1VEJA

Solution structure of rsgi ruh-016, a uba domain from mouse cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
b'GSSGSSGARACSQSSQTALPTSLFTEGRYQQELEELKALGFANRDANLQALVATDGDIHAAIEMLLGASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 4931431F19
publication title Solution Structure of RSGI RUH-016, a UBA Domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vejA00
2G3QA 3FRHA 2MJ5B 2H5XA 2LVAA 2K9DA 1IFYA 1VEKA 1OQYA 1HJPA 1HT2E 1DV0A 3T6PA 3FRIA 2OOAA 1ZMWA 4F2LA 3K9OA 2DAGA 1ZV1A 2DI0A 1CUKA 2DAKA 2LVOC 1Y8GA 1YLAA 1G4AE 1OTRA 2DZLA 1ZMUA 1ZMVA 1OKSA 2JUJA 2EKKA 2EJSA 2KNVA 1T6OA 1T43A 2JY6B 1R4GA 1TR8A 2KNAA 2LVQD 3FE3A 2QHOB 1IXSA 2WZJA 3GLHE 1G41A 2LTUA 1UFZA 1VG5A 2CWBA 2R0IA 2BWEA 2L2DA 3K9PA 2HWJA 1JR3E 1GO5A 1WHCA 1EFUB 2RRUA 1C7YA 1AIPC 2BWBA 2K0BX 1XB2B 1V92A 2B3TA 2JP7A 2DHYA 1WR1B 1MN3A 4HEOA 4DBGB 1F4IA 2JY7A 3E21A 2OOBA 1VEJA 2MGWA 1WGLA 2L4FA 2ZTCA 4GEWA 2DAIA 2EKFA 2JY5A 2O25A 4R71A 4Q7JA 3IECA 3LCVB 2DNAA 3GLFE 5JI2E 1WJ7A 1VQ1A 4UN2B 3E46A 2DKLA 2JY8A 2DAMA 1TTEA 1HT1E 1NV9A 1DO0A 2LVNC 1PGYA 2DAEA 2JNHA 3IHPA 1IM2A 2HAKA 2KNZA 2QSFX 1A5TA 2ZTDA 2MR9A 2OO9A 1DO2A 5DFLA 1Q02A 1P3QQ 3H4JA 1E94E 2MROB 2DENA 3LCUA 4F1IA 1G3IA 2QNJA 1WIVA 1BVSA 2LBCA 2JZ1A 4WP2A 1KYIA 1VDLA 2L4EA 3B89A 1QZEA 2CP8A 2JZ0A 1SG9A 1NV8A 1VEGA 1XXHE 3BBZA 2LVPC 3MMPA 2KHHA 3GLGE 3GLIE 3F92A 4G3OA 1WGNA 1OAIA 1HQYE
chains in the Genus database with same CATH superfamily
4M9ZA 1V34A 3FYCA 3C9PA 3U60A 3SMPA 2D7HA 2R44A 1L2DA 4GMQA 1XC8A 4B3SM 3EIHA 4NC6A 4KHPM 1OFIA 4B3TM 1IFYA 2O5RA 4FCWA 1GJSA 1NHGC 4DV1M 1HNXM 3WHLA 3W0LB 4JI6M 1E9RA 1QAOA 2C99A 2VF8A 4LRTA 5KQ8A 2QPAA 4GKJM 4F2LA 2HKJA 3L26A 2KDLA 2L6OA 1GLNA 2DAGA 3FTCA 3SFZA 3OTOM 