3J81S

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
b'SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j81S01
3TWLA 4DR6M 2UUCM 4DV7M 4MB7A 5ITXA 4B3MM 4X65M 2HKJA 4X64M 3C58A 3SARA 3U6CA 4KHPM 1HNZM 3SASA 5IWAM 4G4QA 4NRWA 1Q3CA 3T1YM 1MU5A 1HNWM 4DV6M 3J7AS 4JYAM 4DR7M 4DV0M 3TWMA 2F5SA 1XC8A 2HHHM 1N36M 4LF7M 1IBLM 4DUYM 4JI8M 2UXBM 4NXNM 2ZBKB 3U6OA 4G4OA 3GPPA 5ITQA 4LFAM 4PDIA 3VK8A 3DOAA 4AQYM 3T1HM 3U6QA 1HR0M 2Q2EB 3TWKA 5LMUM 5BR8M 4JI3M 1L1ZA 4JI0M 1R2ZA 4DR3M 2EA0A 2E5LM 4B3TM 5A2QS 3VK7A 1IBKM 3GPUA 4G4NA 1N34M 4B3RM 2VQFM 3SAVA 4DR4M 1Z5AA 3GQ4A 4GKJM 1L1TA 1PJJA 1HNXM 4JI7M 4JI1M 2UUBM 4LF4M 4DR5M 3SAUA 2ZM6M 3J80S 4PD2A 5IT9S 1Z5CA 3JR5A 3U6EA 3A46A 5ITYA 2UU9M 3JR4A 1XNQM 1L2BA 2F5PA 1N32M 4GKKM 4PDGA 1K3WA 4DV4M 2XZUA 1L2CA 4K0KM 1PM5A 4JI4M 4LF5M 1EE8A 4NRVA 4CISA 3JAMS 3SBJA 4JI6M 4LF8M 1Z5BA 3U6DA 1R2YA 4B3SM 4DV2M 2OQ4A 4DV3M 2F5QA 4DV5M 1K82A 3A45A 1K3XA 1XMQM 3GP1A 4YY3M 3W0FA 5ITUA 3U6LA 1NNJA 4ITQA 3OTOM 4LF6M 1I94M 4OX9M 4X66M 4DV1M 3GQ5A 4DR1M 4DR2M 1N33M 4JI5M 4X62M 3U6MA 2UXCM 4YHHM 3GQ3A 1FJGM 1J5EM 5ITRA 2VQEM 2UUAM 3GPXA 1MX0A 3A42A 1Q3BA 2F4VM 4LF9M 2UXDM 4NXMM 5ITXE 1IBMM 5FLXS 1Z59A 2F5NA 5LMNM 1TDZA 3GPYA 5ITTA 1XNRM 4DUZM 1KFVA 1TDHA 4JV5M 2OPFA 3SAWA 1XMOM 1L2DA 4LFBM 3U6PA 2XZFA 4G4RA 3U6SA 1PJIA 3SATA 1Q39A 4JI2M 4PCZA 3J81S 3GO8A 4LFCM 2F5OA
chains in the Genus database with same CATH superfamily
4DR6M 5EP3A 4DV7M 5ITXA 4DBGB 2FNAA 1MJGM 2JY5A 4X64M 2KHHA 2BNKA 2LBCA 3D8LA 2DZOB 4REZA 3SARA 1NVMA 2DENA 3GLGA 1IXRC 3B89A 5KPRA 1HNZM 1NV9A 4G4QA 4BBAA 4L15A 2D7GA 3KSXA 2QPAA 4CIZA 1EFUB 2DHRA 4LCBA 4LJ9A 5IWAM 4DV0M 4A3VB 2F5SA 4DR7M 2XSZA 1OIPA 3E4RA 2ERCA 5IZ7D 3BXWA 4LRSA 1YUBA 1E32A 2EUCA 4MH0E 3J27B 1DO0A 3GPPA 3WHLA 4LFAM 1PRBA 1NY6A 2MH8A 2Z8YM 1TGUA 4PT5A 2L6OA 1DGGA 2YFQA 1MN3A 5LMUM 5BPVA 4NOOB 4JI3M 4JI0M 1R2ZA 4B3TM 1HQYE 1IBKM 3AOEC 3GPUA 2DWZB 4GITA 3FRIA 2FS1A 1J09A 3K9OA 2KW0A 3GQ4A 1OJLA 2CV2A 4JI7M 2UUBM 3SHFA 2N35A 1SG9A 3L27A 1R7RA 3M0EA 4OVZA 4AI6A 1Z5CA 4NSRA 5ITYA 3GRRA 3BOSA 4I81A 1NJFA 2GNOA 3MMPA 1XNQM 2F5PA 2JZ1A 2KNVA 3GLGB 4DV4M 1IXZA 5EXPA 4B7HA 4D82A 4IBJA 1OFHA 4I4LA 4LJ8A 3U60A 3K2LA 1PM5A 2JUJA 2DWNA 1R5LA 3A98B 2VIIA 3KP1E 1D2NA 3W67A 2KXEA 2AHMA 3FTCA 4M9XA 4JI6M 5DYGA 3HGIA 3IECA 3SMSA 3T6PA 5DNYA 4W5WA 2DHYA 3V76A 3HHZA 3NWLA 1TR8A 2APLA 3MHVC 5C18A 2XH9A 1K82A 1C7YA 1K3XA 1QDRA 3E9SA 2L7HA 4LZZA 2WSEF 5EP2A 2Y20A 3IHPA 3HJSA 3U6LA 1QZEA 1NHGC 4LF6M 1WXQA 1OFIA 2XEPA 4XBOA 4X66M 2K9DA 1OAOC 1OIZA 2JP7A 2X8AA 3LQRA 2WSCF 5KO3A 3ZQJA 5FTKA 2R44A 5KPZA 3GQ3A 2JNHA 5EXTA 4IBBA 1J5EM 3B9PA 4RNAA 5ITRA 4BLCA 1XHBA 1MX0A 2KNAA 3HU2A 1YLAA 1NV8A 2UXDM 2WZJA 2OOAA 2KA6B 1N78A 4OVZB 4FWHA 1XNRM 2CFOA 1GABA 3TE6A 1TDHA 1ZMVA 4IJFA 4OU7A 4GIPA 2LVPC 2D7HA 1TF0B 2G8LA 3I04M 1WHCA 5EJCA 3GRUA 5KQDA 4G4RA 3U60B 2CEAA 1JR3D 1PJSA 2D7EA 3AOEA 3H4JA 1TH4A 3UMMA 3GLFE 2MJ5B 4JI2M 3J81S 2K6BA 3AV0A 3GO8A 4G3OA 1WR1B 3Q8XA 3HHYA 4BB9A 3H4MA 3THGA 1E9RA 3HZJA 3T15A 2CHVA 3KOXE 3L28A 4ANRA 2KDLA 1YE9A 2UUCM 3I4YA 1IQPA 1IN6A 1OQYA 2KRKA 2J7NA 1ZAEA 3W68A 3NBIA 1VG5A 1YSYA 3T38A 2R62A 3PVSA 2EO2A 1R4GA 2H5XA 2JWSA 2MGWA 3KDSE 4P17A 4B7GA 2HAKA 3FUXA 3L26A 4DV6M 2Z3XA 3PNVA 2LH0A 3E21A 3KP0E 1XB2B 3LCUA 3F92A 4LZJA 4MGHA 4ZPXA 3TWMA 2HHHM 1VEGA 5KQ8A 1DO2A 2UXBM 4NXNM 4D80A 1V33A 4FWDA 2QENA 2X4AA 2ZBKB 2R0IA 3U6OA 1UM8A 3VKHA 4IBGA 3HJQA 2Z4SA 2I7NA 3ZCBB 4B7FA 3U61A 1HR0M 3DZDA 4MGYE 1NO1A 3FD9A 2CV0A 3CF0A 1Y8GA 3HHWA 1L1ZA 2MR9A 4FW9A 2CE7A 2FOIC 2QQ8A 4G4NA 1IN4A 4KT0F 1E9SA 4JXJA 2JY8A 4R71A 4IBCA 5FTLA 2VQFM 1QAMA 4Q7JA 2R45A 1Q02A 3J80S 2K47A 3ZC7B 5L8RF 5IT9S 3GLHB 4XK8F 1SXJD 3SYLA 3JR5A 3A46A 3U6EA 2RRUA 3JR4A 4AKHA 1XWIA 4FWGA 8CATA 4R7GA 3B7QA 5JI2E 3AL0C 4K0KM 3TPZA 3C3DA 1ZMWA 4JI4M 5GKNA 3PNYA 4GHAA 3KOYE 1PGYA 2O25A 1T6OA 4NRVA 1IY0A 2KNZA 1IY2A 3R8FA 3HY5A 