3J81S

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 25
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j81S01
4OX9M 4DV5M 4DV7M 3U6EA 3SAWA 3A45A 4NRWA 1TDHA 2F5SA 3VK8A 4B3MM 5BR8M 2VQEM 4JI5M 1HNZM 3A46A 4PDIA 2Q2EB 1MX0A 1XNQM 3J81S 4LF8M 2ZBKB 1XNRM 2UXCM 5ITRA 4PD2A 2UUBM 1R2YA 2F5NA 5ITQA 2XZFA 4NRVA 3TWKA 2ZM6M 1HNXM 2UU9M 1N36M 4LF7M 2F5PA 1N33M 4G4NA 1L2BA 5ITXE 4JI4M 2HHHM 3GPUA 4G4OA 4JI8M 1K82A 3T1HM 3U6PA 3SASA 2UXDM 4JI1M 1XC8A 1Z59A 4CISA 3J80S 3DOAA 1TDZA 3TWLA 3J7AS 4JI6M 1N32M 4X65M 3GO8A 3GQ3A 1PM5A 1NNJA 5FLXS 1N34M 3JAMS 1Q3BA 1Z5BA 1R2ZA 2F4VM 3GPXA 4K0KM 1PJIA 2F5OA 2OPFA 1HNWM 1FJGM 2OQ4A 1L2CA 3GPYA 1K3WA 1IBMM 4LFAM 2HKJA 3SAVA 2F5QA 4PCZA 4DV2M 4DR4M 3OTOM 4MB7A 1J5EM 4X62M 3SATA 3SBJA 2UUCM 2E5LM 4JYAM 4DUYM 3JR4A 5ITUA 4B3TM 4DV6M 3U6OA 2EA0A 4LFCM 1PJJA 3U6LA 4ITQA 3JR5A 4DV4M 1Q3CA 4X64M 1I94M 4YY3M 4LF6M 1IBLM 5ITYA 1IBKM 5IT9S 3GQ5A 3A42A 4AQYM 4JI0M 4G4QA 4B3RM 1L1TA 1L2DA 5ITTA 1Q39A 4KHPM 5LMNM 4DV1M 3GP1A 2XZUA 4GKJM 4DR6M 1EE8A 4X66M 4GKKM 4JV5M 4G4RA 4DUZM 3U6CA 4JI3M 4DV0M 4LF4M 4DR2M 1MU5A 4YHHM 2VQFM 4DR3M 3VK7A 1XMOM 1Z5AA 4NXMM 3C58A 3W0FA 3SAUA 3U6SA 4LF9M 4DR1M 1L1ZA 4DV3M 3U6MA 4LFBM 4NXNM 5A2QS 5IWAM 3GPPA 4DR5M 4JI7M 5LMUM 3SARA 4DR7M 1KFVA 4LF5M 1Z5CA 3U6DA 1K3XA 3U6QA 2UUAM 2UXBM 5ITXA 3GQ4A 4B3SM 3TWMA 4PDGA 3T1YM 1XMQM 4JI2M 1HR0M
chains in the Genus database with same CATH superfamily
2L4FA 4OX9M 4LJ5A 3PFIA 1T43A 3WHKA 1TDHA 1AIPC 3GLGB 2YR0A 4JI5M 2VQEM 1OJLA 2XGNA 3BOSA 4NOOB 1IM2A 3GLIA 3HHYA 2Q2EB 3GLGE 4LJ7A 1Q02A 4LF8M 1F4IA 2UXCM 3FTFA 4MGZE 3W68A 2UUBM 3C9PA 4OU7A 1R2YA 5ITQA 2VF7A 1XXHB 1NY6A 2MROB 4LJ4A 2F5PA 3PVSA 5KQ8A 2GQFA 4GITA 4G4NA 4LJ9A 2XLJA 4I4LA 3PXGA 3NBXX 2Y0TA 4JI8M 4G4OA 2CUZA 1NO1A 3T1HM 3U6PA 3SASA 4ZPXA 1VG5A 4HLQA 1G71A 1QZMA 3J80S 3H4MA 3TWLA 2Z4SA 2XFTA 2EO2A 4KODA 3GQ3A 3EIHA 1R5LA 5FLXS 2G8LA 1Q3BA 1Z5BA 2K47A 3KP1E 2F4VM 1D0MA 3TQSA 1NV9A 2VIIA 1N77A 2F5OA 2ZANA 1FJGM 2LH0A 2R65A 3TPZA 2YFQA 1IBMM 2HKJA 2V6ZM 2Z4RA 3UZUA 3L26A 1E9SA 2XFSA 2F5QA 4PCZA 3DZDA 4KO8A 4DR4M 4AG5A 1IN8A 4X62M 4CJ6A 2KNAA 4LY6A 2LVOC 3FUXA 4DUYM 2K6BA 3JR4A 2V1UA 4B3TM 1NSFA 3GLIB 2QQ8A 3U6OA 3AL0C 2R6FA 2QZ4A 1E32A 4XGIA 4AG6A 2XEPA 3UJNA 1NHWC 1I4WA 4LGYA 1HQCA 2CFOA 2DAGA 5EJCA 3WHLA 1R4GA 5DNYA 5IT9S 1AUAA 1UM8A 2KZSA 2Y20A 4FWHA 4D80A 2ZAOA 4IBJA 4R71A 1L1TA 1L2DA 1Q39A 1CUKA 5LMNM 1VDLA 3K9PA 3KDSE 3M6AA 1IQPA 4DR6M 5IZ7D 3CGWA 4MGKE 3SMPA 3VDPA 1QQWA 1D2NA 4GEWA 2DNAA 2VF8A 1OQYA 1IXSA 2Y21A 3E9SA 3SHGB 5KPRA 4DV0M 4LF4M 2ZTCA 4YHHM 4DR3M 3RE8A 4GC9A 4R7GA 1GO5A 3TL4X 3HJQA 4R3DA 1QAOA 1DGBA 2H5XA 3FTCA 4F1IA 4LF9M 3R9XB 1T6OA 5FTNA 3ZQJA 2P5TA 4XK8F 2DAKA 4I8OA 3GLFB 4LFBM 3SFZA 5EQTA 1EIJA 4M0WA 1G41A 4DR5M 2LHCA 2ZAMA 4GH9A 4IBGA 5JI3E 3SARA 1OAIA 1Z5CA 3CF2A 4FD2A 8CATA 4QOSA 4RNAA 3MHVC 1C1KA 4LZZA 3TE6A 4B3SM 5C18A 3FYDA 5EP4A 3MMPA 1Y8GA 4PDGA 4QHTA 4FCWA 1PRBA 4AI6A 5EXTA 3HY5A 1DV0A 1SXJB 3CF6E 5FTMA 1ZV1A 3KXEC 4DV5M 3SAWA 5DYGA 3VDUA 2XSZD 3F92A 1JB0F 4XBOA 4M0DA 4LCBA 1IXSB 1V33A 3E4RA 3VK8A 5BR8M 4LZJA 3U61B 4G6ZA 2DWNA 2LVPC 5JI2E 2QSFX 1MX0A 1GKIA 2DHRA 1DGHA 3LVVA 3J81S 2ZBKB 1NV8A 2BJVA 5FTKA 1QVRA 2G3QA 3K1JA 4PD2A 2CV2A 1J09A 3B89A 4L16A 2QNJA 2R4JA 3GRVA 2C96A 2C9OA 4LF7M 3GLHA 2L4EA 2JY6B 3K8ZA 3LCVB 1N33M 4L8RC 2BWBA 2APLA 1RU3A 2O01F 1L2BA 3RFWA 3I01M 2C99A 2I7PA 4L78A 3GPUA 1YE9A 3W0LB 1V34A 3HU2A 3GLHB 3H4JA 2CV0A 1R7RA 4JI1M 2M5ZA 4CISA 3J7AS 4JI6M 1N32M 2HWJA 2WSFF 2QHOB 3LQRA 3FUWA 3I4VA 2LNHC 1IFYA 1Z6TA 1R2ZA 4Z8XA 3HGIA 2DHYA 1W5TA 2L09A 3CF0A 4FWGA 4K0KM 3LQQA 4L6V6 2JUJA 3KW6A 2DZLA 2RRUA 3W67A 2KRUA 1IXRC 1A5TA 1VEKA 2RKOA 2JY8A 2J7OA 1VDDA 3SAVA 2LVNC 2L7IA 1W5SA 3KVWA 3U60B 1NY5A 4CGYB 3OTOM 4OVZA 4M9SA 4MB7A 1J5EM 3SBJA 3LMMA 2E5LM 2HCBA 3KOXE 5ITUA 3C3EA 1WIVA 3KOYE 4GHLA 2R44A 4FW9A 3ILKA 4GRIA 1OAOC 3L2AA 1HT2E 3K92A 