3J81S

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
b'SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j81S01
4JV5M 2ZBKB 5ITQA 4DR4M 4CISA 4G4RA 2UU9M 2F5QA 4JI0M 1MX0A 5ITUA 1L1ZA 5A2QS 4DV0M 4DR5M 4B3MM 4LF6M 2UXCM 4GKKM 4PDIA 1Z5CA 2HKJA 1EE8A 4KHPM 4DV1M 3U6DA 3SAUA 3U6MA 3SARA 4DV2M 4DR2M 4X62M 5IWAM 4G4QA 2XZUA 4LFCM 4PDGA 4DUYM 3GPPA 2HHHM 1TDHA 4B3TM 1L2BA 5IT9S 2F5PA 4NRWA 1Q3BA 3VK8A 2F5SA 2E5LM 4DR1M 4YHHM 3GQ3A 2Q2EB 3TWMA 4PD2A 3A45A 3JAMS 2VQFM 4DV6M 1NNJA 3U6LA 2F4VM 4X64M 1HR0M 3GPUA 3GO8A 1XC8A 4DUZM 1K3WA 1K3XA 4PCZA 1XMOM 3U6QA 4NXNM 4NRVA 1L2DA 3GQ4A 3A42A 3GQ5A 2UUCM 4LF5M 2UXBM 3U6CA 1Z5BA 3J80S 3GPYA 4X65M 2F5OA 4LF8M 5ITRA 5ITTA 3GP1A 1IBLM 4DV5M 1IBMM 4LF9M 1J5EM 1N36M 1TDZA 4LF4M 1XNRM 3U6EA 3TWKA 3U6OA 4GKJM 3VK7A 1PJIA 1Q3CA 1IBKM 5ITYA 4LF7M 3U6PA 5FLXS 3T1HM 4JI1M 3J7AS 3SBJA 3OTOM 3C58A 4JI2M 3JR5A 4DR7M 4NXMM 3T1YM 4B3SM 4DR3M 3SAWA 4AQYM 4G4NA 2XZFA 4B3RM 4JI5M 3DOAA 4X66M 1PJJA 4OX9M 5ITXE 3SAVA 4DV3M 1N32M 1Z5AA 4YY3M 2ZM6M 4MB7A 4JI4M 1K82A 3TWLA 4JI3M 1HNXM 2UXDM 4DR6M 3JR4A 2UUAM 2OQ4A 4JI7M 1R2ZA 1FJGM 4JYAM 4DV4M 1L1TA 2OPFA 3J81S 4LFBM 1N33M 5BR8M 2UUBM 3A46A 1XNQM 4JI8M 1L2CA 1HNZM 2F5NA 1N34M 1MU5A 2VQEM 1R2YA 5LMUM 1XMQM 3W0FA 3U6SA 3SASA 4DV7M 4ITQA 5LMNM 4LFAM 1PM5A 3SATA 3GPXA 1KFVA 1I94M 4K0KM 4G4OA 1Z59A 2EA0A 4JI6M 5ITXA 1Q39A 1HNWM
chains in the Genus database with same CATH superfamily
2LBCA 1EIJA 1JB0F 5ITQA 1QZMA 4Z8XA 5EP2A 4CISA 1OKSA 5DYGA 4IBBA 4R7GA 4JI0M 2EKKA 2KNAA 1MX0A 3SC3A 1ZMVA 2BNKA 1Z5CA 2HKJA 1GLNA 4DV1M 4IJEA 1YLAA 2V1CA 3Q8XA 3MHVC 1D2NA 1QDTA 3THGA 4IBDA 1VDLA 4X62M 4AKIA 2A5YB 2H1RA 2XZUA 1TR8A 1AUAA 2DAKA 2V6ZM 1D0MA 1S3SA 4XGIA 2J7OA 2OOBA 2JNHA 2FH0A 2K6BA 2HL7A 4NC6A 3U5ZB 4GMQA 4FCWA 4MH0E 5FTMA 5GKNA 1H6UA 4WW0A 2RKOA 3PXGA 4DR1M 3W67A 4QOZC 3FUUA 1Z6TA 1R7RA 3IG5A 4FCVA 1VDDA 3RFWA 3JAMS 2B3TA 1TF0B 3K2LA 3SYLA 2O5RA 1XB2B 2VF8A 1X37A 1V33A 2YNMD 1K3XA 1JR3D 2BWEA 4PCZA 1XMOM 2CV1A 1XXHA 3LMMA 4AI6A 2VDBB 4MM3B 4P16A 1E9RA 3GQ4A 3AV0A 3KOZE 3GPYA 1IN8A 2QENA 4HLQA 5ITRA 1SG9A 1V92A 2RGHA 4KODA 2DI0A 5EP4A 2QCUA 3FUVA 3TL4X 1TDZA 2DWZB 2XFTA 4GKJM 3VK7A 1Q3CA 1IBKM 4LF7M 3U6PA 4LJ7A 4BBAA 1IFYA 4GHAA 3JR5A 3K1JA 3LQQA 4B3SM 1A5TA 2H5XA 5F3WA 2G8LA 1YUBA 5DYIA 3AL0C 4KLNA 4B08A 4X66M 1Y8GA 2WSCF 2JP7A 2HCBA 2VF7A 5ITXE 4LZJA 4DV3M 1W5SA 4AW4A 1VEJA 3HJQA 1VEGA 2C96A 4JXJA 3CF2A 1ZMWA 2R62A 2ZM6M 4D80A 1DV0A 3KSXA 1K82A 4EIWA 4LY6A 1HQCA 5E26A 3TWLA 3T6PA 3QYEA 4DR6M 2DZLA 3PVSA 3DA1A 3TE6A 2OQ4A 2Y20A 4MGHA 1GJTA 2Y0TA 2XSZA 3HGIA 2XLJA 3C3EA 1L1TA 3HJSA 3BBZA 2DXIA 4QHSA 2L7HA 3R9XB 3HHYA 2EO2A 4JI8M 3UMMA 2F5NA 2C5RA 2R18A 3R8FA 3MJ5A 2W82A 2Y21A 3KP0E 3SHGB 3B9PA 1R2YA 1N75A 2R4EA 3W0FA 2WZJA 2R45A 1IXSB 3U6SA 2DENA 4DV7M 1NJFA 4LFAM 2QHOB 2JY6B 4HL4A 4F1IA 3FUWA 3SATA 2QNJA 3U61A 4LJ9A 4OVZA 1I94M 2G3QA 2OO9A 1XXHE 3CTWB 3MMPA 2LXEA 2EA0A 4D81A 4LJ4A 2AHMA 1SXJC 4Q7JA 1RU3A 5FSWA 4M0DA 1W5TA 1IQPA 4LRSA 1R2ZA 1GJSA 2M5ZA 3C3DA 4GITA 5KQ8A 1D0LA 2JXNA 5L8RF 7CATA 4G4RA 3HU3A 5ITUA 1L1ZA 5A2QS 2CP8A 3CF6E 2BWBA 3KSJA 4I81A 3VDPA 4Y28F 1G41A 3D8LA 4L16A 3TPZA 3KS4A 3U60B 4ANRA 4RF0A 2APLA 4HEOA 4G4QA 2L4FA 1GL7A 4PDGA 3H4MA 2DAGA 4DUYM 2XH9A 2YR0A 1TDHA 4B3TM 5IT9S 3HHWA 2F5PA 4NRWA 1WXQA 3UJNA 4L15A 4YHHM 1SXJD 3GQ3A 2NQ8C 3GLFB 3AJIB 3TWMA 1QQWA 4QOSA 1PGYA 4G6ZA 2K0BX 5EJCA 4FD2A 2F4VM 4X64M 2C9CA 2V1UA 3LVVA 4L4UA 5EQTA 3B7QA 2DWNA 2P5TA 3DFZA 3DZDA 4IIWA 2DHYA 3GLIB 2ZTCA 3RE8A 5H37D 1J09A 1T43A 2X49A 4QHTA 4RKUF 3K8ZA 4LCBA 4OW0A 4Z6YA 3W0LB 2GNOA 2KXEA 1G4AE 4GC5A 5ITTA 3NWLA 1NSFA 3GLGA 3U6EA 3TWKA 3I4VA 3IHPA 3J7BA 2HAKA 4WURA 5ITYA 5FTJA 1HQYE 1Q02A 3HX3A 1PJQA 2KW0A 3HZJA 3HWSA 3KDSE 4G3OA 4JI2M 3B74A 3FRHA 4NXMM 3T1YM 3FE3A 3VDUA 1GL6A 2DAEA 4AQYM 1G71A 5EXPA 3KW6A 1JR3A 4G4NA 4WP2A 1VQ1A 5EXTA 1TH2A 2XGNA 4I5SA 2CHQA 1SXJB 3KOXE 2KZUA 