3JAMS 4CJ6A 3SBJA 2QZ4A 1R2YA 1JR3E 3FYDA 4RF0A 2MROB 4AKIA 2OQ4A 2LWXA 3KS4A 3KW6A 2R6FA 2O01F 2W82A 4QNMA 4EIWA 5ITUA 2DAGA 2XLJA 1NNJA 4ITQA 3OTOM 1SXJC 4P16A 3M7GA 3UJNA 4OX9M 3HKPA 3GQ5A 3U61B 2Z4RA 2KZSA 2YNMD 4GEWA 1WGNA 4KLNA 4I5SA 4F2LA 4X62M 2CV1A 4R3DA 1QVRA 2R4EA 2JXNA 2KEBA 2CUZA 1I4WA 2LXEA 2FE8A 3RFWA 1X37A 2QHOB 3GPXA 5F3WA 2UUAM 3HHXA 3FE3A 1T3TA 3A42A 2JY6B 2C9CA 3KS8A 1JR3A 4MGZE 1DGFA 2F4VM 4KO8A 3FKEA 4NC6A 3KFUG 5FTJA 3D8BA 4LY6A 1C1KA 1E94E 1NY5A 1XXHE 2QNJA 3KSJA 4WURA 2LHCA 3ZH9B 4GH9A 3VFDA 2ZANA 4M0WA 2OOBA 4F1IA 1L2DA 4JV5M 3MJ5A 4LFBM 2P5TA 1PJTA 4CHTB 5EXSA 4LJ6A 1V34A 4PCZA 2VF7A 5IREB 4AG5A 3RGSA 1NNUC 4LFCM 5EXXA 4GMQA 2EKKA 1VEKA 4QHTA 3TWLA 3AFHA 3L29A 4MB7A 1TH2A 2K0BX 2HKJA 1XXHA 3LVWA 4Z8XA 4D81A 2YR0A 3HU3A 2Z7JA 1OAIA 1SXJE 1GLNA 4KHPM 5FTNA 4NRWA 4LJ4A 1MU5A 2R4JA 4HLQA 4G6ZA 2R18A 3IG5A 4FCTA 1QAQA 3CF6E 2R46A 3LMMA 3U5ZA 1XC8A 4JYAM 1L8QA 4FCVA 4IIWA 4LF7M 1HQCA 2M60A 2XF3A 4JI8M 5C1BA 4JN6A 2BJVA 1CUKA 4HL4A 2LVAA 4IBEA 4PDIA 2EJSA 4QNRA 3GLIE 3DOAA 1TH3A 1QANA 4HEOA 4AQYM 3VK8A 3U6QA 3QYEA 1GJSA 2I7PA 2R65A 2GQFA 3TWKA 1SXJA 2LHGA 2NQ8C 2QBYA 4DR3M 2EA0A 2E5LM 1NJGA 4GC5A 3VK7A 2LVOC 2DWLA 4B3RM 2DWMA 3KOZE 3SAVA 1AUAA 2DZLA 4MM3B 4WP2A 4DR4M 1Z5AA 2C9OA 2L4EA 3B7NA 4LGYA 1PJJA 4GKJM 3WHKA 1WGLA 1HNXM 1HT2E 3I01M 4LF4M 3SAUA 3IG8A 2ZM6M 3GLFA 3E46A 5JI3E 2C5RA 1WIVA 1VQ1A 4NSOB 2Y0TA 4LG2A 3GLIA 4IBFA 3C3EA 2UU9M 1XXHB 4LGMA 2ZAOA 3EIEA 4XGIA 3RGPA 2DAEA 4B08A 1L2BA 1N32M 1F4IA 1IFYA 1IM2A 3GRYA 2Y0QA 2XZUA 3ILKA 4MGIE 1WJ7A 3L2AA 3I4VA 4LF5M 4M9SA 1IY1A 2H1RA 1JQJC 2RGHA 2WSFF 2DKLA 3W0LB 3U5ZB 4CISA 1IN8A 1HJPA 3FTFA 4QOZC 5DFLA 3KXEC 1GKIA 4DV3M 2CWBA 2VF8A 3FUUA 3GLGE 3LCVB 4I8OA 2F5QA 4DV5M 2HL7A 2XGNA 2G5GX 1A5TA 4FCWA 1G71A 1QAOA 3CGWA 2V1UA 1QUSA 4YY3M 3VKGA 3W0FA 3LQQA 3NBXX 3K9PA 1IN7A 3J2PB 2BWEA 4DR1M 1FNNA 3SC3A 2QCUA 4QHSA 2C96A 4IJEA 4JI5M 4IBDA 1ORYB 3FUVA 4KODA 3U6MA 2UXCM 2CHQA 2QBYB 4YHHM 1ZQ9A 4OW0A 3AJIB 1S3SA 1GVNA 2J7OA 1T43A 2YQZA 4L4UA 4FVMA 3TL4X 2VQEM 1ZMUA 2KRUA 1Q3BA 4L78A 4LF9M 4NXMM 3VDPA 1QUTA 4WW0A 1IBMM 1NSFA 3HWSA 4L8RC 3GLFB 1TDZA 3C9PA 3R9XB 5ITTA 2QSFX 3K92A 1KFVA 1R6BX 2OPFA 1UFZA 1W5SA 3GRVA 4AZFA 4FD2A 3GLIB 4M0DA 4L16A 2ZTDA 3U6PA 1P3QQ 3FUTA 2XFTA 2DAMA 2ZAMA 2B3TA 1PJQA 2JY7A 2LTUA 3SATA 1EIJA 3VLFB 2G3QA 3FTDA 1AIPC 2LVNC 1QDTA 1G41A 4GC9A 2XFSA 2F5OA 1OKSA 4LRTA 4TUWA 1KSFX 1KYIA 2DVWB 4IBKA 3DFZA 4B3MM 4II7A 4X65M 1G8PA 4NL4H 4M9ZA 3VDUA 2L7IA 3C58A 2DXIA 2FH0A 3U6CA 2EKFA 4RKUF 2L09A 3SASA 3I51A 1BVSA 1NHWC 1Q3CA 1W5TA 4QOSA 3T1YM 4AW4A 3AKZA 3J7AS 1HNWM 3B74A 5EQTA 2DAIA 1H6UA 3FYCA 3LW5F 2BWBA 2RKOA 1N36M 2M5ZA 1IBLM 4DUYM 2RGOA 1VEJA 3DA1A 4Y28F 1J7KA 1GL6A 3Q8GA 1D0MA 2L4FA 2LNHC 3B7ZA 3M6AA 2HWJA 5FSWA 5ITQA 4G4OA 4LJAA 2BJWA 5KPTA 2LVQD 1LV7A 4L6V6 1OTRA 3SMPA 3T1HM 5E6JA 7CATA 2Q2EB 3BBZA 5BR8M 1N75A 2XSZD 1Z6TA 4MGKE 1QQWA 1TTEA 3KOWE 5A2QS 1N34M 2FFJA 3CF2A 4UN2B 3SFZA 4GHLA 1L1TA 3HU1A 5DYIA 4JI1M 4DR5M 1GO5A 1G4AE 1IXSA 4PD2A 3KVWA 3HX3A 2V6ZM 3SYKA 1GL7A 2L2DA 1V92A 4AKGA 1ZV1A 3L25A 3SHGB 4GKKM 4PDGA 1K3WA 1L2CA 3AOGA 5EP1A 1DGHA 1G3IA 1GJTA 2VDBB 1JB0F 1EE8A 2CRUA 2KZUA 3GLHE 2A5YB 5E26A 2C98A 3EIHA 2Y21A 3FRHA 2OO9A 3MK6A 3CTWB 1Z5BA 3J7BA 3U6DA 4LF8M 1IN5A 3RE8A 4B3SM 4DV2M 2V1CA 3A45A 2C99A 3PFIA 3PXGA 1XMQM 1G59A 3GP1A 1D0LA 3LVVA 5H37D 3FUWA 1VDLA 3UK6A 2O5RA 1I94M 1D0KA 2DI0A 1RU3A 2CP8A 3QWLA 3UZUA 2JZ0A 4DV1M 4DR2M 1N33M 1LTMA 1FJGM 2X49A 4RF1A 1QYRA 3GLHA 3HJ8A 3FTEA 1DV0A 3TQSA 4GRIA 4LJ5A 1DGBA 1HT1E 3K8ZA 3UGJA 5ITXE 2DZNB 5FLXS 1Z59A 2F5NA 5LMNM 2J5YA 4Z6YA 1IXSB 2CHGA 3K1JA 3GPYA 2ZTCA 4DUZM 3SAWA 4IBIA 1XMOM 4S12A 5EP4A 2DAKA 3QYBA 1N77A 4LJ7A 2DNAA 2XZFA 2JA2A 3U6SA 1PJIA 1DGHB 1QZMA 2HCBA 4AG6A 1Q39A 4CGYB 2QP9X 3QAUA 1SXJB 5FTMA 1VDDA
chains in the Genus database with same CATH topology
