3J81S

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j81S01
4DR7M 4JI4M 1NNJA 5LMNM 1L1TA 2HKJA 2F5SA 4LF8M 4X62M 4LF5M 4DV7M 3T1YM 5ITXE 2F5QA 1L2BA 2HHHM 3T1HM 4LFAM 3GQ4A 2OQ4A 1I94M 4DR3M 2UUCM 1L2CA 5FLXS 3SATA 3GPPA 1Q39A 2XZUA 2OPFA 4OX9M 5ITQA 1XNQM 3J81S 4B3MM 4DV1M 4CISA 5ITXA 4NRVA 4PDGA 1XMQM 1L2DA 4DR6M 1FJGM 5LMUM 2Q2EB 3U6EA 2F4VM 4JV5M 4JI3M 1Z59A 3A42A 3GO8A 1IBLM 4LF9M 2UXDM 4G4NA 1XMOM 3GPUA 4JI7M 5ITTA 4B3TM 4DV6M 4DV3M 1MX0A 4DV2M 3TWMA 1N36M 1N32M 1KFVA 1HR0M 5ITYA 2UU9M 2UUBM 1N34M 4JI0M 3U6LA 1HNWM 4JI8M 2UUAM 5ITUA 5BR8M 4DUYM 1TDZA 2F5PA 1Q3CA 1L1ZA 1J5EM 2ZM6M 3SAVA 4DV5M 3U6OA 1R2ZA 2UXBM 2ZBKB 1Z5CA 4X65M 4B3RM 4DV0M 2VQFM 3U6MA 1PJJA 4JI5M 3OTOM 1N33M 4K0KM 2VQEM 4JI6M 4DR5M 1R2YA 2F5NA 3C58A 4JYAM 4NRWA 1HNZM 3GQ3A 3GP1A 5ITRA 4LF4M 2EA0A 3GPXA 4NXNM 4LF6M 4GKKM 4JI2M 1TDHA 1HNXM 5A2QS 4DUZM 3JR4A 4GKJM 4LF7M 3A46A 4DR2M 4B3SM 4YHHM 3J80S 2UXCM 4JI1M 3GPYA 4G4OA 3TWLA 2F5OA 1PM5A 4NXMM 4LFCM 1XNRM 4G4RA 4PDIA 3JAMS 3U6SA 3DOAA 3TWKA 5IWAM 4X64M 4DV4M 3JR5A 1PJIA 1IBKM 3U6DA 1K82A 1MU5A 4AQYM 3SAUA 2XZFA 3SARA 3A45A 3U6QA 1K3XA 4DR4M 3GQ5A 5IT9S 3J7AS 4LFBM 1Z5BA 4MB7A 4G4QA 4DR1M 3SAWA 3VK7A 4PD2A 2E5LM 1XC8A 1K3WA 1EE8A 1IBMM 3VK8A 1Z5AA 3SBJA 3SASA 4ITQA 3U6CA 3W0FA 4KHPM 3U6PA 1Q3BA 4YY3M 4PCZA 4X66M
chains in the Genus database with same CATH superfamily
3ZC7B 1C7YA 3W68A 4JI4M 4WURA 2EKFA 1L1TA 1QAMA 3I01M 3KSXA 4XGIA 2V1UA 3KXEC 4AKIA 1NY5A 2Z4RA 2VF8A 3IG8A 1L2BA 2HHHM 4F1IA 1IFYA 4CJ6A 2BJWA 1ORYB 1VG5A 2KNVA 4DR3M 2QENA 4IIWA 5EXSA 4MGYE 3NWLA 3THGA 3GPPA 4L8RC 1IQPA 3GRYA 4MM3B 4IBIA 5ITQA 2M60A 1OIPA 2MH8A 2V1CA 3KOYE 2Z7JA 1EIJA 3NBXX 4I81A 4R3DA 4QOZC 1IXSA 1E9RA 4D80A 4PDGA 5KQDA 2JY6B 4OU7A 4Z6YA 3U61A 4IJEA 1FJGM 1GKIA 3KW6A 4FWHA 2JA2A 3GLIB 3U6EA 1OAIA 2F4VM 1SXJB 2L6OA 4JI3M 1XB2B 3GO8A 1IBLM 4GHLA 4LF9M 4G4NA 1NY6A 1X37A 2L7HA 2C9OA 2DZLA 2LVOC 1GJTA 1IN4A 1XXHA 2RKOA 1IN5A 3D8BA 4IBEA 1GL6A 1T6OA 2LTUA 3GLGE 1N32M 1HR0M 3KSJA 4G6ZA 1NJFA 3GRRA 1GVNA 4A3VB 1HNWM 3R8FA 2R62A 1YE9A 1IN7A 2UUAM 4JI8M 5ITUA 4AKHA 4L16A 3AOEA 3VFDA 3FD9A 2ZANA 3QYEA 1GLNA 1JQJC 5EXTA 2ZM6M 1J5EM 1L1ZA 4W5WA 3KFUG 3LQQA 5E6JA 2VQFM 3KP1E 4GC5A 1PJJA 3H4JA 4K0KM 1G3IA 4JN6A 1QAQA 2OOAA 2JXNA 2VQEM 1WGNA 2M5ZA 3GLHE 4LY6A 3GLIE 4DR5M 3U5ZB 1R2YA 2F5NA 3GQ3A 1JR3E 2JNHA 3GP1A 4LF4M 4LF6M 3V76A 3KVWA 3Q8XA 3GPXA 4GKKM 4AG5A 1IY0A 1HNXM 5A2QS 1NO1A 1ZAEA 4DUZM 3JR4A 3B7QA 2GQFA 3A46A 4NSOB 2DWMA 2CUZA 1IXRC 4YHHM 2UXCM 3HZJA 3GPYA 3MJ5A 3TWLA 2KRUA 2QSFX 7CATA 2F5OA 3FTCA 3SC3A 3BBZA 4QNRA 3SYLA 4LFCM 3AV0A 4GRIA 2CHQA 5KQ8A 1R7RA 3L29A 2MROB 1W5TA 4RKUF 4IBBA 1DV0A 1NHWC 3TWKA 4DV4M 3JR5A 4HLQA 3GLHA 3WHKA 3FUUA 2DKLA 3B9PA 3K2LA 3B7NA 3HHWA 1G4AE 3GLHB 4LJ9A 3VDUA 2O5RA 1D0LA 2XZFA 3FUWA 3U6QA 4OW0A 1V33A 2ZTCA 1SG9A 1DGGA 3AFHA 3KP0E 1NSFA 2K0BX 2C99A 4IBGA 4G3OA 3HU2A 1AUAA 2MR9A 2H5XA 3TL4X 4L6V6 5KPZA 2CHVA 3RFWA 3SASA 3QYBA 1XXHE 1G71A 1GJSA 3GLGA 4YY3M 3J80S 4X66M 4DR7M 2MGWA 1NNJA 5DYIA 5DNYA 4B08A 3FRHA 3L25A 2LH0A 2RGHA 1VQ1A 4FCWA 5EXXA 1WR1B 1IY1A 4CIZA 2JZ1A 4IBCA 3U5ZA 3FTDA 1HQCA 1I4WA 1RU3A 2DAGA 4CHTB 4LFAM 3GQ4A 3L26A 5H37D 4GC9A 1QZEA 3HGIA 1L2CA 2UUCM 5FLXS 2JWSA 3GRUA 1QDTA 4B7FA 2CHGA 1TH3A 4R7GA 4LGYA 2EJSA 3J81S 4B3MM 1HJPA 2R46A 3E9SA 5KPTA 4AG6A 1ZMWA 3KOZE 3RGPA 1ZMVA 3BOSA 1VDDA 2LNHC 3UGJA 2KZSA 4MGHA 4I4LA 3IG5A 3A42A 2QPAA 3KS4A 2DWLA 2BWBA 2KHHA 1D0KA 2FH0A 4LJ7A 3SHGB 1TGUA 4JI7M 2OO9A 3UMMA 4GHAA 3CF0A 3F92A 3FTFA 2FS1A 2JUJA 2LVQD 1MX0A 2QNJA 8CATA 1N36M 1W5SA 2LWXA 2R65A 3GLFB 1E94E 2EO2A 3CF6E 4M0WA 2DHRA 5ITYA 2UU9M 1G41A 1T43A 2UUBM 3CTWB 2K6BA 2QZ4A 2DVWB 2Y20A 4Z8XA 1V34A 4FWDA 5BR8M 4F2LA 1ZMUA 2HCBA 4XK8F 1Q02A 1OIZA 1KSFX 4DUYM 2YFQA 3VKHA 3SAVA 2DNAA 2Y0TA 3CF2A 1Z5CA 3KOWE 1TR8A 2JP7A 4GH9A 4Q7JA 4Y28F 3FTEA 4LJ4A 4EIWA 4BLCA 1IN8A 4MH0E 3DZDA 4B7GA 2X49A 