3E9SA 2JA2A 3FUTA 2XF3A 4M9XA 5E6JA 1TH3A 2VIIA 1IY1A 2ERCA 4IBFA 4JI4M 3T15A 2RGOA 2Z7JA 2D7HA 2UXDM 2QP9X 1QVRA 1C1KA 4ZPXA 2DAIA 2UUAM 1WGNA 3L26A 4FWHA 2JY5A 3QAUA 2Z4RA 1NV8A 3L28A 1IXSA 2J5YA 2QPAA 1T3TA 4GH9A 2Z8YM 4LJ6A 2R6FA 4NSOB 4BB9A 2OPFA 3I04M 2L2DA 3HJ8A 1N33M 4QNMA 3Q8GA 1IN5A 5BR8M 1V34A 2KEBA 4CJ6A 2K47A 3WHKA 2RRUA 3B7NA 2R65A 2G5GX 2QSFX 2KA6B 5DFLA 2FE8A 1MU5A 1N34M 1FNNA 3KFUG 3B89A 5LMUM 1IXZA 1IY2A 4LGMA 4GHLA 2FOIC 3FTDA 5JI3E 1DO0A 2CRUA 2MR9A 3SASA 2MH8A 5LMNM 4KO8A 1D0KA 3PFIA 3SMPA 5FTLA 2LH0A 5KPZA 1T6OA 1WIVA 1IN4A 1Z59A 1QZEA 2DWMA 4JI6M 2DZOB 1DGFA 1Q39A 1HNWM 2XFSA 2JZ1A 2DVWB 1QDRA 2CEAA 2ZBKB 2WSEF 1QUTA 3HY5A 3I4YA 2FS1A 2QBYA 4JV5M 4FVMA 2MJ5B 3GLGE 2F5QA 1ZV1A 4DV0M 4FW9A 4LF6M 2UXCM 8CATA 4LRTA 4GKKM 3VKGA 4PDIA 4GRIA 3GLHB 5EXSA 1QANA 4REZA 3GLFA 3U6DA 1IY0A 4AKHA 2LVOC 1NHGC 4LJ8A 1P3QQ 3VLFB 3L29A 5IWAM 4B7GA 4S12A 1JR3E 3M7GA 1OAOC 3GPPA 2HHHM 4IBIA 2Y0QA 3GLIA 2F5SA 3M6AA 5KO3A 3AOEC 4UN2B 1NY5A 4M9SA 3KOWE 2E5LM 1HT1E 3FRIA 2XSZD 4L8RC 1NNJA 4AG5A 1UFZA 2LVAA 2LVQD 1OAIA 4R71A 2JY7A 2KNVA 3U5ZA 3GO8A 1XC8A 3I01M 1QUSA 5KPTA 2Z3XA 3FD9A 2HWJA 4NXNM 4NRVA 3V76A 2DAMA 2CWBA 3A42A 3ZC7B 3GQ5A 2UXBM 5DNYA 2KDLA 3D8BA 3LCVB 3J80S 2JY8A 4X65M 2F5OA 4LF8M 2LHGA 2I7PA 3H4JA 1IBMM 4A3VB 3GP1A 1NO1A 1IBLM 1XNRM 1NVMA 1J5EM 4LF4M 3E4RA 1PJIA 5JI2E 1SXJA 5FLXS 1PJTA 1TGUA 3J7AS 3SBJA 3IG8A 2J7NA 3OTOM 2DZNB 3M0EA 5C1BA 3C58A 2KRUA 4DR7M 1MJGM 1NHWC 3KVWA 3SAWA 4I4LA 2R4JA 3T38A 1ZQ9A 4FWDA 3L2AA 2CV2A 2O01F 1YE9A 4B3RM 2ZANA 4MGKE 4JI5M 4L78A 2JZ0A 1HT2E 1WGLA 4OX9M 3E21A 3SAVA 1XHBA 4FWGA 1NV9A 1BVSA 4M9ZA 1N32M 1N78A 1OFIA 3QWLA 4MGZE 3AKZA 3QYBA 4YY3M 4IBJA 4MB7A 2QZ4A 1ORYB 4JN6A 5FTKA 3KP1E 4M0WA 1GABA 4LJAA 1OQYA 3JR4A 4B7HA 3GLFE 4QNRA 2KRKA 2R44A 1IN6A 3FUXA 4BLCA 3RGPA 3HHXA 1FJGM 1GO5A 4JYAM 1IXRC 3WHLA 2EKFA 3FYCA 3J81S 3J2PB 4LFBM 4IBKA 5EP3A 3HU1A 4KT0F 5C18A 3A46A 2CHVA 3FKEA 3U61B 2DHRA 4OVZB 3GLIE 1L2CA 1HNZM 3RGSA 3GRRA 1TTEA 5EXXA 1QAMA 3E46A 3SHFA 4CIZA 2LVNC 3LVWA 3BXWA 4AZFA 2EJSA 3ZQJA 5KPRA 3ILKA 4II7A 3LQRA 1XMQM 2WSFF 4MGIE 1WR1B 3EIHA 2C98A 2D7EA 3HKPA 3PNVA 1PM5A 4GEWA 3GPXA 1G8PA 3GRUA 1KYIA 3ZCBB 3GLHA 3UK6A 3W68A 1KFVA 4XK8F 1ZMUA 2I7NA 4NSRA 2L4EA 1DGHB 1E9SA 3CF0A 4NOOB 4LG2A 3KS8A 1PRBA 2FFJA 2XEPA 3C9PA 2N35A 4W5WA 1F4IA 3CGWA 3ZH9B 4DR4M 1VEKA 2BJVA 2O25A 4FCTA 1C7YA 2UU9M 1YSYA 1G3IA 4IBCA 4DR5M 1N77A 4B3MM 1QAQA 1SXJE 1WJ7A 4OU7A 1EE8A 2GQFA 2LTUA 4XBOA 3TQSA 4KHPM 3EIEA 1J7KA 3SAUA 3U6MA 2C9OA 1JQJC 4LZZA 2R46A 3SARA 4DV2M 2CHGA 4DR2M 1IM2A 3NBIA 1XWIA 3HHZA 4LFCM 4GC9A 2ZTDA 4IBGA 1DO2A 1L2BA 3A98B 2CE7A 3NBXX 4R3DA 1NJGA 3PNYA 1Q3BA 3VK8A 5FTNA 2ZAOA 4IBEA 3FYDA 2FNAA 2Q2EB 2OOAA 4PD2A 3U60A 3A45A 2DNAA 1OIPA 2VQFM 4DV6M 2DWLA 5IZ7D 1R6BX 3U6LA 1AIPC 1G59A 3SYKA 1HR0M 2L09A 2KZSA 3SFZA 3GPUA 3GLGB 1QYRA 4DUZM 1K3WA 1UM8A 1E32A 5KQDA 1R4GA 2DKLA 1OFHA 4RF1A 4D82A 3U6QA 1L2DA 4CHTB 4F2LA 4LF5M 2UUCM 3UGJA 4TUWA 1NNUC 3U6CA 1Z5BA 1ZAEA 2CV0A 1HJPA 1L8QA 1LTMA 3GRVA 5IREB 3KXEC 4LF9M 4DV5M 3AOGA 3MK6A 1R5LA 4LGYA 1N36M 1NY6A 3AFHA 3LCUA 3J27B 3U6OA 1OTRA 1E94E 1OJLA 3T1HM 2D7GA 4JI1M 2KNZA 4P17A 1XXHB 3HU2A 4NL4H 3FTCA 3LW5F 4IJFA 4AKGA 2BJWA 2ZAMA 3SMSA 4DR3M 3UZUA 3GLHE 4LJ5A 2C99A 2XZFA 3DOAA 2YQZA 1PJJA 3L27A 3FTFA 2X8AA 4RNAA 2R0IA 3K92A 4L6V6 1Z5AA 3F92A 2YFQA 3K9OA 3VFDA 3BOSA 4GIPA 3B7ZA 4JI3M 1HNXM 1KSFX 1PJSA 2CUZA 2L6OA 2MROB 4CGYB 3K9PA 1DGGA 5EP1A 1TH4A 2M60A 4DBGB 3KOYE 3AOEA 4JI7M 1GKIA 3VKHA 3IECA 1MN3A 2LNHC 2LVPC 2CFOA 1GVNA 2EUCA 1DGBA 4PT5A 4DV4M 1CUKA 4I8OA 2Z4SA 2LHCA 2JWSA 5BPVA 2UUBM 4B7FA 1XNQM 3I51A 2JUJA 1DGHA 2QQ8A 1LV7A 2X4AA 2VQEM 3GRYA 3FTEA 1WHCA 2QBYB 2K9DA 4ITQA 1QAOA 2L7IA 2MGWA 1VG5A 1IN7A 1EFUB 4AG6A 3L25A 4K0KM 4G4OA 1I4WA 1OIZA 2KHHA 5ITXA 2LWXA 4MGYE
chains in the Genus database with same CATH topology
