3J81S

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j81S01
1Z5AA 1N33M 4JV5M 3TWLA 2F5QA 1K82A 5FLXS 4G4QA 3J80S 4DR7M 1Q39A 3C58A 3A45A 5LMUM 1XNRM 3GQ3A 3U6SA 1R2ZA 4B3SM 1L2BA 4DV3M 1R2YA 4LF9M 4G4RA 2HHHM 3U6LA 3T1HM 1HNWM 4DV5M 4JYAM 4OX9M 3GP1A 4AQYM 2XZUA 1XC8A 2HKJA 1PJIA 2EA0A 4NXNM 3JR5A 3SAUA 4JI0M 2XZFA 4LFBM 1HNXM 4DV0M 2F5SA 5IT9S 4B3RM 4JI2M 2ZM6M 1TDHA 3A46A 3U6PA 4JI6M 1XNQM 1J5EM 1NNJA 2OPFA 4G4OA 5ITYA 3DOAA 4YHHM 2ZBKB 4PCZA 1XMOM 1N34M 1FJGM 4LF5M 3GPPA 1Z5CA 1K3XA 3SAWA 5ITXE 2Q2EB 3U6DA 1PJJA 4X65M 2OQ4A 4LF8M 3SATA 3OTOM 3GPYA 3W0FA 4LF6M 2UXCM 1MX0A 3TWMA 5LMNM 4JI5M 3J81S 4DR3M 4GKKM 4DR5M 4B3MM 4DR2M 5ITXA 4PDGA 3SAVA 4DV7M 2UU9M 1HNZM 3U6EA 1IBKM 4KHPM 5IWAM 1IBLM 3GQ5A 4CISA 3U6CA 3GO8A 3A42A 4NRWA 4DV2M 4X62M 3J7AS 3GPUA 2UXDM 1Z59A 3JAMS 4DR4M 4DV4M 3U6OA 2F5OA 2UUAM 5A2QS 4JI7M 4NXMM 4LF4M 4DV6M 1N36M 2VQEM 1L1TA 1I94M 4NRVA 4X64M 4DV1M 1TDZA 3VK7A 5ITQA 4PDIA 2F5NA 4DR1M 3U6MA 3JR4A 4DUYM 1L1ZA 1XMQM 2F5PA 3SARA 4ITQA 4JI3M 1MU5A 1EE8A 4LFAM 4DR6M 5BR8M 1PM5A 5ITRA 3T1YM 1IBMM 2UXBM 4JI8M 4B3TM 1Z5BA 3U6QA 2UUCM 5ITTA 2VQFM 1Q3BA 4X66M 1L2CA 3SASA 4JI4M 1Q3CA 3GQ4A 3SBJA 1L2DA 1HR0M 4PD2A 2UUBM 4LF7M 4LFCM 2F4VM 4GKJM 5ITUA 4G4NA 4JI1M 3VK8A 4K0KM 4MB7A 1K3WA 4YY3M 4DUZM 1KFVA 2E5LM 1N32M 3TWKA 3GPXA
chains in the Genus database with same CATH superfamily
1OFHA 2LVQD 1N33M 2KXEA 2KNVA 3FTCA 1K82A 2DI0A 3J80S 3C58A 1SXJC 4LJ7A 1G3IA 3U6SA 4IBEA 3KP1E 2RRUA 2I7PA 1NV9A 2NQ8C 3SYLA 4LJ8A 4DV3M 4M9SA 4R7GA 4NSOB 1L2BA 1IN5A 4CISA 4GC9A 2DAMA 3HHYA 1QYRA 4LZZA 1QZEA 3T38A 2DWZB 2XZFA 1GJSA 3HGIA 2MJ5B 1YUBA 4RF1A 1E94E 3B7QA 5DYGA 2KDLA 2YNMD 3BBZA 1PJTA 3LVWA 4XK8F 2R44A 4AG5A 2R62A 3HU3A 2OPFA 2JZ1A 3DOAA 3LCVB 2ZBKB 3BXWA 3GPPA 3PFIA 3KFUG 3GLFA 3D8BA 2W82A 1YLAA 2WSFF 1WIVA 4B7HA 2DWNA 5C1BA 1OFIA 2KNZA 4OVZB 2JXNA 2J7OA 2GQFA 3B89A 5EXSA 4A3VB 2L7HA 3HJQA 4F1IA 5IREB 3TWMA 5H37D 4G3OA 5LMNM 3GLGA 3V76A 1PJSA 3K9PA 3SMPA 1XHBA 2R4EA 3E9SA 3AL0C 4Z6YA 1N78A 2Z3XA 1E9SA 4BLCA 1V33A 4B3MM 2XSZD 1SXJE 5BPVA 5EQTA 1VEKA 5F3WA 2KHHA 3SAVA 5JI2E 1HT2E 1D0MA 4HEOA 1TH2A 4XGIA 3KS8A 3VKHA 4BBAA 2C99A 5KQ8A 2L6OA 4KHPM 4MM3B 3GRVA 4IBFA 1RU3A 4MGKE 5EP4A 2A5YB 4X62M 1JR3D 1DO2A 2FNAA 2BNKA 2JWSA 1N77A 4NXMM 1TF0B 4LF4M 1OAOC 4DV6M 3RGSA 1I94M 1WGLA 3GRYA 3LQRA 4DV1M 3HKPA 3LVVA 3SMSA 2APLA 3BOSA 4L6V6 1QAMA 1DGGA 4KLNA 4DUYM 3ZQJA 1GKIA 1VEGA 2KNAA 4IBIA 2LVNC 1XXHE 4CJ6A 2LVAA 4AW4A 1R4GA 1EE8A 2D7HA 2K0BX 3M7GA 2JZ0A 3KSJA 4DR6M 1GL7A 4L16A 5E26A 4QHTA 1IBMM 3M6AA 5L8RF 4B3TM 4Q7JA 3U5ZB 2QHOB 5ITTA 1WXQA 2LBCA 3I4VA 2XFSA 4BB9A 1J7KA 1Q3CA 5EP2A 4LGYA 2QSFX 3GQ4A 1IXSB 1G59A 4JI4M 4Y28F 3SC3A 5KPZA 2RKOA 4FWHA 2VF8A 2DHYA 2MGWA 2DZNB 3FD9A 4II7A 2DAGA 1SXJD 4GEWA 2BJVA 1T3TA 1VEJA 2L7IA 4LJ5A 3IG8A 2VDBB 5EP3A 5EP1A 3VK8A 4OU7A 2FE8A 4JYAM 1KFVA 2XF3A 3WHLA 4OVZA 3TWKA 1YSYA 3W67A 3K92A 1VDDA 1Z5AA 2ZAOA 3B9PA 3UZUA 2B3TA 4MGYE 3T6PA 2P5TA 5LMUM 1ZMVA 3A45A 2KRUA 1Z6TA 1XNQM 4B3SM 2WSEF 4QHSA 4XBOA 2YFQA 4LF9M 2HHHM 1V92A 4NL4H 1BVSA 2L2DA 5FTKA 2QCUA 2EA0A 3GLHB 2VF7A 4GMQA 4JI0M 3SAUA 4IBDA 3R8FA 1HNXM 3F92A 4I5SA 2ZM6M 2C9OA 2J5YA 1TDHA 7CATA 3U6PA 4JI6M 1J5EM 1S3SA 2BWBA 2CEAA 4FD2A 1QAOA 1NNJA 2CV0A 3KOYE 2LHGA 4WURA 5ITYA 1NJGA 1C1KA 3E4RA 4PCZA 1WR1B 1JR3A 4LF5M 4IBKA 1NNUC 1Z5CA 3HJ8A 2JUJA 4B7GA 2CHVA 3FRHA 4CGYB 2QP9X 3GRRA 3HHZA 2G8LA 3GLIA 3OTOM 2CV2A 1IN4A 3GPYA 2ZAMA 3FRIA 1ZAEA 5KPRA 4AKHA 3L29A 3VKGA 3J81S 3PVSA 4DR3M 2LVOC 3C3EA 4GKKM 3U5ZA 1GO5A 3UJNA 1W5TA 4LY6A 4P16A 4D82A 1TR8A 4GITA 3QYEA 1IXSA 2Z4RA 3HU1A 4PDGA 5C18A 1HNZM 3U6EA 2LTUA 3FUVA 1IXRC 1NHWC 2V1CA 2G3QA 1G4AE 3A98B 1VQ1A 4QOSA 3KP0E 3GQ5A 1VG5A 3A42A 3LCUA 2RGHA 3VDPA 4GIPA 4DV2M 3J7AS 3HU2A 1NSFA 4NC6A 1OJLA 2DAIA 1Z59A 3B74A 3UGJA 2KW0A 5IZ7D 3EIEA 2VQEM 1L1TA 2DNAA 4LRSA 1E32A 4IBJA 1C7YA 1ORYB 3B7NA 1ZMWA 4GH9A 