1VEJA

Solution structure of rsgi ruh-016, a uba domain from mouse cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
GSSGSSGARACSQSSQTALPTSLFTEGRYQQELEELKALGFANRDANLQALVATDGDIHAAIEMLLGASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-016, a UBA Domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 4931431F19
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vejA00
2DAIA 2DAEA 1MN3A 1V92A 3E21A 1XB2B 1QZEA 1OAIA 2EJSA 2O25A 2JP7A 1XXHE 3GLHE 2QSFX 2DI0A 2HWJA 2BWBA 1R4GA 1Y8GA 2DNAA 1OKSA 2ZTDA 2K9DA 2DKLA 3GLIE 3GLFE 2DAMA 2DHYA 1VEKA 2HAKA 2K0BX 2LBCA 2JY7A 1OTRA 1IFYA 1WJ7A 1WHCA 1T6OA 4WP2A 2CP8A 2QNJA 5DFLA 4F1IA 1AIPC 2KNAA 2DENA 1G3IA 3FE3A 2EKFA 2MJ5B 1ZMUA 2KNZA 2ZTCA 1C7YA 1WGLA 2BWEA 1YLAA 3K9PA 1G41A 2R0IA 1VDLA 2LVOC 2QHOB 1IM2A 2WZJA 1NV8A 3LCVB 1VEJA 1HT2E 2CWBA 2JUJA 3FRHA 3BBZA 1NV9A 3K9OA 1DO2A 2EKKA 1IXSA 2G3QA 1WR1B 2JZ0A 2L4EA 1KYIA 4UN2B 3GLGE 2LVPC 2OO9A 3IHPA 4DBGB 2LVQD 2LTUA 1SG9A 1TR8A 2OOBA 1WIVA 2MROB 2MGWA 1VG5A 2DAKA 4Q7JA 2DZLA 2B3TA 3IECA 1HJPA 1VQ1A 2KHHA 3B89A 2OOAA 1DO0A 3F92A 1DV0A 1T43A 2DAGA 1ZMVA 1A5TA 1OQYA 1EFUB 1PGYA 3E46A 2KNVA 3MMPA 1TTEA 2JZ1A 2RRUA 1F4IA 1GO5A 2JY8A 2JY5A 1Q02A 1ZMWA 1JR3E 4HEOA 1WGNA 2H5XA 2JY6B 2L2DA 3H4JA 4F2LA 3LCUA 2L4FA 3FRIA 1G4AE 4GEWA 1HT1E 5JI2E 1VEGA 2LVNC 2JNHA 2LVAA 1ZV1A 2MR9A 1E94E 1P3QQ 1HQYE 3T6PA 1BVSA 4R71A 1UFZA 4G3OA 1CUKA
chains in the Genus database with same CATH superfamily
1DGBA 4DV0M 1TH4A 5EP2A 5H37D 4LCBA 4X65M 2W82A 3RE8A 2QENA 1ZAEA 5ITTA 2WSFF 2VIIA 5FTMA 4FWGA 3KOXE 2Z7JA 1XXHE 3DA1A 2FS1A 2QSFX 2Z8YM 4LJ9A 1N33M 2RGHA 3J80S 4M9XA 1NVMA 1NO1A 3C3EA 1JB0F 4KT0F 5KPRA 1I4WA 2DKLA 2LNHC 2YR0A 1IXRC 1XXHA 5EXPA 3EIHA 1Q3BA 2APLA 2HAKA 2DWLA 3GLGB 3IG8A 3KFUG 1PJQA 3HJQA 2LBCA 2V1UA 2JY7A 3B9PA 3LQQA 3MK6A 1V34A 5BR8M 5IWAM 4MGKE 1MU5A 2DWZB 1WHCA 4B08A 3R9XB 3D8LA 3SC3A 3I01M 5ITRA 4F1IA 3A45A 5ITXE 1XHBA 2CUZA 1DGHB 2VF7A 2R44A 4I8OA 4NSRA 4B3TM 1R7RA 2WSCF 5FTJA 3TWMA 4KHPM 2MJ5B 4GHAA 4QNMA 4MH0E 1SXJB 2ZTCA 1WGLA 2BWEA 4FW9A 1C7YA 4LF9M 5ITUA 2C96A 1IN7A 3FTDA 3U6EA 2QBYA 4LF8M 1W5TA 3FUVA 1QUSA 2R0IA 3FUWA 3PXGA 2CV1A 3SARA 2E5LM 1DGGA 1IM2A 2G5GX 2WZJA 2YFQA 2Z4RA 3GP1A 2CV0A 5KPTA 3M6AA 1L2CA 2CWBA 2JUJA 2AHMA 5FTLA 3K9OA 2DXIA 3HHXA 4R7GA 2F5SA 1HNWM 1AUAA 5KO3A 3GPXA 2JZ0A 4DV4M 2G8LA 3KS4A 3U6QA 4IJFA 4B7GA 2UUCM 3TE6A 3FUXA 1VDDA 1KYIA 1XMQM 1GJTA 1IN8A 4JV5M 3SYLA 2Y0TA 2OPFA 2LVQD 3ZC7B 3GLFB 2Y21A 3DZDA 4FWDA 3ZQJA 4DUYM 1YSYA 1VG5A 3QAUA 2FOIC 2J7OA 1HJPA 4TUWA 1L8QA 3GLHB 4CHTB 1QZMA 1Z5BA 3AOEC 2F5PA 1EFUB 1NSFA 3HU3A 1PGYA 3AJIB 3E46A 5KQ8A 2KNVA 4M9SA 4CGYB 5EP4A 4HL4A 2R45A 1GO5A 