1N75A 1CUKA 2DAKA 1N34M 3JR5A 1OIZA 2FS1A 1R7RA 3LW5F 3I51A 4OVZA 2RGOA 4R3DA 2Y21A 1YLAA 2HL7A 3SYLA 3U6EA 3VKGA 3IG8A 4GHAA 1NVMA 3LQRA 1ZMUA 3KDSE 4M0DA 3U6LA 4RF1A 3EIEA 2J7OA 1R4GA 1TR8A 2KNAA 2LVQD 5EXTA 3UGJA 2QHOB 1XWIA 1D0KA 2I7PA 2WZJA 4GKKM 3AFHA 5FSWA 4X64M 2C96A 2D7EA 3SC3A 4JI5M 2R0IA 3KW6A 4MGZE 4B7GA 3FTDA 1TDZA 5DNYA 4B7FA 2AHMA 2Y0TA 3K2LA 2L7IA 4QHTA 1PJQA 4IBBA 5LMUM 4LF8M 3DOAA 3HY5A 3FKEA 3SBJA 1XNQM 1AIPC 4GHLA 5FLXS 2CHQA 4WW0A 3VDPA 2GNOA 2JP7A 1TH4A 4NRVA 3ZQJA 4II7A 1NO1A 5BPVA 1NSFA 2ZTCA 1TDHA 2DAIA 4GEWA 3KFUG 3NBIA 4HLQA 1X37A 4DR7M 2Q2EB 1J7KA 4IBIA 4ZPXA 3MJ5A 5FTMA 2G8LA 2JWSA 5KPZA 3GLFE 5JI2E 3HJSA 2YNMD 2XZFA 4W5WA 2ZM6M 4A3VB 3Q8GA 1E32A 2R18A 1DO0A 4X62M 3V76A 4NXMM 2QP9X 2DAEA 3SARA 3PXGA 1IM2A 2KNZA 3KOXE 3VK7A 2RGHA 2OO9A 1R2YA 1Q02A 2LHCA 4IBEA 3HU3A 4LGMA 3QAUA 1IXZA 1E94E 3HHZA 2DENA 3C58A 1BVSA 4XK8F 5A2QS 1AUAA 3FYDA 1VDLA 1EIJA 4IJFA 1N33M 4QOZC 4GH9A 4IJEA 1Q39A 3M7GA 4B08A 2UU9M 1OFHA 3D8LA 1N32M 3TQSA 5EP3A 2X49A 4DR4M 4IBFA 4KO8A 4CHTB 4PD2A 2CHVA 3UK6A 3TWMA 1J5EM 4BLCA 2F5OA 2R4JA 4I81A 2WSEF 2VF7A 3BXWA 3HGIA 1DGBA 1WXQA 3M0EA 3MMPA 5ITXE 3GLIE 3SAUA 4JYAM 4LG2A 1YSYA 5KPRA 4AKGA 2ERCA 3FD9A 2XFSA 4FWDA 3JR4A 1QDRA 2MJ5B 3THGA 2XEPA 3R9XB 1ZQ9A 5ITQA 2Z4RA 3AOEA 1QQWA 4CJ6A 3BOSA 3RGPA 1YE9A 1HJPA 4I5SA 1NY6A 2C98A 1PJIA 1QUTA 4JI2M 2FE8A 2LNHC 2OOAA 2R46A 3ILKA 2LWXA 1SXJB 2W82A 4FCVA 3U61A 3ZC7B 1QYRA 2X4AA 4M0WA 2Z4SA 5FTLA 1KFVA 3L29A 3NBXX 3U5ZA 2LVOC 2XFTA 4G4OA 3CTWB 3KSJA 5KQDA 3FUWA 4CGYB 3UMMA 5FTKA 4DV4M 4G6ZA 4FD2A 1ZMVA 1HQCA 1OKSA 2L7HA 2DZOB 5IWAM 1IBMM 5DYGA 4Y28F 1R5LA 3HU2A 4M9SA 4NL4H 3GQ3A 3RGSA 5IT9S 5EXXA 2C5RA 4L6V6 3T38A 1G59A 4DR3M 1L8QA 1IXSA 5BR8M 2XLJA 4LY6A 