2LVPC 2EA0A 3SHFA 3GLGB 1XWIA 4I8OA 2DWNA 1C1KA 1UFZA 4QHTA 2D7GA 4MGZE 2LHGA 2LVAA 4PT5A 4LF7M 3WHLA 2LXEA 4DR2M 4P17A 1Z6TA 2KNZA 2O01F 2YNMD 4TUWA 1WHCA 3T38A 3SYKA 2O25A 4LZZA 2R4JA 2GNOA 3HJ8A 3HU1A 3IHPA 3T15A 4NXMM 1GL7A 5FSWA 2ZAOA 1WIVA 3HX3A 2X4AA 1XNRM 4PDIA 1XHBA 1GO5A 2FNAA 2FE8A 2QHOB 3W0LB 2G8LA 2K9DA 3AOGA 3DA1A 3HY5A 1MU5A 2AHMA 4OVZA 1D2NA 1E9SA 3SARA 2NQ8C 3A45A 2CE7A 4KT0F 3GQ5A 2CWBA 2XH9A 2KEBA 4MGKE 1E32A 1TH4A 5BPVA 4MB7A 2EKKA 4GEWA 4G4QA 3C3DA 3SAWA 2XF3A 4PD2A 4ZPXA 1BVSA 2L09A 4AW4A 4GMQA 4L15A 3GLFA 2J5YA 2JY8A 4S12A 1EE8A 2HL7A 1P3QQ 3E46A 3M6AA 3U60B 2L2DA 3W0FA 1QUSA 3L27A 5EP2A 1R5LA 4M9ZA 1HT2E 4KO8A 5EP4A 4PCZA 1N78A 1PJSA 1DO0A 5LMNM 2HWJA 2HKJA 3D8LA 5FTKA 4LCBA 4LF5M 1YLAA 3CGWA 4NOOB 5EP3A 3T1YM 4ANRA 1WJ7A 2DI0A 5EP1A 3T1HM 4LRTA 2LVNC 3M7GA 1I94M 3LVWA 3K9OA 3HHZA 1VDLA 2CV2A 1YSYA 3SATA 2Z8YM 4GIPA 1Q39A 2OPFA 4OX9M 3BXWA 1Y8GA 2ERCA 2CEAA 2FOIC 5ITXA 4NRVA 1VEGA 3UK6A 3PXGA 1QANA 5GKNA 2KXEA 4FW9A 4AI6A 5LMUM 2R18A 1D0MA 4GITA 2N35A 4JV5M 3L2AA 1H6UA 3EIHA 1N77A 2DENA 3FRIA 4R71A 3HHXA 4B3TM 3ZH9B 3HJSA 2CV0A 3TWMA 1L8QA 3VDPA 2ZAMA 1AIPC 1KFVA 2C9CA 3DFZA 4WW0A 1ZV1A 2D7HA 2Z3XA 2JY7A 1N34M 3HKPA 1DO2A 2KNAA 4FWGA 5IREB 1DGBA 1OQYA 4LJ6A 1IXZA 1TDZA 3LW5F 4KODA 1Q3CA 4LZJA 1NNUC 4RNAA 3KOXE 3L28A 3K1JA 4D81A 1R2ZA 3ILKA 2ZBKB 4X65M 4DV0M 2K47A 2R44A 1A5TA 3U6MA 4JI5M 2A5YB 2XEPA 1HQYE 2OOBA 2Z4SA 1N33M 3J2PB 1JB0F 4JI6M 3U60A 3FUTA 4JYAM 3QAUA 1HNZM 2B3TA 3AJIB 4LJ8A 4NXNM 3GLFE 1QYRA 4REZA 2DWZB 2KRKA 1HT1E 3HU3A 4L4UA 4IBJA 4NC6A 2XSZA 3M0EA 2XSZD 3MHVC 1G59A 5FTJA 1MJGM 2DAIA 2C96A 4G4OA 2C98A 3QWLA 2KZUA 3J7BA 2QQ8A 5KO3A 2L4FA 5EJCA 4QHSA 2XFSA 5C1BA 2DAKA 1J7KA 2YR0A 3KDSE 4OVZB 5C18A 2L4EA 4RF1A 3DOAA 4X64M 4FD2A 4NSRA 5EQTA 1PJTA 2DAEA 2WSEF 3U6DA 1N75A 4FVMA 1VEJA 3I4VA 1TTEA 3E4RA 2XFTA 4NL4H 5L8RF 1NHGC 1K3XA 3B74A 5IT9S 2Y0QA 1TF0B 3IECA 3J7AS 4LFBM 5DFLA 1Z5BA 5DYGA 3FUVA 5KPRA 4HL4A 1NV9A 3VK7A 3I04M 3AL0C 5EXPA 4WP2A 3SMPA 2RGOA 4LJAA 3ZQJA 2KA6B 4AKGA 1DGFA 2C5RA 2R0IA 1IBMM 2L7IA 3RE8A 2G3QA 2DZOB 3AOEC 4RF0A 3W67A 3SBJA 3MMPA 3U6CA 1NVMA 2J7OA 4ITQA 3VLFB 1Q3BA 2R6FA 1QDRA 1QZMA 4DV1M 1T3TA 1XC8A 1OFIA 2DXIA 2F5SA 1TH2A 4LF8M 4X62M 4DV7M 1SXJE 3HWSA 1LV7A 2WSFF 1G8PA 3GRVA 3SMSA 1KYIA 3TPZA 2RRUA 4II7A 5ITXE 2F5QA 4JXJA 2VDBB 1PJQA 1YUBA 2BJVA 4M0DA 5IZ7D 2OQ4A 4XBOA 1S3SA 1MN3A 2R45A 4M9SA 1ZQ9A 2XZUA 2BNKA 1XNQM 3I4YA 1NJGA 2FFJA 4CISA 3UZUA 2LHCA 2LBCA 1XMQM 1L2DA 3FKEA 4DR6M 1WGLA 2Q2EB 1DGHB 2KW0A 4IBKA 4I5SA 4D82A 1OKSA 1R6BX 1OTRA 3FYDA 4IJFA 3AKZA 1Z59A 2QBYA 1DGHA 1OFHA 1QAOA 3EIEA 2EUCA 3UJNA 2UXDM 1XMOM 3K92A 3PFIA 1JR3A 3LCVB 1SXJA 2APLA 2R4EA 4L78A 5ITTA 3GPUA 2QBYB 2JY5A 4DV6M 4DV3M 3E21A 3A98B 4DV2M 1GABA 2QCUA 3FE3A 3ZCBB 1QVRA 1R4GA 2MJ5B 4LRSA 4QNMA 4JI0M 3U6LA 3RGSA 3LQRA 1QQWA 2ZTDA 2X8AA 3K9PA 2P5TA 3H4MA 3PNVA 3LCUA 5E26A 4DV5M 3U6OA 1IY2A 4MGIE 2BWEA 2UXBM 1WXQA 4B3RM 1LTMA 3B7ZA 2D7EA 4FCVA 4KLNA 3KS8A 2VIIA 2WSCF 3OTOM 2I7NA 2W82A 3J27B 3MK6A 1IM2A 4IBDA 2DAMA 3C58A 4NRWA 3VKGA 3C9PA 2YQZA 5ITRA 2DZNB 3LVVA 4JI2M 1UM8A 2HAKA 1TDHA 3K8ZA 3TQSA 3R9XB 4GKJM 5FTNA 4LJ5A 3Q8GA 2CP8A 4B3SM 1IXSB 4LGMA 5JI3E 2JZ0A 1OJLA 1CUKA 2H1RA 3I51A 4JI1M 1NV8A 2J7NA 3HJQA 4BB9A 1IN6A 4FCTA 2WZJA 1PM5A 3LMMA 2VF7A 2XGNA 1FNNA 3TE6A 1VEKA 1SXJC 3NBIA 1V92A 3PNYA 4G4RA 3HHYA 1QUTA 3SFZA 3JAMS 3U6SA 1XXHB 4HEOA 5IWAM 1PJIA 2CV1A 4BBAA 1IBKM 2V6ZM 4QOSA 3FUXA 4LG2A 2G5GX 1K82A 2DHYA 4AQYM 2CRUA 1PRBA 3SAUA 3PVSA 4P16A 5FTLA 4DR4M 4CGYB 4DBGB 1J09A 2I7PA 3B89A 1OAOC 3FYCA 2CFOA 2KDLA 3U61B 4DR1M 2F5PA 3C3EA 3GLIA 2E5LM 1F4IA 1JR3D 3T6PA 1SXJD 2XLJA 1EFUB 4B7HA 5FTMA 1K3WA 4UN2B 3VK8A 1Z5AA 2QP9X 1PGYA 4M9XA 5F3WA 4KHPM 3U6PA 2Y21A 4IBFA 4AZFA 5JI2E
chains in the Genus database with same CATH topology
