3J81S

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j81S01
3DOAA 4G4NA 5ITYA 4PD2A 3U6PA 4JI2M 1HNZM 1IBMM 2VQFM 1Q39A 4X62M 4DR2M 4DV1M 3TWLA 4PDIA 4DV6M 1HNWM 1PM5A 1N34M 1TDHA 2ZM6M 4LF7M 2VQEM 2F5OA 4X64M 3SATA 3JAMS 3SBJA 2UUAM 4JI5M 1TDZA 3J81S 4DR5M 3J80S 2OQ4A 3U6DA 3U6CA 3SASA 3TWKA 2ZBKB 4LF6M 1IBKM 3U6SA 4JI0M 2EA0A 4GKJM 3OTOM 1HNXM 2F5PA 1L2BA 3GPXA 4G4RA 2HHHM 4DV2M 1R2ZA 4JI8M 1FJGM 3J7AS 1MX0A 5BR8M 1XNRM 4DR1M 4JI6M 4LF5M 4DV4M 3SARA 2F5NA 4JI7M 1Z5AA 4LFAM 4PDGA 1N32M 1XC8A 1KFVA 3C58A 1Z5BA 5ITXE 1HR0M 1I94M 4GKKM 4NXNM 1XMQM 3U6OA 3GO8A 3SAUA 3GQ4A 4DR3M 4DV7M 4K0KM 5ITUA 3VK7A 4JI1M 5ITTA 2UXBM 5IT9S 3TWMA 2F5QA 3U6MA 4JI4M 3A42A 4LFCM 5ITQA 1Q3CA 3T1YM 4YHHM 1XNQM 2UXDM 1K82A 4JV5M 1K3XA 4ITQA 4JYAM 4B3RM 1Z5CA 4DV3M 4DUZM 4X66M 4DV5M 2UUBM 1PJJA 2F4VM 2F5SA 4B3TM 4DR6M 4G4QA 4JI3M 2E5LM 4YY3M 3GPPA 3A46A 1NNJA 4DV0M 2UU9M 3GP1A 5FLXS 1R2YA 4OX9M 3U6EA 2UUCM 3JR4A 5LMUM 1IBLM 1J5EM 5A2QS 1Z59A 4NRVA 1L2DA 1N36M 5ITRA 2OPFA 1PJIA 3GQ5A 4LFBM 1MU5A 4DR7M 3U6LA 2XZUA 4MB7A 1L1ZA 4NXMM 1Q3BA 3A45A 4B3SM 4LF8M 5ITXA 3W0FA 2HKJA 3GPUA 4CISA 4NRWA 3JR5A 1K3WA 4KHPM 4AQYM 1L1TA 3T1HM 5IWAM 4PCZA 3SAVA 3U6QA 4DR4M 1N33M 3VK8A 1L2CA 5LMNM 2Q2EB 4B3MM 3SAWA 4G4OA 1XMOM 2UXCM 2XZFA 4LF9M 1EE8A 3GPYA 3GQ3A 4LF4M 4X65M 4DUYM
chains in the Genus database with same CATH superfamily
2XEPA 2CHVA 4NSRA 2L09A 4LJ6A 3U6PA 4JI2M 2JXNA 4IBGA 1ZQ9A 2H1RA 3FKEA 4GIPA 3GLHE 2JY6B 4X62M 3GLHB 4DR2M 2DXIA 1V33A 3TWLA 2KEBA 5E26A 4CHTB 2Z7JA 3FYDA 3IG8A 2EKKA 2ZM6M 1OFIA 2CRUA 2N35A 3ZCBB 4CIZA 2DAGA 4M9ZA 1XHBA 2EUCA 4OU7A 2F5OA 4X64M 3KOXE 1OTRA 4IBKA 1R5LA 1ORYB 4L15A 3SBJA 4EIWA 4DR5M 4QOZC 3U6CA 1IXSB 3UK6A 3QYBA 1IBKM 3GLGB 3U61B 4IJFA 1HNXM 4LCBA 2QQ8A 1OQYA 1L2BA 3FTFA 4HEOA 1R2ZA 3EIHA 4WP2A 3KOWE 1E9RA 3LW5F 8CATA 3AKZA 2W82A 5FTNA 4DR1M 1H6UA 2JZ1A 3GRYA 1DO0A 2FH0A 2BWBA 2CV1A 4DV4M 1N77A 3SARA 2F5NA 3U60B 3GLFA 2L4EA 4B7HA 4PDGA 1IXZA 2V1CA 1XC8A 1L8QA 1XB2B 2JWSA 1NJGA 5ITXE 4RF0A 3LMMA 1I94M 4LG2A 2VDBB 4GKKM 2C9OA 1F4IA 1WGNA 3SAUA 1JQJC 3GLIA 1IN4A 3LCUA 1JR3A 3Q8GA 5JI2E 4PT5A 2QP9X 2UXBM 3TWMA 4WURA 1SXJD 2L6OA 2BJVA 4JI4M 3K2LA 3T1YM 4NC6A 2R18A 3VLFB 4JXJA 3KP0E 2Z4RA 1WHCA 1YLAA 2VF8A 2ZAOA 3FTEA 3FD9A 2XFTA 1K3XA 2BJWA 4ITQA 3M7GA 2KRUA 4IBDA 3GLFB 4BBAA 2LH0A 4I8OA 2Y0TA 4MM3B 2F4VM 1IQPA 3KXEC 2F5SA 3LQRA 4DR6M 4M0DA 2E5LM 1YSYA 5GKNA 1E9SA 3GPPA 5KPZA 3A46A 4JN6A 1R6BX 4DV0M 2UU9M 5FLXS 1JB0F 2JY7A 1WXQA 1IBLM 2P5TA 1LV7A 1N36M 5ITRA 3SMSA 3UGJA 1PJIA 3DA1A 2B3TA 3EIEA 3CF6E 5EXPA 1NJFA 2KNAA 4BB9A 3BBZA 3HGIA 3U6LA 4MB7A 1QDRA 4KO8A 4NXMM 1MJGM 4NRWA 3KSXA 4FW9A 4KHPM 3MHVC 4ANRA 1HT1E 4AKGA 1GABA 2DVWB 3FYCA 4IJEA 4IBBA 4PCZA 3SAVA 1IY1A 3U6QA 1W5TA 2Z8YM 1C7YA 1VEGA 3WHKA 1GKIA 2LHGA 2WSFF 4GEWA 2QENA 2Q2EB 1L2CA 1DGGA 4B3MM 4CJ6A 1DGFA 2KZUA 1IN6A 5EXXA 4P16A 1T3TA 2CP8A 4QHTA 2R4JA 2XZFA 3FUUA 1NO1A 3CTWB 1PJSA 2EO2A 1SXJA 3HJSA 2J7NA 2X49A 4DUYM 2R4EA 2KXEA 4AW4A 5ITYA 3B74A 3SHGB 5KQDA 2EKFA 3U5ZB 2X8AA 3KS4A 2CV2A 1S3SA 1OAOC 4P17A 4D82A 3B9PA 1KYIA 4XBOA 1TDHA 5E6JA 2DHYA 1QDTA 3MMPA 4LF7M 3ZC7B 1YE9A 2DZOB 4BLCA 4IBFA 2R6FA 1EFUB 3JAMS 3Q8XA 2ERCA 2QCUA 1YUBA 1T43A 4LJ4A 1JR3D 2RKOA 3U6SA 3HKPA 4WW0A 2EA0A 3OTOM 4GKJM 2F5PA 1SXJB 1NHGC 1V34A 4NL4H 3TPZA 3GQ5A 4QOSA 3J27B 2YR0A 1XNRM 4REZA 3J2PB 5FTLA 1TTEA 3KVWA 3PFIA 1DO2A 1D0LA 1PGYA 4G6ZA 4RKUF 4AKHA 1QQWA 4Y28F 1Z5AA 3B89A 4F1IA 2M5ZA 4AG6A 2FFJA 4FWHA 3FRIA 1KFVA 2CHGA 4R3DA 1OAIA 4MGKE 2XFSA 3F92A 1GJTA 3THGA 1TF0B 2GQFA 3U6OA 5L8RF 2O5RA 2WSEF 3HX3A 3W0LB 2FE8A 3UJNA 2DWLA 2EJSA 5IZ7D 5ITUA 3VK7A 3FUTA 4GC9A 4IBIA 2F5QA 3AOEC 2DAKA 5IT9S 4MGYE 1VEJA 2JP7A 3GLGE 5DFLA 4LJAA 3K92A 4AI6A 2LVAA 3HZJA 5ITQA 1D0MA 2LWXA 4GHAA 1NSFA 5EQTA 2DENA 2LVNC 3AOGA 1ZV1A 5EP2A 2UXDM 1K82A 1VDDA 2QZ4A 4QNMA 1IN5A 2GNOA 4LY6A 3AJIB 4DBGB 3RFWA 1QAOA 2LVOC 