3ZC7B 3R9XB 3DZDA 3PNYA 5KQDA 2CRUA 1IFYA 4AKIA 4PDIA 5DFLA 3HZJA 3U6MA 2DKLA 3FYDA 1TTEA 1XMQM 2F5PA 3SARA 3E21A 1N75A 1AUAA 3FUXA 3RE8A 3U61B 4KT0F 4I4LA 1QAQA 5FSWA 5ITRA 5BR8M 3GLHA 1V34A 3T1YM 2L4EA 3MK6A 1Z5BA 1GABA 1D0KA 2Y20A 1Q3BA 3SASA 1TH4A 3CGWA 3I04M 1X37A 3SBJA 3U60A 1HR0M 1JQJC 1KYIA 4PD2A 2YQZA 1HQYE 4RF0A 3GLFE 2UUBM 4D81A 4CHTB 2ZTCA 3KW6A 2JY7A 2WZJA 3FYCA 2F4VM 3W68A 4AKGA 5ITUA 2QBYA 3KSXA 2KZUA 1PRBA 1HJPA 3L27A 1QANA 4YY3M 1N32M 4AI6A 3GLIB 3GLGE 2FOIC 4MGZE 3QYBA 3NBXX 1NY6A 3TE6A 4LG2A 5DYIA 2GNOA 1GJTA 3TWLA 3K2LA 3MMPA 5FLXS 5KPTA 4DR7M 1R2ZA 1SG9A 2WSCF 1XWIA 2JY8A 4IBBA 2V1UA 2QQ8A 4OW0A 2O01F 3VFDA 2XFTA 4LCBA 5EXTA 3TL4X 3AOEA 1DO0A 4DV5M 3LMMA 4OX9M 3GP1A 2HCBA 4AQYM 1GL6A 3J27B 2XZUA 1XC8A 1PJIA 1OIPA 2DZLA 2CUZA 5IT9S 1EFUB 2F5SA 2I7NA 3TPZA 4JI2M 4R3DA 3K1JA 3A46A 2K47A 3AKZA 2QNJA 3C3DA 2DWLA 1TH3A 4YHHM 1DGFA 1QDTA 1XMOM 1SXJB 1N34M 3DA1A 1FJGM 1NVMA 2X8AA 3UK6A 2DAEA 1NHGC 5FTNA 3C9PA 3QWLA 1GVNA 5FTLA 5ITXE 4WW0A 3U6DA 1ZQ9A 2QZ4A 1PJJA 4GRIA 4MGHA 1NY5A 2CHQA 2OQ4A 3SATA 1IN8A 2R6FA 2LVPC 1WJ7A 4GHLA 1OKSA 1IY2A 1HQCA 4FCWA 2VIIA 3W0FA 4Z8XA 2UXCM 4FWGA 2M60A 4QNRA 3U61A 4G6ZA 5JI3E 4AG6A 4JI5M 2EKKA 4W5WA 1H6UA 1HT1E 2X49A 2CWBA 1P3QQ 2M5ZA 2XSZA 3THGA 2DXIA 3KS4A 4DR5M 2JY6B 3CF0A 4FW9A 4M0DA 1IN6A 1G8PA 4EIWA 3U60B 4L78A 2Y21A 4DV7M 3NBIA 2UU9M 3D8LA 3L25A 1IBKM 3KXEC 1PJQA 5IWAM 1XXHB 1WHCA 3PNVA 3RFWA 1YE9A 1UM8A 1CUKA 3MJ5A 2XH9A 4IBCA 2DENA 3FKEA 4HLQA 4IIWA 4S12A 3JAMS 2QBYB 1NJFA 2MROB 4JI7M 4DR4M 4UN2B 2R18A 1IM2A 1AIPC 1N36M 3H4JA 3ZH9B 4X64M 4B08A 1DGBA 3VK7A 3KVWA 2L4FA 1T6OA 2LHCA 3HHXA 3K9OA 2OOAA 4L15A 5GKNA 2XLJA 2DWMA 4LJ9A 1QUTA 3CTWB 2KRKA 2F5NA 3JR4A 3J7BA 2H1RA 1L1ZA 2Z4SA 3AJIB 1MU5A 3QAUA 4JI3M 2N35A 3DFZA 1J09A 2HWJA 4FCTA 4NSRA 2KA6B 3VLFB 4I8OA 1R6BX 2O5RA 1PM5A 4JI8M 2R65A 3IG5A 1ZMUA 2MR9A 4L4UA 4X66M 2G5GX 2DZOB 3Q8XA 4F2LA 1L2CA 4IJEA 4TUWA 3AOGA 1JR3E 3I01M 2KEBA 3TQSA 1L2DA 3CF2A 3KOXE 1OIZA 1QDRA 4LF7M 1R7RA 2CHGA 1SXJA 5FTMA 1LTMA 4LFCM 3GLIE 2H5XA 1JB0F 1VDLA 4NOOB 4G4NA 4JI1M 2ERCA 3ZCBB 4K0KM 4LJ6A 4I81A 2Y0TA 4MB7A 4LJ4A 2R0IA 2R46A 1IN7A 3HX3A 4ANRA 4DUZM 3FTFA 1G41A 1DV0A 3T15A 2XEPA 3FTDA 4MGIE 4ZPXA 4JV5M 1OTRA 3EIHA 1WGNA 2DAKA 2F5QA 4REZA 1D2NA 3FUUA 4FWDA 4G4QA 5DNYA 1Q39A 1XNRM 3GQ3A 3L26A 1W5SA 5FTJA 2D7GA 2BJWA 1R2YA 1EIJA 5EXPA 4G4RA 3HJSA 4LZJA 3SHGB 2EO2A 1L8QA 4FVMA 3U6LA 2R4JA 3T1HM 3NWLA 1HNWM 3LQQA 2J7NA 4D80A 2JA2A 3ILKA 2HKJA 2Z8YM 1XXHA 3KOWE 4NXNM 2FH0A 1R5LA 3VDUA 3JR5A 4LFBM 4DV0M 3M0EA 1A5TA 2LNHC 4B3RM 2O25A 2DHRA 4M0WA 3LW5F 4DBGB 3RGPA 3FTEA 2YR0A 2DVWB 2K6BA 4G4OA 4HL4A 3K8ZA 4GHAA 1Y8GA 2Y0QA 4QOZC 4JN6A 1D0LA 1T43A 4P17A 3L28A 2MH8A 2CP8A 3AOEC 2L09A 4QNMA 3SAWA 2Q2EB 1K3XA 1MJGM 2X4AA 4X65M 4LF8M 2KZSA 4LGMA 2OOBA 1QVRA 2LWXA 4RNAA 1DGHB 4L8RC 4AZFA 3GLHE 2CV1A 2OO9A 4LF6M 1MX0A 4IJFA 3W0LB 3AV0A 1OQYA 1F4IA 3HWSA 2FFJA 5EXXA 1ZV1A 1QQWA 1I4WA 1XB2B 2BWEA 2HL7A 3UMMA 3J2PB 4DR2M 5ITXA 1IXZA 3E46A 2QPAA 2RGOA 5KO3A 3FE3A 2FS1A 3SYKA 3KOZE 2ZANA 4KO8A 1QZMA 1TGUA 3IECA 2C96A 3KDSE 3U6CA 3GO8A 1IBLM 4NRWA 1G71A 4FCVA 4LJAA 3I4YA 2UXDM 3GPUA 1IY0A 2JNHA 2C98A 4DV4M 3U6OA 3CF6E 5A2QS 2F5OA 2UUAM 1Q02A 2XGNA 3IHPA 3HY5A 4GC5A 4RKUF 4NRVA 3PXGA 4LRTA 2C9CA 1FNNA 2ZTDA 4R71A 1TDZA 1NV8A 3MHVC 3B7ZA 2LH0A 3GLFB 5ITQA 8CATA 1UFZA 3I51A 1KSFX 2CFOA 5EJCA 1PGYA 2EKFA 4DR1M 4CIZA 3FUWA 1LV7A 4B7FA 2C5RA 4ITQA 3GRUA 3H4MA 2JP7A 4M9XA 4LFAM 4WP2A 2K9DA 3GLGB 2UXBM 2V6ZM 2EJSA 2Z7JA 5E6JA 1MN3A 3U6QA 2UUCM 1NO1A 2JY5A 2VQFM 1QUSA 4MH0E 2EUCA 3AFHA 4M9ZA 3WHKA 3HHWA 3FUTA 2QENA 4PT5A 3SHFA 4JXJA 2D7EA 1IY1A 1OAIA 3Q8GA 4GKJM 1IQPA 2HAKA 2LXEA 4IBGA 2R45A 1GLNA 1K3WA 1DGHA 2E5LM 2CE7A 3L2AA 3SFZA 4KODA 2AHMA 1E9RA 3GPXA
chains in the Genus database with same CATH topology