4DR6M 5EP3A 4DV7M 5ITXA 2FNAA 4X64M 3D8LA 2BNKA 2DZOB 4REZA 3SARA 1NVMA 3GLGA 1IXRC 5KPRA 1HNZM 4G4QA 4BBAA 4L15A 2D7GA 3KSXA 2QPAA 2DHRA 4LCBA 4LJ9A 4DR7M 4DV0M 4A3VB 2F5SA 2XSZA 3E4RA 2ERCA 5IZ7D 4LRSA 1YUBA 1E32A 2EUCA 4MH0E 3J27B 1DO0A 3GPPA 3WHLA 4LFAM 1NY6A 4PT5A 1TGUA 2L6OA 1DGGA 2YFQA 5LMUM 5BPVA 4NOOB 4JI3M 4JI0M 1R2ZA 4B3TM 1HQYE 1IBKM 3AOEC 3GPUA 2DWZB 4GITA 1J09A 2KW0A 3GQ4A 1OJLA 2CV2A 4JI7M 2UUBM 3SHFA 3L27A 1R7RA 3M0EA 4OVZA 4AI6A 1Z5CA 4NSRA 5ITYA 3GRRA 3BOSA 4I81A 1NJFA 1XNQM 2F5PA 3GLGB 4DV4M 1IXZA 5EXPA 4B7HA 4D82A 4IBJA 1OFHA 4I4LA 4LJ8A 3U60A 3K2LA 1PM5A 2DWNA 3A98B 2VIIA 3KP1E 1D2NA 2KXEA 2AHMA 3FTCA 4M9XA 4JI6M 5DYGA 3HGIA 5DNYA 3SMSA 4W5WA 3HHZA 3NWLA 5C18A 3MHVC 2XH9A 1K82A 1K3XA 3E9SA 2L7HA 4LZZA 5EP2A 2Y20A 3HJSA 3U6LA 1NHGC 4LF6M 1WXQA 1OFIA 2XEPA 4XBOA 4X66M 3LQRA 2X8AA 5KO3A 5FTKA 5KPZA 3GQ3A 5EXTA 4IBBA 1J5EM 3B9PA 4RNAA 5ITRA 4BLCA 1XHBA 1MX0A 3HU2A 2UXDM 2KA6B 1N78A 4OVZB 4FWHA 1XNRM 2CFOA 3TE6A 1TDHA 4IJFA 4OU7A 4GIPA 2D7HA 2G8LA 5EJCA 3GRUA 5KQDA 4G4RA 3U60B 2CEAA 1JR3D 2D7EA 3AOEA 3UMMA 4JI2M 1TH4A 3J81S 3AV0A 3GO8A 3HHYA 3Q8XA 4BB9A 3H4MA 3THGA 1E9RA 3T15A 2CHVA 3KOXE 3L28A 2UUCM 1YE9A 3I4YA 1IQPA 1IN6A 2KRKA 2J7NA 1ZAEA 3NBIA 1YSYA 3T38A 2R62A 3PVSA 2EO2A 5IWAM 3KDSE 4B7GA 3L26A 3FUXA 4DV6M 2Z3XA 3PNVA 2LH0A 3KP0E 4LZJA 4MGHA 3TWMA 4ZPXA 2HHHM 5KQ8A 1DO2A 2UXBM 4NXNM 4D80A 4FWDA 2QENA 2X4AA 2ZBKB 3U6OA 1UM8A 3VKHA 4IBGA 3HJQA 2Z4SA 2I7NA 3ZCBB 4B7FA 3U61A 1HR0M 3DZDA 4MGYE 3FD9A 2CV0A 3CF0A 3HHWA 1L1ZA 4FW9A 2CE7A 2FOIC 4G4NA 1IN4A 1E9SA 4JXJA 4IBCA 5FTLA 2VQFM 1QAMA 2R45A 3J80S 2K47A 3ZC7B 5IT9S 3GLHB 1SXJD 3SYLA 3JR5A 3A46A 3U6EA 3JR4A 4AKHA 1XWIA 4FWGA 8CATA 4R7GA 5JI2E 3AL0C 4K0KM 3TPZA 4JI4M 5GKNA 3PNYA 4GHAA 3KOYE 4NRVA 1IY0A 3R8FA 1IY2A 3JAMS 3SBJA 2QZ4A 1R2YA 3FYDA 4RF0A 4AKIA 2OQ4A 2LWXA 3KS4A 3KW6A 2W82A 4QNMA 4EIWA 5ITUA 2XLJA 1NNJA 4ITQA 3OTOM 1SXJC 4P16A 3M7GA 3UJNA 4OX9M 3HKPA 3GQ5A 3U61B 2Z4RA 2KZSA 2YNMD 4KLNA 4X62M 2CV1A 4I5SA 4R3DA 1QVRA 2R4EA 2KEBA 2CUZA 1I4WA 2LXEA 2FE8A 3RFWA 1X37A 5F3WA 3GPXA 2UUAM 3HHXA 1T3TA 3A42A 3KS8A 2C9CA 1JR3A 4MGZE 1DGFA 2F4VM 4KO8A 3FKEA 3KFUG 5FTJA 3D8BA 4LY6A 1C1KA 1E94E 1NY5A 3KSJA 4WURA 4JV5M 3ZH9B 4GH9A 3VFDA 2ZANA 4M0WA 1L2DA 3MJ5A 4LFBM 2P5TA 4CHTB 5EXSA 4LJ6A 4PCZA 5IREB 4AG5A 3RGSA 1NNUC 4LFCM 5EXXA 4GMQA 4QHTA 3TWLA 3AFHA 3L29A 4MB7A 1TH2A 2HKJA 1XXHA 3LVWA 4Z8XA 4D81A 2YR0A 3HU3A 2Z7JA 1SXJE 1GLNA 4KHPM 5FTNA 4NRWA 4LJ4A 1MU5A 2R4JA 4HLQA 4G6ZA 2R18A 3IG5A 4FCTA 1QAQA 3CF6E 2R46A 3LMMA 3U5ZA 1XC8A 4JYAM 1L8QA 4FCVA 4IIWA 4LF7M 1HQCA 2M60A 2XF3A 4JI8M 5C1BA 4JN6A 2BJVA 4HL4A 4IBEA 4PDIA 4QNRA 3VK8A 3DOAA 1TH3A 1QANA 4AQYM 3U6QA 2I7PA 2R65A 3TWKA 1SXJA 2NQ8C 2QBYA 4DR3M 2EA0A 2E5LM 1NJGA 4GC5A 3VK7A 2DWLA 4B3RM 2DWMA 3KOZE 3SAVA 4MM3B 4DR4M 1Z5AA 2C9OA 4GKJM 4LGYA 1PJJA 3WHKA 1HNXM 1HT2E 4LF4M 3SAUA 3IG8A 2ZM6M 3GLFA 5JI3E 2C5RA 4NSOB 2Y0TA 4LG2A 3GLIA 4IBFA 2UU9M 1XXHB 4LGMA 2ZAOA 3EIEA 4XGIA 3RGPA 4B08A 1L2BA 1N32M 1IM2A 3GRYA 2Y0QA 2XZUA 3ILKA 4MGIE 3L2AA 3I4VA 4LF5M 4M9SA 1IY1A 2H1RA 1JQJC 2RGHA 3W0LB 3U5ZB 4CISA 3FTFA 4QOZC 1IN8A 3KXEC 1GKIA 4DV3M 3FUUA 2F5QA 4I8OA 4DV5M 2HL7A 2XGNA 2G5GX 4FCWA 1QAOA 2V1UA 4YY3M 3VKGA 3W0FA 3LQQA 1IN7A 3J2PB 4DR1M 1FNNA 3SC3A 2QCUA 4QHSA 2C96A 4IJEA 4JI5M 4IBDA 1ORYB 3FUVA 4KODA 3U6MA 2UXCM 2CHQA 2QBYB 4YHHM 1ZQ9A 4OW0A 3AJIB 1S3SA 1GVNA 2J7OA 2YQZA 4L4UA 2VQEM 4FVMA 3TL4X 2KRUA 1Q3BA 4L78A 4LF9M 4NXMM 3VDPA 4WW0A 1IBMM 1NSFA 3HWSA 4L8RC 3GLFB 1TDZA 3R9XB 5ITTA 3K92A 1KFVA 1R6BX 2OPFA 3GRVA 1W5SA 4AZFA 3GLIB 4FD2A 4M0DA 4L16A 3U6PA 3FUTA 2XFTA 2ZAMA 3SATA 3VLFB 3FTDA 1G41A 4GC9A 2XFSA 2F5OA 4LRTA 4TUWA 1KSFX 1KYIA 2DVWB 4IBKA 3DFZA 4B3MM 4II7A 4X65M 1G8PA 4NL4H 4M9ZA 3VDUA 2L7IA 3C58A 2DXIA 3U6CA 2L09A 3SASA 3I51A 1NHWC 1Q3CA 1W5TA 4QOSA 3T1YM 4AW4A 3AKZA 3J7AS 1HNWM 5EQTA 1H6UA 3FYCA 2RKOA 1N36M 2M5ZA 1IBLM 4DUYM 2RGOA 3DA1A 1J7KA 1GL6A 