1OFIA 4DR2M 1PJIA 2CV2A 4B3SM 1NJFA 1HNZM 3IG5A 3LW5F 5FTNA 4HEOA 4X64M 1WGNA 2H5XA 4ZPXA 5FLXS 1N75A 4JXJA 5E6JA 2I7PA 1G59A 2EO2A 1UM8A 4MB7A 3HJSA 4GEWA 4Z8XA 3Q8XA 1QANA 4DV5M 3U5ZA 3AFHA 5JI2E 1VEGA 2LVNC 1SXJC 2JNHA 2XEPA 4JI8M 1NNJA 3VK8A 1P3QQ 1YUBA 5EP3A 3U6MA 2J7NA 4JI7M 3GRRA 3KOZE 3T1HM 4YHHM 3GRYA 3HWSA 4G3OA 3RFWA 4Y28F 2ZAOA 2VDBB 3GQ3A 1PJSA 4BB9A 2CHVA 5E26A 1E32A 2NQ8C 3KW6A 1NY6A 1X37A 2DAIA 1N78A 3KDSE 1C1KA 4I4LA 3I04M 3ZCBB 3GQ4A 3GQ5A 2JA2A 4GKKM 1T3TA 2DI0A 1ZQ9A 4JI2M 1R4GA 2C98A 1E9RA 4IIWA 5IREB 2ZTDA 4AQYM 3KXEC 4BBAA 1HQCA 2VF8A 4D82A 2R4JA 1JR3D 2K0BX 5DYGA 3BOSA 4R3DA 3CF0A 3GLIA 1GKIA 3GO8A 3J7BA 4JI0M 1G8PA 1OIPA 1E9SA 1IFYA 1WJ7A 4QHTA 4XK8F 4AKHA 1IN6A 2ZM6M 4OX9M 2M60A 4MGIE 4FWHA 3T38A 1K82A 4FD2A 2KW0A 4JI3M 1AIPC 3WHLA 2DENA 3B74A 3LVWA 5EP1A 4ANRA 2C9OA 4AKGA 4I5SA 2Z4SA 7CATA 4PCZA 3HHYA 1JR3A 3K9PA 4X66M 2UUBM 4NSOB 1R2YA 4AG6A 2D7GA 3U6LA 4XBOA 1IN5A 1NV8A 3FTEA 1I94M 2JWSA 4PDGA 3SFZA 2OQ4A 1HT2E 3VLFB 3KOYE 3BBZA 3LMMA 5EJCA 5C18A 1DO2A 3KOWE 3U61B 3V76A 3L29A 5LMNM 1GLNA 1Z59A 2D7EA 2G3QA 3LVVA 4G4RA 1WR1B 5GKNA 4OW0A 2X4AA 4LG2A 3C9PA 4LF6M 2J5YA 4P17A 4OVZA 2LVPC 3IHPA 2KEBA 4LFAM 4KO8A 1IBKM 1OIZA 1J7KA 1PRBA 3VKHA 3GRUA 1QAMA 3HKPA 3PNYA 2DZOB 2DAKA 3FTFA 3KSXA 4QNRA 1R2ZA 1G71A 2DZLA 2XGNA 3DOAA 5F3WA 2OOAA 3HHZA 1DGHA 5LMUM 4RKUF 3RGPA 1FNNA 1IBLM 3U6PA 3UMMA 3MMPA 3U60B 2F5NA 1MJGM 2JZ1A 4DR7M 2VQEM 5ITXA 2JY8A 3GLGA 2F4VM 2BJWA 2HL7A 3KP0E 4M9ZA 4L4UA 1Z6TA 8CATA 1WXQA 3FD9A 3K2LA 2R4EA 2R62A 3HX3A 4F2LA 5ITYA 4XGIA 2L4FA 1PJTA 4LY6A 3UGJA 3CF6E 1G4AE 4GRIA 1HT1E 2QZ4A 4PT5A 2A5YB 2KDLA 2LVAA 4KODA 2F5OA 1NY5A 2R18A 2XSZD 1XWIA 2HKJA 4FCTA 3L28A 5EQTA 4Z6YA 3AOEA 3FUTA 2XZUA 1QDTA 2R65A 3EIEA 1DGFA 1L2DA 4I81A 4IBFA 1TH3A 4GITA 4D81A 2X49A 3FUUA 4B3MM 2Y0QA 2Q2EB 1UFZA 2FNAA 1YE9A 4GC9A 5BPVA 2KZSA 4L8RC 1HR0M 2FH0A 2K47A 1N77A 4LFCM 1PM5A 3PFIA 2QCUA 2DAEA 4L16A 3VFDA 2ZANA 2QQ8A 3L2AA 4DV3M 2EJSA 3U6SA 2O25A 3SBJA 2Y20A 2ERCA 3FYCA 3GLHE 2BJVA 2C99A 4RF1A 2O5RA 3W0LB 2HWJA 3SAWA 3SYKA 2BWBA 2L7HA 5FTKA 1Y8GA 4G6ZA 1Z5AA 3I4VA 5C1BA 1IY0A 1RU3A 3H4MA 1R6BX 4FVMA 2QPAA 3GLFE 3GLIE 3A98B 3GLHA 2DAMA 2DHYA 1L1ZA 1VEKA 2XF3A 4HLQA 4AKIA 4DV2M 1EE8A 2CE7A 1IQPA 3JR4A 3SASA 3JAMS 3AL0C 3J27B 1H6UA 4DR5M 3TPZA 4B7FA 3GPPA 4QHSA 1LTMA 1TGUA 4LZZA 2CP8A 2L6OA 3PNVA 4M0DA 2QNJA 5DFLA 3M0EA 1J5EM 4NXMM 3J7AS 4G4QA 2KNAA 3L27A 3THGA 3VDPA 5IT9S 4AI6A 2KNZA 3GPYA 2KZUA 4MM3B 4JI5M 5L8RF 1SXJD 4LF7M 1V33A 4QOZC 1VDLA 2LVOC 2KXEA 2QHOB 1GJSA 3HHWA 5A2QS 4LGYA 4DV7M 4NL4H 3GRVA 2N35A 2LXEA 1QVRA 3FRHA 2XFTA 2QBYB 2K6BA 2DHRA 2EKKA 4LGMA 4GHLA 1IXSA 4DUZM 1L1TA 