4X64M 4L4UA 2QPAA 3FUTA 3QYEA 1NNUC 3BXWA 5BPVA 4WURA 1GLNA 1P3QQ 4IJEA 1IBKM 1IN6A 2EJSA 3UGJA 1TH4A 3E21A 2CRUA 1JR3A 4AQYM 1DO0A 1NVMA 2KRKA 2J5YA 4FWDA 2VDBB 4KHPM 1T3TA 3R8FA 1OTRA 1LV7A 1WGNA 4LJ6A 4GKJM 4QNRA 4LGMA 3GRYA 4X66M 4JV5M 2QCUA 3AFHA 3I51A 1WJ7A 2O25A 1S3SA 1QDTA 2KW0A 4FCTA 3GLGA 4TUWA 1PJQA 2DI0A 3HU3A 4HEOA 3U5ZB 4QHSA 3GRRA 2X49A 3NWLA 4UN2B 1QYRA 1TTEA 3M0EA 1SXJD 1IY0A 3I4YA 4DV3M 2CHVA 1L1ZA 1PGYA 3GLFE 1N75A 2DAEA 3GPPA 3HJ8A 2JWSA 1N78A 4RF1A 2FS1A 1NJGA 4JI7M 2KXEA 4DBGB 1KFVA 2QBYB 2J7NA 3QWLA 2UUAM 2A5YB 3KP0E 2JA2A 4W5WA 1TH2A 4EIWA 4JI2M 1HQYE 5E6JA 1HJPA 2R4EA 5DFLA 4B08A 1QUTA 2OOBA 4BLCA 2X4AA 4DV7M 4JXJA 3U6EA 3VKHA 3L27A 2JXNA 4NSOB 5KPTA 3DFZA 3A98B 1QUSA 2BNKA 3HKPA 3HZJA 2O5RA 3THGA 1HNZM 2R46A 3A46A 2DWZB 2DZOB 3SC3A 4IBCA 2RGHA 2KEBA 4KLNA 3U60A 2WSEF 3B7ZA 2CV1A 3GLIE 2F5NA 2XZFA 2CP8A 1HNXM 1N36M 1JQJC 2R0IA 3QYBA 4I5SA 4P17A 2LVQD 1KYIA 2FE8A 3VLFB 2VQFM 1WXQA 2N35A 4MH0E 4REZA 1GJSA 1SG9A 3KOWE 2HL7A 3ZC7B 1K82A 1FNNA 2YQZA 1YSYA 1SXJE 2DAIA 2UXDM 4FCVA 5L8RF 1XC8A 3FTEA 1Z59A 1XXHA 1TDZA 3DOAA 3RGPA 4X65M 4IBDA 1DGGA 2Y0QA 1TH3A 2MGWA 3FE3A 3LVWA 4Y28F 1PM5A 2FOIC 1NNJA 1N34M 3JAMS 1OKSA 2FNAA 3B7QA 4AKIA 3J7BA 3Q8GA 4L15A 5EP1A 3FRHA 3U5ZA 5EXSA 1D0KA 2Z7JA 3IG8A 1V92A 3J27B 1ORYB 3NBIA 3HJSA 3D8BA 3GPYA 1NJFA 2OQ4A 1L2CA 2KHHA 3EIEA 4LFAM 5FSWA 3C3DA 1UFZA 2X8AA 1IY2A 1G8PA 3FYCA 1QDRA 2DENA 2JY7A 4BB9A 3SATA 1XHBA 1MN3A 2UUCM 3VKGA 4JYAM 1JR3D 4LJAA 3IHPA 2DZNB 4DV6M 2EA0A 3FUVA 3FTDA 3U6LA 1PJJA 4GC5A 1I94M 5IREB 1IN7A 3LCUA 3T15A 1OIZA 1G59A 5KPZA 2JNHA 1YLAA 1R6BX 5ITYA 4CHTB 3Q8XA 2LWXA 3GRUA 1D0LA 4F2LA 2OO9A 2XSZA 3A42A 3RGSA 1EFUB 2K0BX 2FFJA 4G4QA 2ERCA 3FRIA 3T38A 4DV1M 2XZUA 1SXJA 4IBBA 2ZTDA 4LJ8A 3SYLA 1EE8A 1C7YA 4GKKM 1G4AE 2K9DA 3IECA 3AOEC 1DGHB 2Z8YM 2Z3XA 5KO3A 2C98A 3U6CA 3FD9A 5F3WA 4JN6A 2DAMA 4DR2M 4IBFA 4IBIA 2MH8A 1XMOM 4M9ZA 2LTUA 4KT0F 1TR8A 3AV0A 1H6UA 4M9XA 1QAQA 3HWSA 3QAUA 2L2DA 3L25A 3GLHE 3HX3A 5IWAM 2WZJA 2R45A 3VFDA 3UK6A 1VEJA 2WSCF 2KNZA 2XF3A 4ANRA 3U6DA 1K3XA 1WHCA 3U6QA 2FH0A 1PJSA 2CEAA 2UXBM 1LTMA 4LRTA 1IY1A 4IIWA 4NC6A 3TWMA 3L29A 3T1YM 2DKLA 1SXJC 2QBYA 2KZUA 1VEGA 1HR0M 3FKEA 1OFIA 2I7NA 2BJWA 1L8QA 4IJFA 3A45A 3MJ5A 4LG2A 3HHZA 4NRWA 4B7FA 1OFHA 1ZMUA 2CHGA 3AOGA 3B74A 3I04M 2F5SA 4B3MM 4PDIA 1XNQM 2LVAA 4BBAA 3AKZA 1XNRM 3PNYA 1GL6A 3MK6A 4HL4A 4OW0A 5ITRA 4II7A 3T6PA 3CTWB 4Q7JA 5EXXA 1QANA 2EKFA 4NRVA 3TWKA 2LHGA 3V76A 2JZ0A 4AW4A 2ZM6M 2UU9M 2NQ8C 2GNOA 2H1RA 1GJTA 7CATA 2MR9A 1OIPA 2BWEA 4JI4M 5ITXE 4AKGA 2D7HA 5E26A 2HHHM 3K9OA 2JZ1A 4AKHA 4I81A 2CE7A 2RGOA 2AHMA 2V1CA 3D8LA 5GKNA 2MJ5B 2KDLA 3B9PA 1WR1B 3HHWA 1KSFX 2EUCA 4D82A 4IBEA 3KOZE 3GO8A 2DWLA 1BVSA 4RKUF 1IN5A 1GABA 2CHQA 3IG5A 3KS4A 2LBCA 2L7HA 3ZH9B 3GPXA 2C5RA 1PJIA 3FUUA 1GL7A 2OPFA 1HNWM 4AZFA 1QAMA 3SMSA 1K3WA 3ZCBB 5EP3A 1IXZA 2QENA 3E46A 5EXPA 2DVWB 4DV2M 5C1BA 4MGIE 1J7KA 2R62A 4NSRA 3GLFA 4GMQA 2DXIA 4GIPA 4Z6YA 4CIZA 2YNMD 5FTJA 2HAKA 4IBKA 4LFCM 3UMMA 4MGHA 4ITQA 4B7HA 1DO2A 1HT1E 1ZQ9A 5FTLA 3JR5A 2D7EA 1Q3CA 5H37D 4DV4M 3J2PB 4YY3M 1GVNA 1TGUA 4LF6M 1IN4A 4S12A 1IBLM 2C9CA 5DYIA 4MGYE 4WP2A 1NHGC 1ZMVA 4D81A 2CWBA 3GQ5A 4QOZC 4MM3B 3HHXA 4LRSA 4G3OA 2KNVA 4JI0M 4B3RM 5ITTA 3K2LA 3HU1A 4P16A 2KA6B 1JR3E 1VQ1A 3DA1A 4RF0A 3SHFA 3GP1A 3LW5F 3KSJA 1G3IA 1QZEA 3SYKA 1XB2B 1TF0B 3KS8A 1E94E 2D7GA 2G5GX 4DUZM 2QP9X 4G4RA 2R18A 4JI3M 4OVZB 2OOAA 4A3VB 1MU5A 1X37A 4FVMA 4QNMA 1E9RA 5KQDA 1MJGM 2JP7A 3B7NA 1Z5AA 3L28A 3VK7A 3KSXA 4NXMM 2EKKA 3C58A 3W0FA 1YUBA 1ZMWA 3SAUA 3U6SA 2W82A 2JY5A 1WGLA 2LXEA 4DR1M 3M7GA 3U6MA 3AOEA 4NXNM 5A2QS 1ZAEA 2XH9A 3BBZA 1DGFA 5EP2A 2M60A 5LMUM 4DR7M 4LF5M 1XWIA 2L6OA 3PNVA 4NL4H 4PT5A 5ITXA 3GQ4A 2DWMA 2B3TA 4B7GA 1XXHE 4GHAA 3KFUG 1XMQM 1PJTA 3AJIB 4WW0A 3U61A
chains in the Genus database with same CATH topology