2LNHC 3M6AA 5FSWA 5ITQA 4G4OA 4LJAA 2BJWA 5KPTA 1LV7A 3T1HM 3SMPA 5E6JA 7CATA 2Q2EB 5BR8M 1N75A 2XSZD 1Z6TA 4MGKE 1QQWA 3KOWE 5A2QS 1N34M 2FFJA 3CF2A 3SFZA 4GHLA 1L1TA 3HU1A 5DYIA 4JI1M 4DR5M 1G4AE 4PD2A 3KVWA 2V6ZM 3SYKA 1GL7A 4AKGA 3L25A 3SHGB 4GKKM 4PDGA 1K3WA 1L2CA 3AOGA 5EP1A 1DGHA 1G3IA 1EE8A 2KZUA 2A5YB 5E26A 2C98A 3EIHA 2Y21A 3MK6A 4LF8M 3CTWB 1Z5BA 3J7BA 3U6DA 1IN5A 3RE8A 4B3SM 4DV2M 2V1CA 3A45A 2C99A 3PFIA 3PXGA 1XMQM 1G59A 3GP1A 3LVVA 5H37D 3FUWA 3UK6A 2O5RA 1I94M 4DV1M 4DR2M 3UZUA 3QWLA 1N33M 1FJGM 2X49A 4RF1A 3GLHA 1QYRA 3HJ8A 3FTEA 3TQSA 4GRIA 4LJ5A 1DGBA 1HT1E 3K8ZA 3UGJA 5ITXE 2DZNB 5FLXS 1Z59A 2F5NA 5LMNM 4Z6YA 1IXSB 2CHGA 3K1JA 3GPYA 4DUZM 3SAWA 4IBIA 1XMOM 4S12A 5EP4A 1N77A 4LJ7A 2XZFA 2JA2A 3U6SA 1PJIA 1DGHB 1QZMA 2HCBA 4AG6A 1Q39A 4CGYB 2QP9X 3QAUA 1SXJB 5FTMA 1VDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWL A;  4DR6 M;  2UUC M;  4DV7 M;  4MB7 A;  5ITX A;  4B3M M;  4X65 M;  2HKJ A;  4X64 M;  3C58 A;  3SAR A;  3U6C A;  4KHP M;  1HNZ M;  3SAS A;  5IWA M;  4G4Q A;  4NRW A;  1Q3C A;  3T1Y M;  1MU5 A;  1HNW M;  4DV6 M;  3J7A S;  4JYA M;  4DR7 M;  4DV0 M;  3TWM A;  2F5S A;  1XC8 A;  2HHH M;  1N36 M;  4LF7 M;  1IBL M;  4DUY M;  4JI8 M;  2UXB M;  4NXN M;  2ZBK B;  3U6O A;  4G4O A;  3GPP A;  5ITQ A;  4LFA M;  4PDI A;  3VK8 A;  3DOA A;  4AQY M;  3T1H M;  3U6Q A;  1HR0 M;  2Q2E B;  3TWK A;  5LMU M;  5BR8 M;  4JI3 M;  1L1Z A;  4JI0 M;  1R2Z A;  4DR3 M;  2EA0 A;  2E5L M;  4B3T M;  5A2Q S;  3VK7 A;  1IBK M;  3GPU A;  4G4N A;  1N34 M;  4B3R M;  2VQF M;  3SAV A;  4DR4 M;  1Z5A A;  3GQ4 A;  4GKJ M;  1L1T A;  1PJJ A;  1HNX M;  4JI7 M;  4JI1 M;  2UUB M;  4LF4 M;  4DR5 M;  3SAU A;  2ZM6 M;  3J80 S;  4PD2 A;  5IT9 S;  1Z5C A;  3JR5 A;  3U6E A;  3A46 A;  5ITY A;  2UU9 M;  3JR4 A;  1XNQ M;  1L2B A;  2F5P A;  1N32 M;  4GKK M;  4PDG A;  1K3W A;  4DV4 M;  2XZU A;  1L2C A;  4K0K M;  1PM5 A;  4JI4 M;  4LF5 M;  1EE8 A;  4NRV A;  4CIS A;  3JAM S;  3SBJ A;  4JI6 M;  4LF8 M;  1Z5B A;  3U6D A;  1R2Y A;  4B3S M;  4DV2 M;  2OQ4 A;  4DV3 M;  2F5Q A;  4DV5 M;  1K82 A;  3A45 A;  1K3X A;  1XMQ M;  3GP1 A;  4YY3 M;  3W0F A;  5ITU A;  3U6L A;  1NNJ A;  4ITQ A;  3OTO M;  4LF6 M;  1I94 M;  4OX9 M;  4X66 M;  4DV1 M;  3GQ5 A;  4DR1 M;  4DR2 M;  1N33 M;  4JI5 M;  4X62 M;  3U6M A;  2UXC M;  4YHH M;  3GQ3 A;  1FJG M;  1J5E M;  5ITR A;  2VQE M;  2UUA M;  3GPX A;  1MX0 A;  3A42 A;  1Q3B A;  2F4V M;  4LF9 M;  2UXD M;  4NXM M;  5ITX E;  1IBM M;  5FLX S;  1Z59 A;  2F5N A;  5LMN M;  1TDZ A;  3GPY A;  5ITT A;  1XNR M;  4DUZ M;  1KFV A;  1TDH A;  4JV5 M;  2OPF A;  3SAW A;  1XMO M;  1L2D A;  4LFB M;  3U6P A;  2XZF A;  4G4R A;  3U6S A;  1PJI A;  3SAT A;  1Q39 A;  4JI2 M;  4PCZ A;  3J81 S;  3GO8 A;  4LFC M;  2F5O A; 
#chains in the Genus database with same CATH topology
 4DR6 M;  5EP3 A;  4DV7 M;  5ITX A;  4DBG B;  2FNA A;  1MJG M;  2JY5 A;  4X64 M;  2KHH A;  2BNK A;  2LBC A;  3D8L A;  2DZO B;  4REZ A;  3SAR A;  1NVM A;  2DEN A;  3GLG A;  1IXR C;  3B89 A;  5KPR A;  1HNZ M;  1NV9 A;  4G4Q A;  4BBA A;  4L15 A;  2D7G A;  3KSX A;  2QPA A;  4CIZ A;  1EFU B;  2DHR A;  4LCB A;  4LJ9 A;  5IWA M;  4DV0 M;  4A3V B;  2F5S A;  4DR7 M;  2XSZ A;  1OIP A;  3E4R A;  2ERC A;  5IZ7 D;  3BXW A;  4LRS A;  1YUB A;  1E32 A;  2EUC A;  4MH0 E;  3J27 B;  1DO0 A;  3GPP A;  3WHL A;  4LFA M;  1PRB A;  1NY6 A;  2MH8 A;  2Z8Y M;  1TGU A;  4PT5 A;  2L6O A;  1DGG A;  2YFQ A;  1MN3 A;  5LMU M;  5BPV A;  4NOO B;  4JI3 M;  4JI0 M;  1R2Z A;  4B3T M;  1HQY E;  1IBK M;  3AOE C;  3GPU A;  2DWZ B;  4GIT A;  3FRI A;  2FS1 A;  1J09 A;  3K9O A;  2KW0 A;  3GQ4 A;  1OJL A;  2CV2 A;  4JI7 M;  2UUB M;  3SHF A;  2N35 A;  1SG9 A;  3L27 A;  1R7R A;  3M0E A;  4OVZ A;  4AI6 A;  1Z5C A;  4NSR A;  5ITY A;  3GRR A;  3BOS A;  4I81 A;  1NJF A;  2GNO A;  3MMP A;  1XNQ M;  2F5P A;  2JZ1 A;  2KNV A;  3GLG B;  4DV4 M;  1IXZ A;  