1OFHA 1N33M 2KXEA 3FTCA 1K82A 3J80S 3C58A 1SXJC 4LJ7A 1G3IA 3U6SA 4IBEA 3KP1E 2I7PA 3SYLA 2NQ8C 1L2BA 4LJ8A 4DV3M 4M9SA 4R7GA 4NSOB 1IN5A 4GC9A 3HHYA 1QYRA 4LZZA 3T38A 2DWZB 2XZFA 3HGIA 1YUBA 4RF1A 1E94E 5DYGA 2YNMD 1XNQM 4AG5A 3LVWA 2OPFA 2R62A 3HU3A 3DOAA 2ZBKB 3GPPA 3PFIA 3KFUG 3GLFA 3D8BA 2W82A 2DWNA 4B7HA 5C1BA 1OFIA 4OVZB 2J7OA 5EXSA 4A3VB 2L7HA 3HJQA 5IREB 3TWMA 5H37D 5LMNM 3GLGA 3SMPA 1XHBA 2R4EA 3E9SA 3AL0C 4Z6YA 1N78A 2Z3XA 1E9SA 4BLCA 4B3MM 2XSZD 1SXJE 5BPVA 5EQTA 5F3WA 3SAVA 5JI2E 1HT2E 3VKHA 1TH2A 4XGIA 3KS8A 4BBAA 2C99A 5KQ8A 2L6OA 4KHPM 4MM3B 3GRVA 4IBFA 4MGKE 5EP4A 2A5YB 4X62M 1JR3D 1DO2A 2FNAA 2BNKA 1N77A 4NXMM 4LF4M 4DV6M 3RGSA 1I94M 3GRYA 3LQRA 4DV1M 3HKPA 3LVVA 3SMSA 3BOSA 1QAMA 1DGGA 4KLNA 4DUYM 1GKIA 4IBIA 4AW4A 2D7HA 1EE8A 3M7GA 4DR6M 3KSJA 1GL7A 4L16A 5E26A 4QHTA 1IBMM 3M6AA 4B3TM 3U5ZB 5ITTA 1WXQA 3I4VA 2XFSA 4BB9A 1J7KA 1Q3CA 5EP2A 4LGYA 3GQ4A 1G59A 1IXSB 4JI4M 3SC3A 5KPZA 2RKOA 4FWHA 2DZNB 3FD9A 4II7A 1SXJD 2BJVA 1T3TA 2L7IA 4LJ5A 3IG8A 5EP1A 5EP3A 3VK8A 4OU7A 2FE8A 4JYAM 1KFVA 2XF3A 3WHLA 4OVZA 3TWKA 1YSYA 3K92A 1VDDA 1Z5AA 2ZAOA 3B9PA 3UZUA 4MGYE 2P5TA 5LMUM 3A45A 2KRUA 1Z6TA 4B3SM 4QHSA 4XBOA 2YFQA 4LF9M 2HHHM 4NL4H 5FTKA 2QCUA 2EA0A 3GLHB 4GMQA 3SAUA 4JI0M 3R8FA 4IBDA 1HNXM 4I5SA 2ZM6M 2C9OA 1TDHA 7CATA 3U6PA 4JI6M 1J5EM 1S3SA 1NNJA 2CEAA 4FD2A 1QAOA 2CV0A 3KOYE 4WURA 5ITYA 1NJGA 1C1KA 3E4RA 4PCZA 1JR3A 4LF5M 4IBKA 1NNUC 1Z5CA 3HJ8A 4B7GA 2CHVA 4CGYB 2QP9X 3GRRA 3HHZA 2G8LA 3GLIA 3OTOM 2CV2A 1IN4A 3GPYA 2ZAMA 1ZAEA 5KPRA 4AKHA 3L29A 3VKGA 3J81S 3PVSA 4DR3M 4GKKM 3U5ZA 3UJNA 1W5TA 4LY6A 4P16A 4D82A 4GITA 4PDGA 2Z4RA 3HU1A 5C18A 1HNZM 3U6EA 3FUVA 1IXRC 1NHWC 2V1CA 1G4AE 3A98B 3GQ5A 4QOSA 3KP0E 4CISA 3A42A 4DV2M 2RGHA 3VDPA 4GIPA 3J7AS 3HU2A 1NSFA 1OJLA 1Z59A 3UGJA 2KW0A 5IZ7D 3EIEA 2VQEM 1L1TA 4LRSA 1E32A 4IBJA 1ORYB 4GH9A 3ZC7B 3R9XB 3DZDA 3PNYA 5KQDA 4AKIA 4PDIA 3U6MA 3FYDA 1XMQM 2F5PA 3SARA 1N75A 3FUXA 3RE8A 3U61B 5FSWA 4I4LA 1QAQA 5ITRA 5BR8M 3T1YM 3GLHA 3MK6A 1Z5BA 2Y20A 1Q3BA 3SASA 1TH4A 1X37A 3SBJA 3U60A 1HR0M 1JQJC 1KYIA 4PD2A 2YQZA 1HQYE 4RF0A 2UUBM 4D81A 4CHTB 3KW6A 3FYCA 2F4VM 4AKGA 5ITUA 2QBYA 3KSXA 3L27A 2KZUA 1QANA 4YY3M 1N32M 4AI6A 3GLIB 2FOIC 4MGZE 1NY6A 3TE6A 4LG2A 5DYIA 3TWLA 3K2LA 5FLXS 5KPTA 4DR7M 1R2ZA 1XWIA 4IBBA 2V1UA 4OW0A 3VFDA 2XFTA 4LCBA 5EXTA 3TL4X 3AOEA 1DO0A 4DV5M 3LMMA 4OX9M 3GP1A 2HCBA 4AQYM 1GL6A 3J27B 2XZUA 1XC8A 1PJIA 5IT9S 2CUZA 2F5SA 2I7NA 3TPZA 4JI2M 4R3DA 3K1JA 3A46A 2K47A 3AKZA 2DWLA 1TH3A 4YHHM 1DGFA 1XMOM 1SXJB 1N34M 3DA1A 1FJGM 1NVMA 2X8AA 3UK6A 5FTNA 1NHGC 3QWLA 1GVNA 5FTLA 5ITXE 4WW0A 3U6DA 1ZQ9A 2QZ4A 1PJJA 4GRIA 4MGHA 1NY5A 2CHQA 2OQ4A 3SATA 1IN8A 4GHLA 1IY2A 1HQCA 4FCWA 2VIIA 3W0FA 4Z8XA 2UXCM 4FWGA 2M60A 4QNRA 3U61A 4G6ZA 5JI3E 4AG6A 4JI5M 4W5WA 1H6UA 1HT1E 2X49A 2M5ZA 2XSZA 3THGA 2DXIA 3KS4A 4DR5M 3CF0A 4FW9A 4M0DA 1IN6A 1G8PA 4EIWA 3U60B 4L78A 2Y21A 4DV7M 3NBIA 2UU9M 3D8LA 3L25A 1IBKM 3KXEC 5IWAM 1XXHB 3PNVA 3RFWA 1YE9A 1UM8A 3MJ5A 2XH9A 4IBCA 3FKEA 4HLQA 4IIWA 4S12A 3JAMS 2QBYB 4DR4M 1NJFA 4JI7M 2R18A 1IM2A 1N36M 3ZH9B 4X64M 4B08A 1DGBA 3VK7A 3KVWA 2DWMA 3HHXA 5GKNA 4L15A 2XLJA 4LJ9A 3CTWB 2F5NA 2KRKA 3JR4A 3J7BA 2H1RA 1L1ZA 2Z4SA 3AJIB 1MU5A 3QAUA 4JI3M 3DFZA 1J09A 4FCTA 4NSRA 2KA6B 3VLFB 4I8OA 1R6BX 2O5RA 1PM5A 4JI8M 2R65A 3IG5A 4L4UA 4X66M 2G5GX 2DZOB 3Q8XA 1L2CA 4TUWA 4IJEA 3AOGA 2KEBA 3TQSA 1L2DA 3CF2A 3KOXE 4LF7M 1R7RA 2CHGA 1SXJA 5FTMA 4LFCM 4NOOB 4G4NA 4JI1M 2ERCA 3ZCBB 4K0KM 4LJ6A 4I81A 2Y0TA 4MB7A 4LJ4A 2R46A 1IN7A 4DUZM 3FTFA 1G41A 3T15A 2XEPA 3FTDA 4MGIE 4ZPXA 4JV5M 3EIHA 2F5QA 4REZA 1D2NA 3FUUA 4FWDA 4G4QA 5DNYA 1Q39A 1XNRM 3GQ3A 3L26A 1W5SA 5FTJA 2D7GA 2BJWA 1R2YA 5EXPA 4G4RA 3HJSA 4LZJA 3SHGB 2EO2A 1L8QA 4FVMA 3U6LA 2R4JA 3T1HM 3NWLA 1HNWM 3LQQA 2J7NA 4D80A 2JA2A 3ILKA 2HKJA 1XXHA 3KOWE 4NXNM 3JR5A 4LFBM 3VDUA 4DV0M 3M0EA 4B3RM 2LNHC 2DHRA 4M0WA 3RGPA 3FTEA 2YR0A 2DVWB 4G4OA 4HL4A 3K8ZA 4GHAA 2Y0QA 4QOZC 4JN6A 