4OX9M 4LJ5A 3PFIA 3WHKA 1TDHA 3GLGB 2YR0A 4JI5M 2VQEM 1OJLA 2XGNA 3BOSA 4NOOB 1IM2A 3GLIA 3HHYA 2Q2EB 4LJ7A 4LF8M 2UXCM 3FTFA 4MGZE 2UUBM 4OU7A 1R2YA 5ITQA 1XXHB 1NY6A 4LJ4A 2F5PA 3PVSA 5KQ8A 4GITA 4G4NA 4LJ9A 2XLJA 4I4LA 3PXGA 2Y0TA 4JI8M 4G4OA 2CUZA 3T1HM 3U6PA 3SASA 4ZPXA 4HLQA 1QZMA 3J80S 3H4MA 3TWLA 2Z4SA 2XFTA 2EO2A 4KODA 3GQ3A 3EIHA 5FLXS 2G8LA 3KP1E 1Q3BA 1Z5BA 2K47A 2F4VM 3TQSA 2VIIA 1N77A 2F5OA 2ZANA 1FJGM 2LH0A 2R65A 3TPZA 2YFQA 1IBMM 2HKJA 2V6ZM 2Z4RA 3UZUA 3L26A 1E9SA 2XFSA 2F5QA 4PCZA 3DZDA 4KO8A 4DR4M 4AG5A 1IN8A 4X62M 4LY6A 3FUXA 4DUYM 3JR4A 2V1UA 4B3TM 1NSFA 3GLIB 3U6OA 3AL0C 2QZ4A 1E32A 4XGIA 4AG6A 2XEPA 3UJNA 1NHWC 1I4WA 4LGYA 1HQCA 2CFOA 5EJCA 3WHLA 5DNYA 5IT9S 1UM8A 2KZSA 4FWHA 2Y20A 4D80A 2ZAOA 4IBJA 1L1TA 1L2DA 1Q39A 5LMNM 3KDSE 3M6AA 1IQPA 4DR6M 5IZ7D 4MGKE 3SMPA 3VDPA 1QQWA 1D2NA 2Y21A 3SHGB 3E9SA 5KPRA 4DV0M 4LF4M 4YHHM 4DR3M 3RE8A 4GC9A 4R7GA 3TL4X 3HJQA 4R3DA 1QAOA 1DGBA 3FTCA 4LF9M 3R9XB 5FTNA 2P5TA 3GLFB 4I8OA 4LFBM 3SFZA 5EQTA 4M0WA 1G41A 4DR5M 2ZAMA 4GH9A 4IBGA 5JI3E 3SARA 1Z5CA 3CF2A 4FD2A 8CATA 4QOSA 4RNAA 3MHVC 1C1KA 4LZZA 3TE6A 4B3SM 5C18A 3FYDA 5EP4A 4PDGA 4QHTA 4FCWA 4AI6A 5EXTA 1SXJB 3CF6E 5FTMA 3KXEC 4DV5M 3SAWA 5DYGA 3VDUA 2XSZD 4XBOA 4M0DA 4LCBA 1IXSB 3E4RA 3VK8A 5BR8M 4LZJA 3U61B 4G6ZA 2DWNA 5JI2E 1MX0A 1GKIA 2DHRA 1DGHA 3LVVA 3J81S 2ZBKB 2BJVA 5FTKA 1QVRA 3K1JA 4PD2A 2CV2A 1J09A 4L16A 2R4JA 3GRVA 2C96A 2C9OA 4LF7M 3GLHA 3K8ZA 1N33M 4L8RC 1L2BA 3RFWA 2C99A 2I7PA 4L78A 3GPUA 1YE9A 3W0LB 3HU2A 3GLHB 2CV0A 1R7RA 4JI1M 2M5ZA 4CISA 3J7AS 4JI6M 1N32M 3LQRA 3FUWA 3I4VA 2LNHC 1Z6TA 1R2ZA 4Z8XA 3HGIA 1W5TA 2L09A 3CF0A 4FWGA 4K0KM 3LQQA 3KW6A 2KRUA 1IXRC 2RKOA 2J7OA 1VDDA 3SAVA 2L7IA 1W5SA 3KVWA 3U60B 1NY5A 4CGYB 3OTOM 4OVZA 4M9SA 4MB7A 1J5EM 3SBJA 3LMMA 2E5LM 2HCBA 3KOXE 5ITUA 3KOYE 4GHLA 4FW9A 3ILKA 4GRIA 3L2AA 1HT2E 3K92A 4X64M 4L4UA 2QPAA 3FUTA 1NNUC 5BPVA 4WURA 1GLNA 4IJEA 1IBKM 1IN6A 3UGJA 1TH4A 1JR3A 4AQYM 1DO0A 1NVMA 2KRKA 4FWDA 4KHPM 1T3TA 3R8FA 1LV7A 4LJ6A 4GKJM 4QNRA 4LGMA 3GRYA 4X66M 4JV5M 2QCUA 3AFHA 3I51A 1S3SA 2KW0A 4FCTA 4TUWA 3GLGA 3HU3A 3U5ZB 4QHSA 3NWLA 2X49A 3GRRA 1QYRA 3M0EA 1SXJD 1IY0A 3I4YA 4DV3M 2CHVA 1L1ZA 1N75A 3GPPA 3HJ8A 1N78A 4RF1A 1NJGA 4JI7M 2KXEA 1KFVA 2QBYB 2J7NA 3QWLA 2UUAM 2A5YB 3KP0E 2JA2A 4W5WA 1TH2A 4EIWA 4JI2M 1HQYE 5E6JA 2R4EA 4B08A 4BLCA 2X4AA 4DV7M 4JXJA 3U6EA 3VKHA 3L27A 4NSOB 5KPTA 3DFZA 3A98B 3HKPA 2BNKA 2O5RA 3THGA 1HNZM 2R46A 3A46A 2DWZB 2DZOB 3SC3A 4IBCA 2RGHA 2KEBA 4KLNA 3U60A 2CV1A 2F5NA 2XZFA 1HNXM 1N36M 1JQJC 4I5SA 1KYIA 2FE8A 3VLFB 1WXQA 4MH0E 4REZA 3KOWE 3ZC7B 2HL7A 1K82A 1FNNA 2YQZA 1YSYA 1SXJE 2UXDM 4FCVA 1XC8A 3FTEA 1Z59A 1XXHA 1TDZA 3DOAA 3RGPA 4X65M 4IBDA 1DGGA 2Y0QA 1TH3A 3LVWA 1PM5A 1NNJA 2FOIC 1N34M 3JAMS 2FNAA 4AKIA 3J7BA 4L15A 5EP1A 3U5ZA 5EXSA 2Z7JA 3IG8A 3J27B 2OQ4A 1ORYB 3NBIA 3HJSA 3D8BA 3GPYA 1NJFA 1L2CA 3EIEA 4LFAM 5FSWA 2X8AA 1IY2A 1G8PA 3FYCA 4BB9A 3SATA 1XHBA 2UUCM 3VKGA 4JYAM 1JR3D 4LJAA 2DZNB 4DV6M 2EA0A 3FUVA 3FTDA 3U6LA 1PJJA 4GC5A 1I94M 5IREB 1IN7A 1G59A 3T15A 5KPZA 1R6BX 5ITYA 4CHTB 3Q8XA 2LWXA 3GRUA 2XSZA 3A42A 3RGSA 2FFJA 4G4QA 2ERCA 3T38A 4DV1M 2XZUA 1SXJA 4IBBA 4LJ8A 3SYLA 1EE8A 4GKKM 1G4AE 3AOEC 1DGHB 2Z3XA 5KO3A 2C98A 3U6CA 3FD9A 5F3WA 4JN6A 4DR2M 4IBFA 4IBIA 1XMOM 4M9ZA 3AV0A 1H6UA 4M9XA 1QAQA 3HWSA 3QAUA 3L25A 5IWAM 2R45A 3VFDA 3UK6A 2XF3A 3U6DA 1K3XA 3U6QA 2CEAA 2UXBM 4LRTA 1IY1A 4IIWA 3TWMA 3L29A 3T1YM 1SXJC 2QBYA 2KZUA 1HR0M 3FKEA 1OFIA 2I7NA 2BJWA 1L8QA 4IJFA 3A45A 3MJ5A 4LG2A 3HHZA 4NRWA 4B7FA 1OFHA 2CHGA 3AOGA 2F5SA 4B3MM 4PDIA 1XNQM 4BBAA 3AKZA 1XNRM 3PNYA 1GL6A 3MK6A 4HL4A 4OW0A 5ITRA 4II7A 3CTWB 5EXXA 1QANA 4NRVA 3TWKA 4AW4A 2ZM6M 2UU9M 2NQ8C 2H1RA 7CATA 4AKGA 4JI4M 5ITXE 2D7HA 5E26A 2HHHM 4AKHA 4I81A 2CE7A 2RGOA 2AHMA 2V1CA 3D8LA 5GKNA 3B9PA 3HHWA 1KSFX 2EUCA 4D82A 4IBEA 3KOZE 3GO8A 2DWLA 1IN5A 3KS4A 2CHQA 3IG5A 2L7HA 3ZH9B 3GPXA 2C5RA 1PJIA 