5EXP A;  4B7H A;  4D82 A;  4IBJ A;  1OFH A;  4I4L A;  4LJ8 A;  3U60 A;  3K2L A;  1PM5 A;  2JUJ A;  2DWN A;  1R5L A;  3A98 B;  2VII A;  3KP1 E;  1D2N A;  3W67 A;  2KXE A;  2AHM A;  3FTC A;  4M9X A;  4JI6 M;  5DYG A;  3HGI A;  3IEC A;  3SMS A;  3T6P A;  5DNY A;  4W5W A;  2DHY A;  3V76 A;  3HHZ A;  3NWL A;  1TR8 A;  2APL A;  3MHV C;  5C18 A;  2XH9 A;  1K82 A;  1C7Y A;  1K3X A;  1QDR A;  3E9S A;  2L7H A;  4LZZ A;  2WSE F;  5EP2 A;  2Y20 A;  3IHP A;  3HJS A;  3U6L A;  1QZE A;  1NHG C;  4LF6 M;  1WXQ A;  1OFI A;  2XEP A;  4XBO A;  4X66 M;  2K9D A;  1OAO C;  1OIZ A;  2JP7 A;  2X8A A;  3LQR A;  2WSC F;  5KO3 A;  3ZQJ A;  5FTK A;  2R44 A;  5KPZ A;  3GQ3 A;  2JNH A;  5EXT A;  4IBB A;  1J5E M;  3B9P A;  4RNA A;  5ITR A;  4BLC A;  1XHB A;  1MX0 A;  2KNA A;  3HU2 A;  1YLA A;  1NV8 A;  2UXD M;  2WZJ A;  2OOA A;  2KA6 B;  1N78 A;  4OVZ B;  4FWH A;  1XNR M;  2CFO A;  1GAB A;  3TE6 A;  1TDH A;  1ZMV A;  4IJF A;  4OU7 A;  4GIP A;  2LVP C;  2D7H A;  1TF0 B;  2G8L A;  3I04 M;  1WHC A;  5EJC A;  3GRU A;  5KQD A;  4G4R A;  3U60 B;  2CEA A;  1JR3 D;  1PJS A;  2D7E A;  3AOE A;  3H4J A;  1TH4 A;  3UMM A;  3GLF E;  2MJ5 B;  4JI2 M;  3J81 S;  2K6B A;  3AV0 A;  3GO8 A;  4G3O A;  1WR1 B;  3Q8X A;  3HHY A;  4BB9 A;  3H4M A;  3THG A;  1E9R A;  3HZJ A;  3T15 A;  2CHV A;  3KOX E;  3L28 A;  4ANR A;  2KDL A;  1YE9 A;  2UUC M;  3I4Y A;  1IQP A;  1IN6 A;  1OQY A;  2KRK A;  2J7N A;  1ZAE A;  3W68 A;  3NBI A;  1VG5 A;  1YSY A;  3T38 A;  2R62 A;  3PVS A;  2EO2 A;  1R4G A;  2H5X A;  2JWS A;  2MGW A;  3KDS E;  4P17 A;  4B7G A;  2HAK A;  3FUX A;  3L26 A;  4DV6 M;  2Z3X A;  3PNV A;  2LH0 A;  3E21 A;  3KP0 E;  1XB2 B;  3LCU A;  3F92 A;  4LZJ A;  4MGH A;  4ZPX A;  3TWM A;  2HHH M;  1VEG A;  5KQ8 A;  1DO2 A;  2UXB M;  4NXN M;  4D80 A;  1V33 A;  4FWD A;  2QEN A;  2X4A A;  2ZBK B;  2R0I A;  3U6O A;  1UM8 A;  3VKH A;  4IBG A;  3HJQ A;  2Z4S A;  2I7N A;  3ZCB B;  4B7F A;  3U61 A;  1HR0 M;  3DZD A;  4MGY E;  1NO1 A;  3FD9 A;  2CV0 A;  3CF0 A;  1Y8G A;  3HHW A;  1L1Z A;  2MR9 A;  4FW9 A;  2CE7 A;  2FOI C;  2QQ8 A;  4G4N A;  1IN4 A;  4KT0 F;  1E9S A;  4JXJ A;  2JY8 A;  4R71 A;  4IBC A;  5FTL A;  2VQF M;  1QAM A;  4Q7J A;  2R45 A;  1Q02 A;  3J80 S;  2K47 A;  3ZC7 B;  5L8R F;  5IT9 S;  3GLH B;  4XK8 F;  1SXJ D;  3SYL A;  3JR5 A;  3A46 A;  3U6E A;  2RRU A;  3JR4 A;  4AKH A;  1XWI A;  4FWG A;  8CAT A;  4R7G A;  3B7Q A;  5JI2 E;  3AL0 C;  4K0K M;  3TPZ A;  3C3D A;  1ZMW A;  4JI4 M;  5GKN A;  3PNY A;  4GHA A;  3KOY E;  1PGY A;  2O25 A;  1T6O A;  4NRV A;  1IY0 A;  2KNZ A;  1IY2 A;  3R8F A;  3HY5 A;  3JAM S;  4CJ6 A;  3SBJ A;  2QZ4 A;  1R2Y A;  1JR3 E;  3FYD A;  4RF0 A;  2MRO B;  4AKI A;  2OQ4 A;  2LWX A;  3KS4 A;  3KW6 A;  2R6F A;  2O01 F;  2W82 A;  4QNM A;  4EIW A;  5ITU A;  2DAG A;  2XLJ A;  1NNJ A;  4ITQ A;  3OTO M;  1SXJ C;  4P16 A;  3M7G A;  3UJN A;  4OX9 M;  3HKP A;  3GQ5 A;  3U61 B;  2Z4R A;  2KZS A;  2YNM D;  4GEW A;  1WGN A;  4KLN A;  4I5S A;  4F2L A;  4X62 M;  2CV1 A;  4R3D A;  1QVR A;  2R4E A;  2JXN A;  2KEB A;  2CUZ A;  1I4W A;  2LXE A;  2FE8 A;  3RFW A;  1X37 A;  2QHO B;  3GPX A;  5F3W A;  2UUA M;  3HHX A;  3FE3 A;  1T3T A;  3A42 A;  2JY6 B;  2C9C A;  3KS8 A;  1JR3 A;  4MGZ E;  1DGF A;  2F4V M;  4KO8 A;  3FKE A;  4NC6 A;  3KFU G;  5FTJ A;  3D8B A;  4LY6 A;  1C1K A;  1E94 E;  1NY5 A;  1XXH E;  2QNJ A;  3KSJ A;  4WUR A;  2LHC A;  3ZH9 B;  4GH9 A;  3VFD A;  2ZAN A;  4M0W A;  2OOB A;  4F1I A;  1L2D A;  4JV5 M;  3MJ5 A;  4LFB M;  2P5T A;  1PJT A;  4CHT B;  5EXS A;  4LJ6 A;  1V34 A;  4PCZ A;  2VF7 A;  5IRE B;  4AG5 A;  3RGS A;  1NNU C;  4LFC M;  5EXX A;  4GMQ A;  2EKK A;  1VEK A;  4QHT A;  3TWL A;  3AFH A;  3L29 A;  4MB7 A;  1TH2 A;  2K0B X;  2HKJ A;  1XXH A;  3LVW A;  4Z8X A;  4D81 A;  2YR0 A;  3HU3 A;  2Z7J A;  1OAI A;  1SXJ E;  1GLN A;  4KHP M;  5FTN A;  4NRW A;  4LJ4 A;  1MU5 A;  2R4J A;  