1UFZA 1EE8A 5ITYA 5KO3A 3Q8XA 2BWEA 3MHVC 2UXCM 4LJ8A 2HWJA 2UUAM 1JR3E 5IREB 5L8RF 4Z6YA 1PJJA 4PDIA 4B3RM 3HHXA 4RKUF 2FFJA 3VK8A 5EJCA 1UM8A 2C9CA 2M60A 3NWLA 3U60B 1IXSB 5C18A 3GQ4A 4DR2M 1K3WA 1T3TA 3GLGA 4JI8M 1YUBA 4G4QA 4RF0A 2KEBA 4LJ4A 3H4MA 2Y0QA 1NNJA 3FTFA 2XF3A 1F4IA 3E21A 1WGLA 3QYEA 7CATA 3K1JA 3K8ZA 2JY5A 4BB9A 2QENA 3B9PA 3W67A 3WHKA 2OPFA 4OVZB 1R6BX 5FTJA 1L2BA 1TH2A 3IECA 3LCVB 4DUYM 4TUWA 3HJ8A 3RE8A 2UXBM 4BBAA 1IY1A 2DNAA 5IZ7D 4UN2B 5FTNA 2CV1A 2JY8A 3U6CA 2F5QA 1Z6TA 2ZBKB 2DAMA 3A42A 2RKOA 1HT1E 2M5ZA 1N77A 3L25A 4DR6M 3LQQA 2K47A 2QSFX 3SHFA 1A5TA 2ZTDA 4I4LA 3E4RA 3R8FA 2MH8A 3VDUA 4AKIA 2EO2A 3I4VA 4IBCA 1P3QQ 4AG6A 2J5YA 3B7NA 3GLHA 2F5SA 1G3IA 2XSZD 4AZFA 4LJ9A 3KXEC 4GIPA 4WP2A 1QANA 1HNWM 4FW9A 1Z5BA 1D2NA 1KSFX 3B89A 4MGYE 3A45A 1L1ZA 3KOZE 2CFOA 4R7GA 3LMMA 4GITA 1TH3A 4NXNM 2KW0A 3K92A 2DVWB 4LFBM 2KA6B 3GLHB 3IG5A 2BJVA 4L8RC 3GPYA 1SG9A 1RU3A 4DV2M 4MGKE 1IXRC 3KS8A 1Z59A 3BBZA 1W5TA 3L28A 1MN3A 1JR3D 1OAIA 3LVVA 3SYKA 3HHYA 2CRUA 3ZCBB 1PRBA 2CEAA 2R6FA 2KZSA 3AV0A 4XGIA 2G3QA 1I94M 2H5XA 5ITTA 2K9DA 4PT5A 1R2ZA 1K3XA 3ZH9B 4MGHA 1VEKA 4QNMA 4Z8XA 4KODA 1QAMA 3KVWA 4L15A 2EUCA 3GRVA 4LJ7A 1DV0A 3J27B 2UXDM 4FWHA 4QOSA 3D8BA 3K9OA 4IBDA 2VQFM 1GL6A 3DFZA 3U6PA 4CISA 1J09A 2NQ8C 2E5LM 2LHGA 3J80S 2DZLA 8CATA 3U6SA 2JUJA 3C3EA 3TPZA 2XGNA 2N35A 4DUZM 3I04M 2CE7A 2UUCM 3FE3A 3L27A 4LJ5A 3DZDA 2A5YB 2FH0A 1IQPA 1NHWC 4L16A 4ANRA 1XMQM 4DV7M 2LTUA 1GABA 1VG5A 2CWBA 2DWZB 3GPUA 3TE6A 3K9PA 5EXPA 1LV7A 3KP0E 3T1YM 2XH9A 4LFCM 2V1UA 3TL4X 4AW4A 3MK6A 1C7YA 1OJLA 1ORYB 3HJQA 1IN8A 1XXHA 4ITQA 1V92A 4IBKA 3DA1A 2B3TA 3KP1E 5EQTA 1DGGA 3B74A 4QHSA 2DHYA 4JI0M 4HEOA 1MU5A 3KS4A 1H6UA 3HKPA 2MGWA 4OX9M 3U61B 1IN4A 