3B7ZA 3NBIA 2UUAM 3W68A 4JI6M 4GIPA 2KRKA 3KVWA 3K1JA 4BLCA 1QYRA 2CHQA 1K3WA 4LJ8A 4LJ7A 1EIJA 3FTCA 1IXSB 2CRUA 4D80A 4DBGB 2LWXA 1SG9A 2OOBA 3U5ZB 1S3SA 1TDZA 2MGWA 3MJ5A 2XFSA 3UJNA 4Q7JA 3BXWA 4G4OA 2LHGA 3IECA 2KHHA 1VQ1A 1DV0A 1XXHB 1DO0A 4IBKA 2LHCA 3AOGA 1T43A 2DAGA 3R8FA 2ZBKB 4MGZE 2Z3XA 1OQYA 3L25A 2C5RA 3TL4X 4P16A 1TH2A 2XSZA 3KP1E 3SATA 3NWLA 4DR4M 2MH8A 1FJGM 4IBEA 3ZH9B 4LF5M 2CHGA 2RRUA 4WURA 2XZFA 2JY5A 1ZMWA 1R5LA 1JR3E 2L09A 2P5TA 1K3XA 4W5WA 2R6FA 3SMSA 2JY6B 2L2DA 3K92A 1XMOM 4IBGA 3JR5A 3U6DA 2UU9M 2JXNA 4K0KM 3TWLA 3FRIA 3VKGA 3D8BA 4RNAA 4CIZA 4AW4A 3GLFA 1MX0A 4B3RM 4IJEA 4EIWA 4G4NA 4OVZB 5EXTA 3SHFA 1TDHA 2MR9A 2YQZA 3CTWB 2DWNA 5IZ7D 4LJ4A 4LZJA 1HQYE 3T6PA 3J2PB 4MGHA 4AZFA 1QAOA 5DNYA 4CISA 4LFBM 2DVWB 4R71A 1CUKA 1Q39A 1IXZA 3HU1A 4GC5A 2FE8A 2M5ZA 4M0WA 3U60A 1MN3A 1V92A 2EA0A 3SHGB 3E21A 1XB2B 4NRWA 3UZUA 4X62M 1J09A 1QZEA 1OAIA 4IBDA 4LJAA 2JP7A 5JI3E 2L7IA 4PDIA 3HGIA 2RGOA 3T1YM 3HY5A 3FYDA 3DFZA 4LJ5A 1GL7A 3M7GA 1NHWC 4LRSA 2DNAA 4OU7A 5EXSA 1OKSA 3OTOM 3KSJA 2K9DA 4GMQA 2R46A 4WW0A 1IBMM 3U61A 1D2NA 1IY1A 1ORYB 2FFJA 3I4YA 4IBCA 4RF0A 4NXNM 3E4RA 3E9SA 1OTRA 4AG5A 2C9CA 1IY2A 3NBXX 5EXXA 1T6OA 2BNKA 2CFOA 2V6ZM 4L78A 4WP2A 1NHGC 4DR6M 2H1RA 2ZAMA 3SMPA 4A3VB 2XLJA 4LRTA 1OAOC 1G3IA 1Q3CA 3FE3A 3FKEA 4MGYE 4PD2A 1OJLA 2EKFA 3PVSA 1ZMUA 4IBJA 5ITQA 3Q8GA 3T15A 1KFVA 1YLAA 3QWLA 2V1CA 3VK7A 1QAQA 2F5QA 1G41A 3U6CA 5KQDA 1GVNA 3LCVB 1XNQM 1IN4A 5KPZA 4GKJM 1VEJA 1HNXM 1GL6A 1NJGA 3MHVC 4S12A 3GPUA 2UXBM 4DR3M 3ILKA 3L26A 2KRUA 3AV0A 1NV9A 1QDRA 4JN6A 2EUCA 4II7A 3QYEA 4LJ6A 2I7NA 4JI4M 5DYIA 3VDUA 3GLIB 3TQSA 3UK6A 4GH9A 1L2BA 2L4EA 2GNOA 4UN2B 3W67A 3GLGE 1D0MA 2OO9A 1NNUC 3TWKA 2LTUA 1TR8A 2UXCM 1Z5CA 1WIVA 1OFHA 2MROB 4CJ6A 4ITQA 3CF2A 1XNRM 1GABA 3W0FA 4KLNA 2B3TA 1KSFX 2O01F 1LV7A 3B89A 3F92A 4NRVA 4DR1M 1ZMVA 2CEAA 1A5TA 4DV6M 3SAVA 3A46A 1SXJE 1SXJA 1D0LA 2HCBA 3HZJA 2DZNB 4NC6A 3SAUA 1JQJC 1QQWA 1TTEA 3A42A 3QYBA 4NOOB 3C58A 4LF4M 1F4IA 4B7HA 1Q02A 1D0KA 3HU2A 3B7NA 3HJ8A 2YNMD 3I51A 4FCWA 3J81S 2HHHM 3H4JA 4L6V6 1W5SA 1N32M 3K8ZA 2RKOA 3U6OA 3LCUA 2D7HA 2KA6B 1QUTA 3C3DA 3LQRA 4IBBA 1N36M 1PJJA 3RGSA 2LH0A 2UXDM 2X8AA 3WHKA 4YY3M 1ZV1A 3AKZA 2XH9A 5FSWA 1XC8A 4L15A 4JI1M 3B7QA 2GQFA 1E94E 4DV1M 1TF0B 2QP9X 4IBIA 3KS8A 4REZA 2WSEF 4QOSA 3CGWA 1BVSA 4JYAM 4FCVA 2VQFM 1N34M 2DWMA
chains in the Genus database with same CATH topology