4HLQ A;  4G6Z A;  2R18 A;  3IG5 A;  4FCT A;  1QAQ A;  3CF6 E;  2R46 A;  3LMM A;  3U5Z A;  1XC8 A;  4JYA M;  1L8Q A;  4FCV A;  4IIW A;  4LF7 M;  1HQC A;  2M60 A;  2XF3 A;  4JI8 M;  5C1B A;  4JN6 A;  2BJV A;  1CUK A;  4HL4 A;  2LVA A;  4IBE A;  4PDI A;  2EJS A;  4QNR A;  3GLI E;  3DOA A;  1TH3 A;  1QAN A;  4HEO A;  4AQY M;  3VK8 A;  3U6Q A;  3QYE A;  1GJS A;  2I7P A;  2R65 A;  2GQF A;  3TWK A;  1SXJ A;  2LHG A;  2NQ8 C;  2QBY A;  4DR3 M;  2EA0 A;  2E5L M;  1NJG A;  4GC5 A;  3VK7 A;  2LVO C;  2DWL A;  4B3R M;  2DWM A;  3KOZ E;  3SAV A;  1AUA A;  2DZL A;  4MM3 B;  4WP2 A;  4DR4 M;  1Z5A A;  2C9O A;  2L4E A;  3B7N A;  4LGY A;  1PJJ A;  4GKJ M;  3WHK A;  1WGL A;  1HNX M;  1HT2 E;  3I01 M;  4LF4 M;  3SAU A;  3IG8 A;  2ZM6 M;  3GLF A;  3E46 A;  5JI3 E;  2C5R A;  1WIV A;  1VQ1 A;  4NSO B;  2Y0T A;  4LG2 A;  3GLI A;  4IBF A;  3C3E A;  2UU9 M;  1XXH B;  4LGM A;  2ZAO A;  3EIE A;  4XGI A;  3RGP A;  2DAE A;  4B08 A;  1L2B A;  1N32 M;  1F4I A;  1IFY A;  1IM2 A;  3GRY A;  2Y0Q A;  2XZU A;  3ILK A;  4MGI E;  1WJ7 A;  3L2A A;  3I4V A;  4LF5 M;  4M9S A;  1IY1 A;  2H1R A;  1JQJ C;  2RGH A;  2WSF F;  2DKL A;  3W0L B;  3U5Z B;  4CIS A;  1IN8 A;  1HJP A;  3FTF A;  4QOZ C;  5DFL A;  3KXE C;  1GKI A;  4DV3 M;  2CWB A;  2VF8 A;  3FUU A;  3GLG E;  3LCV B;  4I8O A;  2F5Q A;  4DV5 M;  2HL7 A;  2XGN A;  2G5G X;  1A5T A;  4FCW A;  1G71 A;  1QAO A;  3CGW A;  2V1U A;  1QUS A;  4YY3 M;  3VKG A;  3W0F A;  3LQQ A;  3NBX X;  3K9P A;  1IN7 A;  3J2P B;  2BWE A;  4DR1 M;  1FNN A;  3SC3 A;  2QCU A;  4QHS A;  2C96 A;  4IJE A;  4JI5 M;  4IBD A;  1ORY B;  3FUV A;  4KOD A;  3U6M A;  2UXC M;  2CHQ A;  2QBY B;  4YHH M;  1ZQ9 A;  4OW0 A;  3AJI B;  1S3S A;  1GVN A;  2J7O A;  1T43 A;  2YQZ A;  4L4U A;  4FVM A;  3TL4 X;  2VQE M;  1ZMU A;  2KRU A;  1Q3B A;  4L78 A;  4LF9 M;  4NXM M;  3VDP A;  1QUT A;  4WW0 A;  1IBM M;  1NSF A;  3HWS A;  4L8R C;  3GLF B;  1TDZ A;  3C9P A;  3R9X B;  5ITT A;  2QSF X;  3K92 A;  1KFV A;  1R6B X;  2OPF A;  1UFZ A;  1W5S A;  3GRV A;  4AZF A;  4FD2 A;  3GLI B;  4M0D A;  4L16 A;  2ZTD A;  3U6P A;  1P3Q Q;  3FUT A;  2XFT A;  2DAM A;  2ZAM A;  2B3T A;  1PJQ A;  2JY7 A;  2LTU A;  3SAT A;  1EIJ A;  3VLF B;  2G3Q A;  3FTD A;  1AIP C;  2LVN C;  1QDT A;  1G41 A;  4GC9 A;  2XFS A;  2F5O A;  1OKS A;  4LRT A;  4TUW A;  1KSF X;  1KYI A;  2DVW B;  4IBK A;  3DFZ A;  4B3M M;  4II7 A;  4X65 M;  1G8P A;  4NL4 H;  4M9Z A;  3VDU A;  2L7I A;  3C58 A;  2DXI A;  2FH0 A;  3U6C A;  2EKF A;  4RKU F;  2L09 A;  3SAS A;  3I51 A;  1BVS A;  1NHW C;  1Q3C A;  1W5T A;  4QOS A;  3T1Y M;  4AW4 A;  3AKZ A;  3J7A S;  1HNW M;  3B74 A;  5EQT A;  2DAI A;  1H6U A;  3FYC A;  3LW5 F;  2BWB A;  2RKO A;  1N36 M;  2M5Z A;  1IBL M;  4DUY M;  2RGO A;  1VEJ A;  3DA1 A;  4Y28 F;  1J7K A;  1GL6 A;  3Q8G A;  1D0M A;  2L4F A;  2LNH C;  3B7Z A;  3M6A A;  2HWJ A;  5FSW A;  5ITQ A;  4G4O A;  4LJA A;  2BJW A;  5KPT A;  2LVQ D;  1LV7 A;  4L6V 6;  1OTR A;  3SMP A;  3T1H M;  5E6J A;  7CAT A;  2Q2E B;  3BBZ A;  5BR8 M;  1N75 A;  2XSZ D;  1Z6T A;  4MGK E;  1QQW A;  1TTE A;  3KOW E;  5A2Q S;  1N34 M;  2FFJ A;  3CF2 A;  4UN2 B;  3SFZ A;  4GHL A;  1L1T A;  3HU1 A;  5DYI A;  4JI1 M;  4DR5 M;  1GO5 A;  1G4A E;  1IXS A;  4PD2 A;  3KVW A;  3HX3 A;  2V6Z M;  3SYK A;  1GL7 A;  2L2D A;  1V92 A;  4AKG A;  1ZV1 A;  3L25 A;  3SHG B;  4GKK M;  4PDG A;  1K3W A;  1L2C A;  3AOG A;  5EP1 A;  1DGH A;  1G3I A;  1GJT A;  2VDB B;  1JB0 F;  1EE8 A;  2CRU A;  2KZU A;  3GLH E;  2A5Y B;  5E26 A;  2C98 A;  3EIH A;  2Y21 A;  3FRH A;  2OO9 A;  3MK6 A;  3CTW B;  1Z5B A;  3J7B A;  3U6D A;  4LF8 M;  1IN5 A;  3RE8 A;  4B3S M;  4DV2 M;  2V1C A;  3A45 A;  2C99 A;  3PFI A;  3PXG A;  1XMQ M;  1G59 A;  3GP1 A;  1D0L A;  3LVV A;  5H37 D;  3FUW A;  1VDL A;  3UK6 A;  2O5R A;  1I94 M;  1D0K A;  2DI0 A;  1RU3 A;  2CP8 A;  3QWL A;  3UZU A;  2JZ0 A;  4DV1 M;  4DR2 M;  1N33 M;  1LTM A;  1FJG M;  2X49 A;  4RF1 A;  1QYR A;  3GLH A;  3HJ8 A;  3FTE A;  1DV0 A;  3TQS A;  4GRI A;  4LJ5 A;  1DGB A;  1HT1 E;  3K8Z A;  3UGJ A;  5ITX E;  2DZN B;  5FLX S;  1Z59 A;  2F5N A;  5LMN M;  2J5Y A;  4Z6Y A;  1IXS B;  2CHG A;  3K1J A;  3GPY A;  2ZTC A;  4DUZ M;  3SAW A;  4IBI A;  1XMO M;  4S12 A;  5EP4 A;  2DAK A;  3QYB A;  1N77 A;  4LJ7 A;  2DNA A;  2XZF A;  2JA2 A;  3U6S A;  1PJI A;  1DGH B;  1QZM A;  2HCB A;  4AG6 A;  1Q39 A;  4CGY B;  2QP9 X;  3QAU A;  1SXJ B;  5FTM A;  1VDD A; 