5KO3A 4L8RC 4B3RM 3B7QA 2L7HA 1IM2A 3FTDA 4LJ8A 1WGLA 4DV3M 4X66M 2KZSA 1QZEA 3PVSA 1HJPA 4L78A 2UUBM 2L2DA 1TH3A 1GO5A 4JI3M 3DFZA 2LVPC 2AHMA 3E21A 2CUZA 1D2NA 2YFQA 3NBXX 4G3OA 2I7PA 4OX9M 3K8ZA 3KOYE 1J5EM 1X37A 2RGHA 4L4UA 1Z59A 4NRVA 3T1HM 2XF3A 4D81A 3AL0C 3B7ZA 5DYIA 4IBJA 1MU5A 1XXHA 3QWLA 2FOIC 4FD2A 2OO9A 4FVMA 3M0EA 2HCBA 1DGBA 1EIJA 1Z6TA 1Q3BA 2JNHA 3A45A 4R7GA 3T6PA 3GLFE 2HKJA 2HL7A 1IXRC 1MN3A 4CISA 1K3WA 2L4FA 4M9XA 3UMMA 1L1TA 3HU3A 4XGIA 2LNHC 2Y20A 2QBYA 1GJSA 3AV0A 4AZFA 5EP3A 4DR4M 3D8LA 2V6ZM 2D7EA 2Z3XA 3KS8A 4I81A 3GLIB 2H5XA 4FWDA 3HJQA 2C99A 2DZLA 1ZMVA 1EE8A 2JY8A 3H4JA 4OVZA 3I51A 3GPYA 1ZAEA 1J09A 2X4AA 3GQ3A 4MGHA 3LCVB 3WHLA 5F3WA 1KSFX 2YNMD 1C1KA 2QSFX 3VDPA 1A5TA 3FUXA 4KODA 4PDIA 4DV6M 3T15A 1HNWM 5EP4A 1PM5A 3KP1E 4IBCA 4B7FA 3HU2A 4QHSA 4ZPXA 2K6BA 2HAKA 2VQEM 3AFHA 2QBYB 3SATA 3FRHA 2LXEA 1LTMA 4Q7JA 2UUAM 4JI5M 1GL7A 1G41A 2OQ4A 2VF7A 3IHPA 3U6DA 3HY5A 3I01M 3L29A 1NV8A 3SASA 2ZBKB 4LF6M 2KDLA 1GLNA 4F2LA 4L6V6 2RGOA 1AUAA 2ZAMA 1GL6A 4OVZB 3GPXA 1NNUC 2G5GX 4JI8M 1WJ7A 1MX0A 2J5YA 5BR8M 4AKIA 1PJQA 5EXTA 1Q02A 3QAUA 3IG5A 1IY0A 1OKSA 2NQ8C 4GRIA 1SG9A 2QNJA 4LFAM 3KSJA 2A5YB 2JZ0A 1NV9A 5EJCA 1HR0M 3GRRA 4NXNM 4LJ9A 1XMQM 1QZMA 1XWIA 4S12A 1E32A 3PNYA 3ZH9B 3GQ4A 2DNAA 4K0KM 1G4AE 2WZJA 4DV7M 2R44A 4JI1M 1FNNA 5ITTA 2G3QA 2DI0A 1VG5A 4LZZA 3HHYA 1TH2A 2CFOA 4M0WA 2XLJA 1SXJE 4LF8M 2O25A 1VQ1A 2KNZA 1NY5A 3DZDA 4LFCM 2JUJA 4YHHM 1XNQM 1OIZA 3CF2A 4NOOB 2OOAA 3GLHA 4HL4A 2LBCA 1OIPA 4OW0A 3TE6A 2R45A 4LJ5A 4RF1A 1CUKA 4L16A 5IREB 4JYAM 1G59A 1IY2A 3SYLA 5BPVA 3QYEA 4FCWA 4DUZM 2DKLA 3FUVA 4DV5M 4LGMA 4CGYB 2LTUA 1Y8GA 4IBEA 2FNAA 3L28A 3LQQA 3GLGA 4LJ7A 1NHWC 2APLA 4Z6YA 3I04M 3K1JA 3U61A 2CEAA 4II7A 3GP1A 4FCTA 3RE8A 5DNYA 2KHHA 2UUCM 5DYGA 1NVMA 2FS1A 3A98B 4GC5A 5LMUM 4B08A 2JA2A 5A2QS 3VKGA 2BNKA 1SXJC 1L2DA 1P3QQ 1TGUA 4QNRA 2J7OA 2RRUA 3U60A 4KLNA 4IIWA 3IECA 2XZUA 3TQSA 1L1ZA 1HQCA 2XGNA 4HLQA 4B3SM 5ITXA 4FWGA 3GPUA 4I5SA 1UM8A 3MK6A 2R65A 3MJ5A 1TR8A 2MJ5B 2HWJA 2MR9A 3C3EA 1OJLA 5IWAM 1TH4A 3BXWA 1N33M 1HT2E 5LMNM 2KNVA 2K9DA 2YQZA 3FUWA 4KT0F 3E4RA 1W5SA 4G4OA 2JY5A 1V92A 3SHFA 1GVNA 3HHWA 4LF9M 3KDSE 2CE7A 4I4LA 2KA6B 4LF4M 4X65M 3DOAA 4G4NA 3L25A 5FTKA 2DWZB 4PD2A 3E46A 3R8FA 1HNZM 1IBMM 2VQFM 1Q39A 2DAIA 3PNVA 4MGIE 4DV1M 5H37D 1PJTA 2R62A 2C9CA 3VFDA 3SYKA 1N34M 3R9XB 2ZANA 3RGSA 1QUTA 2QPAA 1VDLA 1QVRA 3I4VA 2DZNB 1DV0A 2XSZA 3J81S 1TDZA 3J80S 2G8LA 3GLIE 3TWKA 4FCVA 1DGHA 3E9SA 1JR3E 4JI0M 2BWEA 1QUSA 1UFZA 3CGWA 4G4RA 1IN7A 2HHHM 4DV2M 5FTJA 1FJGM 3J7AS 2LVQD 3K9PA 5C1BA 4Z8XA 4JI6M 3H4MA 4LF5M 4LRSA 5EP1A 3PXGA 2ZTDA 1N78A 2Y0QA 4JI7M 1XXHE 2VIIA 3C3DA 1XXHB 3FE3A 3GRVA 1N32M 1R4GA 4NSOB 1Z5BA 3C58A 2M60A 4D80A 1J7KA 2R0IA 4LZJA 2OOBA 1RU3A 1QAMA 3GO8A 3KOZE 4DR3M 5KPRA 3TL4X 4GHLA 4A3VB 2Y21A 4W5WA 3L2AA 1DGHB 3L27A 1E94E 4M9SA 2MH8A 3U6MA 3KFUG 3A42A 5KQ8A 2I7NA 1OFHA 2K0BX 3U5ZA 4MGZE 3T38A 1Q3CA 1BVSA 5EXSA 2D7GA 4AG5A 2QHOB 3SC3A 4LGYA 1IN8A 2K47A 4RNAA 4JV5M 2DAMA 1G8PA 4LRTA 2DWNA 2C96A 4R71A 2LHCA 5JI3E 1ZMUA 1Z5CA 3VKHA 4XK8F 4GITA 1PJJA 3M6AA 3RGPA 4B3TM 1G71A 2C98A 5FTMA 4G4QA 3VDUA 3AOEA 3HHXA 1ZMWA 4MH0E 2D7HA 1WIVA 2MROB 3GRUA 4YY3M 7CATA 1NNJA 3J7BA 3SMPA 4UN2B 2XH9A 3K9OA 2DHRA 1R2YA 3NWLA 2Z4SA 3U6EA 1NY6A 2L7IA 3FTCA 1AIPC 4GMQA 3L26A 3BOSA 3JR4A 3W68A 3HHZA 3B7NA 1IFYA 1G3IA 1I4WA 2OPFA 2WSCF 1VEKA 5KPTA 2C5RA 1HQYE 3KW6A 2V1UA 4LFBM 4DR7M 3HJ8A 3LVWA 2ZTCA 3NBIA 1N75A 2KRKA 5FSWA 1QYRA 3HWSA 3W0FA 2O01F 3ZQJA 3JR5A 2DWMA 3CF0A 1PRBA 4AQYM 1QANA 3UZUA 2CHQA 1WR1B 3SFZA 4TUWA 1T6OA 3VK8A 2XSZD 4B7GA 1IXSA 3C9PA 3SAWA 3HU1A 3V76A 1R7RA 1XMOM 3I4YA 2UXCM 3ILKA 2KW0A 2CV0A 2CWBA 2R46A 1D0KA 2DAEA 3D8BA 3LVVA 4GH9A 5C18A 3W67A 2MGWA 1QAQA
chains in the Genus database with same CATH topology