3L28A 1K3XA 3AOEC 4QNMA 2L09A 3SAWA 2Q2EB 2X4AA 4X65M 4LF8M 2KZSA 4LGMA 1QVRA 2LWXA 4RNAA 1DGHB 4L8RC 4AZFA 2CV1A 4LF6M 1MX0A 4IJFA 3W0LB 3AV0A 3HWSA 2FFJA 5EXXA 1QQWA 1I4WA 2HL7A 3UMMA 3J2PB 4DR2M 5ITXA 1IXZA 5KO3A 2QPAA 2RGOA 3SYKA 3KOZE 2ZANA 4KO8A 1QZMA 1TGUA 1IBLM 2C96A 3KDSE 3U6CA 3GO8A 4NRWA 4LJAA 4FCVA 3I4YA 2UXDM 3GPUA 1IY0A 2C98A 4DV4M 3U6OA 3CF6E 5A2QS 2F5OA 2UUAM 3PXGA 2XGNA 4GC5A 4NRVA 4LRTA 2C9CA 1FNNA 1TDZA 3MHVC 2LH0A 3GLFB 5ITQA 8CATA 3I51A 1KSFX 2CFOA 5EJCA 4DR1M 3FUWA 1LV7A 4B7FA 2C5RA 4ITQA 3GRUA 3H4MA 4M9XA 4LFAM 3GLGB 2UXBM 2V6ZM 2Z7JA 5E6JA 3U6QA 2UUCM 2VQFM 4MH0E 2EUCA 3AFHA 4M9ZA 3WHKA 3HHWA 3FUTA 2QENA 4PT5A 3SHFA 4JXJA 2D7EA 1IY1A 4GKJM 1IQPA 2LXEA 4IBGA 2R45A 1GLNA 1K3WA 1DGHA 2E5LM 2CE7A 3L2AA 3SFZA 4KODA 2AHMA 1E9RA 3GPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5A A;  1N33 M;  4JV5 M;  3TWL A;  2F5Q A;  1K82 A;  5FLX S;  4G4Q A;  3J80 S;  4DR7 M;  1Q39 A;  3C58 A;  3A45 A;  5LMU M;  1XNR M;  3GQ3 A;  3U6S A;  1R2Z A;  4B3S M;  1L2B A;  4DV3 M;  1R2Y A;  4LF9 M;  4G4R A;  2HHH M;  3U6L A;  3T1H M;  1HNW M;  4DV5 M;  4JYA M;  4OX9 M;  3GP1 A;  4AQY M;  2XZU A;  1XC8 A;  2HKJ A;  1PJI A;  2EA0 A;  4NXN M;  3JR5 A;  3SAU A;  4JI0 M;  2XZF A;  4LFB M;  1HNX M;  4DV0 M;  2F5S A;  5IT9 S;  4B3R M;  4JI2 M;  2ZM6 M;  1TDH A;  3A46 A;  3U6P A;  4JI6 M;  1XNQ M;  1J5E M;  1NNJ A;  2OPF A;  4G4O A;  5ITY A;  3DOA A;  4YHH M;  2ZBK B;  4PCZ A;  1XMO M;  1N34 M;  1FJG M;  4LF5 M;  3GPP A;  1Z5C A;  1K3X A;  3SAW A;  5ITX E;  2Q2E B;  3U6D A;  1PJJ A;  4X65 M;  2OQ4 A;  4LF8 M;  3SAT A;  3OTO M;  3GPY A;  3W0F A;  4LF6 M;  2UXC M;  1MX0 A;  3TWM A;  5LMN M;  4JI5 M;  3J81 S;  4DR3 M;  4GKK M;  4DR5 M;  4B3M M;  4DR2 M;  5ITX A;  4PDG A;  3SAV A;  4DV7 M;  2UU9 M;  1HNZ M;  3U6E A;  1IBK M;  4KHP M;  5IWA M;  1IBL M;  3GQ5 A;  4CIS A;  3U6C A;  3GO8 A;  3A42 A;  4NRW A;  4DV2 M;  4X62 M;  3J7A S;  3GPU A;  2UXD M;  1Z59 A;  3JAM S;  4DR4 M;  4DV4 M;  3U6O A;  2F5O A;  2UUA M;  5A2Q S;  4JI7 M;  4NXM M;  4LF4 M;  4DV6 M;  1N36 M;  2VQE M;  1L1T A;  1I94 M;  4NRV A;  4X64 M;  4DV1 M;  1TDZ A;  3VK7 A;  5ITQ A;  4PDI A;  2F5N A;  4DR1 M;  3U6M A;  3JR4 A;  4DUY M;  1L1Z A;  1XMQ M;  2F5P A;  3SAR A;  4ITQ A;  4JI3 M;  1MU5 A;  1EE8 A;  4LFA M;  4DR6 M;  5BR8 M;  1PM5 A;  5ITR A;  3T1Y M;  1IBM M;  2UXB M;  4JI8 M;  4B3T M;  1Z5B A;  3U6Q A;  2UUC M;  5ITT A;  2VQF M;  1Q3B A;  4X66 M;  1L2C A;  3SAS A;  4JI4 M;  1Q3C A;  3GQ4 A;  3SBJ A;  1L2D A;  1HR0 M;  4PD2 A;  2UUB M;  4LF7 M;  4LFC M;  2F4V M;  4GKJ M;  5ITU A;  4G4N A;  4JI1 M;  3VK8 A;  4K0K M;  4MB7 A;  1K3W A;  4YY3 M;  4DUZ M;  1KFV A;  2E5L M;  1N32 M;  3TWK A;  3GPX A; 
#chains in the Genus database with same CATH topology
 1OFH A;  2LVQ D;  1N33 M;  2KXE A;  2KNV A;  3FTC A;  1K82 A;  2DI0 A;  3J80 S;  3C58 A;  1SXJ C;  4LJ7 A;  1G3I A;  3U6S A;  4IBE A;  3KP1 E;  2RRU A;  2I7P A;  1NV9 A;  2NQ8 C;  3SYL A;  4LJ8 A;  4DV3 M;  4M9S A;  4R7G A;  4NSO B;  1L2B A;  1IN5 A;  4CIS A;  4GC9 A;  2DAM A;  3HHY A;  1QYR A;  4LZZ A;  1QZE A;  3T38 A;  2DWZ B;  2XZF A;  1GJS A;  3HGI A;  2MJ5 B;  1YUB A;  4RF1 A;  1E94 E;  3B7Q A;  5DYG A;  2KDL A;  2YNM D;  3BBZ A;  1PJT A;  3LVW A;  4XK8 F;  2R44 A;  4AG5 A;  2R62 A;  3HU3 A;  2OPF A;  2JZ1 A;  3DOA A;  3LCV B;  2ZBK B;  3BXW A;  3GPP A;  3PFI A;  3KFU G;  3GLF A;  3D8B A;  2W82 A;  1YLA A;  2WSF F;  1WIV A;  4B7H A;  2DWN A;  5C1B A;  1OFI A;  2KNZ A;  4OVZ B;  2JXN A;  2J7O A;  2GQF A;  3B89 A;  5EXS A;  4A3V B;  2L7H A;  3HJQ A;  4F1I A;  5IRE B;  3TWM A;  5H37 D;  4G3O A;  5LMN M;  3GLG A;  3V76 A;  1PJS A;  3K9P A;  3SMP A;  1XHB A;  2R4E A;  3E9S A;  3AL0 C;  4Z6Y A;  1N78 A;  2Z3X A;  1E9S A;  4BLC A;  1V33 A;  4B3M M;  2XSZ D;  1SXJ E;  5BPV A;  5EQT A;  1VEK A;  5F3W A;  2KHH A;  3SAV A;  5JI2 E;  