2DAIA 2DAEA 1MN3A 1V92A 3E21A 1XB2B 1QZEA 1OAIA 2EJSA 2O25A 2JP7A 1XXHE 3GLHE 2QSFX 2DI0A 2HWJA 2BWBA 1R4GA 1Y8GA 2DNAA 1OKSA 2ZTDA 2K9DA 2DKLA 3GLIE 3GLFE 2DAMA 2DHYA 1VEKA 2HAKA 2K0BX 2LBCA 2JY7A 1OTRA 1IFYA 1WJ7A 1WHCA 1T6OA 4WP2A 2CP8A 2QNJA 5DFLA 4F1IA 1AIPC 2KNAA 2DENA 1G3IA 3FE3A 2EKFA 2MJ5B 1ZMUA 2KNZA 2ZTCA 1C7YA 1WGLA 2BWEA 1YLAA 3K9PA 1G41A 2R0IA 1VDLA 2LVOC 2QHOB 1IM2A 2WZJA 1NV8A 3LCVB 1VEJA 1HT2E 2CWBA 2JUJA 3FRHA 3BBZA 1NV9A 3K9OA 1DO2A 2EKKA 1IXSA 2G3QA 1WR1B 2JZ0A 2L4EA 1KYIA 4UN2B 3GLGE 2LVPC 2OO9A 3IHPA 4DBGB 2LVQD 2LTUA 1SG9A 1TR8A 2OOBA 1WIVA 2MROB 2MGWA 1VG5A 2DAKA 4Q7JA 2DZLA 2B3TA 3IECA 1HJPA 1VQ1A 2KHHA 3B89A 2OOAA 1DO0A 3F92A 1DV0A 1T43A 2DAGA 1ZMVA 1A5TA 1OQYA 1EFUB 1PGYA 3E46A 2KNVA 3MMPA 1TTEA 2JZ1A 2RRUA 1F4IA 1GO5A 2JY8A 2JY5A 1Q02A 1ZMWA 1JR3E 4HEOA 1WGNA 2H5XA 2JY6B 2L2DA 3H4JA 4F2LA 3LCUA 2L4FA 3FRIA 1G4AE 4GEWA 1HT1E 5JI2E 1VEGA 2LVNC 2JNHA 2LVAA 1ZV1A 2MR9A 1E94E 1P3QQ 1HQYE 3T6PA 1BVSA 4R71A 1UFZA 4G3OA 1CUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAI A;  2DAE A;  1MN3 A;  1V92 A;  3E21 A;  1XB2 B;  1QZE A;  1OAI A;  2EJS A;  2O25 A;  2JP7 A;  1XXH E;  3GLH E;  2QSF X;  2DI0 A;  2HWJ A;  2BWB A;  1R4G A;  1Y8G A;  2DNA A;  1OKS A;  2ZTD A;  2K9D A;  2DKL A;  3GLI E;  3GLF E;  2DAM A;  2DHY A;  1VEK A;  2HAK A;  2K0B X;  2LBC A;  2JY7 A;  1OTR A;  1IFY A;  1WJ7 A;  1WHC A;  1T6O A;  4WP2 A;  2CP8 A;  2QNJ A;  5DFL A;  4F1I A;  1AIP C;  2KNA A;  2DEN A;  1G3I A;  3FE3 A;  2EKF A;  2MJ5 B;  1ZMU A;  2KNZ A;  2ZTC A;  1C7Y A;  1WGL A;  2BWE A;  1YLA A;  3K9P A;  1G41 A;  2R0I A;  1VDL A;  2LVO C;  2QHO B;  1IM2 A;  2WZJ A;  1NV8 A;  3LCV B;  1VEJ A;  1HT2 E;  2CWB A;  2JUJ A;  3FRH A;  3BBZ A;  1NV9 A;  3K9O A;  1DO2 A;  2EKK A;  1IXS A;  2G3Q A;  1WR1 B;  2JZ0 A;  2L4E A;  1KYI A;  4UN2 B;  3GLG E;  2LVP C;  2OO9 A;  3IHP A;  4DBG B;  2LVQ D;  2LTU A;  1SG9 A;  1TR8 A;  2OOB A;  1WIV A;  2MRO B;  2MGW A;  1VG5 A;  2DAK A;  4Q7J A;  2DZL A;  2B3T A;  3IEC A;  1HJP A;  1VQ1 A;  2KHH A;  3B89 A;  2OOA A;  1DO0 A;  3F92 A;  1DV0 A;  1T43 A;  2DAG A;  1ZMV A;  1A5T A;  1OQY A;  1EFU B;  1PGY A;  3E46 A;  2KNV A;  3MMP A;  1TTE A;  2JZ1 A;  2RRU A;  1F4I A;  1GO5 A;  2JY8 A;  2JY5 A;  1Q02 A;  1ZMW A;  1JR3 E;  4HEO A;  1WGN A;  2H5X A;  2JY6 B;  2L2D A;  3H4J A;  4F2L A;  3LCU A;  2L4F A;  3FRI A;  1G4A E;  4GEW A;  1HT1 E;  5JI2 E;  1VEG A;  2LVN C;  2JNH A;  2LVA A;  1ZV1 A;  2MR9 A;  1E94 E;  1P3Q Q;  1HQY E;  3T6P A;  1BVS A;  4R71 A;  1UFZ A;  4G3O A;  1CUK A; 
#chains in the Genus database with same CATH topology