3FUUA 1GL7A 2OPFA 1HNWM 4AZFA 1QAMA 3SMSA 1K3WA 3ZCBB 5EP3A 1IXZA 2QENA 5EXPA 2DVWB 4DV2M 5C1BA 4MGIE 1J7KA 2R62A 4NSRA 3GLFA 4GMQA 2DXIA 4GIPA 4Z6YA 2YNMD 5FTJA 4IBKA 4LFCM 3UMMA 4MGHA 4ITQA 4B7HA 1DO2A 1HT1E 1ZQ9A 5FTLA 3JR5A 2D7EA 1Q3CA 5H37D 4DV4M 3J2PB 4YY3M 1GVNA 1TGUA 4LF6M 1IN4A 4S12A 1IBLM 2C9CA 5DYIA 4MGYE 1NHGC 4D81A 4QOZC 3GQ5A 4MM3B 3HHXA 4LRSA 4JI0M 4B3RM 5ITTA 3K2LA 3HU1A 4P16A 2KA6B 3DA1A 4RF0A 3SHFA 3GP1A 3KSJA 1G3IA 3SYKA 3KS8A 1E94E 2D7GA 2G5GX 4DUZM 2QP9X 4G4RA 2R18A 4JI3M 4OVZB 4A3VB 1MU5A 1X37A 4FVMA 4QNMA 1E9RA 5KQDA 2VQFM 3VK7A 3L28A 1Z5AA 4NXMM 3KSXA 3C58A 3W0FA 1YUBA 3SAUA 3U6SA 2W82A 4DR1M 2LXEA 3M7GA 3U6MA 3AOEA 4NXNM 5A2QS 1ZAEA 2XH9A 1DGFA 5EP2A 2M60A 5LMUM 4DR7M 4LF5M 1XWIA 2L6OA 3PNVA 4NL4H 4PT5A 5ITXA 3GQ4A 2DWMA 4B7GA 4GHAA 3KFUG 1XMQM 3AJIB 4WW0A 3U61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 M;  4DV5 M;  4DV7 M;  3U6E A;  3SAW A;  3A45 A;  4NRW A;  1TDH A;  2F5S A;  3VK8 A;  4B3M M;  5BR8 M;  2VQE M;  4JI5 M;  1HNZ M;  3A46 A;  4PDI A;  2Q2E B;  1MX0 A;  1XNQ M;  3J81 S;  4LF8 M;  2ZBK B;  1XNR M;  2UXC M;  5ITR A;  4PD2 A;  2UUB M;  1R2Y A;  2F5N A;  5ITQ A;  2XZF A;  4NRV A;  3TWK A;  2ZM6 M;  1HNX M;  2UU9 M;  1N36 M;  4LF7 M;  2F5P A;  1N33 M;  4G4N A;  1L2B A;  5ITX E;  4JI4 M;  2HHH M;  3GPU A;  4G4O A;  4JI8 M;  1K82 A;  3T1H M;  3U6P A;  3SAS A;  2UXD M;  4JI1 M;  1XC8 A;  1Z59 A;  4CIS A;  3J80 S;  3DOA A;  1TDZ A;  3TWL A;  3J7A S;  4JI6 M;  1N32 M;  4X65 M;  3GO8 A;  3GQ3 A;  1PM5 A;  1NNJ A;  5FLX S;  1N34 M;  3JAM S;  1Q3B A;  1Z5B A;  1R2Z A;  2F4V M;  3GPX A;  4K0K M;  1PJI A;  2F5O A;  2OPF A;  1HNW M;  1FJG M;  2OQ4 A;  1L2C A;  3GPY A;  1K3W A;  1IBM M;  4LFA M;  2HKJ A;  3SAV A;  2F5Q A;  4PCZ A;  4DV2 M;  4DR4 M;  3OTO M;  4MB7 A;  1J5E M;  4X62 M;  3SAT A;  3SBJ A;  2UUC M;  2E5L M;  4JYA M;  4DUY M;  3JR4 A;  5ITU A;  4B3T M;  4DV6 M;  3U6O A;  2EA0 A;  4LFC M;  1PJJ A;  3U6L A;  4ITQ A;  3JR5 A;  4DV4 M;  1Q3C A;  4X64 M;  1I94 M;  4YY3 M;  4LF6 M;  1IBL M;  5ITY A;  1IBK M;  5IT9 S;  3GQ5 A;  3A42 A;  4AQY M;  4JI0 M;  4G4Q A;  4B3R M;  1L1T A;  1L2D A;  5ITT A;  1Q39 A;  4KHP M;  5LMN M;  4DV1 M;  3GP1 A;  2XZU A;  4GKJ M;  4DR6 M;  1EE8 A;  4X66 M;  4GKK M;  4JV5 M;  4G4R A;  4DUZ M;  3U6C A;  4JI3 M;  4DV0 M;  4LF4 M;  4DR2 M;  1MU5 A;  4YHH M;  2VQF M;  4DR3 M;  3VK7 A;  1XMO M;  1Z5A A;  4NXM M;  3C58 A;  3W0F A;  3SAU A;  3U6S A;  4LF9 M;  4DR1 M;  1L1Z A;  4DV3 M;  3U6M A;  4LFB M;  4NXN M;  5A2Q S;  5IWA M;  3GPP A;  4DR5 M;  4JI7 M;  5LMU M;  3SAR A;  4DR7 M;  1KFV A;  4LF5 M;  1Z5C A;  3U6D A;  1K3X A;  3U6Q A;  2UUA M;  2UXB M;  5ITX A;  3GQ4 A;  4B3S M;  3TWM A;  4PDG A;  3T1Y M;  1XMQ M;  4JI2 M;  1HR0 M; 
#chains in the Genus database with same CATH topology
 2L4F A;  4OX9 M;  4LJ5 A;  3PFI A;  1T43 A;  3WHK A;  1TDH A;  1AIP C;  3GLG B;  2YR0 A;  4JI5 M;  2VQE M;  1OJL A;  2XGN A;  3BOS A;  4NOO B;  1IM2 A;  3GLI A;  3HHY A;  2Q2E B;  3GLG E;  4LJ7 A;  1Q02 A;  4LF8 M;  1F4I A;  2UXC M;  3FTF A;  4MGZ E;  3W68 A;  2UUB M;  3C9P A;  4OU7 A;  1R2Y A;  5ITQ A;  2VF7 A;  1XXH B;  1NY6 A;  2MRO B;  4LJ4 A;  2F5P A;  3PVS A;  5KQ8 A;  2GQF A;  4GIT A;  4G4N A;  4LJ9 A;  2XLJ A;  4I4L A;  3PXG A;  3NBX X;  2Y0T A;  4JI8 M;  4G4O A;  2CUZ A;  1NO1 A;  3T1H M;  3U6P A;  3SAS A;  4ZPX A;  1VG5 A;  4HLQ A;  1G71 A;  1QZM A;  3J80 S;  3H4M A;  3TWL A;  2Z4S A;  2XFT A;  2EO2 A;  4KOD A;  3GQ3 A;  3EIH A;  1R5L A;  5FLX S;  2G8L A;  1Q3B A;  1Z5B A;  2K47 A;  3KP1 E;  2F4V M;  1D0M A;  3TQS A;  1NV9 A;  2VII A;  1N77 A;  2F5O A;  2ZAN A;  1FJG M;  2LH0 A;  2R65 A;  3TPZ A;  2YFQ A;  1IBM M;  2HKJ A;  2V6Z M;  2Z4R A;  3UZU A;  3L26 A;  1E9S A;  2XFS A;  2F5Q A;  4PCZ A;  3DZD A;  4KO8 A;  4DR4 M;  4AG5 A;  1IN8 A;  4X62 M;  4CJ6 A;  2KNA A;  4LY6 A;  2LVO C;  3FUX A;  