3ZC7B 4JI4M 4WURA 1L1TA 1QAMA 3KSXA 4XGIA 2V1UA 3KXEC 1NY5A 2Z4RA 3IG8A 1L2BA 2HHHM 2BJWA 1ORYB 4DR3M 2QENA 4IIWA 5EXSA 4MGYE 3NWLA 3THGA 3GPPA 4L8RC 1IQPA 3GRYA 4MM3B 4IBIA 5ITQA 2M60A 2V1CA 3KOYE 2Z7JA 4I81A 4R3DA 4QOZC 4AKIA 4D80A 1E9RA 4PDGA 5KQDA 4OU7A 4Z6YA 3U61A 4IJEA 1FJGM 1GKIA 3KW6A 4FWHA 2JA2A 3GLIB 3U6EA 2F4VM 1SXJB 2L6OA 4JI3M 3GO8A 1IBLM 4GHLA 4LF9M 4G4NA 1NY6A 1X37A 2L7HA 2C9OA 2RKOA 1IN4A 1XXHA 3D8BA 1IN5A 4IBEA 1GL6A 1N32M 1HR0M 3KSJA 4G6ZA 1NJFA 3GRRA 1GVNA 4A3VB 1HNWM 3R8FA 2R62A 1YE9A 1IN7A 2UUAM 4JI8M 5ITUA 4AKHA 4L16A 3AOEA 3VFDA 3FD9A 2ZANA 1L1ZA 1GLNA 1JQJC 5EXTA 2ZM6M 1J5EM 2F5PA 4W5WA 3KFUG 3LQQA 5E6JA 2VQFM 3KP1E 4GC5A 1PJJA 4K0KM 1G3IA 4JN6A 1QAQA 3U5ZB 2VQEM 2M5ZA 4LY6A 4DR5M 1R2YA 2F5NA 3GQ3A 3GP1A 4LF4M 4LF6M 4GKKM 3GPXA 3KVWA 3Q8XA 4AG5A 1IY0A 1HNXM 5A2QS 1ZAEA 4DUZM 3JR4A 3A46A 4NSOB 2DWMA 2CUZA 1IXRC 4YHHM 2UXCM 3GPYA 3MJ5A 3TWLA 2KRUA 7CATA 2F5OA 3FTCA 3SC3A 4QNRA 3SYLA 4LFCM 3AV0A 4GRIA 2CHQA 5KQ8A 1R7RA 3L29A 1W5TA 4IBBA 1NHWC 3TWKA 4DV4M 3JR5A 4HLQA 3GLHA 3WHKA 3FUUA 3B9PA 3K2LA 3HHWA 1G4AE 3GLHB 4LJ9A 3VDUA 2O5RA 2XZFA 3FUWA 3U6QA 4OW0A 1DGGA 3AFHA 3KP0E 1NSFA 2C99A 4IBGA 3HU2A 3TL4X 5KPZA 2CHVA 3RFWA 3SASA 3GLGA 4YY3M 3J80S 4X66M 4DR7M 1NNJA 5DYIA 5DNYA 4B08A 3L25A 2LH0A 2RGHA 4FCWA 5EXXA 1IY1A 4IBCA 3U5ZA 3FTDA 1HQCA 1I4WA 4CHTB 4LFAM 3GQ4A 3L26A 5H37D 4GC9A 3HGIA 1L2CA 2UUCM 5FLXS 3GRUA 4B7FA 2CHGA 1TH3A 4R7GA 4LGYA 3J81S 4B3MM 2R46A 3E9SA 5KPTA 4AG6A 3KOZE 3RGPA 3BOSA 1VDDA 2LNHC 3UGJA 2KZSA 4MGHA 4I4LA 3IG5A 3A42A 2QPAA 3KS4A 2DWLA 4LJ7A 3SHGB 1TGUA 4JI7M 3UMMA 4GHAA 3CF0A 3FTFA 8CATA 1MX0A 1N36M 1W5SA 2LWXA 2R65A 3GLFB 1E94E 2EO2A 3CF6E 4M0WA 2DHRA 5ITYA 2UU9M 1G41A 2UUBM 3CTWB 2QZ4A 2DVWB 2Y20A 4Z8XA 4FWDA 5BR8M 2HCBA 4DUYM 1KSFX 2YFQA 3VKHA 3SAVA 2Y0TA 3CF2A 1Z5CA 3KOWE 4GH9A 3FTEA 4LJ4A 4EIWA 4BLCA 1IN8A 4MH0E 3DZDA 4B7GA 2X49A 2EA0A 3SHFA 3GLGB 1XWIA 4I8OA 2DWNA 1C1KA 4QHTA 2D7GA 4MGZE 4PT5A 4LF7M 3WHLA 2LXEA 4DR2M 1Z6TA 2YNMD 4TUWA 3T38A 3SYKA 4LZZA 2R4JA 3HJ8A 3HU1A 3T15A 4NXMM 1GL7A 5FSWA 2ZAOA 2X4AA 1XNRM 4PDIA 1XHBA 2FNAA 2FE8A 3W0LB 2G8LA 3AOGA 3DA1A 1MU5A 2AHMA 4OVZA 1D2NA 1E9SA 3SARA 2NQ8C 3A45A 2CE7A 3GQ5A 4MGKE 2XH9A 2KEBA 1E32A 1TH4A 5BPVA 4MB7A 4G4QA 3SAWA 2XF3A 4PD2A 4ZPXA 2L09A 4AW4A 4GMQA 4L15A 3GLFA 4S12A 1EE8A 2HL7A 3M6AA 3U60B 3W0FA 3L27A 5EP2A 4M9ZA 1HT2E 4KO8A 5EP4A 4PCZA 1N78A 1DO0A 5LMNM 3D8LA 2HKJA 5FTKA 4LCBA 4LF5M 4NOOB 5EP3A 3T1YM 5EP1A 3T1HM 4LRTA 3M7GA 1I94M 3LVWA 3HHZA 2CV2A 1YSYA 3SATA 4GIPA 1Q39A 2OPFA 4OX9M 2ERCA 2CEAA 2FOIC 5ITXA 4NRVA 3UK6A 3PXGA 1QANA 5GKNA 2KXEA 4FW9A 4AI6A 5LMUM 2R18A 4GITA 4JV5M 3L2AA 1H6UA 3EIHA 1N77A 3HHXA 4B3TM 3ZH9B 3HJSA 2CV0A 3TWMA 1L8QA 3VDPA 2ZAMA 1KFVA 2C9CA 3DFZA 4WW0A 2D7HA 2Z3XA 1N34M 3HKPA 1DO2A 4FWGA 5IREB 1DGBA 4LJ6A 1IXZA 1TDZA 4KODA 4LZJA 1Q3CA 4RNAA 1NNUC 4D81A 3KOXE 3L28A 3K1JA 1R2ZA 3ILKA 2ZBKB 4X65M 4DV0M 2K47A 3U6MA 4JI5M 2A5YB 2XEPA 1HQYE 2Z4SA 1N33M 3J2PB 4JI6M 3U60A 3FUTA 4JYAM 3QAUA 1HNZM 3AJIB 4LJ8A 4NXNM 1QYRA 4REZA 2DWZB 2KRKA 1HT1E 3HU3A 4L4UA 4IBJA 2XSZA 3M0EA 2XSZD 3MHVC 1G59A 5FTJA 2C96A 4G4OA 2C98A 3QWLA 2KZUA 3J7BA 5KO3A 5EJCA 4QHSA 2XFSA 5C1BA 1J7KA 2YR0A 3KDSE 4OVZB 5C18A 4RF1A 3DOAA 4X64M 4FD2A 4NSRA 5EQTA 3U6DA 1N75A 4FVMA 3I4VA 3E4RA 2XFTA 4NL4H 1NHGC 1K3XA 5IT9S 2Y0QA 3J7AS 4LFBM 1Z5BA 5DYGA 3FUVA 5KPRA 4HL4A 3VK7A 3AL0C 5EXPA 3SMPA 2RGOA 4LJAA 2KA6B 4AKGA 1DGFA 2C5RA 1IBMM 2L7IA 3RE8A 3SBJA 2DZOB 3AOEC 4RF0A 4ITQA 3U6CA 1NVMA 2J7OA 3VLFB 1Q3BA 4DV1M 1QZMA 1XC8A 1T3TA 1OFIA 2DXIA 2F5SA 1TH2A 4LF8M 4X62M 4DV7M 1SXJE 3HWSA 1LV7A 1G8PA 3GRVA 3SMSA 1KYIA 3TPZA 4II7A 5ITXE 2F5QA 4JXJA 1YUBA 4M0DA 2BJVA 5IZ7D 2OQ4A 4XBOA 1S3SA 2R45A 4M9SA 1ZQ9A 2XZUA 2BNKA 1XNQM 3I4YA 1NJGA 2FFJA 4CISA 3UZUA 1L2DA 1XMQM 3FKEA 4DR6M 2Q2EB 1DGHB 2KW0A 4IBKA 4I5SA 4D82A 1R6BX 3FYDA 4IJFA 3AKZA 1Z59A 2QBYA 1DGHA 1OFHA 1QAOA 3EIEA 2EUCA 3UJNA 2UXDM 1XMOM 3K92A 3PFIA 1JR3A 3GPUA 1SXJA 2R4EA 