5ITQA 1QZMA 4Z8XA 5EP2A 4CISA 5DYGA 4IBBA 4R7GA 4JI0M 1MX0A 3SC3A 2BNKA 1Z5CA 2HKJA 1GLNA 4DV1M 4IJEA 2V1CA 3Q8XA 3MHVC 1D2NA 3THGA 4IBDA 4X62M 4AKIA 2A5YB 2H1RA 2XZUA 2V6ZM 4XGIA 1S3SA 2J7OA 2HL7A 3U5ZB 4GMQA 4FCWA 4MH0E 5FTMA 5GKNA 1H6UA 4WW0A 2RKOA 3PXGA 4DR1M 4QOZC 3FUUA 1Z6TA 1R7RA 3IG5A 4FCVA 1VDDA 3RFWA 3JAMS 3K2LA 3SYLA 2O5RA 1X37A 2YNMD 1K3XA 1JR3D 4PCZA 1XMOM 2CV1A 1XXHA 3LMMA 4AI6A 4MM3B 4P16A 1E9RA 3GQ4A 3AV0A 3KOZE 3GPYA 1IN8A 2QENA 4HLQA 5ITRA 4KODA 2RGHA 5EP4A 3TL4X 2QCUA 3FUVA 1TDZA 2DWZB 2XFTA 4GKJM 3VK7A 1Q3CA 1IBKM 4LF7M 3U6PA 4LJ7A 4BBAA 4GHAA 3JR5A 3K1JA 3LQQA 4B3SM 5F3WA 2G8LA 1YUBA 5DYIA 3AL0C 4KLNA 4B08A 4X66M 2HCBA 5ITXE 4LZJA 4DV3M 1W5SA 4AW4A 3HJQA 2C96A 4JXJA 3CF2A 2R62A 2ZM6M 4D80A 3KSXA 1K82A 4EIWA 4LY6A 1HQCA 5E26A 3TWLA 4DR6M 3PVSA 3DA1A 3TE6A 2OQ4A 2Y20A 4MGHA 2Y0TA 2XSZA 3HGIA 2XLJA 1L1TA 3HJSA 2DXIA 4QHSA 2L7HA 3R9XB 3HHYA 2EO2A 4JI8M 3UMMA 2F5NA 2C5RA 2R18A 3R8FA 3MJ5A 2W82A 2Y21A 3KP0E 3SHGB 3B9PA 1R2YA 1N75A 2R4EA 3W0FA 2R45A 1IXSB 3U6SA 4DV7M 1NJFA 4LFAM 4HL4A 3FUWA 3SATA 3U61A 4LJ9A 4OVZA 1I94M 3CTWB 2LXEA 2EA0A 4D81A 4LJ4A 2AHMA 1SXJC 5FSWA 1R2ZA 4M0DA 1W5TA 1IQPA 4LRSA 2M5ZA 4GITA 5KQ8A 7CATA 4G4RA 3HU3A 5ITUA 1L1ZA 5A2QS 3CF6E 3KSJA 4I81A 3VDPA 1G41A 3D8LA 4L16A 3TPZA 3KS4A 3U60B 4RF0A 4G4QA 1GL7A 4PDGA 3H4MA 4DUYM 2XH9A 2YR0A 1TDHA 4B3TM 5IT9S 3HHWA 2F5PA 4NRWA 1WXQA 3UJNA 4L15A 4YHHM 1SXJD 3GQ3A 2NQ8C 3GLFB 3AJIB 3TWMA 1QQWA 4QOSA 4G6ZA 5EJCA 4FD2A 2F4VM 4X64M 2C9CA 2V1UA 3LVVA 4L4UA 5EQTA 2DWNA 2P5TA 3DFZA 3DZDA 4IIWA 3GLIB 3RE8A 5H37D 1J09A 2X49A 4QHTA 3K8ZA 4LCBA 4OW0A 4Z6YA 3W0LB 2KXEA 1G4AE 4GC5A 5ITTA 3NWLA 1NSFA 3GLGA 3U6EA 3TWKA 3I4VA 3J7BA 4WURA 5ITYA 5FTJA 1HQYE 2KW0A 3HWSA 3KDSE 4JI2M 4NXMM 3T1YM 3VDUA 1GL6A 4AQYM 5EXPA 3KW6A 1JR3A 4G4NA 5EXTA 1TH2A 2XGNA 4I5SA 2CHQA 1SXJB 3KOXE 2KZUA 3E9SA 2JA2A 3FUTA 2XF3A 4M9XA 5E6JA 1TH3A 2VIIA 1IY1A 2ERCA 4IBFA 4JI4M 3T15A 2RGOA 2Z7JA 2D7HA 2UXDM 2QP9X 1QVRA 1C1KA 4ZPXA 2UUAM 3L26A 4FWHA 3QAUA 2Z4RA 3L28A 2QPAA 1T3TA 4GH9A 4NSOB 4LJ6A 4BB9A 2OPFA 3HJ8A 1N33M 4QNMA 1IN5A 5BR8M 2KEBA 2K47A 3WHKA 2R65A 2G5GX 2KA6B 1N34M 2FE8A 1MU5A 3KFUG 1FNNA 5LMUM 1IXZA 1IY2A 4LGMA 4GHLA 2FOIC 3FTDA 5JI3E 1DO0A 3SASA 5LMNM 4KO8A 3PFIA 3SMPA 5FTLA 2LH0A 5KPZA 1IN4A 1Z59A 2DWMA 4JI6M 2DZOB 1DGFA 1Q39A 1HNWM 2XFSA 2DVWB 2QBYA 2CEAA 2ZBKB 3I4YA 4JV5M 4FVMA 2F5QA 2UXCM 4DV0M 4FW9A 4LF6M 8CATA 4LRTA 4GKKM 3VKGA 4PDIA 4GRIA 3GLHB 5EXSA 1QANA 4REZA 3GLFA 3U6DA 1IY0A 4AKHA 1NHGC 4LJ8A 3VLFB 3L29A 5IWAM 4B7GA 4S12A 3M7GA 3GPPA 2HHHM 4IBIA 2Y0QA 3GLIA 2F5SA 3M6AA 5KO3A 3AOEC 2E5LM 1NY5A 4M9SA 3KOWE 1HT1E 2XSZD 4L8RC 1NNJA 4AG5A 3U5ZA 3GO8A 1XC8A 5KPTA 2Z3XA 3FD9A 4NXNM 4NRVA 3A42A 3ZC7B 3GQ5A 2UXBM 5DNYA 3D8BA 3J80S 2F5OA 4X65M 4LF8M 2I7PA 1IBMM 4A3VB 3GP1A 1IBLM 1XNRM 1NVMA 1J5EM 4LF4M 3E4RA 1PJIA 5JI2E 1SXJA 5FLXS 1TGUA 3J7AS 3SBJA 3IG8A 2J7NA 3OTOM 2DZNB 3M0EA 5C1BA 3C58A 2KRUA 4DR7M 1NHWC 3KVWA 3SAWA 4I4LA 2R4JA 3T38A 1ZQ9A 4FWDA 3L2AA 2CV2A 1YE9A 4B3RM 2ZANA 4MGKE 4JI5M 4L78A 1HT2E 4OX9M 3SAVA 1XHBA 4FWGA 4M9ZA 1N32M 1N78A 1OFIA 3QWLA 4MGZE 3AKZA 4YY3M 4IBJA 4MB7A 2QZ4A 1ORYB 4JN6A 5FTKA 3KP1E 4M0WA 4LJAA 3JR4A 4B7HA 4QNRA 2KRKA 3FUXA 1IN6A 4BLCA 3RGPA 3HHXA 1FJGM 4JYAM 1IXRC 3WHLA 3FYCA 3J81S 3J2PB 4LFBM 4IBKA 5EP3A 3HU1A 5C18A 3A46A 2CHVA 3FKEA 3U61B 2DHRA 4OVZB 1L2CA 1HNZM 3RGSA 3GRRA 5EXXA 1QAMA 3SHFA 3LVWA 4AZFA 5KPRA 3ILKA 4II7A 3LQRA 1XMQM 4MGIE 3EIHA 2C98A 2D7EA 3HKPA 3PNVA 1PM5A 3GPXA 1G8PA 3GRUA 1KYIA 3ZCBB 3GLHA 3UK6A 1KFVA 2I7NA 4NSRA 1DGHB 1E9SA 3CF0A 4NOOB 4LG2A 3KS8A 2FFJA 2XEPA 4W5WA 3ZH9B 4DR4M 2BJVA 2UU9M 4FCTA 1YSYA 1G3IA 4IBCA 4DR5M 1N77A 4B3MM 1QAQA 1SXJE 4OU7A 1EE8A 4XBOA 4KHPM 3TQSA 3EIEA 1J7KA 3SAUA 3U6MA 2C9OA 1JQJC 4LZZA 2R46A 3SARA 4DV2M 2CHGA 4DR2M 1IM2A 3NBIA 1XWIA 3HHZA 4LFCM 4GC9A 4IBGA 1DO2A 1L2BA 3A98B 2CE7A 4R3DA 1NJGA 3PNYA 1Q3BA 3VK8A 5FTNA 2ZAOA 4IBEA 3FYDA 2FNAA 