4DUY M;  2K6B A;  3JR4 A;  2V1U A;  4B3T M;  1NSF A;  3GLI B;  2QQ8 A;  3U6O A;  3AL0 C;  2R6F A;  2QZ4 A;  1E32 A;  4XGI A;  4AG6 A;  2XEP A;  3UJN A;  1NHW C;  1I4W A;  4LGY A;  1HQC A;  2CFO A;  2DAG A;  5EJC A;  3WHL A;  1R4G A;  5DNY A;  5IT9 S;  1AUA A;  1UM8 A;  2KZS A;  2Y20 A;  4FWH A;  4D80 A;  2ZAO A;  4IBJ A;  4R71 A;  1L1T A;  1L2D A;  1Q39 A;  1CUK A;  5LMN M;  1VDL A;  3K9P A;  3KDS E;  3M6A A;  1IQP A;  4DR6 M;  5IZ7 D;  3CGW A;  4MGK E;  3SMP A;  3VDP A;  1QQW A;  1D2N A;  4GEW A;  2DNA A;  2VF8 A;  1OQY A;  1IXS A;  2Y21 A;  3E9S A;  3SHG B;  5KPR A;  4DV0 M;  4LF4 M;  2ZTC A;  4YHH M;  4DR3 M;  3RE8 A;  4GC9 A;  4R7G A;  1GO5 A;  3TL4 X;  3HJQ A;  4R3D A;  1QAO A;  1DGB A;  2H5X A;  3FTC A;  4F1I A;  4LF9 M;  3R9X B;  1T6O A;  5FTN A;  3ZQJ A;  2P5T A;  4XK8 F;  2DAK A;  4I8O A;  3GLF B;  4LFB M;  3SFZ A;  5EQT A;  1EIJ A;  4M0W A;  1G41 A;  4DR5 M;  2LHC A;  2ZAM A;  4GH9 A;  4IBG A;  5JI3 E;  3SAR A;  1OAI A;  1Z5C A;  3CF2 A;  4FD2 A;  8CAT A;  4QOS A;  4RNA A;  3MHV C;  1C1K A;  4LZZ A;  3TE6 A;  4B3S M;  5C18 A;  3FYD A;  5EP4 A;  3MMP A;  1Y8G A;  4PDG A;  4QHT A;  4FCW A;  1PRB A;  4AI6 A;  5EXT A;  3HY5 A;  1DV0 A;  1SXJ B;  3CF6 E;  5FTM A;  1ZV1 A;  3KXE C;  4DV5 M;  3SAW A;  5DYG A;  3VDU A;  2XSZ D;  3F92 A;  1JB0 F;  4XBO A;  4M0D A;  4LCB A;  1IXS B;  1V33 A;  3E4R A;  3VK8 A;  5BR8 M;  4LZJ A;  3U61 B;  4G6Z A;  2DWN A;  2LVP C;  5JI2 E;  2QSF X;  1MX0 A;  1GKI A;  2DHR A;  1DGH A;  3LVV A;  3J81 S;  2ZBK B;  1NV8 A;  2BJV A;  5FTK A;  1QVR A;  2G3Q A;  3K1J A;  4PD2 A;  2CV2 A;  1J09 A;  3B89 A;  4L16 A;  2QNJ A;  2R4J A;  3GRV A;  2C96 A;  2C9O A;  4LF7 M;  3GLH A;  2L4E A;  2JY6 B;  3K8Z A;  3LCV B;  1N33 M;  4L8R C;  2BWB A;  2APL A;  1RU3 A;  2O01 F;  1L2B A;  3RFW A;  3I01 M;  2C99 A;  2I7P A;  4L78 A;  3GPU A;  1YE9 A;  3W0L B;  1V34 A;  3HU2 A;  3GLH B;  3H4J A;  2CV0 A;  1R7R A;  4JI1 M;  2M5Z A;  4CIS A;  3J7A S;  4JI6 M;  1N32 M;  2HWJ A;  2WSF F;  2QHO B;  3LQR A;  3FUW A;  3I4V A;  2LNH C;  1IFY A;  1Z6T A;  1R2Z A;  4Z8X A;  3HGI A;  2DHY A;  1W5T A;  2L09 A;  3CF0 A;  4FWG A;  4K0K M;  3LQQ A;  4L6V 6;  2JUJ A;  3KW6 A;  2DZL A;  2RRU A;  3W67 A;  2KRU A;  1IXR C;  1A5T A;  1VEK A;  2RKO A;  2JY8 A;  2J7O A;  1VDD A;  3SAV A;  2LVN C;  2L7I A;  1W5S A;  3KVW A;  3U60 B;  1NY5 A;  4CGY B;  3OTO M;  4OVZ A;  4M9S A;  4MB7 A;  1J5E M;  3SBJ A;  3LMM A;  2E5L M;  2HCB A;  3KOX E;  5ITU A;  3C3E A;  1WIV A;  3KOY E;  4GHL A;  2R44 A;  4FW9 A;  3ILK A;  4GRI A;  1OAO C;  3L2A A;  1HT2 E;  3K92 A;  4X64 M;  4L4U A;  2QPA A;  3FUT A;  3QYE A;  1NNU C;  3BXW A;  5BPV A;  4WUR A;  1GLN A;  1P3Q Q;  4IJE A;  1IBK M;  1IN6 A;  2EJS A;  3UGJ A;  1TH4 A;  3E21 A;  2CRU A;  1JR3 A;  4AQY M;  1DO0 A;  1NVM A;  2KRK A;  2J5Y A;  4FWD A;  2VDB B;  4KHP M;  1T3T A;  3R8F A;  1OTR A;  1LV7 A;  1WGN A;  4LJ6 A;  4GKJ M;  4QNR A;  4LGM A;  3GRY A;  4X66 M;  4JV5 M;  2QCU A;  3AFH A;  3I51 A;  1WJ7 A;  2O25 A;  1S3S A;  1QDT A;  2KW0 A;  4FCT A;  3GLG A;  4TUW A;  1PJQ A;  2DI0 A;  3HU3 A;  4HEO A;  3U5Z B;  4QHS A;  3GRR A;  2X49 A;  3NWL A;  4UN2 B;  1QYR A;  1TTE A;  3M0E A;  1SXJ D;  1IY0 A;  3I4Y A;  4DV3 M;  2CHV A;  1L1Z A;  1PGY A;  3GLF E;  1N75 A;  2DAE A;  3GPP A;  3HJ8 A;  2JWS A;  1N78 A;  4RF1 A;  2FS1 A;  1NJG A;  4JI7 M;  2KXE A;  4DBG B;  1KFV A;  2QBY B;  2J7N A;  3QWL A;  2UUA M;  2A5Y B;  3KP0 E;  2JA2 A;  4W5W A;  1TH2 A;  4EIW A;  4JI2 M;  1HQY E;  5E6J A;  1HJP A;  2R4E A;  5DFL A;  4B08 A;  1QUT A;  2OOB A;  4BLC A;  2X4A A;  4DV7 M;  4JXJ A;  3U6E A;  3VKH A;  3L27 A;  2JXN A;  4NSO B;  5KPT A;  3DFZ A;  3A98 B;  1QUS A;  2BNK A;  3HKP A;  3HZJ A;  2O5R A;  3THG A;  1HNZ M;  2R46 A;  3A46 A;  2DWZ B;  2DZO B;  3SC3 A;  4IBC A;  2RGH A;  2KEB A;  4KLN A;  3U60 A;  2WSE F;  3B7Z A;  2CV1 A;  