2XEPA 2CHVA 4NSRA 2L09A 4LJ6A 3U6PA 4JI2M 4IBGA 1ZQ9A 2H1RA 3FKEA 4GIPA 4X62M 4DR2M 3GLHB 2DXIA 3TWLA 2KEBA 5E26A 4CHTB 2Z7JA 3FYDA 3IG8A 2ZM6M 1OFIA 3ZCBB 4M9ZA 1XHBA 2EUCA 4OU7A 2F5OA 4X64M 3KOXE 4IBKA 1ORYB 4L15A 3SBJA 4EIWA 4DR5M 4QOZC 3U6CA 1IXSB 3UK6A 1IBKM 3GLGB 3U61B 4IJFA 1HNXM 4LCBA 1L2BA 3FTFA 1R2ZA 3EIHA 3KOWE 1E9RA 8CATA 3AKZA 2W82A 5FTNA 4DR1M 1H6UA 3GRYA 1DO0A 2CV1A 4DV4M 1N77A 3SARA 2F5NA 3U60B 3GLFA 4B7HA 4PDGA 1IXZA 2V1CA 1XC8A 1L8QA 1NJGA 5ITXE 4RF0A 3LMMA 1I94M 4LG2A 4GKKM 2C9OA 3SAUA 1JQJC 3GLIA 1IN4A 1JR3A 5JI2E 4PT5A 2QP9X 2UXBM 3TWMA 4WURA 1SXJD 2L6OA 2BJVA 4JI4M 3K2LA 3T1YM 2R18A 3VLFB 4JXJA 3KP0E 2Z4RA 2ZAOA 3FTEA 3FD9A 2XFTA 1K3XA 2BJWA 4ITQA 3M7GA 2KRUA 4IBDA 3GLFB 4BBAA 2LH0A 4I8OA 2Y0TA 4MM3B 2F4VM 1IQPA 3KXEC 2F5SA 3LQRA 4DR6M 4M0DA 2E5LM 1YSYA 5GKNA 1E9SA 3GPPA 5KPZA 3A46A 4JN6A 1R6BX 4DV0M 2UU9M 5FLXS 1WXQA 1IBLM 2P5TA 1LV7A 1N36M 5ITRA 3SMSA 3UGJA 1PJIA 3DA1A 3EIEA 4BB9A 3CF6E 5EXPA 1NJFA 3GQ5A 3U6LA 3HGIA 4MB7A 4KO8A 4NXMM 4NRWA 3KSXA 4FW9A 4KHPM 3MHVC 1HT1E 4AKGA 2DVWB 3FYCA 4IJEA 4IBBA 4PCZA 3SAVA 1IY1A 3U6QA 1W5TA 3WHKA 1GKIA 1L2CA 2QENA 2Q2EB 1DGGA 4B3MM 1DGFA 2KZUA 1IN6A 5EXXA 4P16A 1T3TA 4QHTA 2R4JA 2XZFA 3FUUA 3HJSA 3CTWB 2EO2A 1SXJA 2J7NA 2X49A 4DUYM 2R4EA 2KXEA 4AW4A 5ITYA 3SHGB 5KQDA 3U5ZB 2X8AA 3KS4A 2CV2A 1S3SA 4D82A 3B9PA 1KYIA 4XBOA 1TDHA 5E6JA 4LF7M 3ZC7B 1YE9A 2DZOB 4BLCA 4IBFA 3JAMS 3Q8XA 2ERCA 2QCUA 1YUBA 4LJ4A 1JR3D 2RKOA 3U6SA 3HKPA 4WW0A 2EA0A 3OTOM 4GKJM 2F5PA 1SXJB 1NHGC 4NL4H 3TPZA 4QOSA 3J27B 2YR0A 1XNRM 4REZA 3J2PB 5FTLA 3KVWA 3PFIA 1DO2A 4G6ZA 4AKHA 1QQWA 1Z5AA 2M5ZA 4AG6A 2FFJA 4FWHA 1KFVA 2CHGA 4R3DA 4MGKE 2XFSA 3U6OA 2O5RA 3W0LB 2FE8A 3UJNA 2DWLA 5ITUA 5IZ7D 3VK7A 3FUTA 4GC9A 4IBIA 2F5QA 3AOEC 5IT9S 4MGYE 4LJAA 3K92A 5ITQA 2LWXA 4GHAA 1NSFA 5EQTA 3AOGA 2UXDM 5EP2A 1K82A 1VDDA 2QZ4A 4QNMA 1IN5A 4LY6A 3AJIB 3RFWA 1QAOA 5KO3A 4L8RC 4B3RM 4LJ8A 2L7HA 1IM2A 3FTDA 4DV3M 4X66M 2KZSA 3PVSA 4L78A 2UUBM 1TH3A 4JI3M 3DFZA 2AHMA 2CUZA 1D2NA 2YFQA 2I7PA 4OX9M 3K8ZA 3KOYE 1J5EM 1X37A 2RGHA 4L4UA 1Z59A 4NRVA 2XF3A 4D81A 3AL0C 5DYIA 4IBJA 1MU5A 1XXHA 3QWLA 2FOIC 4FD2A 4FVMA 3M0EA 2HCBA 1DGBA 1Z6TA 1Q3BA 3A45A 4R7GA 4LF8M 2HKJA 2HL7A 1IXRC 4CISA 1K3WA 4M9XA 3UMMA 1L1TA 3HU3A 4XGIA 2LNHC 2Y20A 2QBYA 3AV0A 4AZFA 5EP3A 4DR4M 3D8LA 2V6ZM 2D7EA 2Z3XA 3KS8A 4I81A 3GLIB 4FWDA 3HJQA 2C99A 1EE8A 4OVZA 3I51A 3GPYA 2X4AA 1ZAEA 1J09A 3GQ3A 4MGHA 3WHLA 5F3WA 1KSFX 2YNMD 1C1KA 3VDPA 3FUXA 4KODA 4PDIA 4DV6M 3T15A 1HNWM 5EP4A 1PM5A 3KP1E 4IBCA 4B7FA 3HU2A 4QHSA 4ZPXA 2VQEM 3AFHA 2QBYB 3SATA 2LXEA 2UUAM 4JI5M 1GL7A 1G41A 2OQ4A 3U6DA 3L29A 3SASA 2ZBKB 4LF6M 1GLNA 2RGOA 4AI6A 2ZAMA 1GL6A 4OVZB 3GPXA 1NNUC 2G5GX 4JI8M 4AKIA 1MX0A 5BR8M 5EXTA 3QAUA 3IG5A 1IY0A 2NQ8C 4GRIA 4LFAM 3KSJA 2A5YB 5EJCA 1HR0M 3GRRA 4NXNM 4LJ9A 1XMQM 1QZMA 1XWIA 4S12A 1E32A 3PNYA 3ZH9B 3GQ4A 4K0KM 1G4AE 4DV7M 4JI1M 1FNNA 5ITTA 4LZZA 3HHYA 1TH2A 2CFOA 4M0WA 2XLJA 1SXJE 4LFCM 1NY5A 3DZDA 4YHHM 1XNQM 3CF2A 4NOOB 3GLHA 4HL4A 4OW0A 3TE6A 2R45A 4LJ5A 4RF1A 5IREB 4L16A 4JYAM 1G59A 1IY2A 3SYLA 5BPVA 4FCWA 4DUZM 4DV5M 3FUVA 4LGMA 4CGYB 4IBEA 2FNAA 3L28A 3LQQA 3GLGA 4LJ7A 1NHWC 4Z6YA 3U61A 3K1JA 2CEAA 4II7A 3GP1A 4FCTA 3RE8A 5DNYA 2UUCM 5DYGA 1NVMA 3A98B 4GC5A 5LMUM 4B08A 2JA2A 5A2QS 3VKGA 2BNKA 1SXJC 1L2DA 1TGUA 4QNRA 2J7OA 3U60A 4KLNA 4IIWA 2XZUA 3TQSA 1L1ZA 1HQCA 2XGNA 4HLQA 4B3SM 5ITXA 4FWGA 3GPUA 4I5SA 1UM8A 3MK6A 2R65A 3MJ5A 3THGA 5IWAM 3T1HM 1OJLA 1TH4A 1N33M 1HT2E 5LMNM 2YQZA 3FUWA 3E4RA 1W5SA 4G4OA 3SHFA 1GVNA 3HHWA 4LF9M 3KDSE 2CE7A 4I4LA 2KA6B 4LF4M 4X65M 3DOAA 4G4NA 3L25A 5FTKA 2DWZB 4PD2A 3R8FA 1HNZM 1IBMM 2VQFM 1Q39A 3PNVA 4MGIE 4DV1M 2R62A 2C9CA 3VFDA 3SYKA 1N34M 3R9XB 2ZANA 3RGSA 2QPAA 1QVRA 3I4VA 2DZNB 2XSZA 3J81S 1TDZA 3J80S 2G8LA 3TWKA 4FCVA 1DGHA 3E9SA 4JI0M 4G4RA 1IN7A 2HHHM 4DV2M 5FTJA 1FJGM 3J7AS 5C1BA 4Z8XA 4JI6M 3H4MA 4LF5M 4LRSA 5EP1A 3PXGA 1N78A 2Y0QA 4JI7M 2VIIA 3GRVA 1XXHB 1N32M 4NSOB 