJI A;  2QBY A;  1G4A E;  3FKE A;  3VK7 A;  2VII A;  3I4V A;  3HHW A;  4FWD A;  3AOG A;  3GPX A;  3JAM S;  4LJ5 A;  1KYI A;  3AV0 A;  1DGH B;  5KPT A;  4G6Z A;  1N78 A;  3VDP A;  1HNX M;  1IBL M;  2KXE A;  3CF2 A;  3HKP A;  3TPZ A;  3SAT A;  2XZU A;  3KOZ E;  5KQ8 A;  2XEP A;  4LRS A;  1JQJ C;  3HGI A;  1G3I A;  3MJ5 A;  1TDZ A;  2R45 A;  1HQC A;  1UM8 A;  3SBJ A;  1E9R A;  2XSZ A;  1QZM A;  1ZAE A;  5DNY A;  5EXX A;  4IIW A;  2D7E A;  2Q2E B;  3FYC A;  2F5S A;  4FCV A;  1TDH A;  3E9S A;  4JI7 M;  3KOY E;  3GRV A;  4JV5 M;  3KDS E;  1OJL A;  3SMP A;  1MU5 A;  1WXQ A;  4AKH A;  1QQW A;  5IWA M;  3AKZ A;  2FE8 A;  4JI8 M;  4FWH A;  2CE7 A;  3A98 B;  3SHG B;  3FTE A;  1X37 A;  4GH9 A;  4A3V B;  3FTF A;  2XF3 A;  1T3T A;  4PCZ A;  1IQP A;  2O5R A;  4GHL A;  4QNR A;  2FOI C;  3L28 A;  2RKO A;  4QNM A;  2C99 A;  4B08 A;  3TWM A;  4CGY B;  2I7P A;  1HQY E;  4NL4 H;  1L2D A;  2YR0 A;  1HT2 E;  3L26 A;  1NJG A;  2KA6 B;  1DO2 A;  1EE8 A;  2F5P A;  4GRI A;  3A46 A;  5A2Q S;  1DGF A;  1NVM A;  5FTL A;  2X49 A;  4IBE A;  3FTC A;  4NRW A;  4G4R A;  3J7A S;  4DV0 M;  1XNQ M;  4DR6 M;  4JI5 M;  1Q3B A;  5GKN A;  2ZAN A;  4NOO B;  1XXH A;  2CUZ A;  1IN5 A;  2CHV A;  4OVZ A;  2G5G X;  3GQ3 A;  4R7G A;  4FVM A;  5LMU M;  1R6B X;  1QVR A;  3VFD A;  3OTO M;  1K3X A;  2V1C A;  4X64 M;  1SXJ C;  3UMM A;  1QAM A;  4LFA M;  1J09 A;  3B9P A;  4MGH A;  3U6D A;  5IT9 S;  1JR3 A;  3U5Z B;  2Z3X A;  1GKI A;  3GLH B;  5DYI A;  3EIE A;  4PDG A;  1FJG M;  4MM3 B;  3U6E A;  4GC5 A;  3LMM A;  3QAU A;  4DV2 M;  1IN4 A;  1DGB A;  2CHQ A;  3U60 B;  4M0D A;  1XNR M;  3NBI A;  4L4U A;  2KZU A;  3KW6 A;  3MHV C;  2KRU A;  5E6J A;  4B3R M;  3T1Y M;  3U61 A;  4B7F A;  1SXJ B;  3HU1 A;  4QOZ C;  1G41 A;  5EP4 A;  1HNZ M;  3U6L A;  4B7H A;  4OX9 M;  2FNA A;  1TH3 A;  4FD2 A;  2VQE M;  3KSJ A;  2XFT A;  3GLI B;  4L15 A;  2W82 A;  3A42 A;  2UXD M;  4D80 A;  1PJJ A;  2EUC A;  4LF9 M;  2J7O A;  1GLN A;  4MGK E;  5LMN M;  1GL7 A;  2XSZ D;  2UUC M;  3AOE C;  4RF0 A;  3DFZ A;  3KFU G;  4QHT A;  1KFV A;  1E94 E;  4B3M M;  3BOS A;  2Z4R A;  4GIP A;  1XWI A;  3J27 B;  3IG5 A;  3HJ8 A;  2D7G A;  2C9C A;  3QWL A;  1IY0 A;  4LF7 M;  4BB9 A;  2K47 A;  4AQY M;  1HT1 E;  3D8B A;  4AI6 A;  3HWS A;  4JXJ A;  5KPR A;  3SAV A;  3TWL A;  4DV1 M;  4MGZ E;  2DZO B;  4DR4 M;  2KW0 A;  1OFI A;  3SHF A;  1IXZ A;  2NQ8 C;  1DGG A;  3HU3 A;  3UK6 A;  3DZD A;  1J5E M;  3AL0 C;  3LVW A;  1IXR C;  2HL7 A;  4AG6 A;  4D81 A;  4XGI A;  5F3W A;  2C5R A;  2Y21 A;  4IBF A;  4LZZ A;  2DWZ B;  4LJ8 A;  2F5O A;  4PDI A;  5ITR A;  3GO8 A;  3RGP A;  3KOW E;  5ITQ A;  3W0F A;  3I4Y A;  3KOX E;  1R2Z A;  1QAO A;  4DR3 M;  3PNV A;  2R46 A;  1L1T A;  5FSW A;  1Z5C A;  2L7H A;  4DUZ M;  4L8R C;  4GIT A;  3SAW A;  1R2Y A;  2DWL A;  4IBK A;  4FWG A;  8CAT A;  3E4R A;  2UXC M;  4DV3 M;  2BJW A;  5EJC A;  3K2L A;  2CV1 A;  4JI3 M;  3T38 A;  4X62 M;  4G4O A;  4IBC A;  3FUV A;  2QP9 X;  3WHK A;  3J2P B;  2V6Z M;  1J7K A;  4CIS A;  2R18 A;  4AW4 A;  3UJN A;  3JR5 A;  3GRR A;  1NNU C;  3SFZ A;  4G4Q A;  4DR2 M;  4JN6 A;  2QCU A;  3HHZ A;  1XMQ M;  4M9S A;  3HHY A;  4P16 A;  3KP1 E;  3VLF B;  3KVW A;  4L16 A;  4MGI E;  3CTW B;  4II7 A;  3W0L B;  3HJQ A;  1N33 M;  1Z6T A;  4Z6Y A;  1GL6 A;  4MH0 E;  4BBA A;  1IM2 A;  4PT5 A;  4ITQ A;  5FTJ A;  5FTM A;  3LQQ A;  4M9Z A;  3L29 A;  1TGU A;  1XXH B;  3ZCB B;  3K1J A;  4IBB A;  3R9X B;  1DGH A;  4DV5 M;  3VKH A;  4JI6 M;  2R4J A;  3HJS A;  3FUU A;  3IG8 A;  3Q8X A;  1K82 A;  1NHG C;  3U5Z A;  3GPU A;  2CHG A;  5C1B A;  3GPP A;  1W5S A;  4BLC A;  2ZM6 M;  4YY3 M;  1IN7 A;  1ORY B;  2DZN B;  2YQZ A;  2EA0 A;  3KXE C;  3UZU A;  1KSF X;  3RGS A;  4DV7 M;  3PXG A;  4W5W A;  4DUY M;  2C96 A;  3DOA A;  2AHM A;  2ZAO A;  5EXT A;  3GLF A;  2LXE A;  2QBY B;  2YFQ A;  4NSR A;  3SC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...