#chains in the Genus database with same CATH homology
 4DR6 M;  5EP3 A;  4DV7 M;  5ITX A;  2FNA A;  4X64 M;  3D8L A;  2BNK A;  2DZO B;  4REZ A;  3SAR A;  1NVM A;  3GLG A;  1IXR C;  5KPR A;  1HNZ M;  4G4Q A;  4BBA A;  4L15 A;  2D7G A;  3KSX A;  2QPA A;  2DHR A;  4LCB A;  4LJ9 A;  4DR7 M;  4DV0 M;  4A3V B;  2F5S A;  2XSZ A;  3E4R A;  2ERC A;  5IZ7 D;  4LRS A;  1YUB A;  1E32 A;  2EUC A;  4MH0 E;  3J27 B;  1DO0 A;  3GPP A;  3WHL A;  4LFA M;  1NY6 A;  4PT5 A;  1TGU A;  2L6O A;  1DGG A;  2YFQ A;  5LMU M;  5BPV A;  4NOO B;  4JI3 M;  4JI0 M;  1R2Z A;  4B3T M;  1HQY E;  1IBK M;  3AOE C;  3GPU A;  2DWZ B;  4GIT A;  1J09 A;  2KW0 A;  3GQ4 A;  1OJL A;  2CV2 A;  4JI7 M;  2UUB M;  3SHF A;  3L27 A;  1R7R A;  3M0E A;  4OVZ A;  4AI6 A;  1Z5C A;  4NSR A;  5ITY A;  3GRR A;  3BOS A;  4I81 A;  1NJF A;  1XNQ M;  2F5P A;  3GLG B;  4DV4 M;  1IXZ A;  5EXP A;  4B7H A;  4D82 A;  4IBJ A;  1OFH A;  4I4L A;  4LJ8 A;  3U60 A;  3K2L A;  1PM5 A;  2DWN A;  3A98 B;  2VII A;  3KP1 E;  1D2N A;  2KXE A;  2AHM A;  3FTC A;  4M9X A;  4JI6 M;  5DYG A;  3HGI A;  5DNY A;  3SMS A;  4W5W A;  3HHZ A;  3NWL A;  5C18 A;  3MHV C;  2XH9 A;  1K82 A;  1K3X A;  3E9S A;  2L7H A;  4LZZ A;  5EP2 A;  2Y20 A;  3HJS A;  3U6L A;  1NHG C;  4LF6 M;  1WXQ A;  1OFI A;  2XEP A;  4XBO A;  4X66 M;  3LQR A;  2X8A A;  5KO3 A;  5FTK A;  5KPZ A;  3GQ3 A;  5EXT A;  4IBB A;  1J5E M;  3B9P A;  4RNA A;  5ITR A;  4BLC A;  1XHB A;  1MX0 A;  3HU2 A;  2UXD M;  2KA6 B;  1N78 A;  4OVZ B;  4FWH A;  1XNR M;  2CFO A;  3TE6 A;  1TDH A;  4IJF A;  4OU7 A;  4GIP A;  2D7H A;  2G8L A;  5EJC A;  3GRU A;  5KQD A;  4G4R A;  3U60 B;  2CEA A;  1JR3 D;  2D7E A;  3AOE A;  3UMM A;  4JI2 M;  1TH4 A;  3J81 S;  3AV0 A;  3GO8 A;  3HHY A;  3Q8X A;  4BB9 A;  3H4M A;  3THG A;  1E9R A;  3T15 A;  2CHV A;  3KOX E;  3L28 A;  2UUC M;  1YE9 A;  3I4Y A;  1IQP A;  1IN6 A;  2KRK A;  2J7N A;  1ZAE A;  3NBI A;  1YSY A;  3T38 A;  2R62 A;  3PVS A;  2EO2 A;  5IWA M;  3KDS E;  4B7G A;  3L26 A;  3FUX A;  4DV6 M;  2Z3X A;  3PNV A;  2LH0 A;  3KP0 E;  4LZJ A;  4MGH A;  3TWM A;  4ZPX A;  2HHH M;  5KQ8 A;  1DO2 A;  2UXB M;  4NXN M;  4D80 A;  4FWD A;  2QEN A;  2X4A A;  2ZBK B;  3U6O A;  1UM8 A;  3VKH A;  4IBG A;  3HJQ A;  2Z4S A;  2I7N A;  3ZCB B;  4B7F A;  3U61 A;  1HR0 M;  3DZD A;  4MGY E;  3FD9 A;  2CV0 A;  3CF0 A;  3HHW A;  1L1Z A;  4FW9 A;  2CE7 A;  2FOI C;  4G4N A;  1IN4 A;  1E9S A;  4JXJ A;  4IBC A;  5FTL A;  2VQF M;  1QAM A;  2R45 A;  3J80 S;  2K47 A;  3ZC7 B;  5IT9 S;  3GLH B;  1SXJ D;  3SYL A;  3JR5 A;  3A46 A;  3U6E A;  3JR4 A;  4AKH A;  1XWI A;  4FWG A;  8CAT A;  4R7G A;  5JI2 E;  3AL0 C;  4K0K M;  3TPZ A;  4JI4 M;  5GKN A;  3PNY A;  4GHA A;  3KOY E;  4NRV A;  1IY0 A;  3R8F A;  1IY2 A;  3JAM S;  3SBJ A;  2QZ4 A;  1R2Y A;  3FYD A;  4RF0 A;  4AKI A;  2OQ4 A;  2LWX A;  3KS4 A;  3KW6 A;  2W82 A;  4QNM A;  4EIW A;  5ITU A;  2XLJ A;  1NNJ A;  4ITQ A;  3OTO M;  1SXJ C;  4P16 A;  3M7G A;  3UJN A;  4OX9 M;  3HKP A;  3GQ5 A;  3U61 B;  2Z4R A;  2KZS A;  2YNM D;  4KLN A;  4X62 M;  2CV1 A;  4I5S A;  4R3D A;  1QVR A;  2R4E A;  2KEB A;  2CUZ A;  1I4W A;  2LXE A;  2FE8 A;  3RFW A;  1X37 A;  5F3W A;  3GPX A;  2UUA M;  3HHX A;  1T3T A;  3A42 A;  3KS8 A;  2C9C A;  1JR3 A;  4MGZ E;  1DGF A;  2F4V M;  4KO8 A;  3FKE A;  3KFU G;  5FTJ A;  3D8B A;  4LY6 A;  1C1K A;  1E94 E;  1NY5 