3GLI E;  2F5N A;  2XZF A;  2CP8 A;  1HNX M;  1N36 M;  1JQJ C;  2R0I A;  3QYB A;  4I5S A;  4P17 A;  2LVQ D;  1KYI A;  2FE8 A;  3VLF B;  2VQF M;  1WXQ A;  2N35 A;  4MH0 E;  4REZ A;  1GJS A;  1SG9 A;  3KOW E;  2HL7 A;  3ZC7 B;  1K82 A;  1FNN A;  2YQZ A;  1YSY A;  1SXJ E;  2DAI A;  2UXD M;  4FCV A;  5L8R F;  1XC8 A;  3FTE A;  1Z59 A;  1XXH A;  1TDZ A;  3DOA A;  3RGP A;  4X65 M;  4IBD A;  1DGG A;  2Y0Q A;  1TH3 A;  2MGW A;  3FE3 A;  3LVW A;  4Y28 F;  1PM5 A;  2FOI C;  1NNJ A;  1N34 M;  3JAM S;  1OKS A;  2FNA A;  3B7Q A;  4AKI A;  3J7B A;  3Q8G A;  4L15 A;  5EP1 A;  3FRH A;  3U5Z A;  5EXS A;  1D0K A;  2Z7J A;  3IG8 A;  1V92 A;  3J27 B;  1ORY B;  3NBI A;  3HJS A;  3D8B A;  3GPY A;  1NJF A;  2OQ4 A;  1L2C A;  2KHH A;  3EIE A;  4LFA M;  5FSW A;  3C3D A;  1UFZ A;  2X8A A;  1IY2 A;  1G8P A;  3FYC A;  1QDR A;  2DEN A;  2JY7 A;  4BB9 A;  3SAT A;  1XHB A;  1MN3 A;  2UUC M;  3VKG A;  4JYA M;  1JR3 D;  4LJA A;  3IHP A;  2DZN B;  4DV6 M;  2EA0 A;  3FUV A;  3FTD A;  3U6L A;  1PJJ A;  4GC5 A;  1I94 M;  5IRE B;  1IN7 A;  3LCU A;  3T15 A;  1OIZ A;  1G59 A;  5KPZ A;  2JNH A;  1YLA A;  1R6B X;  5ITY A;  4CHT B;  3Q8X A;  2LWX A;  3GRU A;  1D0L A;  4F2L A;  2OO9 A;  2XSZ A;  3A42 A;  3RGS A;  1EFU B;  2K0B X;  2FFJ A;  4G4Q A;  2ERC A;  3FRI A;  3T38 A;  4DV1 M;  2XZU A;  1SXJ A;  4IBB A;  2ZTD A;  4LJ8 A;  3SYL A;  1EE8 A;  1C7Y A;  4GKK M;  1G4A E;  2K9D A;  3IEC A;  3AOE C;  1DGH B;  2Z8Y M;  2Z3X A;  5KO3 A;  2C98 A;  3U6C A;  3FD9 A;  5F3W A;  4JN6 A;  2DAM A;  4DR2 M;  4IBF A;  4IBI A;  2MH8 A;  1XMO M;  4M9Z A;  2LTU A;  4KT0 F;  1TR8 A;  3AV0 A;  1H6U A;  4M9X A;  1QAQ A;  3HWS A;  3QAU A;  2L2D A;  3L25 A;  3GLH E;  3HX3 A;  5IWA M;  2WZJ A;  2R45 A;  3VFD A;  3UK6 A;  1VEJ A;  2WSC F;  2KNZ A;  2XF3 A;  4ANR A;  3U6D A;  1K3X A;  1WHC A;  3U6Q A;  2FH0 A;  1PJS A;  2CEA A;  2UXB M;  1LTM A;  4LRT A;  1IY1 A;  4IIW A;  4NC6 A;  3TWM A;  3L29 A;  3T1Y M;  2DKL A;  1SXJ C;  2QBY A;  2KZU A;  1VEG A;  1HR0 M;  3FKE A;  1OFI A;  2I7N A;  2BJW A;  1L8Q A;  4IJF A;  3A45 A;  3MJ5 A;  4LG2 A;  3HHZ A;  4NRW A;  4B7F A;  1OFH A;  1ZMU A;  2CHG A;  3AOG A;  3B74 A;  3I04 M;  2F5S A;  4B3M M;  4PDI A;  1XNQ M;  2LVA A;  4BBA A;  3AKZ A;  1XNR M;  3PNY A;  1GL6 A;  3MK6 A;  4HL4 A;  4OW0 A;  5ITR A;  4II7 A;  3T6P A;  3CTW B;  4Q7J A;  5EXX A;  1QAN A;  2EKF A;  4NRV A;  3TWK A;  2LHG A;  3V76 A;  2JZ0 A;  4AW4 A;  2ZM6 M;  2UU9 M;  2NQ8 C;  2GNO A;  2H1R A;  1GJT A;  7CAT A;  2MR9 A;  1OIP A;  2BWE A;  4JI4 M;  5ITX E;  4AKG A;  2D7H A;  5E26 A;  2HHH M;  3K9O A;  2JZ1 A;  4AKH A;  4I81 A;  2CE7 A;  2RGO A;  2AHM A;  2V1C A;  3D8L A;  5GKN A;  2MJ5 B;  2KDL A;  3B9P A;  1WR1 B;  3HHW A;  1KSF X;  2EUC A;  4D82 A;  4IBE A;  3KOZ E;  3GO8 A;  2DWL A;  1BVS A;  4RKU F;  1IN5 A;  1GAB A;  2CHQ A;  3IG5 A;  3KS4 A;  2LBC A;  2L7H A;  3ZH9 B;  3GPX A;  2C5R A;  1PJI A;  3FUU A;  1GL7 A;  2OPF A;  1HNW M;  4AZF A;  1QAM A;  3SMS A;  1K3W A;  3ZCB B;  5EP3 A;  1IXZ A;  2QEN A;  3E46 A;  5EXP A;  2DVW B;  4DV2 M;  5C1B A;  4MGI E;  1J7K A;  2R62 A;  4NSR A;  3GLF A;  4GMQ A;  2DXI A;  4GIP A;  4Z6Y A;  4CIZ A;  2YNM D;  5FTJ A;  2HAK A;  4IBK A;  4LFC M;  3UMM A;  4MGH A;  4ITQ A;  4B7H A;  1DO2 A;  1HT1 E;  1ZQ9 A;  5FTL A;  3JR5 A;  2D7E A;  1Q3C A;  5H37 D;  4DV4 M;  3J2P B;  4YY3 M;  1GVN A;  1TGU A;  4LF6 M;  1IN4 A;  4S12 A;  1IBL M;  2C9C A;  5DYI A;  4MGY E;  4WP2 A;  1NHG C;  1ZMV A;  4D81 A;  2CWB A;  3GQ5 A;  4QOZ C;  4MM3 B;  3HHX A;  4LRS A;  4G3O A;  2KNV A;  4JI0 M;  4B3R M;  5ITT A;  3K2L A;  3HU1 A;  4P16 A;  2KA6 B;  1JR3 E;  1VQ1 A;  3DA1 A;  4RF0 A;  3SHF A;  3GP1 A;  3LW5 F;  3KSJ A;  1G3I A;  1QZE A;  3SYK A;  1XB2 B;  1TF0 B;  3KS8 A;  1E94 E;  2D7G A;  2G5G X;  4DUZ M;  2QP9 X;  4G4R A;  2R18 A;  4JI3 M;  4OVZ B;  2OOA A;  4A3V B;  1MU5 A;  1X37 A;  4FVM A;  4QNM A;  1E9R A;  5KQD A;  1MJG M;  2JP7 A;  3B7N A;  1Z5A A;  3L28 A;  3VK7 A;  3KSX A;  4NXM M;  2EKK A;  3C58 A;  3W0F A;  1YUB A;  1ZMW A;  3SAU A;  3U6S A;  2W82 A;  2JY5 A;  1WGL A;  2LXE A;  4DR1 M;  3M7G A;  3U6M A;  3AOE A;  4NXN M;  5A2Q S;  1ZAE A;  2XH9 A;  3BBZ A;  1DGF A;  5EP2 A;  2M60 A;  5LMU M;  4DR7 M;  4LF5 M;  1XWI A;  2L6O A;  3PNV A;  4NL4 H;  4PT5 A;  5ITX A;  3GQ4 A;  2DWM A;  2B3T A;  4B7G A;  1XXH E;  4GHA A;  3KFU G;  1XMQ M;  1PJT A;  3AJI B;  4WW0 A;  3U61 A; 