1HT2 E;  1D0M A;  4HEO A;  1TH2 A;  4XGI A;  3KS8 A;  3VKH A;  4BBA A;  2C99 A;  5KQ8 A;  2L6O A;  4KHP M;  4MM3 B;  3GRV A;  4IBF A;  1RU3 A;  4MGK E;  5EP4 A;  2A5Y B;  4X62 M;  1JR3 D;  1DO2 A;  2FNA A;  2BNK A;  2JWS A;  1N77 A;  4NXM M;  1TF0 B;  4LF4 M;  1OAO C;  4DV6 M;  3RGS A;  1I94 M;  1WGL A;  3GRY A;  3LQR A;  4DV1 M;  3HKP A;  3LVV A;  3SMS A;  2APL A;  3BOS A;  4L6V 6;  1QAM A;  1DGG A;  4KLN A;  4DUY M;  3ZQJ A;  1GKI A;  1VEG A;  2KNA A;  4IBI A;  2LVN C;  1XXH E;  4CJ6 A;  2LVA A;  4AW4 A;  1R4G A;  1EE8 A;  2D7H A;  2K0B X;  3M7G A;  2JZ0 A;  3KSJ A;  4DR6 M;  1GL7 A;  4L16 A;  5E26 A;  4QHT A;  1IBM M;  3M6A A;  5L8R F;  4B3T M;  4Q7J A;  3U5Z B;  2QHO B;  5ITT A;  1WXQ A;  2LBC A;  3I4V A;  2XFS A;  4BB9 A;  1J7K A;  1Q3C A;  5EP2 A;  4LGY A;  2QSF X;  3GQ4 A;  1IXS B;  1G59 A;  4JI4 M;  4Y28 F;  3SC3 A;  5KPZ A;  2RKO A;  4FWH A;  2VF8 A;  2DHY A;  2MGW A;  2DZN B;  3FD9 A;  4II7 A;  2DAG A;  1SXJ D;  4GEW A;  2BJV A;  1T3T A;  1VEJ A;  2L7I A;  4LJ5 A;  3IG8 A;  2VDB B;  5EP3 A;  5EP1 A;  3VK8 A;  4OU7 A;  2FE8 A;  4JYA M;  1KFV A;  2XF3 A;  3WHL A;  4OVZ A;  3TWK A;  1YSY A;  3W67 A;  3K92 A;  1VDD A;  1Z5A A;  2ZAO A;  3B9P A;  3UZU A;  2B3T A;  4MGY E;  3T6P A;  2P5T A;  5LMU M;  1ZMV A;  3A45 A;  2KRU A;  1Z6T A;  1XNQ M;  4B3S M;  2WSE F;  4QHS A;  4XBO A;  2YFQ A;  4LF9 M;  2HHH M;  1V92 A;  4NL4 H;  1BVS A;  2L2D A;  5FTK A;  2QCU A;  2EA0 A;  3GLH B;  2VF7 A;  4GMQ A;  4JI0 M;  3SAU A;  4IBD A;  3R8F A;  1HNX M;  3F92 A;  4I5S A;  2ZM6 M;  2C9O A;  2J5Y A;  1TDH A;  7CAT A;  3U6P A;  4JI6 M;  1J5E M;  1S3S A;  2BWB A;  2CEA A;  4FD2 A;  1QAO A;  1NNJ A;  2CV0 A;  3KOY E;  2LHG A;  4WUR A;  5ITY A;  1NJG A;  1C1K A;  3E4R A;  4PCZ A;  1WR1 B;  1JR3 A;  4LF5 M;  4IBK A;  1NNU C;  1Z5C A;  3HJ8 A;  2JUJ A;  4B7G A;  2CHV A;  3FRH A;  4CGY B;  2QP9 X;  3GRR A;  3HHZ A;  2G8L A;  3GLI A;  3OTO M;  2CV2 A;  1IN4 A;  3GPY A;  2ZAM A;  3FRI A;  1ZAE A;  5KPR A;  4AKH A;  3L29 A;  3VKG A;  3J81 S;  3PVS A;  4DR3 M;  2LVO C;  3C3E A;  4GKK M;  3U5Z A;  1GO5 A;  3UJN A;  1W5T A;  4LY6 A;  4P16 A;  4D82 A;  1TR8 A;  4GIT A;  3QYE A;  1IXS A;  2Z4R A;  3HU1 A;  4PDG A;  5C18 A;  1HNZ M;  3U6E A;  2LTU A;  3FUV A;  1IXR C;  1NHW C;  2V1C A;  2G3Q A;  1G4A E;  3A98 B;  1VQ1 A;  4QOS A;  3KP0 E;  3GQ5 A;  1VG5 A;  3A42 A;  3LCU A;  2RGH A;  3VDP A;  4GIP A;  4DV2 M;  3J7A S;  3HU2 A;  1NSF A;  4NC6 A;  1OJL A;  2DAI A;  1Z59 A;  3B74 A;  3UGJ A;  2KW0 A;  5IZ7 D;  3EIE A;  2VQE M;  1L1T A;  2DNA A;  4LRS A;  1E32 A;  4IBJ A;  1C7Y A;  1ORY B;  3B7N A;  1ZMW A;  4GH9 A;  3ZC7 B;  3R9X B;  3DZD A;  3PNY A;  5KQD A;  2CRU A;  1IFY A;  4AKI A;  4PDI A;  5DFL A;  3HZJ A;  3U6M A;  2DKL A;  3FYD A;  1TTE A;  1XMQ M;  2F5P A;  3SAR A;  3E21 A;  1N75 A;  1AUA A;  3FUX A;  3RE8 A;  3U61 B;  4KT0 F;  4I4L A;  1QAQ A;  5FSW A;  5ITR A;  5BR8 M;  3GLH A;  1V34 A;  3T1Y M;  2L4E A;  3MK6 A;  1Z5B A;  1GAB A;  1D0K A;  2Y20 A;  1Q3B A;  3SAS A;  1TH4 A;  3CGW A;  3I04 M;  1X37 A;  3SBJ A;  3U60 A;  1HR0 M;  1JQJ C;  1KYI A;  4PD2 A;  2YQZ A;  1HQY E;  4RF0 A;  3GLF E;  2UUB M;  4D81 A;  4CHT B;  2ZTC A;  3KW6 A;  2JY7 A;  2WZJ A;  3FYC A;  2F4V M;  3W68 A;  4AKG A;  5ITU A;  2QBY A;  3KSX A;  2KZU A;  1PRB A;  1HJP A;  3L27 A;  1QAN A;  4YY3 M;  1N32 M;  4AI6 A;  3GLI B;  3GLG E;  2FOI C;  4MGZ E;  3QYB A;  3NBX X;  1NY6 A;  3TE6 A;  4LG2 A;  5DYI A;  2GNO A;  1GJT A;  3TWL A;  3K2L A;  3MMP A;  5FLX S;  5KPT A;  4DR7 M;  1R2Z A;  1SG9 A;  2WSC F;  1XWI A;  2JY8 A;  4IBB A;  2V1U A;  2QQ8 A;  4OW0 A;  2O01 F;  3VFD A;  2XFT A;  4LCB A;  5EXT A;  3TL4 X;  3AOE A;  1DO0 A;  4DV5 M;  3LMM A;  4OX9 M;  3GP1 A;  2HCB A;  4AQY M;  1GL6 A;  3J27 B;  2XZU A;  1XC8 A;  1PJI A;  1OIP A;  2DZL A;  2CUZ A;  5IT9 S;  1EFU B;  2F5S A;  2I7N A;  