2Q2EB 4PD2A 3U60A 3A45A 2VQFM 4DV6M 2DWLA 5IZ7D 1R6BX 3U6LA 1G59A 3SYKA 1HR0M 2L09A 2KZSA 3SFZA 3GPUA 3GLGB 1QYRA 4DUZM 1K3WA 1UM8A 1E32A 5KQDA 4RF1A 3U6QA 1OFHA 4D82A 1L2DA 4CHTB 4LF5M 2UUCM 3UGJA 4TUWA 1NNUC 3U6CA 1Z5BA 1ZAEA 2CV0A 5IREB 1L8QA 3GRVA 3KXEC 4LF9M 4DV5M 3AOGA 3MK6A 4LGYA 1N36M 1NY6A 3AFHA 3J27B 3U6OA 1E94E 1OJLA 3T1HM 2D7GA 4JI1M 1XXHB 3HU2A 4NL4H 3FTCA 4IJFA 4AKGA 2BJWA 2ZAMA 3SMSA 4DR3M 3UZUA 4LJ5A 2C99A 2XZFA 3DOAA 2YQZA 1PJJA 3L27A 3FTFA 2X8AA 4RNAA 3K92A 1Z5AA 2YFQA 3VFDA 3BOSA 4GIPA 4JI3M 1HNXM 1KSFX 2CUZA 2L6OA 4CGYB 1DGGA 5EP1A 1TH4A 2M60A 3KOYE 3AOEA 4JI7M 1GKIA 3VKHA 2LNHC 2CFOA 1GVNA 2EUCA 1DGBA 4PT5A 4DV4M 4I8OA 2Z4SA 5BPVA 2UUBM 4B7FA 1XNQM 3I51A 1DGHA 1LV7A 2X4AA 2VQEM 3GRYA 3FTEA 2QBYB 4ITQA 1QAOA 2L7IA 1IN7A 4AG6A 3L25A 4K0KM 4G4OA 1I4WA 5ITXA 2LWXA 4MGYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 M;  2ZBK B;  5ITQ A;  4DR4 M;  4CIS A;  4G4R A;  2UU9 M;  2F5Q A;  4JI0 M;  1MX0 A;  5ITU A;  1L1Z A;  5A2Q S;  4DV0 M;  4DR5 M;  4B3M M;  4LF6 M;  2UXC M;  4GKK M;  4PDI A;  1Z5C A;  2HKJ A;  1EE8 A;  4KHP M;  4DV1 M;  3U6D A;  3SAU A;  3U6M A;  3SAR A;  4DV2 M;  4DR2 M;  4X62 M;  5IWA M;  4G4Q A;  2XZU A;  4LFC M;  4PDG A;  4DUY M;  3GPP A;  2HHH M;  1TDH A;  4B3T M;  1L2B A;  5IT9 S;  2F5P A;  4NRW A;  1Q3B A;  3VK8 A;  2F5S A;  2E5L M;  4DR1 M;  4YHH M;  3GQ3 A;  2Q2E B;  3TWM A;  4PD2 A;  3A45 A;  3JAM S;  2VQF M;  4DV6 M;  1NNJ A;  3U6L A;  2F4V M;  4X64 M;  1HR0 M;  3GPU A;  3GO8 A;  1XC8 A;  4DUZ M;  1K3W A;  1K3X A;  4PCZ A;  1XMO M;  3U6Q A;  4NXN M;  4NRV A;  1L2D A;  3GQ4 A;  3A42 A;  3GQ5 A;  2UUC M;  4LF5 M;  2UXB M;  3U6C A;  1Z5B A;  3J80 S;  3GPY A;  4X65 M;  2F5O A;  4LF8 M;  5ITR A;  5ITT A;  3GP1 A;  1IBL M;  4DV5 M;  1IBM M;  4LF9 M;  1J5E M;  1N36 M;  1TDZ A;  4LF4 M;  1XNR M;  3U6E A;  3TWK A;  3U6O A;  4GKJ M;  3VK7 A;  1PJI A;  1Q3C A;  1IBK M;  5ITY A;  4LF7 M;  3U6P A;  5FLX S;  3T1H M;  4JI1 M;  3J7A S;  3SBJ A;  3OTO M;  3C58 A;  4JI2 M;  3JR5 A;  4DR7 M;  4NXM M;  3T1Y M;  4B3S M;  4DR3 M;  3SAW A;  4AQY M;  4G4N A;  2XZF A;  4B3R M;  4JI5 M;  3DOA A;  4X66 M;  1PJJ A;  4OX9 M;  5ITX E;  3SAV A;  4DV3 M;  1N32 M;  1Z5A A;  4YY3 M;  2ZM6 M;  4MB7 A;  4JI4 M;  1K82 A;  3TWL A;  4JI3 M;  1HNX M;  2UXD M;  4DR6 M;  3JR4 A;  2UUA M;  2OQ4 A;  4JI7 M;  1R2Z A;  1FJG M;  4JYA M;  4DV4 M;  1L1T A;  2OPF A;  3J81 S;  4LFB M;  1N33 M;  5BR8 M;  2UUB M;  3A46 A;  1XNQ M;  4JI8 M;  1L2C A;  1HNZ M;  2F5N A;  1N34 M;  1MU5 A;  2VQE M;  1R2Y A;  5LMU M;  1XMQ M;  3W0F A;  3U6S A;  3SAS A;  4DV7 M;  4ITQ A;  5LMN M;  4LFA M;  1PM5 A;  3SAT A;  3GPX A;  1KFV A;  1I94 M;  4K0K M;  4G4O A;  1Z59 A;  2EA0 A;  4JI6 M;  5ITX A;  1Q39 A;  1HNW M; 
#chains in the Genus database with same CATH topology
 2LBC A;  1EIJ A;  1JB0 F;  5ITQ A;  1QZM A;  4Z8X A;  5EP2 A;  4CIS A;  1OKS A;  5DYG A;  4IBB A;  4R7G A;  4JI0 M;  2EKK A;  2KNA A;  1MX0 A;  3SC3 A;  1ZMV A;  2BNK A;  1Z5C A;  2HKJ A;  1GLN A;  4DV1 M;  4IJE A;  1YLA A;  2V1C A;  3Q8X A;  3MHV C;  1D2N A;  1QDT A;  3THG A;  4IBD A;  1VDL A;  4X62 M;  4AKI A;  2A5Y B;  2H1R A;  2XZU A;  1TR8 A;  1AUA A;  2DAK A;  2V6Z M;  1D0M A;  1S3S A;  4XGI A;  2J7O A;  2OOB A;  2JNH A;  2FH0 A;  2K6B A;  2HL7 A;  4NC6 A;  3U5Z B;  4GMQ A;  4FCW A;  4MH0 E;  5FTM A;  5GKN A;  1H6U A;  4WW0 A;  2RKO A;  3PXG A;  4DR1 M;  3W67 A;  4QOZ C;  3FUU A;  1Z6T A;  1R7R A;  3IG5 A;  4FCV A;  1VDD A;  3RFW A;  3JAM S;  2B3T A;  1TF0 B;  3K2L A;  3SYL A;  2O5R A;  1XB2 B;  2VF8 A;  1X37 A;  1V33 A;  2YNM D;  1K3X A;  1JR3 D;  2BWE A;  4PCZ A;  1XMO M;  2CV1 A;  1XXH A;  3LMM A;  4AI6 A;  2VDB B;  4MM3 B;  4P16 A;  1E9R A;  3GQ4 A;  3AV0 A;  3KOZ E;  3GPY A;  1IN8 A;  2QEN A;  4HLQ A;  5ITR A;  1SG9 A;  1V92 A;  2RGH A;  4KOD A;  2DI0 A;  5EP4 A;  2QCU A;  3FUV A;  3TL4 X;  