 1DGB A;  4DV0 M;  1TH4 A;  5EP2 A;  5H37 D;  4LCB A;  4X65 M;  2W82 A;  3RE8 A;  2QEN A;  1ZAE A;  5ITT A;  2WSF F;  2VII A;  5FTM A;  4FWG A;  3KOX E;  2Z7J A;  1XXH E;  3DA1 A;  2FS1 A;  2QSF X;  2Z8Y M;  4LJ9 A;  1N33 M;  2RGH A;  3J80 S;  4M9X A;  1NVM A;  1NO1 A;  3C3E A;  1JB0 F;  4KT0 F;  5KPR A;  1I4W A;  2DKL A;  2LNH C;  2YR0 A;  1IXR C;  1XXH A;  5EXP A;  3EIH A;  1Q3B A;  2APL A;  2HAK A;  2DWL A;  3GLG B;  3IG8 A;  3KFU G;  1PJQ A;  3HJQ A;  2LBC A;  2V1U A;  2JY7 A;  3B9P A;  3LQQ A;  3MK6 A;  1V34 A;  5BR8 M;  5IWA M;  4MGK E;  1MU5 A;  2DWZ B;  1WHC A;  4B08 A;  3R9X B;  3D8L A;  3SC3 A;  3I01 M;  5ITR A;  4F1I A;  3A45 A;  5ITX E;  1XHB A;  2CUZ A;  1DGH B;  2VF7 A;  2R44 A;  4I8O A;  4NSR A;  4B3T M;  1R7R A;  2WSC F;  5FTJ A;  3TWM A;  4KHP M;  2MJ5 B;  4GHA A;  4QNM A;  4MH0 E;  1SXJ B;  2ZTC A;  1WGL A;  2BWE A;  4FW9 A;  1C7Y A;  4LF9 M;  5ITU A;  2C96 A;  1IN7 A;  3FTD A;  3U6E A;  2QBY A;  4LF8 M;  1W5T A;  3FUV A;  1QUS A;  2R0I A;  3FUW A;  3PXG A;  2CV1 A;  3SAR A;  2E5L M;  1DGG A;  1IM2 A;  2G5G X;  2WZJ A;  2YFQ A;  2Z4R A;  3GP1 A;  2CV0 A;  5KPT A;  3M6A A;  1L2C A;  2CWB A;  2JUJ A;  2AHM A;  5FTL A;  3K9O A;  2DXI A;  3HHX A;  4R7G A;  2F5S A;  1HNW M;  1AUA A;  5KO3 A;  3GPX A;  2JZ0 A;  4DV4 M;  2G8L A;  3KS4 A;  3U6Q A;  4IJF A;  4B7G A;  2UUC M;  3TE6 A;  3FUX A;  1VDD A;  1KYI A;  1XMQ M;  1GJT A;  1IN8 A;  4JV5 M;  3SYL A;  2Y0T A;  2OPF A;  2LVQ D;  3ZC7 B;  3GLF B;  2Y21 A;  3DZD A;  4FWD A;  3ZQJ A;  4DUY M;  1YSY A;  1VG5 A;  3QAU A;  2FOI C;  2J7O A;  1HJP A;  4TUW A;  1L8Q A;  3GLH B;  4CHT B;  1QZM A;  1Z5B A;  3AOE C;  2F5P A;  1EFU B;  1NSF A;  3HU3 A;  1PGY A;  3AJI B;  3E46 A;  5KQ8 A;  2KNV A;  4M9S A;  4CGY B;  5EP4 A;  4HL4 A;  2R45 A;  1GO5 A;  1OFI A;  4DR2 M;  1PJI A;  2CV2 A;  4B3S M;  1NJF A;  1HNZ M;  3IG5 A;  3LW5 F;  5FTN A;  4HEO A;  4X64 M;  1WGN A;  2H5X A;  4ZPX A;  5FLX S;  1N75 A;  4JXJ A;  5E6J A;  2I7P A;  1G59 A;  2EO2 A;  1UM8 A;  4MB7 A;  3HJS A;  4GEW A;  4Z8X A;  3Q8X A;  1QAN A;  4DV5 M;  3U5Z A;  3AFH A;  5JI2 E;  1VEG A;  2LVN C;  1SXJ C;  2JNH A;  2XEP A;  4JI8 M;  1NNJ A;  3VK8 A;  1P3Q Q;  1YUB A;  5EP3 A;  3U6M A;  2J7N A;  4JI7 M;  3GRR A;  3KOZ E;  3T1H M;  4YHH M;  3GRY A;  3HWS A;  4G3O A;  3RFW A;  4Y28 F;  2ZAO A;  2VDB B;  3GQ3 A;  1PJS A;  4BB9 A;  2CHV A;  5E26 A;  1E32 A;  2NQ8 C;  3KW6 A;  1NY6 A;  1X37 A;  2DAI A;  1N78 A;  3KDS E;  1C1K A;  4I4L A;  3I04 M;  3ZCB B;  3GQ4 A;  3GQ5 A;  2JA2 A;  4GKK M;  1T3T A;  2DI0 A;  1ZQ9 A;  4JI2 M;  1R4G A;  2C98 A;  1E9R A;  4IIW A;  5IRE B;  2ZTD A;  4AQY M;  3KXE C;  4BBA A;  1HQC A;  2VF8 A;  4D82 A;  2R4J A;  1JR3 D;  2K0B X;  5DYG A;  3BOS A;  4R3D A;  3CF0 A;  3GLI A;  1GKI A;  3GO8 A;  3J7B A;  4JI0 M;  1G8P A;  1OIP A;  1E9S A;  1IFY A;  1WJ7 A;  4QHT A;  4XK8 F;  4AKH A;  1IN6 A;  2ZM6 M;  4OX9 M;  2M60 A;  4MGI E;  4FWH A;  3T38 A;  1K82 A;  