4L78A 2QBYB 5ITTA 4DV6M 4DV3M 3A98B 4DV2M 2QCUA 3ZCBB 1QVRA 4LRSA 4QNMA 4JI0M 3U6LA 3RGSA 3LQRA 1QQWA 2X8AA 2P5TA 3H4MA 3PNVA 5E26A 4DV5M 3U6OA 1IY2A 4MGIE 2UXBM 1WXQA 4B3RM 2D7EA 4FCVA 4KLNA 3KS8A 2VIIA 3OTOM 2I7NA 2W82A 3J27B 3MK6A 1IM2A 4IBDA 3C58A 4NRWA 3VKGA 2YQZA 5ITRA 2DZNB 3LVVA 4JI2M 1UM8A 1TDHA 3K8ZA 3TQSA 3R9XB 4GKJM 5FTNA 4LJ5A 4B3SM 1IXSB 4LGMA 5JI3E 3I51A 1OJLA 2H1RA 4JI1M 2J7NA 3HJQA 4BB9A 1IN6A 4FCTA 1PM5A 3LMMA 2XGNA 1FNNA 3TE6A 1SXJC 3NBIA 4G4RA 3PNYA 3HHYA 3SFZA 3JAMS 3U6SA 1XXHB 5IWAM 1PJIA 2CV1A 4BBAA 1IBKM 2V6ZM 4QOSA 3FUXA 4LG2A 2G5GX 1K82A 4AQYM 3SAUA 3PVSA 4P16A 5FTLA 4DR4M 4CGYB 1J09A 2I7PA 3FYCA 2CFOA 3U61B 4DR1M 3GLIA 2E5LM 1JR3D 2XLJA 1SXJD 4B7HA 5FTMA 1K3WA 3VK8A 1Z5AA 2QP9X 4M9XA 5F3WA 4KHPM 3U6PA 2Y21A 4IBFA 4AZFA 5JI2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 M;  4JI4 M;  1NNJ A;  5LMN M;  1L1T A;  2HKJ A;  2F5S A;  4LF8 M;  4X62 M;  4LF5 M;  4DV7 M;  3T1Y M;  5ITX E;  2F5Q A;  1L2B A;  2HHH M;  3T1H M;  4LFA M;  3GQ4 A;  2OQ4 A;  1I94 M;  4DR3 M;  2UUC M;  1L2C A;  5FLX S;  3SAT A;  3GPP A;  1Q39 A;  2XZU A;  2OPF A;  4OX9 M;  5ITQ A;  1XNQ M;  3J81 S;  4B3M M;  4DV1 M;  4CIS A;  5ITX A;  4NRV A;  4PDG A;  1XMQ M;  1L2D A;  4DR6 M;  1FJG M;  5LMU M;  2Q2E B;  3U6E A;  2F4V M;  4JV5 M;  4JI3 M;  1Z59 A;  3A42 A;  3GO8 A;  1IBL M;  4LF9 M;  2UXD M;  4G4N A;  1XMO M;  3GPU A;  4JI7 M;  5ITT A;  4B3T M;  4DV6 M;  4DV3 M;  1MX0 A;  4DV2 M;  3TWM A;  1N36 M;  1N32 M;  1KFV A;  1HR0 M;  5ITY A;  2UU9 M;  2UUB M;  1N34 M;  4JI0 M;  3U6L A;  1HNW M;  4JI8 M;  2UUA M;  5ITU A;  5BR8 M;  4DUY M;  1TDZ A;  2F5P A;  1Q3C A;  1L1Z A;  1J5E M;  2ZM6 M;  3SAV A;  4DV5 M;  3U6O A;  1R2Z A;  2UXB M;  2ZBK B;  1Z5C A;  4X65 M;  4B3R M;  4DV0 M;  2VQF M;  3U6M A;  1PJJ A;  4JI5 M;  3OTO M;  1N33 M;  4K0K M;  2VQE M;  4JI6 M;  4DR5 M;  1R2Y A;  2F5N A;  3C58 A;  4JYA M;  4NRW A;  1HNZ M;  3GQ3 A;  3GP1 A;  5ITR A;  4LF4 M;  2EA0 A;  3GPX A;  4NXN M;  4LF6 M;  4GKK M;  4JI2 M;  1TDH A;  1HNX M;  5A2Q S;  4DUZ M;  3JR4 A;  4GKJ M;  4LF7 M;  3A46 A;  4DR2 M;  4B3S M;  4YHH M;  3J80 S;  2UXC M;  4JI1 M;  3GPY A;  4G4O A;  3TWL A;  2F5O A;  1PM5 A;  4NXM M;  4LFC M;  1XNR M;  4G4R A;  4PDI A;  3JAM S;  3U6S A;  3DOA A;  3TWK A;  5IWA M;  4X64 M;  4DV4 M;  3JR5 A;  1PJI A;  1IBK M;  3U6D A;  1K82 A;  1MU5 A;  4AQY M;  3SAU A;  2XZF A;  3SAR A;  3A45 A;  3U6Q A;  1K3X A;  4DR4 M;  3GQ5 A;  5IT9 S;  3J7A S;  4LFB M;  1Z5B A;  4MB7 A;  4G4Q A;  4DR1 M;  3SAW A;  3VK7 A;  4PD2 A;  2E5L M;  1XC8 A;  1K3W A;  1EE8 A;  1IBM M;  3VK8 A;  1Z5A A;  3SBJ A;  3SAS A;  4ITQ A;  3U6C A;  3W0F A;  4KHP M;  3U6P A;  1Q3B A;  4YY3 M;  4PCZ A;  4X66 M; 
#chains in the Genus database with same CATH topology
 3ZC7 B;  1C7Y A;  3W68 A;  4JI4 M;  4WUR A;  2EKF A;  1L1T A;  1QAM A;  3I01 M;  3KSX A;  4XGI A;  2V1U A;  3KXE C;  4AKI A;  1NY5 A;  2Z4R A;  2VF8 A;  3IG8 A;  1L2B A;  2HHH M;  4F1I A;  1IFY A;  4CJ6 A;  2BJW A;  1ORY B;  1VG5 A;  2KNV A;  4DR3 M;  2QEN A;  4IIW A;  5EXS A;  4MGY E;  3NWL A;  3THG A;  3GPP A;  4L8R C;  1IQP A;  3GRY A;  4MM3 B;  4IBI A;  5ITQ A;  2M60 A;  1OIP A;  2MH8 A;  2V1C A;  3KOY E;  2Z7J A;  1EIJ A;  3NBX X;  4I81 A;  4R3D A;  4QOZ C;  1IXS A;  1E9R A;  4D80 A;  4PDG A;  5KQD A;  2JY6 B;  4OU7 A;  4Z6Y A;  3U61 A;  4IJE A;  1FJG M;  1GKI A;  3KW6 A;  4FWH A;  2JA2 A;  3GLI B;  3U6E A;  1OAI A;  2F4V M;  1SXJ B;  2L6O A;  4JI3 M;  1XB2 B;  3GO8 A;  1IBL M;  4GHL A;  4LF9 M;  4G4N A;  1NY6 A;  1X37 A;  2L7H A;  2C9O A;  2DZL A;  2LVO C;  1GJT A;  1IN4 A;  1XXH A;  2RKO A;  1IN5 A;  3D8B A;  4IBE A;  1GL6 A;  1T6O A;  2LTU A;  3GLG E;  1N32 M;  1HR0 M;  3KSJ A;  4G6Z A;  1NJF A;  3GRR A;  1GVN A;  4A3V B;  1HNW M;  3R8F A;  2R62 A;  1YE9 A;  1IN7 A;  2UUA M;  4JI8 M;  5ITU A;  4AKH A;  4L16 A;  3AOE A;  