A;  3KSJ A;  4WUR A;  4JV5 M;  3ZH9 B;  4GH9 A;  3VFD A;  2ZAN A;  4M0W A;  1L2D A;  3MJ5 A;  4LFB M;  2P5T A;  4CHT B;  5EXS A;  4LJ6 A;  4PCZ A;  5IRE B;  4AG5 A;  3RGS A;  1NNU C;  4LFC M;  5EXX A;  4GMQ A;  4QHT A;  3TWL A;  3AFH A;  3L29 A;  4MB7 A;  1TH2 A;  2HKJ A;  1XXH A;  3LVW A;  4Z8X A;  4D81 A;  2YR0 A;  3HU3 A;  2Z7J A;  1SXJ E;  1GLN A;  4KHP M;  5FTN A;  4NRW A;  4LJ4 A;  1MU5 A;  2R4J A;  4HLQ A;  4G6Z A;  2R18 A;  3IG5 A;  4FCT A;  1QAQ A;  3CF6 E;  2R46 A;  3LMM A;  3U5Z A;  1XC8 A;  4JYA M;  1L8Q A;  4FCV A;  4IIW A;  4LF7 M;  1HQC A;  2M60 A;  2XF3 A;  4JI8 M;  5C1B A;  4JN6 A;  2BJV A;  4HL4 A;  4IBE A;  4PDI A;  4QNR A;  3VK8 A;  3DOA A;  1TH3 A;  1QAN A;  4AQY M;  3U6Q A;  2I7P A;  2R65 A;  3TWK A;  1SXJ A;  2NQ8 C;  2QBY A;  4DR3 M;  2EA0 A;  2E5L M;  1NJG A;  4GC5 A;  3VK7 A;  2DWL A;  4B3R M;  2DWM A;  3KOZ E;  3SAV A;  4MM3 B;  4DR4 M;  1Z5A A;  2C9O A;  4GKJ M;  4LGY A;  1PJJ A;  3WHK A;  1HNX M;  1HT2 E;  4LF4 M;  3SAU A;  3IG8 A;  2ZM6 M;  3GLF A;  5JI3 E;  2C5R A;  4NSO B;  2Y0T A;  4LG2 A;  3GLI A;  4IBF A;  2UU9 M;  1XXH B;  4LGM A;  2ZAO A;  3EIE A;  4XGI A;  3RGP A;  4B08 A;  1L2B A;  1N32 M;  1IM2 A;  3GRY A;  2Y0Q A;  2XZU A;  3ILK A;  4MGI E;  3L2A A;  3I4V A;  4LF5 M;  4M9S A;  1IY1 A;  2H1R A;  1JQJ C;  2RGH A;  3W0L B;  3U5Z B;  4CIS A;  3FTF A;  4QOZ C;  1IN8 A;  3KXE C;  1GKI A;  4DV3 M;  3FUU A;  2F5Q A;  4I8O A;  4DV5 M;  2HL7 A;  2XGN A;  2G5G X;  4FCW A;  1QAO A;  2V1U A;  4YY3 M;  3VKG A;  3W0F A;  3LQQ A;  1IN7 A;  3J2P B;  4DR1 M;  1FNN A;  3SC3 A;  2QCU A;  4QHS A;  2C96 A;  4IJE A;  4JI5 M;  4IBD A;  1ORY B;  3FUV A;  4KOD A;  3U6M A;  2UXC M;  2CHQ A;  2QBY B;  4YHH M;  1ZQ9 A;  4OW0 A;  3AJI B;  1S3S A;  1GVN A;  2J7O A;  2YQZ A;  4L4U A;  2VQE M;  4FVM A;  3TL4 X;  2KRU A;  1Q3B A;  4L78 A;  4LF9 M;  4NXM M;  3VDP A;  4WW0 A;  1IBM M;  1NSF A;  3HWS A;  4L8R C;  3GLF B;  1TDZ A;  3R9X B;  5ITT A;  3K92 A;  1KFV A;  1R6B X;  2OPF A;  3GRV A;  1W5S A;  4AZF A;  3GLI B;  4FD2 A;  4M0D A;  4L16 A;  3U6P A;  3FUT A;  2XFT A;  2ZAM A;  3SAT A;  3VLF B;  3FTD A;  1G41 A;  4GC9 A;  2XFS A;  2F5O A;  4LRT A;  4TUW A;  1KSF X;  1KYI A;  2DVW B;  4IBK A;  3DFZ A;  4B3M M;  4II7 A;  4X65 M;  1G8P A;  4NL4 H;  4M9Z A;  3VDU A;  2L7I A;  3C58 A;  2DXI A;  3U6C A;  2L09 A;  3SAS A;  3I51 A;  1NHW C;  1Q3C A;  1W5T A;  4QOS A;  3T1Y M;  4AW4 A;  3AKZ A;  3J7A S;  1HNW M;  5EQT A;  1H6U A;  3FYC A;  2RKO A;  1N36 M;  2M5Z A;  1IBL M;  4DUY M;  2RGO A;  3DA1 A;  1J7K A;  1GL6 A;  2LNH C;  3M6A A;  5FSW A;  5ITQ A;  4G4O A;  4LJA A;  2BJW A;  5KPT A;  1LV7 A;  3T1H M;  3SMP A;  5E6J A;  7CAT A;  2Q2E B;  5BR8 M;  1N75 A;  2XSZ D;  1Z6T A;  4MGK E;  1QQW A;  3KOW E;  5A2Q S;  1N34 M;  2FFJ A;  3CF2 A;  3SFZ A;  4GHL A;  1L1T A;  3HU1 A;  5DYI A;  4JI1 M;  4DR5 M;  1G4A E;  4PD2 A;  3KVW A;  2V6Z M;  3SYK A;  1GL7 A;  4AKG A;  3L25 A;  3SHG B;  4GKK M;  4PDG A;  1K3W A;  1L2C A;  3AOG A;  5EP1 A;  1DGH A;  1G3I A;  1EE8 A;  2KZU A;  2A5Y B;  5E26 A;  2C98 A;  3EIH A;  2Y21 A;  3MK6 A;  4LF8 M;  3CTW B;  1Z5B A;  3J7B A;  3U6D A;  1IN5 A;  3RE8 A;  4B3S M;  4DV2 M;  2V1C A;  3A45 A;  2C99 A;  3PFI A;  3PXG A;  1XMQ M;  1G59 A;  3GP1 A;  3LVV A;  5H37 D;  3FUW A;  3UK6 A;  2O5R A;  1I94 M;  4DV1 M;  4DR2 M;  3UZU A;  3QWL A;  1N33 M;  1FJG M;  2X49 A;  4RF1 A;  3GLH A;  1QYR A;  3HJ8 A;  3FTE A;  3TQS A;  4GRI A;  4LJ5 A;  1DGB A;  1HT1 E;  3K8Z A;  3UGJ A;  5ITX E;  2DZN B;  5FLX S;  1Z59 A;  2F5N A;  5LMN M;  4Z6Y A;  1IXS B;  2CHG A;  3K1J A;  3GPY A;  4DUZ M;  3SAW A;  4IBI A;  1XMO M;  4S12 A;  5EP4 A;  1N77 A;  4LJ7 A;  2XZF A;  2JA2 A;  3U6S A;  1PJI A;  1DGH B;  1QZM A;  2HCB A;  4AG6 A;  1Q39 A;  4CGY B;  2QP9 X;  3QAU A;  1SXJ B;  5FTM A;  1VDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...