1Z5BA 3C58A 2M60A 4D80A 1J7KA 4LZJA 1QAMA 3GO8A 3KOZE 4DR3M 5KPRA 3TL4X 4GHLA 4A3VB 2Y21A 4W5WA 3L2AA 1DGHB 3L27A 1E94E 4M9SA 3U6MA 3KFUG 3A42A 5KQ8A 2I7NA 1OFHA 3U5ZA 4MGZE 3T38A 1Q3CA 5EXSA 2D7GA 4AG5A 3SC3A 4LGYA 1IN8A 2K47A 4RNAA 4JV5M 4LRTA 1G8PA 2DWNA 2C96A 5JI3E 1Z5CA 3VKHA 4GITA 1PJJA 3M6AA 3RGPA 4B3TM 2C98A 5FTMA 4G4QA 3VDUA 3AOEA 3HHXA 4MH0E 2D7HA 3GRUA 4YY3M 7CATA 1NNJA 3J7BA 3SMPA 2XH9A 2DHRA 1R2YA 3NWLA 2Z4SA 3U6EA 1NY6A 2L7IA 3FTCA 4GMQA 3L26A 3JR4A 3BOSA 3HHZA 1G3IA 1I4WA 2OPFA 2V1UA 5KPTA 2C5RA 1HQYE 3KW6A 4LFBM 4DR7M 3HJ8A 3LVWA 3NBIA 1N75A 2KRKA 5FSWA 1QYRA 3HWSA 3W0FA 3JR5A 2DWMA 3CF0A 4AQYM 1QANA 3UZUA 2CHQA 3SFZA 4TUWA 3VK8A 2XSZD 4B7GA 3SAWA 3HU1A 1R7RA 1XMOM 3I4YA 2UXCM 3ILKA 2KW0A 2CV0A 2R46A 3LVVA 3D8BA 4GH9A 5C18A 5H37D 1QAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOA A;  4G4N A;  5ITY A;  4PD2 A;  3U6P A;  4JI2 M;  1HNZ M;  1IBM M;  2VQF M;  1Q39 A;  4X62 M;  4DR2 M;  4DV1 M;  3TWL A;  4PDI A;  4DV6 M;  1HNW M;  1PM5 A;  1N34 M;  1TDH A;  2ZM6 M;  4LF7 M;  2VQE M;  2F5O A;  4X64 M;  3SAT A;  3JAM S;  3SBJ A;  2UUA M;  4JI5 M;  1TDZ A;  3J81 S;  4DR5 M;  3J80 S;  2OQ4 A;  3U6D A;  3U6C A;  3SAS A;  3TWK A;  2ZBK B;  4LF6 M;  1IBK M;  3U6S A;  4JI0 M;  2EA0 A;  4GKJ M;  3OTO M;  1HNX M;  2F5P A;  1L2B A;  3GPX A;  4G4R A;  2HHH M;  4DV2 M;  1R2Z A;  4JI8 M;  1FJG M;  3J7A S;  1MX0 A;  5BR8 M;  1XNR M;  4DR1 M;  4JI6 M;  4LF5 M;  4DV4 M;  3SAR A;  2F5N A;  4JI7 M;  1Z5A A;  4LFA M;  4PDG A;  1N32 M;  1XC8 A;  1KFV A;  3C58 A;  1Z5B A;  5ITX E;  1HR0 M;  1I94 M;  4GKK M;  4NXN M;  1XMQ M;  3U6O A;  3GO8 A;  3SAU A;  3GQ4 A;  4DR3 M;  4DV7 M;  4K0K M;  5ITU A;  3VK7 A;  4JI1 M;  5ITT A;  2UXB M;  5IT9 S;  3TWM A;  2F5Q A;  3U6M A;  4JI4 M;  3A42 A;  4LFC M;  5ITQ A;  1Q3C A;  3T1Y M;  4YHH M;  1XNQ M;  2UXD M;  1K82 A;  4JV5 M;  1K3X A;  4ITQ A;  4JYA M;  4B3R M;  1Z5C A;  4DV3 M;  4DUZ M;  4X66 M;  4DV5 M;  2UUB M;  1PJJ A;  2F4V M;  2F5S A;  4B3T M;  4DR6 M;  4G4Q A;  4JI3 M;  2E5L M;  4YY3 M;  3GPP A;  3A46 A;  1NNJ A;  4DV0 M;  2UU9 M;  3GP1 A;  5FLX S;  1R2Y A;  4OX9 M;  3U6E A;  2UUC M;  3JR4 A;  5LMU M;  1IBL M;  1J5E M;  5A2Q S;  1Z59 A;  4NRV A;  1L2D A;  1N36 M;  5ITR A;  2OPF A;  1PJI A;  3GQ5 A;  4LFB M;  1MU5 A;  4DR7 M;  3U6L A;  2XZU A;  4MB7 A;  1L1Z A;  4NXM M;  1Q3B A;  3A45 A;  4B3S M;  4LF8 M;  5ITX A;  3W0F A;  2HKJ A;  3GPU A;  4CIS A;  4NRW A;  3JR5 A;  1K3W A;  4KHP M;  4AQY M;  1L1T A;  3T1H M;  5IWA M;  4PCZ A;  3SAV A;  3U6Q A;  4DR4 M;  1N33 M;  3VK8 A;  1L2C A;  5LMN M;  2Q2E B;  4B3M M;  3SAW A;  4G4O A;  1XMO M;  2UXC M;  2XZF A;  4LF9 M;  1EE8 A;  3GPY A;  3GQ3 A;  4LF4 M;  4X65 M;  4DUY M; 
#chains in the Genus database with same CATH topology
 2XEP A;  2CHV A;  4NSR A;  2L09 A;  4LJ6 A;  3U6P A;  4JI2 M;  2JXN A;  4IBG A;  1ZQ9 A;  2H1R A;  3FKE A;  4GIP A;  3GLH E;  2JY6 B;  4X62 M;  3GLH B;  4DR2 M;  2DXI A;  1V33 A;  3TWL A;  2KEB A;  5E26 A;  4CHT B;  2Z7J A;  3FYD A;  3IG8 A;  2EKK A;  2ZM6 M;  1OFI A;  2CRU A;  2N35 A;  3ZCB B;  4CIZ A;  2DAG A;  4M9Z A;  1XHB A;  2EUC A;  4OU7 A;  2F5O A;  4X64 M;  3KOX E;  1OTR A;  4IBK A;  1R5L A;  1ORY B;  4L15 A;  3SBJ A;  4EIW A;  4DR5 M;  4QOZ C;  3U6C A;  1IXS B;  3UK6 A;  3QYB A;  1IBK M;  3GLG B;  3U61 B;  4IJF A;  1HNX M;  4LCB A;  2QQ8 A;  1OQY A;  1L2B A;  3FTF A;  4HEO A;  1R2Z A;  3EIH A;  4WP2 A;  3KOW E;  1E9R A;  3LW5 F;  8CAT A;  3AKZ A;  2W82 A;  5FTN A;  4DR1 M;  1H6U A;  2JZ1 A;  3GRY A;  1DO0 A;  2FH0 A;  2BWB A;  2CV1 A;  4DV4 M;  1N77 A;  3SAR A;  2F5N A;  3U60 B;  3GLF A;  2L4E A;  4B7H A;  4PDG A;  1IXZ A;  2V1C A;  1XC8 A;  1L8Q A;  1XB2 B;  2JWS A;  1NJG A;  5ITX E;  4RF0 A;  3LMM A;  1I94 M;  4LG2 A;  2VDB B;  4GKK M;  2C9O A;  1F4I A;  1WGN A;  3SAU A;  1JQJ C;  3GLI A;  1IN4 A;  3LCU A;  1JR3 A;  