1TDZ A;  2DWZ B;  2XFT A;  4GKJ M;  3VK7 A;  1Q3C A;  1IBK M;  4LF7 M;  3U6P A;  4LJ7 A;  4BBA A;  1IFY A;  4GHA A;  3JR5 A;  3K1J A;  3LQQ A;  4B3S M;  1A5T A;  2H5X A;  5F3W A;  2G8L A;  1YUB A;  5DYI A;  3AL0 C;  4KLN A;  4B08 A;  4X66 M;  1Y8G A;  2WSC F;  2JP7 A;  2HCB A;  2VF7 A;  5ITX E;  4LZJ A;  4DV3 M;  1W5S A;  4AW4 A;  1VEJ A;  3HJQ A;  1VEG A;  2C96 A;  4JXJ A;  3CF2 A;  1ZMW A;  2R62 A;  2ZM6 M;  4D80 A;  1DV0 A;  3KSX A;  1K82 A;  4EIW A;  4LY6 A;  1HQC A;  5E26 A;  3TWL A;  3T6P A;  3QYE A;  4DR6 M;  2DZL A;  3PVS A;  3DA1 A;  3TE6 A;  2OQ4 A;  2Y20 A;  4MGH A;  1GJT A;  2Y0T A;  2XSZ A;  3HGI A;  2XLJ A;  3C3E A;  1L1T A;  3HJS A;  3BBZ A;  2DXI A;  4QHS A;  2L7H A;  3R9X B;  3HHY A;  2EO2 A;  4JI8 M;  3UMM A;  2F5N A;  2C5R A;  2R18 A;  3R8F A;  3MJ5 A;  2W82 A;  2Y21 A;  3KP0 E;  3SHG B;  3B9P A;  1R2Y A;  1N75 A;  2R4E A;  3W0F A;  2WZJ A;  2R45 A;  1IXS B;  3U6S A;  2DEN A;  4DV7 M;  1NJF A;  4LFA M;  2QHO B;  2JY6 B;  4HL4 A;  4F1I A;  3FUW A;  3SAT A;  2QNJ A;  3U61 A;  4LJ9 A;  4OVZ A;  1I94 M;  2G3Q A;  2OO9 A;  1XXH E;  3CTW B;  3MMP A;  2LXE A;  2EA0 A;  4D81 A;  4LJ4 A;  2AHM A;  1SXJ C;  4Q7J A;  1RU3 A;  5FSW A;  4M0D A;  1W5T A;  1IQP A;  4LRS A;  1R2Z A;  1GJS A;  2M5Z A;  3C3D A;  4GIT A;  5KQ8 A;  1D0L A;  2JXN A;  5L8R F;  7CAT A;  4G4R A;  3HU3 A;  5ITU A;  1L1Z A;  5A2Q S;  2CP8 A;  3CF6 E;  2BWB A;  3KSJ A;  4I81 A;  3VDP A;  4Y28 F;  1G41 A;  3D8L A;  4L16 A;  3TPZ A;  3KS4 A;  3U60 B;  4ANR A;  4RF0 A;  2APL A;  4HEO A;  4G4Q A;  2L4F A;  1GL7 A;  4PDG A;  3H4M A;  2DAG A;  4DUY M;  2XH9 A;  2YR0 A;  1TDH A;  4B3T M;  5IT9 S;  3HHW A;  2F5P A;  4NRW A;  1WXQ A;  3UJN A;  4L15 A;  4YHH M;  1SXJ D;  3GQ3 A;  2NQ8 C;  3GLF B;  3AJI B;  3TWM A;  1QQW A;  4QOS A;  1PGY A;  4G6Z A;  2K0B X;  5EJC A;  4FD2 A;  2F4V M;  4X64 M;  2C9C A;  2V1U A;  3LVV A;  4L4U A;  5EQT A;  3B7Q A;  2DWN A;  2P5T A;  3DFZ A;  3DZD A;  4IIW A;  2DHY A;  3GLI B;  2ZTC A;  3RE8 A;  5H37 D;  1J09 A;  1T43 A;  2X49 A;  4QHT A;  4RKU F;  3K8Z A;  4LCB A;  4OW0 A;  4Z6Y A;  3W0L B;  2GNO A;  2KXE A;  1G4A E;  4GC5 A;  5ITT A;  3NWL A;  1NSF A;  3GLG A;  3U6E A;  3TWK A;  3I4V A;  3IHP A;  3J7B A;  2HAK A;  4WUR A;  5ITY A;  5FTJ A;  1HQY E;  1Q02 A;  3HX3 A;  1PJQ A;  2KW0 A;  3HZJ A;  3HWS A;  3KDS E;  4G3O A;  4JI2 M;  3B74 A;  3FRH A;  4NXM M;  3T1Y M;  3FE3 A;  3VDU A;  1GL6 A;  2DAE A;  4AQY M;  1G71 A;  5EXP A;  3KW6 A;  1JR3 A;  4G4N A;  4WP2 A;  1VQ1 A;  5EXT A;  1TH2 A;  2XGN A;  4I5S A;  2CHQ A;  1SXJ B;  3KOX E;  2KZU A;  3E9S A;  2JA2 A;  3FUT A;  2XF3 A;  4M9X A;  5E6J A;  1TH3 A;  2VII A;  1IY1 A;  2ERC A;  4IBF A;  4JI4 M;  3T15 A;  2RGO A;  2Z7J A;  2D7H A;  2UXD M;  2QP9 X;  1QVR A;  1C1K A;  4ZPX A;  2DAI A;  2UUA M;  1WGN A;  3L26 A;  4FWH A;  2JY5 A;  3QAU A;  2Z4R A;  1NV8 A;  3L28 A;  1IXS A;  2J5Y A;  2QPA A;  1T3T A;  4GH9 A;  2Z8Y M;  4LJ6 A;  2R6F A;  4NSO B;  4BB9 A;  2OPF A;  3I04 M;  2L2D A;  3HJ8 A;  1N33 M;  4QNM A;  3Q8G A;  1IN5 A;  5BR8 M;  1V34 A;  2KEB A;  4CJ6 A;  2K47 A;  3WHK A;  2RRU A;  3B7N A;  2R65 A;  2G5G X;  2QSF X;  2KA6 B;  5DFL A;  2FE8 A;  1MU5 A;  1N34 M;  1FNN A;  3KFU G;  3B89 A;  5LMU M;  1IXZ A;  1IY2 A;  4LGM A;  4GHL A;  2FOI C;  3FTD A;  5JI3 E;  1DO0 A;  2CRU A;  2MR9 A;  3SAS A;  2MH8 A;  5LMN M;  4KO8 A;  1D0K A;  3PFI A;  3SMP A;  5FTL A;  2LH0 A;  5KPZ A;  1T6O A;  1WIV A;  1IN4 A;  1Z59 A;  1QZE A;  2DWM A;  4JI6 M;  2DZO B;  1DGF A;  1Q39 A;  1HNW M;  2XFS A;  2JZ1 A;  2DVW B;  1QDR A;  2CEA A;  2ZBK B;  2WSE F;  1QUT A;  3HY5 A;  3I4Y A;  2FS1 A;  2QBY A;  4JV5 M;  4FVM A;  2MJ5 B;  3GLG E;  2F5Q A;  1ZV1 A;  4DV0 M;  4FW9 A;  4LF6 M;  2UXC M;  8CAT A;  4LRT A;  4GKK M;  3VKG A;  4PDI A;  4GRI A;  3GLH B;  5EXS A;  1QAN A;  4REZ A;  3GLF A;  3U6D A;  1IY0 A;  4AKH A;  