4FD2 A;  2KW0 A;  4JI3 M;  1AIP C;  3WHL A;  2DEN A;  3B74 A;  3LVW A;  5EP1 A;  4ANR A;  2C9O A;  4AKG A;  4I5S A;  2Z4S A;  7CAT A;  4PCZ A;  3HHY A;  1JR3 A;  3K9P A;  4X66 M;  2UUB M;  4NSO B;  1R2Y A;  4AG6 A;  2D7G A;  3U6L A;  4XBO A;  1IN5 A;  1NV8 A;  3FTE A;  1I94 M;  2JWS A;  4PDG A;  3SFZ A;  2OQ4 A;  1HT2 E;  3VLF B;  3KOY E;  3BBZ A;  3LMM A;  5EJC A;  5C18 A;  1DO2 A;  3KOW E;  3U61 B;  3V76 A;  3L29 A;  5LMN M;  1GLN A;  1Z59 A;  2D7E A;  2G3Q A;  3LVV A;  4G4R A;  1WR1 B;  5GKN A;  4OW0 A;  2X4A A;  4LG2 A;  3C9P A;  4LF6 M;  2J5Y A;  4P17 A;  4OVZ A;  2LVP C;  3IHP A;  2KEB A;  4LFA M;  4KO8 A;  1IBK M;  1OIZ A;  1J7K A;  1PRB A;  3VKH A;  3GRU A;  1QAM A;  3HKP A;  3PNY A;  2DZO B;  2DAK A;  3FTF A;  3KSX A;  4QNR A;  1R2Z A;  1G71 A;  2DZL A;  2XGN A;  3DOA A;  5F3W A;  2OOA A;  3HHZ A;  1DGH A;  5LMU M;  4RKU F;  3RGP A;  1FNN A;  1IBL M;  3U6P A;  3UMM A;  3MMP A;  3U60 B;  2F5N A;  1MJG M;  2JZ1 A;  4DR7 M;  2VQE M;  5ITX A;  2JY8 A;  3GLG A;  2F4V M;  2BJW A;  2HL7 A;  3KP0 E;  4M9Z A;  4L4U A;  1Z6T A;  8CAT A;  1WXQ A;  3FD9 A;  3K2L A;  2R4E A;  2R62 A;  3HX3 A;  4F2L A;  5ITY A;  4XGI A;  2L4F A;  1PJT A;  4LY6 A;  3UGJ A;  3CF6 E;  1G4A E;  4GRI A;  1HT1 E;  2QZ4 A;  4PT5 A;  2A5Y B;  2KDL A;  2LVA A;  4KOD A;  2F5O A;  1NY5 A;  2R18 A;  2XSZ D;  1XWI A;  2HKJ A;  4FCT A;  3L28 A;  5EQT A;  4Z6Y A;  3AOE A;  3FUT A;  2XZU A;  1QDT A;  2R65 A;  3EIE A;  1DGF A;  1L2D A;  4I81 A;  4IBF A;  1TH3 A;  4GIT A;  4D81 A;  2X49 A;  3FUU A;  4B3M M;  2Y0Q A;  2Q2E B;  1UFZ A;  2FNA A;  1YE9 A;  4GC9 A;  5BPV A;  2KZS A;  4L8R C;  1HR0 M;  2FH0 A;  2K47 A;  1N77 A;  4LFC M;  1PM5 A;  3PFI A;  2QCU A;  2DAE A;  4L16 A;  3VFD A;  2ZAN A;  2QQ8 A;  3L2A A;  4DV3 M;  2EJS A;  3U6S A;  2O25 A;  3SBJ A;  2Y20 A;  2ERC A;  3FYC A;  3GLH E;  2BJV A;  2C99 A;  4RF1 A;  2O5R A;  3W0L B;  2HWJ A;  3SAW A;  3SYK A;  2BWB A;  2L7H A;  5FTK A;  1Y8G A;  4G6Z A;  1Z5A A;  3I4V A;  5C1B A;  1IY0 A;  1RU3 A;  3H4M A;  1R6B X;  4FVM A;  2QPA A;  3GLF E;  3GLI E;  3A98 B;  3GLH A;  2DAM A;  2DHY A;  1L1Z A;  1VEK A;  2XF3 A;  4HLQ A;  4AKI A;  4DV2 M;  1EE8 A;  2CE7 A;  1IQP A;  3JR4 A;  3SAS A;  3JAM S;  3AL0 C;  3J27 B;  1H6U A;  4DR5 M;  3TPZ A;  4B7F A;  3GPP A;  4QHS A;  1LTM A;  1TGU A;  4LZZ A;  2CP8 A;  2L6O A;  3PNV A;  4M0D A;  2QNJ A;  5DFL A;  3M0E A;  1J5E M;  4NXM M;  3J7A S;  4G4Q A;  2KNA A;  3L27 A;  3THG A;  3VDP A;  5IT9 S;  4AI6 A;  2KNZ A;  3GPY A;  2KZU A;  4MM3 B;  4JI5 M;  5L8R F;  1SXJ D;  4LF7 M;  1V33 A;  4QOZ C;  1VDL A;  2LVO C;  2KXE A;  2QHO B;  1GJS A;  3HHW A;  5A2Q S;  