3Q8G A;  5JI2 E;  4PT5 A;  2QP9 X;  2UXB M;  3TWM A;  4WUR A;  1SXJ D;  2L6O A;  2BJV A;  4JI4 M;  3K2L A;  3T1Y M;  4NC6 A;  2R18 A;  3VLF B;  4JXJ A;  3KP0 E;  2Z4R A;  1WHC A;  1YLA A;  2VF8 A;  2ZAO A;  3FTE A;  3FD9 A;  2XFT A;  1K3X A;  2BJW A;  4ITQ A;  3M7G A;  2KRU A;  4IBD A;  3GLF B;  4BBA A;  2LH0 A;  4I8O A;  2Y0T A;  4MM3 B;  2F4V M;  1IQP A;  3KXE C;  2F5S A;  3LQR A;  4DR6 M;  4M0D A;  2E5L M;  1YSY A;  5GKN A;  1E9S A;  3GPP A;  5KPZ A;  3A46 A;  4JN6 A;  1R6B X;  4DV0 M;  2UU9 M;  5FLX S;  1JB0 F;  2JY7 A;  1WXQ A;  1IBL M;  2P5T A;  1LV7 A;  1N36 M;  5ITR A;  3SMS A;  3UGJ A;  1PJI A;  3DA1 A;  2B3T A;  3EIE A;  3CF6 E;  5EXP A;  1NJF A;  2KNA A;  4BB9 A;  3BBZ A;  3HGI A;  3U6L A;  4MB7 A;  1QDR A;  4KO8 A;  4NXM M;  1MJG M;  4NRW A;  3KSX A;  4FW9 A;  4KHP M;  3MHV C;  4ANR A;  1HT1 E;  4AKG A;  1GAB A;  2DVW B;  3FYC A;  4IJE A;  4IBB A;  4PCZ A;  3SAV A;  1IY1 A;  3U6Q A;  1W5T A;  2Z8Y M;  1C7Y A;  1VEG A;  3WHK A;  1GKI A;  2LHG A;  2WSF F;  4GEW A;  2QEN A;  2Q2E B;  1L2C A;  1DGG A;  4B3M M;  4CJ6 A;  1DGF A;  2KZU A;  1IN6 A;  5EXX A;  4P16 A;  1T3T A;  2CP8 A;  4QHT A;  2R4J A;  2XZF A;  3FUU A;  1NO1 A;  3CTW B;  1PJS A;  2EO2 A;  1SXJ A;  3HJS A;  2J7N A;  2X49 A;  4DUY M;  2R4E A;  2KXE A;  4AW4 A;  5ITY A;  3B74 A;  3SHG B;  5KQD A;  2EKF A;  3U5Z B;  2X8A A;  3KS4 A;  2CV2 A;  1S3S A;  1OAO C;  4P17 A;  4D82 A;  3B9P A;  1KYI A;  4XBO A;  1TDH A;  5E6J A;  2DHY A;  1QDT A;  3MMP A;  4LF7 M;  3ZC7 B;  1YE9 A;  2DZO B;  4BLC A;  4IBF A;  2R6F A;  1EFU B;  3JAM S;  3Q8X A;  2ERC A;  2QCU A;  1YUB A;  1T43 A;  4LJ4 A;  1JR3 D;  2RKO A;  3U6S A;  3HKP A;  4WW0 A;  2EA0 A;  3OTO M;  4GKJ M;  2F5P A;  1SXJ B;  1NHG C;  1V34 A;  4NL4 H;  3TPZ A;  3GQ5 A;  4QOS A;  3J27 B;  2YR0 A;  1XNR M;  4REZ A;  3J2P B;  5FTL A;  1TTE A;  3KVW A;  3PFI A;  1DO2 A;  1D0L A;  1PGY A;  4G6Z A;  4RKU F;  4AKH A;  1QQW A;  4Y28 F;  1Z5A A;  3B89 A;  4F1I A;  2M5Z A;  4AG6 A;  2FFJ A;  4FWH A;  3FRI A;  1KFV A;  2CHG A;  4R3D A;  1OAI A;  4MGK E;  2XFS A;  3F92 A;  1GJT A;  3THG A;  1TF0 B;  2GQF A;  3U6O A;  5L8R F;  2O5R A;  2WSE F;  3HX3 A;  3W0L B;  2FE8 A;  3UJN A;  2DWL A;  2EJS A;  5IZ7 D;  5ITU A;  3VK7 A;  3FUT A;  4GC9 A;  4IBI A;  2F5Q A;  3AOE C;  2DAK A;  5IT9 S;  4MGY E;  1VEJ A;  2JP7 A;  3GLG E;  5DFL A;  4LJA A;  3K92 A;  4AI6 A;  2LVA A;  3HZJ A;  5ITQ A;  1D0M A;  2LWX A;  4GHA A;  1NSF A;  5EQT A;  2DEN A;  2LVN C;  3AOG A;  1ZV1 A;  5EP2 A;  2UXD M;  1K82 A;  1VDD A;  2QZ4 A;  4QNM A;  1IN5 A;  2GNO A;  4LY6 A;  3AJI B;  4DBG B;  3RFW A;  1QAO A;  2LVO C;  5KO3 A;  4L8R C;  4B3R M;  3B7Q A;  2L7H A;  1IM2 A;  3FTD A;  4LJ8 A;  1WGL A;  4DV3 M;  4X66 M;  2KZS A;  1QZE A;  3PVS A;  1HJP A;  4L78 A;  2UUB M;  2L2D A;  1TH3 A;  1GO5 A;  4JI3 M;  3DFZ A;  2LVP C;  2AHM A;  3E21 A;  2CUZ A;  1D2N A;  2YFQ A;  3NBX X;  4G3O A;  2I7P A;  4OX9 M;  3K8Z A;  3KOY E;  1J5E M;  1X37 A;  2RGH A;  4L4U A;  1Z59 A;  4NRV A;  3T1H M;  2XF3 A;  4D81 A;  3AL0 C;  3B7Z A;  5DYI A;  4IBJ A;  1MU5 A;  1XXH A;  3QWL A;  2FOI C;  4FD2 A;  2OO9 A;  4FVM A;  3M0E A;  2HCB A;  1DGB A;  1EIJ A;  1Z6T A;  1Q3B A;  2JNH A;  3A45 A;  4R7G A;  3T6P A;  3GLF E;  2HKJ A;  2HL7 A;  1IXR C;  1MN3 A;  4CIS A;  1K3W A;  2L4F A;  4M9X A;  3UMM A;  1L1T A;  3HU3 A;  4XGI A;  2LNH C;  2Y20 A;  2QBY A;  1GJS A;  3AV0 A;  4AZF A;  5EP3 A;  4DR4 M;  3D8L A;  2V6Z M;  2D7E A;  2Z3X A;  3KS8 A;  4I81 A;  3GLI B;  2H5X A;  4FWD A;  3HJQ A;  2C99 A;  2DZL A;  1ZMV A;  1EE8 A;  2JY8 A;  3H4J A;  4OVZ A;  3I51 A;  3GPY A;  1ZAE A;  1J09 A;  2X4A A;  3GQ3 A;  4MGH A;  3LCV B;  3WHL A;  5F3W A;  1KSF X;  2YNM D;  1C1K A;  2QSF X;  3VDP A;  1A5T A;  3FUX A;  4KOD A;  4PDI A;  4DV6 M;  3T15 A;  1HNW M;  5EP4 A;  1PM5 A;  3KP1 E;  4IBC A;  4B7F A;  3HU2 A;  