3VFD A;  3FD9 A;  2ZAN A;  3QYE A;  1GLN A;  1JQJ C;  5EXT A;  2ZM6 M;  1J5E M;  1L1Z A;  4W5W A;  3KFU G;  3LQQ A;  5E6J A;  2VQF M;  3KP1 E;  4GC5 A;  1PJJ A;  3H4J A;  4K0K M;  1G3I A;  4JN6 A;  1QAQ A;  2OOA A;  2JXN A;  2VQE M;  1WGN A;  2M5Z A;  3GLH E;  4LY6 A;  3GLI E;  4DR5 M;  3U5Z B;  1R2Y A;  2F5N A;  3GQ3 A;  1JR3 E;  2JNH A;  3GP1 A;  4LF4 M;  4LF6 M;  3V76 A;  3KVW A;  3Q8X A;  3GPX A;  4GKK M;  4AG5 A;  1IY0 A;  1HNX M;  5A2Q S;  1NO1 A;  1ZAE A;  4DUZ M;  3JR4 A;  3B7Q A;  2GQF A;  3A46 A;  4NSO B;  2DWM A;  2CUZ A;  1IXR C;  4YHH M;  2UXC M;  3HZJ A;  3GPY A;  3MJ5 A;  3TWL A;  2KRU A;  2QSF X;  7CAT A;  2F5O A;  3FTC A;  3SC3 A;  3BBZ A;  4QNR A;  3SYL A;  4LFC M;  3AV0 A;  4GRI A;  2CHQ A;  5KQ8 A;  1R7R A;  3L29 A;  2MRO B;  1W5T A;  4RKU F;  4IBB A;  1DV0 A;  1NHW C;  3TWK A;  4DV4 M;  3JR5 A;  4HLQ A;  3GLH A;  3WHK A;  3FUU A;  2DKL A;  3B9P A;  3K2L A;  3B7N A;  3HHW A;  1G4A E;  3GLH B;  4LJ9 A;  3VDU A;  2O5R A;  1D0L A;  2XZF A;  3FUW A;  3U6Q A;  4OW0 A;  1V33 A;  2ZTC A;  1SG9 A;  1DGG A;  3AFH A;  3KP0 E;  1NSF A;  2K0B X;  2C99 A;  4IBG A;  4G3O A;  3HU2 A;  1AUA A;  2MR9 A;  2H5X A;  3TL4 X;  4L6V 6;  5KPZ A;  2CHV A;  3RFW A;  3SAS A;  3QYB A;  1XXH E;  1G71 A;  1GJS A;  3GLG A;  4YY3 M;  3J80 S;  4X66 M;  4DR7 M;  2MGW A;  1NNJ A;  5DYI A;  5DNY A;  4B08 A;  3FRH A;  3L25 A;  2LH0 A;  2RGH A;  1VQ1 A;  4FCW A;  5EXX A;  1WR1 B;  1IY1 A;  4CIZ A;  2JZ1 A;  4IBC A;  3U5Z A;  3FTD A;  1HQC A;  1I4W A;  1RU3 A;  2DAG A;  4CHT B;  4LFA M;  3GQ4 A;  3L26 A;  5H37 D;  4GC9 A;  1QZE A;  3HGI A;  1L2C A;  2UUC M;  5FLX S;  2JWS A;  3GRU A;  1QDT A;  4B7F A;  2CHG A;  1TH3 A;  4R7G A;  4LGY A;  2EJS A;  3J81 S;  4B3M M;  1HJP A;  2R46 A;  3E9S A;  5KPT A;  4AG6 A;  1ZMW A;  3KOZ E;  3RGP A;  1ZMV A;  3BOS A;  1VDD A;  2LNH C;  3UGJ A;  2KZS A;  4MGH A;  4I4L A;  3IG5 A;  3A42 A;  2QPA A;  3KS4 A;  2DWL A;  2BWB A;  2KHH A;  1D0K A;  2FH0 A;  4LJ7 A;  3SHG B;  1TGU A;  4JI7 M;  2OO9 A;  3UMM A;  4GHA A;  3CF0 A;  3F92 A;  3FTF A;  2FS1 A;  2JUJ A;  2LVQ D;  1MX0 A;  2QNJ A;  8CAT A;  1N36 M;  1W5S A;  2LWX A;  2R65 A;  3GLF B;  1E94 E;  2EO2 A;  3CF6 E;  4M0W A;  2DHR A;  5ITY A;  2UU9 M;  1G41 A;  1T43 A;  2UUB M;  3CTW B;  2K6B A;  2QZ4 A;  2DVW B;  2Y20 A;  4Z8X A;  1V34 A;  4FWD A;  5BR8 M;  4F2L A;  1ZMU A;  2HCB A;  4XK8 F;  1Q02 A;  1OIZ A;  1KSF X;  4DUY M;  2YFQ A;  3VKH A;  3SAV A;  2DNA A;  2Y0T A;  3CF2 A;  1Z5C A;  3KOW E;  1TR8 A;  2JP7 A;  4GH9 A;  4Q7J A;  4Y28 F;  3FTE A;  4LJ4 A;  4EIW A;  4BLC A;  1IN8 A;  4MH0 E;  3DZD A;  4B7G A;  2X49 A;  2LVP C;  2EA0 A;  3SHF A;  3GLG B;  1XWI A;  4I8O A;  2DWN A;  1C1K A;  1UFZ A;  4QHT A;  2D7G A;  4MGZ E;  2LHG A;  2LVA A;  4PT5 A;  4LF7 M;  3WHL A;  2LXE A;  4DR2 M;  4P17 A;  1Z6T A;  2KNZ A;  2O01 F;  2YNM D;  4TUW A;  1WHC A;  3T38 A;  3SYK A;  2O25 A;  4LZZ A;  2R4J A;  2GNO A;  3HJ8 A;  3HU1 A;  3IHP A;  3T15 A;  4NXM M;  1GL7 A;  5FSW A;  2ZAO A;  1WIV A;  3HX3 A;  2X4A A;  1XNR M;  4PDI A;  1XHB A;  1GO5 A;  2FNA A;  2FE8 A;  2QHO B;  3W0L B;  2G8L A;  2K9D A;  3AOG A;  3DA1 A;  3HY5 A;  1MU5 A;  2AHM A;  4OVZ A;  1D2N A;  1E9S A;  3SAR A;  2NQ8 C;  3A45 A;  2CE7 A;  4KT0 F;  3GQ5 A;  2CWB A;  2XH9 A;  2KEB A;  4MGK E;  1E32 A;  1TH4 A;  5BPV A;  4MB7 A;  2EKK A;  4GEW A;  4G4Q A;  3C3D A;  3SAW A;  2XF3 A;  4PD2 A;  4ZPX A;  1BVS A;  2L09 A;  4AW4 A;  4GMQ A;  4L15 A;  3GLF A;  2J5Y A;  2JY8 A;  4S12 A;  1EE8 A;  2HL7 A;  1P3Q Q;  3E46 A;  3M6A A;  3U60 B;  2L2D A;  3W0F A;  1QUS A;  3L27 A;  5EP2 A;  1R5L A;  4M9Z A;  1HT2 E;  4KO8 A;  5EP4 A;  4PCZ A;  1N78 A;  1PJS A;  1DO0 A;  5LMN M;  2HWJ A;  2HKJ A;  3D8L A;  5FTK A;  4LCB A;  4LF5 M;  1YLA A;  3CGW A;  4NOO B;  5EP3 A;  3T1Y M;  4ANR A;  1WJ7 A;  2DI0 A;  5EP1 A;  3T1H M;  4LRT A;  