3TPZ A;  4JI2 M;  4R3D A;  3K1J A;  3A46 A;  2K47 A;  3AKZ A;  2QNJ A;  3C3D A;  2DWL A;  1TH3 A;  4YHH M;  1DGF A;  1QDT A;  1XMO M;  1SXJ B;  1N34 M;  3DA1 A;  1FJG M;  1NVM A;  2X8A A;  3UK6 A;  2DAE A;  1NHG C;  5FTN A;  3C9P A;  3QWL A;  1GVN A;  5FTL A;  5ITX E;  4WW0 A;  3U6D A;  1ZQ9 A;  2QZ4 A;  1PJJ A;  4GRI A;  4MGH A;  1NY5 A;  2CHQ A;  2OQ4 A;  3SAT A;  1IN8 A;  2R6F A;  2LVP C;  1WJ7 A;  4GHL A;  1OKS A;  1IY2 A;  1HQC A;  4FCW A;  2VII A;  3W0F A;  4Z8X A;  2UXC M;  4FWG A;  2M60 A;  4QNR A;  3U61 A;  4G6Z A;  5JI3 E;  4AG6 A;  4JI5 M;  2EKK A;  4W5W A;  1H6U A;  1HT1 E;  2X49 A;  2CWB A;  1P3Q Q;  2M5Z A;  2XSZ A;  3THG A;  2DXI A;  3KS4 A;  4DR5 M;  2JY6 B;  3CF0 A;  4FW9 A;  4M0D A;  1IN6 A;  1G8P A;  4EIW A;  3U60 B;  4L78 A;  2Y21 A;  4DV7 M;  3NBI A;  2UU9 M;  3D8L A;  3L25 A;  1IBK M;  3KXE C;  1PJQ A;  5IWA M;  1XXH B;  1WHC A;  3PNV A;  3RFW A;  1YE9 A;  1UM8 A;  1CUK A;  3MJ5 A;  2XH9 A;  4IBC A;  2DEN A;  3FKE A;  4HLQ A;  4IIW A;  4S12 A;  3JAM S;  2QBY B;  1NJF A;  2MRO B;  4JI7 M;  4DR4 M;  4UN2 B;  2R18 A;  1IM2 A;  1AIP C;  1N36 M;  3H4J A;  3ZH9 B;  4X64 M;  4B08 A;  1DGB A;  3VK7 A;  3KVW A;  2L4F A;  1T6O A;  2LHC A;  3HHX A;  3K9O A;  2OOA A;  4L15 A;  5GKN A;  2XLJ A;  2DWM A;  4LJ9 A;  1QUT A;  3CTW B;  2KRK A;  2F5N A;  3JR4 A;  3J7B A;  2H1R A;  1L1Z A;  2Z4S A;  3AJI B;  1MU5 A;  3QAU A;  4JI3 M;  2N35 A;  3DFZ A;  1J09 A;  2HWJ A;  4FCT A;  4NSR A;  2KA6 B;  3VLF B;  4I8O A;  1R6B X;  2O5R A;  1PM5 A;  4JI8 M;  2R65 A;  3IG5 A;  1ZMU A;  2MR9 A;  4L4U A;  4X66 M;  2G5G X;  2DZO B;  3Q8X A;  4F2L A;  1L2C A;  4IJE A;  4TUW A;  3AOG A;  1JR3 E;  3I01 M;  2KEB A;  3TQS A;  1L2D A;  3CF2 A;  3KOX E;  1OIZ A;  1QDR A;  4LF7 M;  1R7R A;  2CHG A;  1SXJ A;  5FTM A;  1LTM A;  4LFC M;  3GLI E;  2H5X A;  1JB0 F;  1VDL A;  4NOO B;  4G4N A;  4JI1 M;  2ERC A;  3ZCB B;  4K0K M;  4LJ6 A;  4I81 A;  2Y0T A;  4MB7 A;  4LJ4 A;  2R0I A;  2R46 A;  1IN7 A;  3HX3 A;  4ANR A;  4DUZ M;  3FTF A;  1G41 A;  1DV0 A;  3T15 A;  2XEP A;  3FTD A;  4MGI E;  4ZPX A;  4JV5 M;  1OTR A;  3EIH A;  1WGN A;  2DAK A;  2F5Q A;  4REZ A;  1D2N A;  3FUU A;  4FWD A;  4G4Q A;  5DNY A;  1Q39 A;  1XNR M;  3GQ3 A;  3L26 A;  1W5S A;  5FTJ A;  2D7G A;  2BJW A;  1R2Y A;  1EIJ A;  5EXP A;  4G4R A;  3HJS A;  4LZJ A;  3SHG B;  2EO2 A;  1L8Q A;  4FVM A;  3U6L A;  2R4J A;  3T1H M;  3NWL A;  1HNW M;  3LQQ A;  2J7N A;  4D80 A;  2JA2 A;  3ILK A;  2HKJ A;  2Z8Y M;  1XXH A;  3KOW E;  4NXN M;  2FH0 A;  1R5L A;  3VDU A;  3JR5 A;  4LFB M;  4DV0 M;  3M0E A;  1A5T A;  2LNH C;  4B3R M;  2O25 A;  2DHR A;  4M0W A;  3LW5 F;  4DBG B;  3RGP A;  3FTE A;  2YR0 A;  2DVW B;  2K6B A;  4G4O A;  4HL4 A;  3K8Z A;  4GHA A;  1Y8G A;  2Y0Q A;  4QOZ C;  4JN6 A;  1D0L A;  1T43 A;  4P17 A;  3L28 A;  2MH8 A;  2CP8 A;  3AOE C;  2L09 A;  4QNM A;  3SAW A;  2Q2E B;  1K3X A;  1MJG M;  2X4A A;  4X65 M;  4LF8 M;  2KZS A;  4LGM A;  2OOB A;  1QVR A;  2LWX A;  4RNA A;  1DGH B;  4L8R C;  4AZF A;  3GLH E;  2CV1 A;  2OO9 A;  4LF6 M;  1MX0 A;  4IJF A;  3W0L B;  3AV0 A;  1OQY A;  1F4I A;  3HWS A;  2FFJ A;  5EXX A;  1ZV1 A;  1QQW A;  1I4W A;  1XB2 B;  2BWE A;  2HL7 A;  3UMM A;  3J2P B;  4DR2 M;  5ITX A;  1IXZ A;  3E46 A;  2QPA A;  2RGO A;  5KO3 A;  3FE3 A;  2FS1 A;  3SYK A;  3KOZ E;  2ZAN A;  4KO8 A;  1QZM A;  1TGU A;  3IEC A;  2C96 A;  3KDS E;  3U6C A;  3GO8 A;  1IBL M;  4NRW A;  1G71 A;  4FCV A;  4LJA A;  3I4Y A;  2UXD M;  3GPU A;  1IY0 A;  2JNH A;  2C98 A;  4DV4 M;  3U6O A;  3CF6 E;  5A2Q S;  2F5O A;  2UUA M;  1Q02 A;  2XGN A;  3IHP A;  3HY5 A;  4GC5 A;  4RKU F;  4NRV A;  3PXG A;  4LRT A;  2C9C A;  1FNN A;  2ZTD A;  4R71 A;  1TDZ A;  1NV8 A;  3MHV C;  3B7Z A;  2LH0 A;  3GLF B;  5ITQ A;  8CAT A;  1UFZ A;  3I51 A;  1KSF X;  2CFO A;  5EJC A;  1PGY A;  2EKF A;  4DR1 M;  4CIZ A;  3FUW A;  1LV7 A;  4B7F A;  2C5R A;  4ITQ A;  3GRU A;  3H4M A;  2JP7 A;  4M9X A;  4LFA M;  4WP2 A;  2K9D A;  3GLG B;  2UXB M;  2V6Z M;  2EJS A;  2Z7J A;  5E6J A;  1MN3 A;  3U6Q A;  2UUC M;  1NO1 A;  2JY5 A;  2VQF M;  1QUS A;  4MH0 E;  2EUC A;  3AFH A;  4M9Z A;  3WHK A;  3HHW A;  3FUT A;  2QEN A;  4PT5 A;  3SHF A;  4JXJ A;  2D7E A;  1IY1 A;  1OAI A;  3Q8G A;  4GKJ M;  1IQP A;  2HAK A;  2LXE A;  4IBG A;  2R45 A;  1GLN A;  1K3W A;  1DGH A;  2E5L M;  2CE7 A;  3L2A A;  3SFZ A;  4KOD A;  2AHM A;  1E9R A;  3GPX A; 