2LVO C;  1NHG C;  4LJ8 A;  1P3Q Q;  3VLF B;  3L29 A;  5IWA M;  4B7G A;  4S12 A;  1JR3 E;  3M7G A;  1OAO C;  3GPP A;  2HHH M;  4IBI A;  2Y0Q A;  3GLI A;  2F5S A;  3M6A A;  5KO3 A;  3AOE C;  4UN2 B;  1NY5 A;  4M9S A;  3KOW E;  2E5L M;  1HT1 E;  3FRI A;  2XSZ D;  4L8R C;  1NNJ A;  4AG5 A;  1UFZ A;  2LVA A;  2LVQ D;  1OAI A;  4R71 A;  2JY7 A;  2KNV A;  3U5Z A;  3GO8 A;  1XC8 A;  3I01 M;  1QUS A;  5KPT A;  2Z3X A;  3FD9 A;  2HWJ A;  4NXN M;  4NRV A;  3V76 A;  2DAM A;  2CWB A;  3A42 A;  3ZC7 B;  3GQ5 A;  2UXB M;  5DNY A;  2KDL A;  3D8B A;  3LCV B;  3J80 S;  2JY8 A;  4X65 M;  2F5O A;  4LF8 M;  2LHG A;  2I7P A;  3H4J A;  1IBM M;  4A3V B;  3GP1 A;  1NO1 A;  1IBL M;  1XNR M;  1NVM A;  1J5E M;  4LF4 M;  3E4R A;  1PJI A;  5JI2 E;  1SXJ A;  5FLX S;  1PJT A;  1TGU A;  3J7A S;  3SBJ A;  3IG8 A;  2J7N A;  3OTO M;  2DZN B;  3M0E A;  5C1B A;  3C58 A;  2KRU A;  4DR7 M;  1MJG M;  1NHW C;  3KVW A;  3SAW A;  4I4L A;  2R4J A;  3T38 A;  1ZQ9 A;  4FWD A;  3L2A A;  2CV2 A;  2O01 F;  1YE9 A;  4B3R M;  2ZAN A;  4MGK E;  4JI5 M;  4L78 A;  2JZ0 A;  1HT2 E;  1WGL A;  4OX9 M;  3E21 A;  3SAV A;  1XHB A;  4FWG A;  1NV9 A;  1BVS A;  4M9Z A;  1N32 M;  1N78 A;  1OFI A;  3QWL A;  4MGZ E;  3AKZ A;  3QYB A;  4YY3 M;  4IBJ A;  4MB7 A;  2QZ4 A;  1ORY B;  4JN6 A;  5FTK A;  3KP1 E;  4M0W A;  1GAB A;  4LJA A;  1OQY A;  3JR4 A;  4B7H A;  3GLF E;  4QNR A;  2KRK A;  2R44 A;  1IN6 A;  3FUX A;  4BLC A;  3RGP A;  3HHX A;  1FJG M;  1GO5 A;  4JYA M;  1IXR C;  3WHL A;  2EKF A;  3FYC A;  3J81 S;  3J2P B;  4LFB M;  4IBK A;  5EP3 A;  3HU1 A;  4KT0 F;  5C18 A;  3A46 A;  2CHV A;  3FKE A;  3U61 B;  2DHR A;  4OVZ B;  3GLI E;  1L2C A;  1HNZ M;  3RGS A;  3GRR A;  1TTE A;  5EXX A;  1QAM A;  3E46 A;  3SHF A;  4CIZ A;  2LVN C;  3LVW A;  3BXW A;  4AZF A;  2EJS A;  3ZQJ A;  5KPR A;  3ILK A;  4II7 A;  3LQR A;  1XMQ M;  2WSF F;  4MGI E;  1WR1 B;  3EIH A;  2C98 A;  2D7E A;  3HKP A;  3PNV A;  1PM5 A;  4GEW A;  3GPX A;  1G8P A;  3GRU A;  1KYI A;  3ZCB B;  3GLH A;  3UK6 A;  3W68 A;  1KFV A;  4XK8 F;  1ZMU A;  2I7N A;  4NSR A;  2L4E A;  1DGH B;  1E9S A;  3CF0 A;  4NOO B;  4LG2 A;  3KS8 A;  1PRB A;  2FFJ A;  2XEP A;  3C9P A;  2N35 A;  4W5W A;  1F4I A;  3CGW A;  3ZH9 B;  4DR4 M;  1VEK A;  2BJV A;  2O25 A;  4FCT A;  1C7Y A;  2UU9 M;  1YSY A;  1G3I A;  4IBC A;  4DR5 M;  1N77 A;  4B3M M;  1QAQ A;  1SXJ E;  1WJ7 A;  4OU7 A;  1EE8 A;  2GQF A;  2LTU A;  4XBO A;  3TQS A;  4KHP M;  3EIE A;  1J7K A;  3SAU A;  3U6M A;  2C9O A;  1JQJ C;  4LZZ A;  2R46 A;  3SAR A;  4DV2 M;  2CHG A;  4DR2 M;  1IM2 A;  3NBI A;  1XWI A;  3HHZ A;  4LFC M;  4GC9 A;  2ZTD A;  4IBG A;  1DO2 A;  1L2B A;  3A98 B;  2CE7 A;  3NBX X;  4R3D A;  1NJG A;  3PNY A;  1Q3B A;  3VK8 A;  5FTN A;  2ZAO A;  4IBE A;  3FYD A;  2FNA A;  2Q2E B;  2OOA A;  4PD2 A;  3U60 A;  3A45 A;  2DNA A;  1OIP A;  2VQF M;  4DV6 M;  2DWL A;  5IZ7 D;  1R6B X;  3U6L A;  1AIP C;  1G59 A;  3SYK A;  1HR0 M;  2L09 A;  2KZS A;  3SFZ A;  3GPU A;  3GLG B;  1QYR A;  4DUZ M;  1K3W A;  1UM8 A;  1E32 A;  5KQD A;  1R4G A;  2DKL A;  1OFH A;  4RF1 A;  4D82 A;  3U6Q A;  1L2D A;  4CHT B;  4F2L A;  4LF5 M;  2UUC M;  3UGJ A;  4TUW A;  1NNU C;  3U6C A;  1Z5B A;  1ZAE A;  2CV0 A;  1HJP A;  1L8Q A;  1LTM A;  3GRV A;  5IRE B;  3KXE C;  4LF9 M;  4DV5 M;  3AOG A;  3MK6 A;  1R5L A;  4LGY A;  1N36 M;  1NY6 A;  3AFH A;  3LCU A;  3J27 B;  3U6O A;  1OTR A;  1E94 E;  1OJL A;  3T1H M;  2D7G A;  4JI1 M;  2KNZ A;  4P17 A;  1XXH B;  3HU2 A;  4NL4 H;  3FTC A;  3LW5 F;  4IJF A;  4AKG A;  2BJW A;  2ZAM A;  3SMS A;  4DR3 M;  3UZU A;  3GLH E;  4LJ5 A;  2C99 A;  2XZF A;  3DOA A;  2YQZ A;  1PJJ A;  3L27 A;  3FTF A;  2X8A A;  4RNA A;  2R0I A;  3K92 A;  4L6V 6;  1Z5A A;  3F92 A;  2YFQ A;  3K9O A;  3VFD A;  3BOS A;  4GIP A;  3B7Z A;  4JI3 M;  1HNX M;  1KSF X;  1PJS A;  2CUZ A;  2L6O A;  2MRO B;  4CGY B;  3K9P A;  1DGG A;  5EP1 A;  1TH4 A;  2M60 A;  4DBG B;  3KOY E;  3AOE A;  4JI7 M;  1GKI A;  3VKH A;  3IEC A;  1MN3 A;  2LNH C;  2LVP C;  2CFO A;  1GVN A;  2EUC A;  1DGB A;  4PT5 A;  4DV4 M;  1CUK A;  4I8O A;  2Z4S A;  2LHC A;  2JWS A;  5BPV A;  2UUB M;  4B7F A;  1XNQ M;  3I51 A;  2JUJ A;  1DGH A;  2QQ8 A;  1LV7 A;  2X4A A;  2VQE M;  3GRY A;  3FTE A;  1WHC A;  2QBY B;  2K9D A;  4ITQ A;  1QAO A;  2L7I A;  2MGW A;  1VG5 A;  1IN7 A;  1EFU B;  4AG6 A;  3L25 A;  4K0K M;  4G4O A;  1I4W A;  1OIZ A;  2KHH A;  5ITX A;  2LWX A;  4MGY E; 