2LVN C;  3M7G A;  1I94 M;  3LVW A;  3K9O A;  3HHZ A;  1VDL A;  2CV2 A;  1YSY A;  3SAT A;  2Z8Y M;  4GIP A;  1Q39 A;  2OPF A;  4OX9 M;  3BXW A;  1Y8G A;  2ERC A;  2CEA A;  2FOI C;  5ITX A;  4NRV A;  1VEG A;  3UK6 A;  3PXG A;  1QAN A;  5GKN A;  2KXE A;  4FW9 A;  4AI6 A;  5LMU M;  2R18 A;  1D0M A;  4GIT A;  2N35 A;  4JV5 M;  3L2A A;  1H6U A;  3EIH A;  1N77 A;  2DEN A;  3FRI A;  4R71 A;  3HHX A;  4B3T M;  3ZH9 B;  3HJS A;  2CV0 A;  3TWM A;  1L8Q A;  3VDP A;  2ZAM A;  1AIP C;  1KFV A;  2C9C A;  3DFZ A;  4WW0 A;  1ZV1 A;  2D7H A;  2Z3X A;  2JY7 A;  1N34 M;  3HKP A;  1DO2 A;  2KNA A;  4FWG A;  5IRE B;  1DGB A;  1OQY A;  4LJ6 A;  1IXZ A;  1TDZ A;  3LW5 F;  4KOD A;  1Q3C A;  4LZJ A;  1NNU C;  4RNA A;  3KOX E;  3L28 A;  3K1J A;  4D81 A;  1R2Z A;  3ILK A;  2ZBK B;  4X65 M;  4DV0 M;  2K47 A;  2R44 A;  1A5T A;  3U6M A;  4JI5 M;  2A5Y B;  2XEP A;  1HQY E;  2OOB A;  2Z4S A;  1N33 M;  3J2P B;  1JB0 F;  4JI6 M;  3U60 A;  3FUT A;  4JYA M;  3QAU A;  1HNZ M;  2B3T A;  3AJI B;  4LJ8 A;  4NXN M;  3GLF E;  1QYR A;  4REZ A;  2DWZ B;  2KRK A;  1HT1 E;  3HU3 A;  4L4U A;  4IBJ A;  4NC6 A;  2XSZ A;  3M0E A;  2XSZ D;  3MHV C;  1G59 A;  5FTJ A;  1MJG M;  2DAI A;  2C96 A;  4G4O A;  2C98 A;  3QWL A;  2KZU A;  3J7B A;  2QQ8 A;  5KO3 A;  2L4F A;  5EJC A;  4QHS A;  2XFS A;  5C1B A;  2DAK A;  1J7K A;  2YR0 A;  3KDS E;  4OVZ B;  5C18 A;  2L4E A;  4RF1 A;  3DOA A;  4X64 M;  4FD2 A;  4NSR A;  5EQT A;  1PJT A;  2DAE A;  2WSE F;  3U6D A;  1N75 A;  4FVM A;  1VEJ A;  3I4V A;  1TTE A;  3E4R A;  2XFT A;  4NL4 H;  5L8R F;  1NHG C;  1K3X A;  3B74 A;  5IT9 S;  2Y0Q A;  1TF0 B;  3IEC A;  3J7A S;  4LFB M;  5DFL A;  1Z5B A;  5DYG A;  3FUV A;  5KPR A;  4HL4 A;  1NV9 A;  3VK7 A;  3I04 M;  3AL0 C;  5EXP A;  4WP2 A;  3SMP A;  2RGO A;  4LJA A;  3ZQJ A;  2KA6 B;  4AKG A;  1DGF A;  2C5R A;  2R0I A;  1IBM M;  2L7I A;  3RE8 A;  2G3Q A;  2DZO B;  3AOE C;  4RF0 A;  3W67 A;  3SBJ A;  3MMP A;  3U6C A;  1NVM A;  2J7O A;  4ITQ A;  3VLF B;  1Q3B A;  2R6F A;  1QDR A;  1QZM A;  4DV1 M;  1T3T A;  1XC8 A;  1OFI A;  2DXI A;  2F5S A;  1TH2 A;  4LF8 M;  4X62 M;  4DV7 M;  1SXJ E;  3HWS A;  1LV7 A;  2WSF F;  1G8P A;  3GRV A;  3SMS A;  1KYI A;  3TPZ A;  2RRU A;  4II7 A;  5ITX E;  2F5Q A;  4JXJ A;  2VDB B;  1PJQ A;  1YUB A;  2BJV A;  4M0D A;  5IZ7 D;  2OQ4 A;  4XBO A;  1S3S A;  1MN3 A;  2R45 A;  4M9S A;  1ZQ9 A;  2XZU A;  2BNK A;  1XNQ M;  3I4Y A;  1NJG A;  2FFJ A;  4CIS A;  3UZU A;  2LHC A;  2LBC A;  1XMQ M;  1L2D A;  3FKE A;  4DR6 M;  1WGL A;  2Q2E B;  1DGH B;  2KW0 A;  4IBK A;  4I5S A;  4D82 A;  1OKS A;  1R6B X;  1OTR A;  3FYD A;  4IJF A;  3AKZ A;  1Z59 A;  2QBY A;  1DGH A;  1OFH A;  1QAO A;  3EIE A;  2EUC A;  3UJN A;  2UXD M;  1XMO M;  3K92 A;  3PFI A;  1JR3 A;  3LCV B;  1SXJ A;  2APL A;  2R4E A;  4L78 A;  5ITT A;  3GPU A;  2QBY B;  2JY5 A;  4DV6 M;  4DV3 M;  3E21 A;  3A98 B;  4DV2 M;  1GAB A;  2QCU A;  3FE3 A;  3ZCB B;  1QVR A;  1R4G A;  2MJ5 B;  4LRS A;  4QNM A;  4JI0 M;  3U6L A;  3RGS A;  3LQR A;  1QQW A;  2ZTD A;  2X8A A;  3K9P A;  2P5T A;  3H4M A;  3PNV A;  3LCU A;  5E26 A;  4DV5 M;  3U6O A;  1IY2 A;  4MGI E;  2BWE A;  2UXB M;  1WXQ A;  4B3R M;  1LTM A;  3B7Z A;  2D7E A;  4FCV A;  4KLN A;  3KS8 A;  2VII A;  2WSC F;  3OTO M;  2I7N A;  2W82 A;  3J27 B;  3MK6 A;  1IM2 A;  4IBD A;  2DAM A;  3C58 A;  4NRW A;  3VKG A;  3C9P A;  2YQZ A;  5ITR A;  2DZN B;  3LVV A;  4JI2 M;  1UM8 A;  2HAK A;  1TDH A;  3K8Z A;  3TQS A;  3R9X B;  4GKJ M;  5FTN A;  4LJ5 A;  3Q8G A;  2CP8 A;  4B3S M;  1IXS B;  4LGM A;  5JI3 E;  2JZ0 A;  1OJL A;  1CUK A;  2H1R A;  3I51 A;  4JI1 M;  1NV8 A;  2J7N A;  3HJQ A;  4BB9 A;  1IN6 A;  4FCT A;  2WZJ A;  1PM5 A;  3LMM A;  2VF7 A;  2XGN A;  1FNN A;  3TE6 A;  1VEK A;  1SXJ C;  3NBI A;  1V92 A;  3PNY A;  4G4R A;  3HHY A;  1QUT A;  3SFZ A;  3JAM S;  3U6S A;  1XXH B;  4HEO A;  5IWA M;  1PJI A;  2CV1 A;  4BBA A;  1IBK M;  2V6Z M;  4QOS A;  3FUX A;  4LG2 A;  2G5G X;  1K82 A;  2DHY A;  4AQY M;  2CRU A;  1PRB A;  3SAU A;  3PVS A;  4P16 A;  5FTL A;  4DR4 M;  4CGY B;  4DBG B;  1J09 A;  2I7P A;  3B89 A;  1OAO C;  3FYC A;  2CFO A;  2KDL A;  3U61 B;  4DR1 M;  2F5P A;  3C3E A;  3GLI A;  2E5L M;  1F4I A;  1JR3 D;  3T6P A;  1SXJ D;  2XLJ A;  1EFU B;  4B7H A;  5FTM A;  1K3W A;  4UN2 B;  3VK8 A;  1Z5A A;  2QP9 X;  1PGY A;  4M9X A;  5F3W A;  4KHP M;  3U6P A;  2Y21 A;  4IBF A;  4AZF A;  5JI2 E; 