#chains in the Genus database with same CATH homology
 1OFH A;  1N33 M;  2KXE A;  3FTC A;  1K82 A;  3J80 S;  3C58 A;  1SXJ C;  4LJ7 A;  1G3I A;  3U6S A;  4IBE A;  3KP1 E;  2I7P A;  3SYL A;  2NQ8 C;  1L2B A;  4LJ8 A;  4DV3 M;  4M9S A;  4R7G A;  4NSO B;  1IN5 A;  4GC9 A;  3HHY A;  1QYR A;  4LZZ A;  3T38 A;  2DWZ B;  2XZF A;  3HGI A;  1YUB A;  4RF1 A;  1E94 E;  5DYG A;  2YNM D;  1XNQ M;  4AG5 A;  3LVW A;  2OPF A;  2R62 A;  3HU3 A;  3DOA A;  2ZBK B;  3GPP A;  3PFI A;  3KFU G;  3GLF A;  3D8B A;  2W82 A;  2DWN A;  4B7H A;  5C1B A;  1OFI A;  4OVZ B;  2J7O A;  5EXS A;  4A3V B;  2L7H A;  3HJQ A;  5IRE B;  3TWM A;  5H37 D;  5LMN M;  3GLG A;  3SMP A;  1XHB A;  2R4E A;  3E9S A;  3AL0 C;  4Z6Y A;  1N78 A;  2Z3X A;  1E9S A;  4BLC A;  4B3M M;  2XSZ D;  1SXJ E;  5BPV A;  5EQT A;  5F3W A;  3SAV A;  5JI2 E;  1HT2 E;  3VKH A;  1TH2 A;  4XGI A;  3KS8 A;  4BBA A;  2C99 A;  5KQ8 A;  2L6O A;  4KHP M;  4MM3 B;  3GRV A;  4IBF A;  4MGK E;  5EP4 A;  2A5Y B;  4X62 M;  1JR3 D;  1DO2 A;  2FNA A;  2BNK A;  1N77 A;  4NXM M;  4LF4 M;  4DV6 M;  3RGS A;  1I94 M;  3GRY A;  3LQR A;  4DV1 M;  3HKP A;  3LVV A;  3SMS A;  3BOS A;  1QAM A;  1DGG A;  4KLN A;  4DUY M;  1GKI A;  4IBI A;  4AW4 A;  2D7H A;  1EE8 A;  3M7G A;  4DR6 M;  3KSJ A;  1GL7 A;  4L16 A;  5E26 A;  4QHT A;  1IBM M;  3M6A A;  4B3T M;  3U5Z B;  5ITT A;  1WXQ A;  3I4V A;  2XFS A;  4BB9 A;  1J7K A;  1Q3C A;  5EP2 A;  4LGY A;  3GQ4 A;  1G59 A;  1IXS B;  4JI4 M;  3SC3 A;  5KPZ A;  2RKO A;  4FWH A;  2DZN B;  3FD9 A;  4II7 A;  1SXJ D;  2BJV A;  1T3T A;  2L7I A;  4LJ5 A;  3IG8 A;  5EP1 A;  5EP3 A;  3VK8 A;  4OU7 A;  2FE8 A;  4JYA M;  1KFV A;  2XF3 A;  3WHL A;  4OVZ A;  3TWK A;  1YSY A;  3K92 A;  1VDD A;  1Z5A A;  2ZAO A;  3B9P A;  3UZU A;  4MGY E;  2P5T A;  5LMU M;  3A45 A;  2KRU A;  1Z6T A;  4B3S M;  4QHS A;  4XBO A;  2YFQ A;  4LF9 M;  2HHH M;  4NL4 H;  5FTK A;  2QCU A;  2EA0 A;  3GLH B;  4GMQ A;  3SAU A;  4JI0 M;  3R8F A;  4IBD A;  1HNX M;  4I5S A;  2ZM6 M;  2C9O A;  1TDH A;  7CAT A;  3U6P A;  4JI6 M;  1J5E M;  1S3S A;  1NNJ A;  2CEA A;  4FD2 A;  1QAO A;  2CV0 A;  3KOY E;  4WUR A;  5ITY A;  1NJG A;  1C1K A;  3E4R A;  4PCZ A;  1JR3 A;  4LF5 M;  4IBK A;  1NNU C;  1Z5C A;  3HJ8 A;  4B7G A;  2CHV A;  4CGY B;  2QP9 X;  3GRR A;  3HHZ A;  2G8L A;  3GLI A;  3OTO M;  2CV2 A;  1IN4 A;  3GPY A;  2ZAM A;  1ZAE A;  5KPR A;  4AKH A;  3L29 A;  3VKG A;  3J81 S;  3PVS A;  4DR3 M;  4GKK M;  3U5Z A;  3UJN A;  1W5T A;  4LY6 A;  4P16 A;  4D82 A;  4GIT A;  4PDG A;  2Z4R A;  3HU1 A;  5C18 A;  1HNZ M;  3U6E A;  3FUV A;  1IXR C;  1NHW C;  2V1C A;  1G4A E;  3A98 B;  3GQ5 A;  4QOS A;  3KP0 E;  4CIS A;  3A42 A;  4DV2 M;  2RGH A;  3VDP A;  4GIP A;  3J7A S;  3HU2 A;  1NSF A;  1OJL A;  1Z59 A;  3UGJ A;  2KW0 A;  5IZ7 D;  3EIE A;  2VQE M;  1L1T A;  4LRS A;  1E32 A;  4IBJ A;  1ORY B;  4GH9 A;  3ZC7 B;  3R9X B;  3DZD A;  3PNY A;  5KQD A;  4AKI A;  4PDI A;  3U6M A;  3FYD A;  1XMQ M;  2F5P A;  3SAR A;  1N75 A;  3FUX A;  3RE8 A;  3U61 B;  5FSW A;  4I4L A;  1QAQ A;  5ITR A;  5BR8 M;  3T1Y M;  3GLH A;  3MK6 A;  1Z5B A;  2Y20 A;  1Q3B A;  3SAS A;  1TH4 A;  1X37 A;  3SBJ A;  3U60 A;  1HR0 M;  1JQJ C;  1KYI A;  4PD2 A;  2YQZ A;  1HQY E;  4RF0 A;  2UUB M;  4D81 A;  4CHT B;  3KW6 A;  3FYC A;  2F4V M;  4AKG A;  5ITU A;  2QBY A;  3KSX A;  3L27 A;  2KZU A;  1QAN A;  4YY3 M;  1N32 