#chains in the Genus database with same CATH homology
 5ITQ A;  1QZM A;  4Z8X A;  5EP2 A;  4CIS A;  5DYG A;  4IBB A;  4R7G A;  4JI0 M;  1MX0 A;  3SC3 A;  2BNK A;  1Z5C A;  2HKJ A;  1GLN A;  4DV1 M;  4IJE A;  2V1C A;  3Q8X A;  3MHV C;  1D2N A;  3THG A;  4IBD A;  4X62 M;  4AKI A;  2A5Y B;  2H1R A;  2XZU A;  2V6Z M;  4XGI A;  1S3S A;  2J7O A;  2HL7 A;  3U5Z B;  4GMQ A;  4FCW A;  4MH0 E;  5FTM A;  5GKN A;  1H6U A;  4WW0 A;  2RKO A;  3PXG A;  4DR1 M;  4QOZ C;  3FUU A;  1Z6T A;  1R7R A;  3IG5 A;  4FCV A;  1VDD A;  3RFW A;  3JAM S;  3K2L A;  3SYL A;  2O5R A;  1X37 A;  2YNM D;  1K3X A;  1JR3 D;  4PCZ A;  1XMO M;  2CV1 A;  1XXH A;  3LMM A;  4AI6 A;  4MM3 B;  4P16 A;  1E9R A;  3GQ4 A;  3AV0 A;  3KOZ E;  3GPY A;  1IN8 A;  2QEN A;  4HLQ A;  5ITR A;  4KOD A;  2RGH A;  5EP4 A;  3TL4 X;  2QCU A;  3FUV A;  1TDZ A;  2DWZ B;  2XFT A;  4GKJ M;  3VK7 A;  1Q3C A;  1IBK M;  4LF7 M;  3U6P A;  4LJ7 A;  4BBA A;  4GHA A;  3JR5 A;  3K1J A;  3LQQ A;  4B3S M;  5F3W A;  2G8L A;  1YUB A;  5DYI A;  3AL0 C;  4KLN A;  4B08 A;  4X66 M;  2HCB A;  5ITX E;  4LZJ A;  4DV3 M;  1W5S A;  4AW4 A;  3HJQ A;  2C96 A;  4JXJ A;  3CF2 A;  2R62 A;  2ZM6 M;  4D80 A;  3KSX A;  1K82 A;  4EIW A;  4LY6 A;  1HQC A;  5E26 A;  3TWL A;  4DR6 M;  3PVS A;  3DA1 A;  3TE6 A;  2OQ4 A;  2Y20 A;  4MGH A;  2Y0T A;  2XSZ A;  3HGI A;  2XLJ A;  1L1T A;  3HJS A;  2DXI A;  4QHS A;  2L7H A;  3R9X B;  3HHY A;  2EO2 A;  4JI8 M;  3UMM A;  2F5N A;  2C5R A;  2R18 A;  3R8F A;  3MJ5 A;  2W82 A;  2Y21 A;  3KP0 E;  3SHG B;  3B9P A;  1R2Y A;  1N75 A;  2R4E A;  3W0F A;  2R45 A;  1IXS B;  3U6S A;  4DV7 M;  1NJF A;  4LFA M;  4HL4 A;  3FUW A;  3SAT A;  3U61 A;  4LJ9 A;  4OVZ A;  1I94 M;  3CTW B;  2LXE A;  2EA0 A;  4D81 A;  4LJ4 A;  2AHM A;  1SXJ C;  5FSW A;  1R2Z A;  4M0D A;  1W5T A;  1IQP A;  4LRS A;  2M5Z A;  4GIT A;  5KQ8 A;  7CAT A;  4G4R A;  3HU3 A;  5ITU A;  1L1Z A;  5A2Q S;  3CF6 E;  3KSJ A;  4I81 A;  3VDP A;  1G41 A;  3D8L A;  4L16 A;  3TPZ A;  3KS4 A;  3U60 B;  4RF0 A;  4G4Q A;  1GL7 A;  4PDG A;  3H4M A;  4DUY M;  2XH9 A;  2YR0 A;  1TDH A;  4B3T M;  5IT9 S;  3HHW A;  2F5P A;  4NRW A;  1WXQ A;  3UJN A;  4L15 A;  4YHH M;  1SXJ D;  3GQ3 A;  2NQ8 C;  3GLF B;  3AJI B;  3TWM A;  1QQW A;  4QOS A;  4G6Z A;  5EJC A;  4FD2 A;  2F4V M;  4X64 M;  2C9C A;  2V1U A;  3LVV A;  4L4U A;  5EQT A;  2DWN A;  2P5T A;  3DFZ A;  3DZD A;  4IIW A;  3GLI B;  3RE8 A;  5H37 D;  1J09 A;  2X49 A;  4QHT A;  3K8Z A;  4LCB A;  4OW0 A;  4Z6Y A;  3W0L B;  2KXE A;  1G4A E;  4GC5 A;  5ITT A;  3NWL A;  1NSF A;  3GLG A;  3U6E A;  3TWK A;  3I4V A;  3J7B A;  4WUR A;  5ITY A;  5FTJ A;  1HQY E;  2KW0 A;  3HWS A;  3KDS E;  4JI2 M;  4NXM M;  3T1Y M;  3VDU A;  1GL6 A;  4AQY M;  5EXP A;  3KW6 A;  1JR3 A;  4G4N A;  5EXT A;  1TH2 A;  2XGN A;  4I5S A;  2CHQ A;  1SXJ B;  3KOX E;  2KZU A;  3E9S A;  2JA2 A;  3FUT A;  2XF3 A;  4M9X A;  5E6J A;  1TH3 A;  2VII A;  1IY1 A;  2ERC A;  4IBF A;  4JI4 M;  3T15 A;  2RGO A;  2Z7J A;  2D7H A;  2UXD M;  2QP9 X;  1QVR A;  1C1K A;  4ZPX A;  2UUA M;  3L26 A;  4FWH A;  3QAU A;  2Z4R A;  3L28 A;  2QPA A;  1T3T A;  4GH9 A;  4NSO B;  4LJ6 A;  4BB9 A;  2OPF A;  3HJ8 A;  1N33 M;  4QNM A;  1IN5 A;  5BR8 M;  2KEB A;  2K47 A;  3WHK A;  2R65 A;  2G5G X;  2KA6 B;  1N34 M;  2FE8 A;  1MU5 A;  3KFU G;  1FNN A;  5LMU M;  1IXZ A;  1IY2 A;  4LGM A;  4GHL