4QHS A;  4ZPX A;  2K6B A;  2HAK A;  2VQE M;  3AFH A;  2QBY B;  3SAT A;  3FRH A;  2LXE A;  1LTM A;  4Q7J A;  2UUA M;  4JI5 M;  1GL7 A;  1G41 A;  2OQ4 A;  2VF7 A;  3IHP A;  3U6D A;  3HY5 A;  3I01 M;  3L29 A;  1NV8 A;  3SAS A;  2ZBK B;  4LF6 M;  2KDL A;  1GLN A;  4F2L A;  4L6V 6;  2RGO A;  1AUA A;  2ZAM A;  1GL6 A;  4OVZ B;  3GPX A;  1NNU C;  2G5G X;  4JI8 M;  1WJ7 A;  1MX0 A;  2J5Y A;  5BR8 M;  4AKI A;  1PJQ A;  5EXT A;  1Q02 A;  3QAU A;  3IG5 A;  1IY0 A;  1OKS A;  2NQ8 C;  4GRI A;  1SG9 A;  2QNJ A;  4LFA M;  3KSJ A;  2A5Y B;  2JZ0 A;  1NV9 A;  5EJC A;  1HR0 M;  3GRR A;  4NXN M;  4LJ9 A;  1XMQ M;  1QZM A;  1XWI A;  4S12 A;  1E32 A;  3PNY A;  3ZH9 B;  3GQ4 A;  2DNA A;  4K0K M;  1G4A E;  2WZJ A;  4DV7 M;  2R44 A;  4JI1 M;  1FNN A;  5ITT A;  2G3Q A;  2DI0 A;  1VG5 A;  4LZZ A;  3HHY A;  1TH2 A;  2CFO A;  4M0W A;  2XLJ A;  1SXJ E;  4LF8 M;  2O25 A;  1VQ1 A;  2KNZ A;  1NY5 A;  3DZD A;  4LFC M;  2JUJ A;  4YHH M;  1XNQ M;  1OIZ A;  3CF2 A;  4NOO B;  2OOA A;  3GLH A;  4HL4 A;  2LBC A;  1OIP A;  4OW0 A;  3TE6 A;  2R45 A;  4LJ5 A;  4RF1 A;  1CUK A;  4L16 A;  5IRE B;  4JYA M;  1G59 A;  1IY2 A;  3SYL A;  5BPV A;  3QYE A;  4FCW A;  4DUZ M;  2DKL A;  3FUV A;  4DV5 M;  4LGM A;  4CGY B;  2LTU A;  1Y8G A;  4IBE A;  2FNA A;  3L28 A;  3LQQ A;  3GLG A;  4LJ7 A;  1NHW C;  2APL A;  4Z6Y A;  3I04 M;  3K1J A;  3U61 A;  2CEA A;  4II7 A;  3GP1 A;  4FCT A;  3RE8 A;  5DNY A;  2KHH A;  2UUC M;  5DYG A;  1NVM A;  2FS1 A;  3A98 B;  4GC5 A;  5LMU M;  4B08 A;  2JA2 A;  5A2Q S;  3VKG A;  2BNK A;  1SXJ C;  1L2D A;  1P3Q Q;  1TGU A;  4QNR A;  2J7O A;  2RRU A;  3U60 A;  4KLN A;  4IIW A;  3IEC A;  2XZU A;  3TQS A;  1L1Z A;  1HQC A;  2XGN A;  4HLQ A;  4B3S M;  5ITX A;  4FWG A;  3GPU A;  4I5S A;  1UM8 A;  3MK6 A;  2R65 A;  3MJ5 A;  1TR8 A;  2MJ5 B;  2HWJ A;  2MR9 A;  3C3E A;  1OJL A;  5IWA M;  1TH4 A;  3BXW A;  1N33 M;  1HT2 E;  5LMN M;  2KNV A;  2K9D A;  2YQZ A;  3FUW A;  4KT0 F;  3E4R A;  1W5S A;  4G4O A;  2JY5 A;  1V92 A;  3SHF A;  1GVN A;  3HHW A;  4LF9 M;  3KDS E;  2CE7 A;  4I4L A;  2KA6 B;  4LF4 M;  4X65 M;  3DOA A;  4G4N A;  3L25 A;  5FTK A;  2DWZ B;  4PD2 A;  3E46 A;  3R8F A;  1HNZ M;  1IBM M;  2VQF M;  1Q39 A;  2DAI A;  3PNV A;  4MGI E;  4DV1 M;  5H37 D;  1PJT A;  2R62 A;  2C9C A;  3VFD A;  3SYK A;  1N34 M;  3R9X B;  2ZAN A;  3RGS A;  1QUT A;  2QPA A;  1VDL A;  1QVR A;  3I4V A;  2DZN B;  1DV0 A;  2XSZ A;  3J81 S;  1TDZ A;  3J80 S;  2G8L A;  3GLI E;  3TWK A;  4FCV A;  1DGH A;  3E9S A;  1JR3 E;  4JI0 M;  2BWE A;  1QUS A;  1UFZ A;  3CGW A;  4G4R A;  1IN7 A;  2HHH M;  4DV2 M;  5FTJ A;  1FJG M;  3J7A S;  2LVQ D;  3K9P A;  5C1B A;  4Z8X A;  4JI6 M;  3H4M A;  4LF5 M;  4LRS A;  5EP1 A;  3PXG A;  2ZTD A;  1N78 A;  2Y0Q A;  4JI7 M;  1XXH E;  2VII A;  3C3D A;  1XXH B;  3FE3 A;  3GRV A;  1N32 M;  1R4G A;  4NSO B;  1Z5B A;  3C58 A;  2M60 A;  4D80 A;  1J7K A;  2R0I A;  4LZJ A;  2OOB A;  1RU3 A;  1QAM A;  3GO8 A;  3KOZ E;  4DR3 M;  5KPR A;  3TL4 X;  4GHL A;  4A3V B;  2Y21 A;  4W5W A;  3L2A A;  1DGH B;  3L27 A;  1E94 E;  4M9S A;  2MH8 A;  3U6M A;  3KFU G;  3A42 A;  5KQ8 A;  2I7N A;  1OFH A;  2K0B X;  3U5Z A;  4MGZ E;  3T38 A;  1Q3C A;  1BVS A;  5EXS A;  2D7G A;  4AG5 A;  2QHO B;  3SC3 A;  4LGY A;  1IN8 A;  2K47 A;  4RNA A;  4JV5 M;  2DAM A;  1G8P A;  4LRT A;  2DWN A;  2C96 A;  4R71 A;  2LHC A;  5JI3 E;  1ZMU A;  1Z5C A;  3VKH A;  4XK8 F;  4GIT A;  1PJJ A;  3M6A A;  3RGP A;  4B3T M;  1G71 A;  2C98 A;  5FTM A;  4G4Q A;  3VDU A;  3AOE A;  3HHX A;  1ZMW A;  4MH0 E;  2D7H A;  1WIV A;  2MRO B;  3GRU A;  4YY3 M;  7CAT A;  1NNJ A;  3J7B A;  3SMP A;  4UN2 B;  2XH9 A;  3K9O A;  2DHR A;  1R2Y A;  3NWL A;  2Z4S A;  3U6E A;  1NY6 A;  2L7I A;  3FTC A;  1AIP C;  4GMQ A;  3L26 A;  3BOS A;  3JR4 A;  3W68 A;  3HHZ A;  3B7N A;  1IFY A;  1G3I A;  1I4W A;  2OPF A;  2WSC F;  1VEK A;  5KPT A;  2C5R A;  1HQY E;  3KW6 A;  2V1U A;  4LFB M;  4DR7 M;  3HJ8 A;  3LVW A;  2ZTC A;  3NBI A;  1N75 A;  2KRK A;  5FSW A;  1QYR A;  3HWS A;  3W0F A;  2O01 F;  3ZQJ A;  3JR5 A;  2DWM A;  3CF0 A;  1PRB A;  4AQY M;  1QAN A;  3UZU A;  2CHQ A;  1WR1 B;  3SFZ A;  4TUW A;  1T6O A;  3VK8 A;  2XSZ D;  4B7G A;  1IXS A;  3C9P A;  3SAW A;  3HU1 A;  3V76 A;  1R7R A;  1XMO M;  3I4Y A;  2UXC M;  3ILK A;  2KW0 A;  2CV0 A;  2CWB A;  2R46 A;  1D0K A;  2DAE A;  3D8B A;  3LVV A;  4GH9 A;  5C18 A;  3W67 A;  2MGW A;  1QAQ A; 