#chains in the Genus database with same CATH homology
 3ZC7 B;  4JI4 M;  4WUR A;  1L1T A;  1QAM A;  3KSX A;  4XGI A;  2V1U A;  3KXE C;  1NY5 A;  2Z4R A;  3IG8 A;  1L2B A;  2HHH M;  2BJW A;  1ORY B;  4DR3 M;  2QEN A;  4IIW A;  5EXS A;  4MGY E;  3NWL A;  3THG A;  3GPP A;  4L8R C;  1IQP A;  3GRY A;  4MM3 B;  4IBI A;  5ITQ A;  2M60 A;  2V1C A;  3KOY E;  2Z7J A;  4I81 A;  4R3D A;  4QOZ C;  4AKI A;  4D80 A;  1E9R A;  4PDG A;  5KQD A;  4OU7 A;  4Z6Y A;  3U61 A;  4IJE A;  1FJG M;  1GKI A;  3KW6 A;  4FWH A;  2JA2 A;  3GLI B;  3U6E A;  2F4V M;  1SXJ B;  2L6O A;  4JI3 M;  3GO8 A;  1IBL M;  4GHL A;  4LF9 M;  4G4N A;  1NY6 A;  1X37 A;  2L7H A;  2C9O A;  2RKO A;  1IN4 A;  1XXH A;  3D8B A;  1IN5 A;  4IBE A;  1GL6 A;  1N32 M;  1HR0 M;  3KSJ A;  4G6Z A;  1NJF A;  3GRR A;  1GVN A;  4A3V B;  1HNW M;  3R8F A;  2R62 A;  1YE9 A;  1IN7 A;  2UUA M;  4JI8 M;  5ITU A;  4AKH A;  4L16 A;  3AOE A;  3VFD A;  3FD9 A;  2ZAN A;  1L1Z A;  1GLN A;  1JQJ C;  5EXT A;  2ZM6 M;  1J5E M;  2F5P A;  4W5W A;  3KFU G;  3LQQ A;  5E6J A;  2VQF M;  3KP1 E;  4GC5 A;  1PJJ A;  4K0K M;  1G3I A;  4JN6 A;  1QAQ A;  3U5Z B;  2VQE M;  2M5Z A;  4LY6 A;  4DR5 M;  1R2Y A;  2F5N A;  3GQ3 A;  3GP1 A;  4LF4 M;  4LF6 M;  4GKK M;  3GPX A;  3KVW A;  3Q8X A;  4AG5 A;  1IY0 A;  1HNX M;  5A2Q S;  1ZAE A;  4DUZ M;  3JR4 A;  3A46 A;  4NSO B;  2DWM A;  2CUZ A;  1IXR C;  4YHH M;  2UXC M;  3GPY A;  3MJ5 A;  3TWL A;  2KRU A;  7CAT A;  2F5O A;  3FTC A;  3SC3 A;  4QNR A;  3SYL A;  4LFC M;  3AV0 A;  4GRI A;  2CHQ A;  5KQ8 A;  1R7R A;  3L29 A;  1W5T A;  4IBB A;  1NHW C;  3TWK A;  4DV4 M;  3JR5 A;  4HLQ A;  3GLH A;  3WHK A;  3FUU A;  3B9P A;  3K2L A;  3HHW A;  1G4A E;  3GLH B;  4LJ9 A;  3VDU A;  2O5R A;  2XZF A;  3FUW A;  3U6Q A;  4OW0 A;  1DGG A;  3AFH A;  3KP0 E;  1NSF A;  2C99 A;  4IBG A;  3HU2 A;  3TL4 X;  5KPZ A;  2CHV A;  3RFW A;  3SAS A;  3GLG A;  4YY3 M;  3J80 S;  4X66 M;  4DR7 M;  1NNJ A;  5DYI A;  5DNY A;  4B08 A;  3L25 A;  2LH0 A;  2RGH A;  4FCW A;  5EXX A;  1IY1 A;  4IBC A;  3U5Z A;  3FTD A;  1HQC A;  1I4W A;  4CHT B;  4LFA M;  3GQ4 A;  3L26 A;  5H37 D;  4GC9 A;  3HGI A;  1L2C A;  2UUC M;  5FLX S;  3GRU A;  4B7F A;  2CHG A;  1TH3 A;  4R7G A;  4LGY A;  3J81 S;  4B3M M;  2R46 A;  3E9S A;  5KPT A;  4AG6 A;  3KOZ E;  3RGP A;  3BOS A;  1VDD A;  2LNH C;  3UGJ A;  2KZS A;  4MGH A;  4I4L A;  3IG5 A;  3A42 A;  2QPA A;  3KS4 A;  2DWL A;  4LJ7 A;  3SHG B;  1TGU A;  4JI7 M;  3UMM A;  4GHA A;  3CF0 A;  3FTF A;  8CAT A;  1MX0 A;  1N36 M;  1W5S A;  2LWX A;  2R65 A;  3GLF B;  1E94 E;  2EO2 A;  3CF6 E;  4M0W A;  2DHR A;  5ITY A;  2UU9 M;  1G41 A;  2UUB M;  3CTW B;  2QZ4 A;  2DVW B;  2Y20 A;  4Z8X A;  4FWD A;  5BR8 M;  2HCB A;  4DUY M;  1KSF X;  2YFQ A;  3VKH A;  3SAV A;  2Y0T A;  3CF2 A;  1Z5C A;  3KOW E;  4GH9 A;  3FTE A;  4LJ4 A;  4EIW A;  4BLC A;  1IN8 A;  4MH0 E;  3DZD A;  4B7G A;  2X49 A;  2EA0 A;  3SHF A;  3GLG B;  1XWI A;  4I8O A;  2DWN A;  1C1K A;  4QHT A;  2D7G A;  4MGZ E;  4PT5 A;  4LF7 M;  3WHL A;  2LXE A;  4DR2 M;  1Z6T A;  2YNM D;  4TUW A;  3T38 A;  3SYK A;  4LZZ A;  2R4J A;  3HJ8 A;  3HU1 A;  3T15 A;  4NXM M;  1GL7 A;  5FSW A;  2ZAO A;  2X4A A;  1XNR M;  4PDI A;  1XHB A;  2FNA A;  2FE8 A;  3W0L B;  2G8L A;  3AOG A;  3DA1 A;  1MU5 A;  2AHM A;  4OVZ A;  1D2N A;  1E9S A;  3SAR A;  2NQ8 C;  3A45 A;  2CE7 A;  3GQ5 A;  4MGK