M;  4AI6 A;  3GLI B;  2FOI C;  4MGZ E;  1NY6 A;  3TE6 A;  4LG2 A;  5DYI A;  3TWL A;  3K2L A;  5FLX S;  5KPT A;  4DR7 M;  1R2Z A;  1XWI A;  4IBB A;  2V1U A;  4OW0 A;  3VFD A;  2XFT A;  4LCB A;  5EXT A;  3TL4 X;  3AOE A;  1DO0 A;  4DV5 M;  3LMM A;  4OX9 M;  3GP1 A;  2HCB A;  4AQY M;  1GL6 A;  3J27 B;  2XZU A;  1XC8 A;  1PJI A;  5IT9 S;  2CUZ A;  2F5S A;  2I7N A;  3TPZ A;  4JI2 M;  4R3D A;  3K1J A;  3A46 A;  2K47 A;  3AKZ A;  2DWL A;  1TH3 A;  4YHH M;  1DGF A;  1XMO M;  1SXJ B;  1N34 M;  3DA1 A;  1FJG M;  1NVM A;  2X8A A;  3UK6 A;  5FTN A;  1NHG C;  3QWL A;  1GVN A;  5FTL A;  5ITX E;  4WW0 A;  3U6D A;  1ZQ9 A;  2QZ4 A;  1PJJ A;  4GRI A;  4MGH A;  1NY5 A;  2CHQ A;  2OQ4 A;  3SAT A;  1IN8 A;  4GHL A;  1IY2 A;  1HQC A;  4FCW A;  2VII A;  3W0F A;  4Z8X A;  2UXC M;  4FWG A;  2M60 A;  4QNR A;  3U61 A;  4G6Z A;  5JI3 E;  4AG6 A;  4JI5 M;  4W5W A;  1H6U A;  1HT1 E;  2X49 A;  2M5Z A;  2XSZ A;  3THG A;  2DXI A;  3KS4 A;  4DR5 M;  3CF0 A;  4FW9 A;  4M0D A;  1IN6 A;  1G8P A;  4EIW A;  3U60 B;  4L78 A;  2Y21 A;  4DV7 M;  3NBI A;  2UU9 M;  3D8L A;  3L25 A;  1IBK M;  3KXE C;  5IWA M;  1XXH B;  3PNV A;  3RFW A;  1YE9 A;  1UM8 A;  3MJ5 A;  2XH9 A;  4IBC A;  3FKE A;  4HLQ A;  4IIW A;  4S12 A;  3JAM S;  2QBY B;  4DR4 M;  1NJF A;  4JI7 M;  2R18 A;  1IM2 A;  1N36 M;  3ZH9 B;  4X64 M;  4B08 A;  1DGB A;  3VK7 A;  3KVW A;  2DWM A;  3HHX A;  5GKN A;  4L15 A;  2XLJ A;  4LJ9 A;  3CTW B;  2F5N A;  2KRK A;  3JR4 A;  3J7B A;  2H1R A;  1L1Z A;  2Z4S A;  3AJI B;  1MU5 A;  3QAU A;  4JI3 M;  3DFZ A;  1J09 A;  4FCT A;  4NSR A;  2KA6 B;  3VLF B;  4I8O A;  1R6B X;  2O5R A;  1PM5 A;  4JI8 M;  2R65 A;  3IG5 A;  4L4U A;  4X66 M;  2G5G X;  2DZO B;  3Q8X A;  1L2C A;  4TUW A;  4IJE A;  3AOG A;  2KEB A;  3TQS A;  1L2D A;  3CF2 A;  3KOX E;  4LF7 M;  1R7R A;  2CHG A;  1SXJ A;  5FTM A;  4LFC M;  4NOO B;  4G4N A;  4JI1 M;  2ERC A;  3ZCB B;  4K0K M;  4LJ6 A;  4I81 A;  2Y0T A;  4MB7 A;  4LJ4 A;  2R46 A;  1IN7 A;  4DUZ M;  3FTF A;  1G41 A;  3T15 A;  2XEP A;  3FTD A;  4MGI E;  4ZPX A;  4JV5 M;  3EIH A;  2F5Q A;  4REZ A;  1D2N A;  3FUU A;  4FWD A;  4G4Q A;  5DNY A;  1Q39 A;  1XNR M;  3GQ3 A;  3L26 A;  1W5S A;  5FTJ A;  2D7G A;  2BJW A;  1R2Y A;  5EXP A;  4G4R A;  3HJS A;  4LZJ A;  3SHG B;  2EO2 A;  1L8Q A;  4FVM A;  3U6L A;  2R4J A;  3T1H M;  3NWL A;  1HNW M;  3LQQ A;  2J7N A;  4D80 A;  2JA2 A;  3ILK A;  2HKJ A;  1XXH A;  3KOW E;  4NXN M;  3JR5 A;  4LFB M;  3VDU A;  4DV0 M;  3M0E A;  4B3R M;  2LNH C;  2DHR A;  4M0W A;  3RGP A;  3FTE A;  2YR0 A;  2DVW B;  4G4O A;  4HL4 A;  3K8Z A;  4GHA A;  2Y0Q A;  4QOZ C;  4JN6 A;  3L28 A;  1K3X A;  3AOE C;  4QNM A;  2L09 A;  3SAW A;  2Q2E B;  2X4A A;  4X65 M;  4LF8 M;  2KZS A;  4LGM A;  1QVR A;  2LWX A;  4RNA A;  1DGH B;  4L8R C;  4AZF A;  2CV1 A;  4LF6 M;  1MX0 A;  4IJF A;  3W0L B;  3AV0 A;  3HWS A;  2FFJ A;  5EXX A;  1QQW A;  1I4W A;  2HL7 A;  3UMM A;  3J2P B;  4DR2 M;  5ITX A;  1IXZ A;  5KO3 A;  2QPA A;  2RGO A;  3SYK A;  3KOZ E;  2ZAN A;  4KO8 A;  1QZM A;  1TGU A;  1IBL M;  2C96 A;  3KDS E;  3U6C A;  3GO8 A;  4NRW A;  4LJA A;  4FCV A;  3I4Y A;  2UXD M;  3GPU A;  1IY0 A;  2C98 A;  4DV4 M;  3U6O A;  3CF6 E;  5A2Q S;  2F5O A;  2UUA M;  3PXG A;  2XGN A;  4GC5 A;  4NRV A;  4LRT A;  2C9C A;  1FNN A;  1TDZ A;  3MHV C;  2LH0 A;  3GLF B;  5ITQ A;  8CAT A;  3I51 A;  1KSF X;  2CFO A;  5EJC A;  4DR1 M;  3FUW A;  1LV7 A;  4B7F A;  2C5R A;  4ITQ A;  3GRU A;  3H4M A;  4M9X A;  4LFA M;  3GLG B;  2UXB M;  2V6Z M;  2Z7J A;  5E6J A;  3U6Q A;  2UUC M;  2VQF M;  4MH0 E;  2EUC A;  3AFH A;  4M9Z A;  3WHK A;  3HHW A;  3FUT A;  2QEN A;  4PT5 A;  3SHF A;  4JXJ A;  2D7E A;  1IY1 A;  4GKJ M;  1IQP A;  2LXE A;  4IBG A;  2R45 A;  1GLN A;  1K3W A;  1DGH A;  2E5L M;  2CE7 A;  3L2A A;  3SFZ A;  4KOD A;  2AHM A;  1E9R A;  3GPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...