#chains in the Genus database with same CATH homology
 2XEP A;  2CHV A;  4NSR A;  2L09 A;  4LJ6 A;  3U6P A;  4JI2 M;  4IBG A;  1ZQ9 A;  2H1R A;  3FKE A;  4GIP A;  4X62 M;  4DR2 M;  3GLH B;  2DXI A;  3TWL A;  2KEB A;  5E26 A;  4CHT B;  2Z7J A;  3FYD A;  3IG8 A;  2ZM6 M;  1OFI A;  3ZCB B;  4M9Z A;  1XHB A;  2EUC A;  4OU7 A;  2F5O A;  4X64 M;  3KOX E;  4IBK A;  1ORY B;  4L15 A;  3SBJ A;  4EIW A;  4DR5 M;  4QOZ C;  3U6C A;  1IXS B;  3UK6 A;  1IBK M;  3GLG B;  3U61 B;  4IJF A;  1HNX M;  4LCB A;  1L2B A;  3FTF A;  1R2Z A;  3EIH A;  3KOW E;  1E9R A;  8CAT A;  3AKZ A;  2W82 A;  5FTN A;  4DR1 M;  1H6U A;  3GRY A;  1DO0 A;  2CV1 A;  4DV4 M;  1N77 A;  3SAR A;  2F5N A;  3U60 B;  3GLF A;  4B7H A;  4PDG A;  1IXZ A;  2V1C A;  1XC8 A;  1L8Q A;  1NJG A;  5ITX E;  4RF0 A;  3LMM A;  1I94 M;  4LG2 A;  4GKK M;  2C9O A;  3SAU A;  1JQJ C;  3GLI A;  1IN4 A;  1JR3 A;  5JI2 E;  4PT5 A;  2QP9 X;  2UXB M;  3TWM A;  4WUR A;  1SXJ D;  2L6O A;  2BJV A;  4JI4 M;  3K2L A;  3T1Y M;  2R18 A;  3VLF B;  4JXJ A;  3KP0 E;  2Z4R A;  2ZAO A;  3FTE A;  3FD9 A;  2XFT A;  1K3X A;  2BJW A;  4ITQ A;  3M7G A;  2KRU A;  4IBD A;  3GLF B;  4BBA A;  2LH0 A;  4I8O A;  2Y0T A;  4MM3 B;  2F4V M;  1IQP A;  3KXE C;  2F5S A;  3LQR A;  4DR6 M;  4M0D A;  2E5L M;  1YSY A;  5GKN A;  1E9S A;  3GPP A;  5KPZ A;  3A46 A;  4JN6 A;  1R6B X;  4DV0 M;  2UU9 M;  5FLX S;  1WXQ A;  1IBL M;  2P5T A;  1LV7 A;  1N36 M;  5ITR A;  3SMS A;  3UGJ A;  1PJI A;  3DA1 A;  3EIE A;  4BB9 A;  3CF6 E;  5EXP A;  1NJF A;  3GQ5 A;  3U6L A;  3HGI A;  4MB7 A;  4KO8 A;  4NXM M;  4NRW A;  3KSX A;  4FW9 A;  4KHP M;  3MHV C;  1HT1 E;  4AKG A;  2DVW B;  3FYC A;  4IJE A;  4IBB A;  4PCZ A;  3SAV A;  1IY1 A;  3U6Q A;  1W5T A;  3WHK A;  1GKI A;  1L2C A;  2QEN A;  2Q2E B;  1DGG A;  4B3M M;  1DGF A;  2KZU A;  1IN6 A;  5EXX A;  4P16 A;  1T3T A;  4QHT A;  2R4J A;  2XZF A;  3FUU A;  3HJS A;  3CTW B;  2EO2 A;  1SXJ A;  2J7N A;  2X49 A;  4DUY M;  2R4E A;  2KXE A;  4AW4 A;  5ITY A;  3SHG B;  5KQD A;  3U5Z B;  2X8A A;  3KS4 A;  2CV2 A;  1S3S A;  4D82 A;  3B9P A;  1KYI A;  4XBO A;  1TDH A;  5E6J A;  4LF7 M;  3ZC7 B;  1YE9 A;  2DZO B;  4BLC A;  4IBF A;  3JAM S;  3Q8X A;  2ERC A;  2QCU A;  1YUB A;  4LJ4 A;  1JR3 D;  2RKO A;  3U6S A;  3HKP A;  4WW0 A;  2EA0 A;  3OTO M;  4GKJ M;  2F5P A;  1SXJ B;  1NHG C;  4NL4 H;  3TPZ A;  4QOS A;  3J27 B;  2YR0 A;  1XNR M;  4REZ A;  3J2P B;  5FTL A;  3KVW A;  3PFI A;  1DO2 A;  4G6Z A;  4AKH A;  1QQW A;  1Z5A A;  2M5Z A;  4AG6 A;  2FFJ A;  4FWH A;  1KFV A;  2CHG A;  4R3D A;  4MGK E;  2XFS A;  3U6O A;  2O5R A;  3W0L B;  2FE8 A;  3UJN A;  2DWL A;  5ITU A;  5IZ7 D;  3VK7 A;  3FUT A;  4GC9 A;  4IBI A;  2F5Q A;  3AOE C;  5IT9 S;  4MGY E;  4LJA A;  3K92 A;  5ITQ A;  2LWX A;  4GHA A;  1NSF A;  5EQT A;  3AOG A;  2UXD M;  5EP2 A;  1K82 A;  1VDD A;  2QZ4 A;  4QNM A;  1IN5 A;  4LY6 A;  3AJI B;  3RFW A;  1QAO A;  5KO3 A;  4L8R C;  4B3R M;  4LJ8 A;  2L7H A;  1IM2 A;  3FTD A;  4DV3 M;  4X66 M;  2KZS A;  3PVS A;  4L78 A;  2UUB M;  1TH3 A;  4JI3 M;  3DFZ A;  2AHM A;  2CUZ A;  1D2N A;  2YFQ A;  2I7P A;  4OX9 M;  3K8Z A;  3KOY E;  1J5E M;  1X37 A;  2RGH A;  4L4U A;  1Z59 A;  4NRV A;  2XF3 A;  4D81 A;  3AL0 C;  5DYI A;  4IBJ A;  1MU5 A;  1XXH A;  3QWL A;  2FOI C;  4FD2 A;  4FVM A;  3M0E A;  2HCB A;  1DGB A;  1Z6T A;  1Q3B A;  3A45 A;  4R7G A;  4LF8 