E;  2XH9 A;  2KEB A;  1E32 A;  1TH4 A;  5BPV A;  4MB7 A;  4G4Q A;  3SAW A;  2XF3 A;  4PD2 A;  4ZPX A;  2L09 A;  4AW4 A;  4GMQ A;  4L15 A;  3GLF A;  4S12 A;  1EE8 A;  2HL7 A;  3M6A A;  3U60 B;  3W0F A;  3L27 A;  5EP2 A;  4M9Z A;  1HT2 E;  4KO8 A;  5EP4 A;  4PCZ A;  1N78 A;  1DO0 A;  5LMN M;  3D8L A;  2HKJ A;  5FTK A;  4LCB A;  4LF5 M;  4NOO B;  5EP3 A;  3T1Y M;  5EP1 A;  3T1H M;  4LRT A;  3M7G A;  1I94 M;  3LVW A;  3HHZ A;  2CV2 A;  1YSY A;  3SAT A;  4GIP A;  1Q39 A;  2OPF A;  4OX9 M;  2ERC A;  2CEA A;  2FOI C;  5ITX A;  4NRV A;  3UK6 A;  3PXG A;  1QAN A;  5GKN A;  2KXE A;  4FW9 A;  4AI6 A;  5LMU M;  2R18 A;  4GIT A;  4JV5 M;  3L2A A;  1H6U A;  3EIH A;  1N77 A;  3HHX A;  4B3T M;  3ZH9 B;  3HJS A;  2CV0 A;  3TWM A;  1L8Q A;  3VDP A;  2ZAM A;  1KFV A;  2C9C A;  3DFZ A;  4WW0 A;  2D7H A;  2Z3X A;  1N34 M;  3HKP A;  1DO2 A;  4FWG A;  5IRE B;  1DGB A;  4LJ6 A;  1IXZ A;  1TDZ A;  4KOD A;  4LZJ A;  1Q3C A;  4RNA A;  1NNU C;  4D81 A;  3KOX E;  3L28 A;  3K1J A;  1R2Z A;  3ILK A;  2ZBK B;  4X65 M;  4DV0 M;  2K47 A;  3U6M A;  4JI5 M;  2A5Y B;  2XEP A;  1HQY E;  2Z4S A;  1N33 M;  3J2P B;  4JI6 M;  3U60 A;  3FUT A;  4JYA M;  3QAU A;  1HNZ M;  3AJI B;  4LJ8 A;  4NXN M;  1QYR A;  4REZ A;  2DWZ B;  2KRK A;  1HT1 E;  3HU3 A;  4L4U A;  4IBJ A;  2XSZ A;  3M0E A;  2XSZ D;  3MHV C;  1G59 A;  5FTJ A;  2C96 A;  4G4O A;  2C98 A;  3QWL A;  2KZU A;  3J7B A;  5KO3 A;  5EJC A;  4QHS A;  2XFS A;  5C1B A;  1J7K A;  2YR0 A;  3KDS E;  4OVZ B;  5C18 A;  4RF1 A;  3DOA A;  4X64 M;  4FD2 A;  4NSR A;  5EQT A;  3U6D A;  1N75 A;  4FVM A;  3I4V A;  3E4R A;  2XFT A;  4NL4 H;  1NHG C;  1K3X A;  5IT9 S;  2Y0Q A;  3J7A S;  4LFB M;  1Z5B A;  5DYG A;  3FUV A;  5KPR A;  4HL4 A;  3VK7 A;  3AL0 C;  5EXP A;  3SMP A;  2RGO A;  4LJA A;  2KA6 B;  4AKG A;  1DGF A;  2C5R A;  1IBM M;  2L7I A;  3RE8 A;  3SBJ A;  2DZO B;  3AOE C;  4RF0 A;  4ITQ A;  3U6C A;  1NVM A;  2J7O A;  3VLF B;  1Q3B A;  4DV1 M;  1QZM A;  1XC8 A;  1T3T A;  1OFI A;  2DXI A;  2F5S A;  1TH2 A;  4LF8 M;  4X62 M;  4DV7 M;  1SXJ E;  3HWS A;  1LV7 A;  1G8P A;  3GRV A;  3SMS A;  1KYI A;  3TPZ A;  4II7 A;  5ITX E;  2F5Q A;  4JXJ A;  1YUB A;  4M0D A;  2BJV A;  5IZ7 D;  2OQ4 A;  4XBO A;  1S3S A;  2R45 A;  4M9S A;  1ZQ9 A;  2XZU A;  2BNK A;  1XNQ M;  3I4Y A;  1NJG A;  2FFJ A;  4CIS A;  3UZU A;  1L2D A;  1XMQ M;  3FKE A;  4DR6 M;  2Q2E B;  1DGH B;  2KW0 A;  4IBK A;  4I5S A;  4D82 A;  1R6B X;  3FYD A;  4IJF A;  3AKZ A;  1Z59 A;  2QBY A;  1DGH A;  1OFH A;  1QAO A;  3EIE A;  2EUC A;  3UJN A;  2UXD M;  1XMO M;  3K92 A;  3PFI A;  1JR3 A;  3GPU A;  1SXJ A;  2R4E A;  4L78 A;  2QBY B;  5ITT A;  4DV6 M;  4DV3 M;  3A98 B;  4DV2 M;  2QCU A;  3ZCB B;  1QVR A;  4LRS A;  4QNM A;  4JI0 M;  3U6L A;  3RGS A;  3LQR A;  1QQW A;  2X8A A;  2P5T A;  3H4M A;  3PNV A;  5E26 A;  4DV5 M;  3U6O A;  1IY2 A;  4MGI E;  2UXB M;  1WXQ A;  4B3R M;  2D7E A;  4FCV A;  4KLN A;  3KS8 A;  2VII A;  3OTO M;  2I7N A;  2W82 A;  3J27 B;  3MK6 A;  1IM2 A;  4IBD A;  3C58 A;  4NRW A;  3VKG A;  2YQZ A;  5ITR A;  2DZN B;  3LVV A;  4JI2 M;  1UM8 A;  1TDH A;  3K8Z A;  3TQS A;  3R9X B;  4GKJ M;  5FTN A;  4LJ5 A;  4B3S M;  1IXS B;  4LGM A;  5JI3 E;  3I51 A;  1OJL A;  2H1R A;  4JI1 M;  2J7N A;  3HJQ A;  4BB9 A;  1IN6 A;  4FCT A;  1PM5 A;  3LMM A;  2XGN A;  1FNN A;  3TE6 A;  1SXJ C;  3NBI A;  4G4R A;  3PNY A;  3HHY A;  3SFZ A;  3JAM S;  3U6S A;  1XXH B;  5IWA M;  1PJI A;  2CV1 A;  4BBA A;  1IBK M;  2V6Z M;  4QOS A;  3FUX A;  4LG2 A;  2G5G X;  1K82 A;  4AQY M;  3SAU A;  3PVS A;  4P16 A;  5FTL A;  4DR4 M;  4CGY B;  1J09 A;  2I7P A;  3FYC A;  2CFO A;  3U61 B;  4DR1 M;  3GLI A;  2E5L M;  1JR3 D;  2XLJ A;  1SXJ D;  4B7H A;  5FTM A;  1K3W A;  3VK8 A;  1Z5A A;  2QP9 X;  4M9X A;  5F3W A;  4KHP M;  3U6P A;  2Y21 A;  4IBF A;  4AZF A;  5JI2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...