#chains in the Genus database with same CATH homology
 4OX9 M;  4LJ5 A;  3PFI A;  3WHK A;  1TDH A;  3GLG B;  2YR0 A;  4JI5 M;  2VQE M;  1OJL A;  2XGN A;  3BOS A;  4NOO B;  1IM2 A;  3GLI A;  3HHY A;  2Q2E B;  4LJ7 A;  4LF8 M;  2UXC M;  3FTF A;  4MGZ E;  2UUB M;  4OU7 A;  1R2Y A;  5ITQ A;  1XXH B;  1NY6 A;  4LJ4 A;  2F5P A;  3PVS A;  5KQ8 A;  4GIT A;  4G4N A;  4LJ9 A;  2XLJ A;  4I4L A;  3PXG A;  2Y0T A;  4JI8 M;  4G4O A;  2CUZ A;  3T1H M;  3U6P A;  3SAS A;  4ZPX A;  4HLQ A;  1QZM A;  3J80 S;  3H4M A;  3TWL A;  2Z4S A;  2XFT A;  2EO2 A;  4KOD A;  3GQ3 A;  3EIH A;  5FLX S;  2G8L A;  3KP1 E;  1Q3B A;  1Z5B A;  2K47 A;  2F4V M;  3TQS A;  2VII A;  1N77 A;  2F5O A;  2ZAN A;  1FJG M;  2LH0 A;  2R65 A;  3TPZ A;  2YFQ A;  1IBM M;  2HKJ A;  2V6Z M;  2Z4R A;  3UZU A;  3L26 A;  1E9S A;  2XFS A;  2F5Q A;  4PCZ A;  3DZD A;  4KO8 A;  4DR4 M;  4AG5 A;  1IN8 A;  4X62 M;  4LY6 A;  3FUX A;  4DUY M;  3JR4 A;  2V1U A;  4B3T M;  1NSF A;  3GLI B;  3U6O A;  3AL0 C;  2QZ4 A;  1E32 A;  4XGI A;  4AG6 A;  2XEP A;  3UJN A;  1NHW C;  1I4W A;  4LGY A;  1HQC A;  2CFO A;  5EJC A;  3WHL A;  5DNY A;  5IT9 S;  1UM8 A;  2KZS A;  4FWH A;  2Y20 A;  4D80 A;  2ZAO A;  4IBJ A;  1L1T A;  1L2D A;  1Q39 A;  5LMN M;  3KDS E;  3M6A A;  1IQP A;  4DR6 M;  5IZ7 D;  4MGK E;  3SMP A;  3VDP A;  1QQW A;  1D2N A;  2Y21 A;  3SHG B;  3E9S A;  5KPR A;  4DV0 M;  4LF4 M;  4YHH M;  4DR3 M;  3RE8 A;  4GC9 A;  4R7G A;  3TL4 X;  3HJQ A;  4R3D A;  1QAO A;  1DGB A;  3FTC A;  4LF9 M;  3R9X B;  5FTN A;  2P5T A;  3GLF B;  4I8O A;  4LFB M;  3SFZ A;  5EQT A;  4M0W A;  1G41 A;  4DR5 M;  2ZAM A;  4GH9 A;  4IBG A;  5JI3 E;  3SAR A;  1Z5C A;  3CF2 A;  4FD2 A;  8CAT A;  4QOS A;  4RNA A;  3MHV C;  1C1K A;  4LZZ A;  3TE6 A;  4B3S M;  5C18 A;  3FYD A;  5EP4 A;  4PDG A;  4QHT A;  4FCW A;  4AI6 A;  5EXT A;  1SXJ B;  3CF6 E;  5FTM A;  3KXE C;  4DV5 M;  3SAW A;  5DYG A;  3VDU A;  2XSZ D;  4XBO A;  4M0D A;  4LCB A;  1IXS B;  3E4R A;  3VK8 A;  5BR8 M;  4LZJ A;  3U61 B;  4G6Z A;  2DWN A;  5JI2 E;  1MX0 A;  1GKI A;  2DHR A;  1DGH A;  3LVV A;  3J81 S;  2ZBK B;  2BJV A;  5FTK A;  1QVR A;  3K1J A;  4PD2 A;  2CV2 A;  1J09 A;  4L16 A;  2R4J A;  3GRV A;  2C96 A;  2C9O A;  4LF7 M;  3GLH A;  3K8Z A;  1N33 M;  4L8R C;  1L2B A;  3RFW A;  2C99 A;  2I7P A;  4L78 A;  3GPU A;  1YE9 A;  3W0L B;  3HU2 A;  3GLH B;  2CV0 A;  1R7R A;  4JI1 M;  2M5Z A;  4CIS A;  3J7A S;  4JI6 M;  1N32 M;  3LQR A;  3FUW A;  3I4V A;  2LNH C;  1Z6T A;  1R2Z A;  4Z8X A;  3HGI A;  1W5T A;  2L09 A;  3CF0 A;  4FWG A;  4K0K M;  3LQQ A;  3KW6 A;  2KRU A;  1IXR C;  2RKO A;  2J7O A;  1VDD A;  3SAV A;  2L7I A;  1W5S A;  3KVW A;  3U60 B;  1NY5 A;  4CGY B;  3OTO M;  4OVZ A;  4M9S A;  4MB7 A;  1J5E M;  3SBJ A;  3LMM A;  2E5L M;  2HCB A;  3KOX E;  5ITU A;  3KOY E;  4GHL A;  4FW9 A;  3ILK A;  4GRI A;  3L2A A;  1HT2 E;  3K92 A;  4X64 M;  4L4U A;  2QPA A;  3FUT A;  1NNU C;  5BPV A;  4WUR A;  1GLN A;  4IJE A;  1IBK M;  1IN6 A;  3UGJ A;  1TH4 A;  1JR3 A;  4AQY M;  1DO0 A;  1NVM A;  2KRK A;  4FWD A;  4KHP M;  1T3T A;  3R8F A;  1LV7 A;  4LJ6 A;  4GKJ M;  4QNR A;  4LGM A;  3GRY A;  4X66 M;  4JV5 M;  2QCU A;  3AFH A;  3I51 A;  1S3S A;  2KW0 A;  4FCT A;  4TUW A;  3GLG A;  3HU3 A;  3U5Z B;  4QHS A;  3NWL A;  2X49 A;  3GRR A;  1QYR A;  3M0E A;  1SXJ D;  1IY0 A;  3I4Y A;  4DV3 M;  2CHV A;  1L1Z