M;  2HKJ A;  2HL7 A;  1IXR C;  4CIS A;  1K3W A;  4M9X A;  3UMM A;  1L1T A;  3HU3 A;  4XGI A;  2LNH C;  2Y20 A;  2QBY A;  3AV0 A;  4AZF A;  5EP3 A;  4DR4 M;  3D8L A;  2V6Z M;  2D7E A;  2Z3X A;  3KS8 A;  4I81 A;  3GLI B;  4FWD A;  3HJQ A;  2C99 A;  1EE8 A;  4OVZ A;  3I51 A;  3GPY A;  2X4A A;  1ZAE A;  1J09 A;  3GQ3 A;  4MGH A;  3WHL A;  5F3W A;  1KSF X;  2YNM D;  1C1K A;  3VDP A;  3FUX A;  4KOD A;  4PDI A;  4DV6 M;  3T15 A;  1HNW M;  5EP4 A;  1PM5 A;  3KP1 E;  4IBC A;  4B7F A;  3HU2 A;  4QHS A;  4ZPX A;  2VQE M;  3AFH A;  2QBY B;  3SAT A;  2LXE A;  2UUA M;  4JI5 M;  1GL7 A;  1G41 A;  2OQ4 A;  3U6D A;  3L29 A;  3SAS A;  2ZBK B;  4LF6 M;  1GLN A;  2RGO A;  4AI6 A;  2ZAM A;  1GL6 A;  4OVZ B;  3GPX A;  1NNU C;  2G5G X;  4JI8 M;  4AKI A;  1MX0 A;  5BR8 M;  5EXT A;  3QAU A;  3IG5 A;  1IY0 A;  2NQ8 C;  4GRI A;  4LFA M;  3KSJ A;  2A5Y B;  5EJC A;  1HR0 M;  3GRR A;  4NXN M;  4LJ9 A;  1XMQ M;  1QZM A;  1XWI A;  4S12 A;  1E32 A;  3PNY A;  3ZH9 B;  3GQ4 A;  4K0K M;  1G4A E;  4DV7 M;  4JI1 M;  1FNN A;  5ITT A;  4LZZ A;  3HHY A;  1TH2 A;  2CFO A;  4M0W A;  2XLJ A;  1SXJ E;  4LFC M;  1NY5 A;  3DZD A;  4YHH M;  1XNQ M;  3CF2 A;  4NOO B;  3GLH A;  4HL4 A;  4OW0 A;  3TE6 A;  2R45 A;  4LJ5 A;  4RF1 A;  5IRE B;  4L16 A;  4JYA M;  1G59 A;  1IY2 A;  3SYL A;  5BPV A;  4FCW A;  4DUZ M;  4DV5 M;  3FUV A;  4LGM A;  4CGY B;  4IBE A;  2FNA A;  3L28 A;  3LQQ A;  3GLG A;  4LJ7 A;  1NHW C;  4Z6Y A;  3U61 A;  3K1J A;  2CEA A;  4II7 A;  3GP1 A;  4FCT A;  3RE8 A;  5DNY A;  2UUC M;  5DYG A;  1NVM A;  3A98 B;  4GC5 A;  5LMU M;  4B08 A;  2JA2 A;  5A2Q S;  3VKG A;  2BNK A;  1SXJ C;  1L2D A;  1TGU A;  4QNR A;  2J7O A;  3U60 A;  4KLN A;  4IIW A;  2XZU A;  3TQS A;  1L1Z A;  1HQC A;  2XGN A;  4HLQ A;  4B3S M;  5ITX A;  4FWG A;  3GPU A;  4I5S A;  1UM8 A;  3MK6 A;  2R65 A;  3MJ5 A;  3THG A;  5IWA M;  3T1H M;  1OJL A;  1TH4 A;  1N33 M;  1HT2 E;  5LMN M;  2YQZ A;  3FUW A;  3E4R A;  1W5S A;  4G4O A;  3SHF A;  1GVN A;  3HHW A;  4LF9 M;  3KDS E;  2CE7 A;  4I4L A;  2KA6 B;  4LF4 M;  4X65 M;  3DOA A;  4G4N A;  3L25 A;  5FTK A;  2DWZ B;  4PD2 A;  3R8F A;  1HNZ M;  1IBM M;  2VQF M;  1Q39 A;  3PNV A;  4MGI E;  4DV1 M;  2R62 A;  2C9C A;  3VFD A;  3SYK A;  1N34 M;  3R9X B;  2ZAN A;  3RGS A;  2QPA A;  1QVR A;  3I4V A;  2DZN B;  2XSZ A;  3J81 S;  1TDZ A;  3J80 S;  2G8L A;  3TWK A;  4FCV A;  1DGH A;  3E9S A;  4JI0 M;  4G4R A;  1IN7 A;  2HHH M;  4DV2 M;  5FTJ A;  1FJG M;  3J7A S;  5C1B A;  4Z8X A;  4JI6 M;  3H4M A;  4LF5 M;  4LRS A;  5EP1 A;  3PXG A;  1N78 A;  2Y0Q A;  4JI7 M;  2VII A;  3GRV A;  1XXH B;  1N32 M;  4NSO B;  1Z5B A;  3C58 A;  2M60 A;  4D80 A;  1J7K A;  4LZJ A;  1QAM A;  3GO8 A;  3KOZ E;  4DR3 M;  5KPR A;  3TL4 X;  4GHL A;  4A3V B;  2Y21 A;  4W5W A;  3L2A A;  1DGH B;  3L27 A;  1E94 E;  4M9S A;  3U6M A;  3KFU G;  3A42 A;  5KQ8 A;  2I7N A;  1OFH A;  3U5Z A;  4MGZ E;  3T38 A;  1Q3C A;  5EXS A;  2D7G A;  4AG5 A;  3SC3 A;  4LGY A;  1IN8 A;  2K47 A;  4RNA A;  4JV5 M;  4LRT A;  1G8P A;  2DWN A;  2C96 A;  5JI3 E;  1Z5C A;  3VKH A;  4GIT A;  1PJJ A;  3M6A A;  3RGP A;  4B3T M;  2C98 A;  5FTM A;  4G4Q A;  3VDU A;  3AOE A;  3HHX A;  4MH0 E;  2D7H A;  3GRU A;  4YY3 M;  7CAT A;  1NNJ A;  3J7B A;  3SMP A;  2XH9 A;  2DHR A;  1R2Y A;  3NWL A;  2Z4S A;  3U6E A;  1NY6 A;  2L7I A;  3FTC A;  4GMQ A;  3L26 A;  3JR4 A;  3BOS A;  3HHZ A;  1G3I A;  1I4W A;  2OPF A;  2V1U A;  5KPT A;  2C5R A;  1HQY E;  3KW6 A;  4LFB M;  4DR7 M;  3HJ8 A;  3LVW A;  3NBI A;  1N75 A;  2KRK A;  5FSW A;  1QYR A;  3HWS A;  3W0F A;  3JR5 A;  2DWM A;  3CF0 A;  4AQY M;  1QAN A;  3UZU A;  2CHQ A;  3SFZ A;  4TUW A;  3VK8 A;  2XSZ D;  4B7G A;  3SAW A;  3HU1 A;  1R7R A;  1XMO M;  3I4Y A;  2UXC M;  3ILK A;  2KW0 A;  2CV0 A;  2R46 A;  3LVV A;  3D8B A;  4GH9 A;  5C18 A;  5H37 D;  1QAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...