A;  2FOI C;  3FTD A;  5JI3 E;  1DO0 A;  3SAS A;  5LMN M;  4KO8 A;  3PFI A;  3SMP A;  5FTL A;  2LH0 A;  5KPZ A;  1IN4 A;  1Z59 A;  2DWM A;  4JI6 M;  2DZO B;  1DGF A;  1Q39 A;  1HNW M;  2XFS A;  2DVW B;  2QBY A;  2CEA A;  2ZBK B;  3I4Y A;  4JV5 M;  4FVM A;  2F5Q A;  2UXC M;  4DV0 M;  4FW9 A;  4LF6 M;  8CAT A;  4LRT A;  4GKK M;  3VKG A;  4PDI A;  4GRI A;  3GLH B;  5EXS A;  1QAN A;  4REZ A;  3GLF A;  3U6D A;  1IY0 A;  4AKH A;  1NHG C;  4LJ8 A;  3VLF B;  3L29 A;  5IWA M;  4B7G A;  4S12 A;  3M7G A;  3GPP A;  2HHH M;  4IBI A;  2Y0Q A;  3GLI A;  2F5S A;  3M6A A;  5KO3 A;  3AOE C;  2E5L M;  1NY5 A;  4M9S A;  3KOW E;  1HT1 E;  2XSZ D;  4L8R C;  1NNJ A;  4AG5 A;  3U5Z A;  3GO8 A;  1XC8 A;  5KPT A;  2Z3X A;  3FD9 A;  4NXN M;  4NRV A;  3A42 A;  3ZC7 B;  3GQ5 A;  2UXB M;  5DNY A;  3D8B A;  3J80 S;  2F5O A;  4X65 M;  4LF8 M;  2I7P A;  1IBM M;  4A3V B;  3GP1 A;  1IBL M;  1XNR M;  1NVM A;  1J5E M;  4LF4 M;  3E4R A;  1PJI A;  5JI2 E;  1SXJ A;  5FLX S;  1TGU A;  3J7A S;  3SBJ A;  3IG8 A;  2J7N A;  3OTO M;  2DZN B;  3M0E A;  5C1B A;  3C58 A;  2KRU A;  4DR7 M;  1NHW C;  3KVW A;  3SAW A;  4I4L A;  2R4J A;  3T38 A;  1ZQ9 A;  4FWD A;  3L2A A;  2CV2 A;  1YE9 A;  4B3R M;  2ZAN A;  4MGK E;  4JI5 M;  4L78 A;  1HT2 E;  4OX9 M;  3SAV A;  1XHB A;  4FWG A;  4M9Z A;  1N32 M;  1N78 A;  1OFI A;  3QWL A;  4MGZ E;  3AKZ A;  4YY3 M;  4IBJ A;  4MB7 A;  2QZ4 A;  1ORY B;  4JN6 A;  5FTK A;  3KP1 E;  4M0W A;  4LJA A;  3JR4 A;  4B7H A;  4QNR A;  2KRK A;  3FUX A;  1IN6 A;  4BLC A;  3RGP A;  3HHX A;  1FJG M;  4JYA M;  1IXR C;  3WHL A;  3FYC A;  3J81 S;  3J2P B;  4LFB M;  4IBK A;  5EP3 A;  3HU1 A;  5C18 A;  3A46 A;  2CHV A;  3FKE A;  3U61 B;  2DHR A;  4OVZ B;  1L2C A;  1HNZ M;  3RGS A;  3GRR A;  5EXX A;  1QAM A;  3SHF A;  3LVW A;  4AZF A;  5KPR A;  3ILK A;  4II7 A;  3LQR A;  1XMQ M;  4MGI E;  3EIH A;  2C98 A;  2D7E A;  3HKP A;  3PNV A;  1PM5 A;  3GPX A;  1G8P A;  3GRU A;  1KYI A;  3ZCB B;  3GLH A;  3UK6 A;  1KFV A;  2I7N A;  4NSR A;  1DGH B;  1E9S A;  3CF0 A;  4NOO B;  4LG2 A;  3KS8 A;  2FFJ A;  2XEP A;  4W5W A;  3ZH9 B;  4DR4 M;  2BJV A;  2UU9 M;  4FCT A;  1YSY A;  1G3I A;  4IBC A;  4DR5 M;  1N77 A;  4B3M M;  1QAQ A;  1SXJ E;  4OU7 A;  1EE8 A;  4XBO A;  4KHP M;  3TQS A;  3EIE A;  1J7K A;  3SAU A;  3U6M A;  2C9O A;  1JQJ C;  4LZZ A;  2R46 A;  3SAR A;  4DV2 M;  2CHG A;  4DR2 M;  1IM2 A;  3NBI A;  1XWI A;  3HHZ A;  4LFC M;  4GC9 A;  4IBG A;  1DO2 A;  1L2B A;  3A98 B;  2CE7 A;  4R3D A;  1NJG A;  3PNY A;  1Q3B A;  3VK8 A;  5FTN A;  2ZAO A;  4IBE A;  3FYD A;  2FNA A;  2Q2E B;  4PD2 A;  3U60 A;  3A45 A;  2VQF M;  4DV6 M;  2DWL A;  5IZ7 D;  1R6B X;  3U6L A;  1G59 A;  3SYK A;  1HR0 M;  2L09 A;  2KZS A;  3SFZ A;  3GPU A;  3GLG B;  1QYR A;  4DUZ M;  1K3W A;  1UM8 A;  1E32 A;  5KQD A;  4RF1 A;  3U6Q A;  1OFH A;  4D82 A;  1L2D A;  4CHT B;  4LF5 M;  2UUC M;  3UGJ A;  4TUW A;  1NNU C;  3U6C A;  1Z5B A;  1ZAE A;  2CV0 A;  5IRE B;  1L8Q A;  3GRV A;  3KXE C;  4LF9 M;  4DV5 M;  3AOG A;  3MK6 A;  4LGY A;  1N36 M;  1NY6 A;  3AFH A;  3J27 B;  3U6O A;  1E94 E;  1OJL A;  3T1H M;  2D7G A;  4JI1 M;  1XXH B;  3HU2 A;  4NL4 H;  3FTC A;  4IJF A;  4AKG A;  2BJW A;  2ZAM A;  3SMS A;  4DR3 M;  3UZU A;  4LJ5 A;  2C99 A;  2XZF A;  3DOA A;  2YQZ A;  1PJJ A;  3L27 A;  3FTF A;  2X8A A;  4RNA A;  3K92 A;  1Z5A A;  2YFQ A;  3VFD A;  3BOS A;  4GIP A;  4JI3 M;  1HNX M;  1KSF X;  2CUZ A;  2L6O A;  4CGY B;  1DGG A;  5EP1 A;  1TH4 A;  2M60 A;  3KOY E;  3AOE A;  4JI7 M;  1GKI A;  3VKH A;  2LNH C;  2CFO A;  1GVN A;  2EUC A;  1DGB A;  4PT5 A;  4DV4 M;  4I8O A;  2Z4S A;  5BPV A;  2UUB M;  4B7F A;  1XNQ M;  3I51 A;  1DGH A;  1LV7 A;  2X4A A;  2VQE M;  3GRY A;  3FTE A;  2QBY B;  4ITQ A;  1QAO A;  2L7I A;  1IN7 A;  4AG6 A;  3L25 A;  4K0K M;  4G4O A;  1I4W A;  5ITX A;  2LWX A;  4MGY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...