A;  1N75 A;  3GPP A;  3HJ8 A;  1N78 A;  4RF1 A;  1NJG A;  4JI7 M;  2KXE A;  1KFV A;  2QBY B;  2J7N A;  3QWL A;  2UUA M;  2A5Y B;  3KP0 E;  2JA2 A;  4W5W A;  1TH2 A;  4EIW A;  4JI2 M;  1HQY E;  5E6J A;  2R4E A;  4B08 A;  4BLC A;  2X4A A;  4DV7 M;  4JXJ A;  3U6E A;  3VKH A;  3L27 A;  4NSO B;  5KPT A;  3DFZ A;  3A98 B;  3HKP A;  2BNK A;  2O5R A;  3THG A;  1HNZ M;  2R46 A;  3A46 A;  2DWZ B;  2DZO B;  3SC3 A;  4IBC A;  2RGH A;  2KEB A;  4KLN A;  3U60 A;  2CV1 A;  2F5N A;  2XZF A;  1HNX M;  1N36 M;  1JQJ C;  4I5S A;  1KYI A;  2FE8 A;  3VLF B;  1WXQ A;  4MH0 E;  4REZ A;  3KOW E;  3ZC7 B;  2HL7 A;  1K82 A;  1FNN A;  2YQZ A;  1YSY A;  1SXJ E;  2UXD M;  4FCV A;  1XC8 A;  3FTE A;  1Z59 A;  1XXH A;  1TDZ A;  3DOA A;  3RGP A;  4X65 M;  4IBD A;  1DGG A;  2Y0Q A;  1TH3 A;  3LVW A;  1PM5 A;  1NNJ A;  2FOI C;  1N34 M;  3JAM S;  2FNA A;  4AKI A;  3J7B A;  4L15 A;  5EP1 A;  3U5Z A;  5EXS A;  2Z7J A;  3IG8 A;  3J27 B;  2OQ4 A;  1ORY B;  3NBI A;  3HJS A;  3D8B A;  3GPY A;  1NJF A;  1L2C A;  3EIE A;  4LFA M;  5FSW A;  2X8A A;  1IY2 A;  1G8P A;  3FYC A;  4BB9 A;  3SAT A;  1XHB A;  2UUC M;  3VKG A;  4JYA M;  1JR3 D;  4LJA A;  2DZN B;  4DV6 M;  2EA0 A;  3FUV A;  3FTD A;  3U6L A;  1PJJ A;  4GC5 A;  1I94 M;  5IRE B;  1IN7 A;  1G59 A;  3T15 A;  5KPZ A;  1R6B X;  5ITY A;  4CHT B;  3Q8X A;  2LWX A;  3GRU A;  2XSZ A;  3A42 A;  3RGS A;  2FFJ A;  4G4Q A;  2ERC A;  3T38 A;  4DV1 M;  2XZU A;  1SXJ A;  4IBB A;  4LJ8 A;  3SYL A;  1EE8 A;  4GKK M;  1G4A E;  3AOE C;  1DGH B;  2Z3X A;  5KO3 A;  2C98 A;  3U6C A;  3FD9 A;  5F3W A;  4JN6 A;  4DR2 M;  4IBF A;  4IBI A;  1XMO M;  4M9Z A;  3AV0 A;  1H6U A;  4M9X A;  1QAQ A;  3HWS A;  3QAU A;  3L25 A;  5IWA M;  2R45 A;  3VFD A;  3UK6 A;  2XF3 A;  3U6D A;  1K3X A;  3U6Q A;  2CEA A;  2UXB M;  4LRT A;  1IY1 A;  4IIW A;  3TWM A;  3L29 A;  3T1Y M;  1SXJ C;  2QBY A;  2KZU A;  1HR0 M;  3FKE A;  1OFI A;  2I7N A;  2BJW A;  1L8Q A;  4IJF A;  3A45 A;  3MJ5 A;  4LG2 A;  3HHZ A;  4NRW A;  4B7F A;  1OFH A;  2CHG A;  3AOG A;  2F5S A;  4B3M M;  4PDI A;  1XNQ M;  4BBA A;  3AKZ A;  1XNR M;  3PNY A;  1GL6 A;  3MK6 A;  4HL4 A;  4OW0 A;  5ITR A;  4II7 A;  3CTW B;  5EXX A;  1QAN A;  4NRV A;  3TWK A;  4AW4 A;  2ZM6 M;  2UU9 M;  2NQ8 C;  2H1R A;  7CAT A;  4AKG A;  4JI4 M;  5ITX E;  2D7H A;  5E26 A;  2HHH M;  4AKH A;  4I81 A;  2CE7 A;  2RGO A;  2AHM A;  2V1C A;  3D8L A;  5GKN A;  3B9P A;  3HHW A;  1KSF X;  2EUC A;  4D82 A;  4IBE A;  3KOZ E;  3GO8 A;  2DWL A;  1IN5 A;  3KS4 A;  2CHQ A;  3IG5 A;  2L7H A;  3ZH9 B;  3GPX A;  2C5R A;  1PJI A;  3FUU A;  1GL7 A;  2OPF A;  1HNW M;  4AZF A;  1QAM A;  3SMS A;  1K3W A;  3ZCB B;  5EP3 A;  1IXZ A;  2QEN A;  5EXP A;  2DVW B;  4DV2 M;  5C1B A;  4MGI E;  1J7K A;  2R62 A;  4NSR A;  3GLF A;  4GMQ A;  2DXI A;  4GIP A;  4Z6Y A;  2YNM D;  5FTJ A;  4IBK A;  4LFC M;  3UMM A;  4MGH A;  4ITQ A;  4B7H A;  1DO2 A;  1HT1 E;  1ZQ9 A;  5FTL A;  3JR5 A;  2D7E A;  1Q3C A;  5H37 D;  4DV4 M;  3J2P B;  4YY3 M;  1GVN A;  1TGU A;  4LF6 M;  1IN4 A;  4S12 A;  1IBL M;  2C9C A;  5DYI A;  4MGY E;  1NHG C;  4D81 A;  4QOZ C;  3GQ5 A;  4MM3 B;  3HHX A;  4LRS A;  4JI0 M;  4B3R M;  5ITT A;  3K2L A;  3HU1 A;  4P16 A;  2KA6 B;  3DA1 A;  4RF0 A;  3SHF A;  3GP1 A;  3KSJ A;  1G3I A;  3SYK A;  3KS8 A;  1E94 E;  2D7G A;  2G5G X;  4DUZ M;  2QP9 X;  4G4R A;  2R18 A;  4JI3 M;  4OVZ B;  4A3V B;  1MU5 A;  1X37 A;  4FVM A;  4QNM A;  1E9R A;  5KQD A;  2VQF M;  3VK7 A;  3L28 A;  1Z5A A;  4NXM M;  3KSX A;  3C58 A;  3W0F A;  1YUB A;  3SAU A;  3U6S A;  2W82 A;  4DR1 M;  2LXE A;  3M7G A;  3U6M A;  3AOE A;  4NXN M;  5A2Q S;  1ZAE A;  2XH9 A;  1DGF A;  5EP2 A;  2M60 A;  5LMU M;  4DR7 M;  4LF5 M;  1XWI A;  2L6O A;  3PNV A;  4NL4 H;  4PT5 A;  5ITX A;  3GQ4 A;  2DWM A;  4B7G A;  4GHA A;  3KFU G;  1XMQ M;  3AJI B;  4WW0 A;  3U61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...