4LGY A;  4DV7 M;  4NL4 H;  3GRV A;  2N35 A;  2LXE A;  1QVR A;  3FRH A;  2XFT A;  2QBY B;  2K6B A;  2DHR A;  2EKK A;  4LGM A;  4GHL A;  1IXS A;  4DUZ M;  1L1T A;  3B7Z A;  3NBI A;  2UUA M;  3W68 A;  4JI6 M;  4GIP A;  2KRK A;  3KVW A;  3K1J A;  4BLC A;  1QYR A;  2CHQ A;  1K3W A;  4LJ8 A;  4LJ7 A;  1EIJ A;  3FTC A;  1IXS B;  2CRU A;  4D80 A;  4DBG B;  2LWX A;  1SG9 A;  2OOB A;  3U5Z B;  1S3S A;  1TDZ A;  2MGW A;  3MJ5 A;  2XFS A;  3UJN A;  4Q7J A;  3BXW A;  4G4O A;  2LHG A;  3IEC A;  2KHH A;  1VQ1 A;  1DV0 A;  1XXH B;  1DO0 A;  4IBK A;  2LHC A;  3AOG A;  1T43 A;  2DAG A;  3R8F A;  2ZBK B;  4MGZ E;  2Z3X A;  1OQY A;  3L25 A;  2C5R A;  3TL4 X;  4P16 A;  1TH2 A;  2XSZ A;  3KP1 E;  3SAT A;  3NWL A;  4DR4 M;  2MH8 A;  1FJG M;  4IBE A;  3ZH9 B;  4LF5 M;  2CHG A;  2RRU A;  4WUR A;  2XZF A;  2JY5 A;  1ZMW A;  1R5L A;  1JR3 E;  2L09 A;  2P5T A;  1K3X A;  4W5W A;  2R6F A;  3SMS A;  2JY6 B;  2L2D A;  3K92 A;  1XMO M;  4IBG A;  3JR5 A;  3U6D A;  2UU9 M;  2JXN A;  4K0K M;  3TWL A;  3FRI A;  3VKG A;  3D8B A;  4RNA A;  4CIZ A;  4AW4 A;  3GLF A;  1MX0 A;  4B3R M;  4IJE A;  4EIW A;  4G4N A;  4OVZ B;  5EXT A;  3SHF A;  1TDH A;  2MR9 A;  2YQZ A;  3CTW B;  2DWN A;  5IZ7 D;  4LJ4 A;  4LZJ A;  1HQY E;  3T6P A;  3J2P B;  4MGH A;  4AZF A;  1QAO A;  5DNY A;  4CIS A;  4LFB M;  2DVW B;  4R71 A;  1CUK A;  1Q39 A;  1IXZ A;  3HU1 A;  4GC5 A;  2FE8 A;  2M5Z A;  4M0W A;  3U60 A;  1MN3 A;  1V92 A;  2EA0 A;  3SHG B;  3E21 A;  1XB2 B;  4NRW A;  3UZU A;  4X62 M;  1J09 A;  1QZE A;  1OAI A;  4IBD A;  4LJA A;  2JP7 A;  5JI3 E;  2L7I A;  4PDI A;  3HGI A;  2RGO A;  3T1Y M;  3HY5 A;  3FYD A;  3DFZ A;  4LJ5 A;  1GL7 A;  3M7G A;  1NHW C;  4LRS A;  2DNA A;  4OU7 A;  5EXS A;  1OKS A;  3OTO M;  3KSJ A;  2K9D A;  4GMQ A;  2R46 A;  4WW0 A;  1IBM M;  3U61 A;  1D2N A;  1IY1 A;  1ORY B;  2FFJ A;  3I4Y A;  4IBC A;  4RF0 A;  4NXN M;  3E4R A;  3E9S A;  1OTR A;  4AG5 A;  2C9C A;  1IY2 A;  3NBX X;  5EXX A;  1T6O A;  2BNK A;  2CFO A;  2V6Z M;  4L78 A;  4WP2 A;  1NHG C;  4DR6 M;  2H1R A;  2ZAM A;  3SMP A;  4A3V B;  2XLJ A;  4LRT A;  1OAO C;  1G3I A;  1Q3C A;  3FE3 A;  3FKE A;  4MGY E;  4PD2 A;  1OJL A;  2EKF A;  3PVS A;  1ZMU A;  4IBJ A;  5ITQ A;  3Q8G A;  3T15 A;  1KFV A;  1YLA A;  3QWL A;  2V1C A;  3VK7 A;  1QAQ A;  2F5Q A;  1G41 A;  3U6C A;  5KQD A;  1GVN A;  3LCV B;  1XNQ M;  1IN4 A;  5KPZ A;  4GKJ M;  1VEJ A;  1HNX M;  1GL6 A;  1NJG A;  3MHV C;  4S12 A;  3GPU A;  2UXB M;  4DR3 M;  3ILK A;  3L26 A;  2KRU A;  3AV0 A;  1NV9 A;  1QDR A;  4JN6 A;  2EUC A;  4II7 A;  3QYE A;  4LJ6 A;  2I7N A;  4JI4 M;  5DYI A;  3VDU A;  3GLI B;  3TQS A;  3UK6 A;  4GH9 A;  1L2B A;  2L4E A;  2GNO A;  4UN2 B;  3W67 A;  3GLG E;  1D0M A;  2OO9 A;  1NNU C;  3TWK A;  2LTU A;  1TR8 A;  2UXC M;  1Z5C A;  1WIV A;  1OFH A;  2MRO B;  4CJ6 A;  4ITQ A;  3CF2 A;  1XNR M;  1GAB A;  3W0F A;  4KLN A;  2B3T A;  1KSF X;  2O01 F;  1LV7 A;  3B89 A;  3F92 A;  4NRV A;  4DR1 M;  1ZMV A;  2CEA A;  1A5T A;  4DV6 M;  3SAV A;  3A46 A;  1SXJ E;  1SXJ A;  1D0L A;  2HCB A;  3HZJ A;  2DZN B;  4NC6 A;  3SAU A;  1JQJ C;  1QQW A;  1TTE A;  3A42 A;  3QYB A;  4NOO B;  3C58 A;  4LF4 M;  1F4I A;  4B7H A;  1Q02 A;  1D0K A;  3HU2 A;  3B7N A;  3HJ8 A;  2YNM D;  3I51 A;  4FCW A;  3J81 S;  2HHH M;  3H4J A;  4L6V 6;  1W5S A;  1N32 M;  3K8Z A;  2RKO A;  3U6O A;  3LCU A;  2D7H A;  2KA6 B;  1QUT A;  3C3D A;  3LQR A;  4IBB A;  1N36 M;  1PJJ A;  3RGS A;  2LH0 A;  2UXD M;  2X8A A;  3WHK A;  4YY3 M;  1ZV1 A;  3AKZ A;  2XH9 A;  5FSW A;  1XC8 A;  4L15 A;  4JI1 M;  3B7Q A;  2GQF A;  1E94 E;  4DV1 M;  1TF0 B;  2QP9 X;  4IBI A;  3KS8 A;  4REZ A;  2WSE F;  4QOS A;  3CGW A;  1BVS A;  4JYA M;  4FCV A;  2VQF M;  1N34 M;  2DWM A; 
#chains in the Genus database with same CATH homology
 2DAI A;  2DAE A;  1MN3 A;  1V92 A;  3E21 A;  1XB2 B;  1QZE A;  1OAI A;  2EJS A;  2O25 A;  2JP7 A;  1XXH E;  3GLH E;  2QSF X;  2DI0 A;  2HWJ A;  2BWB A;  1R4G A;  1Y8G A;  2DNA A;  1OKS A;  2ZTD A;  2K9D A;  2DKL A;  3GLI E;  3GLF E;  2DAM A;  2DHY A;  1VEK A;  2HAK A;  2K0B X;  2LBC A;  2JY7 A;  1OTR A;  1IFY A;  1WJ7 A;  1WHC A;  1T6O A;  4WP2 A;  2CP8 A;  2QNJ A;  5DFL A;  4F1I A;  1AIP C;  2KNA A;  2DEN A;  1G3I A;  3FE3 A;  2EKF A;  2MJ5 B;  1ZMU A;  2KNZ A;  2ZTC A;  1C7Y A;  1WGL A;  2BWE A;  1YLA A;  3K9P A;  1G41 A;  2R0I A;  1VDL A;  2LVO C;  2QHO B;  1IM2 A;  2WZJ A;  1NV8 A;  3LCV B;  1VEJ A;  1HT2 E;  2CWB A;  2JUJ A;  3FRH A;  3BBZ A;  1NV9 A;  3K9O A;  1DO2 A;  2EKK A;  1IXS A;  2G3Q A;  1WR1 B;  2JZ0 A;  2L4E A;  1KYI A;  4UN2 B;  3GLG E;  2LVP C;  2OO9 A;  3IHP A;  4DBG B;  2LVQ D;  2LTU A;  1SG9 A;  1TR8 A;  2OOB A;  1WIV A;  2MRO B;  2MGW A;  1VG5 A;  2DAK A;  4Q7J A;  2DZL A;  2B3T A;  3IEC A;  1HJP A;  1VQ1 A;  2KHH A;  3B89 A;  2OOA A;  1DO0 A;  3F92 A;  1DV0 A;  1T43 A;  2DAG A;  1ZMV A;  1A5T A;  1OQY A;  1EFU B;  1PGY A;  3E46 A;  2KNV A;  3MMP A;  1TTE A;  2JZ1 A;  2RRU A;  1F4I A;  1GO5 A;  2JY8 A;  2JY5 A;  1Q02 A;  1ZMW A;  1JR3 E;  4HEO A;  1WGN A;  2H5X A;  2JY6 B;  2L2D A;  3H4J A;  4F2L A;  3LCU A;  2L4F A;  3FRI A;  1G4A E;  4GEW A;  1HT1 E;  5JI2 E;  1VEG A;  2LVN C;  2JNH A;  2LVA A;  1ZV1 A;  2MR9 A;  1E94 E;  1P3Q Q;  1HQY E;  3T6P A;  1BVS A;  4R71 A;  1UFZ A;  4G3O A;  1CUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...