1SXJE 2OQ4A 4LZJA 4DV6M 1IBLM 1V33A 2EKFA 2CHGA 1OAOC 3SMSA 4R71A 5ITUA 3U6OA 1XXHB 4LJAA 3U5ZB 5EP2A 4M9XA 2XZUA 4KT0F 1WJ7A 3E46A 2DKLA 2VQEM 1GKIA 3T1HM 5H37D 4LF7M 1TTEA 4D81A 4WURA 1TF0B 3W0FA 2LVNC 1PGYA 1G71A 3A46A 1JQJC 1NNUC 2Z3XA 1GL7A 3SAWA 1C1KA 1PJTA 2MR9A 1N36M 1XNRM 3PNVA 2BNKA 5DFLA 4YHHM 3H4JA 1S3SA 2R62A 1TGUA 2ZANA 1PM5A 3LCUA 4F1IA 2V1CA 3HZJA 1D0MA 1XHBA 1GJTA 2QNJA 3KOWE 2D7GA 4QNRA 2LBCA 3PFIA 3GO8A 2JZ1A 2I7NA 4L4UA 1L2CA 4GC9A 3GLGB 1DGHA 2L4EA 3UZUA 1G8PA 2CV2A 5EP1A 4DV0M 3UJNA 4DR5M 4LGYA 4DV5M 2KRUA 3CF6E 3U6MA 4NSRA 4LF9M 4X65M 3CGWA 2CP8A 4MM3B 1QUSA 1QVRA 3GPPA 3U6QA 1NJFA 4JN6A 4B7HA 3SHGB 4D80A 3J7AS 4P16A 4K0KM 1IN7A 1GVNA 1VEGA 1DGHB 5EXSA 2DWNA 3KSXA 4JV5M 3GLGE 4P17A 2LVPC 2FOIC 2APLA 2JA2A 2EA0A 1HNZM 1VDDA 4G3OA 1I4WA 3M6AA 4AQYM 4LF6M 3FRHA 4RNAA 2J7NA 1Z5AA 2QCUA 4MH0E 4X66M 4OU7A 2LVAA 4CIZA 2DWLA 3C3DA 2HHHM 3GP1A 1OQYA 3TWLA 3SAVA 2JXNA 1HT2E 3CF0A 4I8OA 1IN6A 3J7BA 4YY3M 1IN5A 3A98B 3GLFA 1DGFA 3T6PA 4PDGA 4G4RA 3FRIA 4JI7M 4HL4A 1ZAEA 1N78A 2Y20A 1ZMWA 4NRWA 1SXJD 2YFQA 2L09A 1ZV1A 3I4YA 2DI0A 4LZZA 3KOYE 4B3MM 4LF4M 4L78A 4IBJA 3L2AA 1Y8GA 4NSOB 1FNNA 3J2PB 1QDTA 2KXEA 1G4AE 1OTRA 2V6ZM 3B7ZA 4LRSA 1MJGM 3GLFB 5EP4A 2HCBA 2VIIA 1E9SA 1K82A 2EKKA 2EJSA 3AJIB 4XBOA 3FTEA 1D0LA 2KNVA 1MX0A 1QAQA 3FUTA 1T6OA 4AI6A 2H1RA 3CF2A 1T43A 2JY6B 4KLNA 3J81S 3FUUA 4MB7A 1JB0F 2CV0A 1IBKM 2KRKA 3GLHE 1G41A 1XMOM 2R45A 5GKNA 5ITRA 4LFAM 4OW0A 4AKHA 2ZAMA 2L2DA 2WSCF 4JXJA 3U6DA 5DYIA 4FCTA 3GPXA 1SXJC 4LF5M 2Z7JA 2DZNB 2DHRA 2C9OA 1GO5A 3RFWA 1WHCA 4GRIA 1EFUB 1Q3CA 2RRUA 3AOEC 1FJGM 3AL0C 2BWBA 2K0BX 1IY0A 1XB2B 2GQFA 5ITXA 3GLIA 4G4NA 1HR0M 2WSFF 3B7QA 3SATA 2ZAOA 1WR1B 4DBGB 2VDBB 1IY2A 2JY7A 2F5PA 2OOBA 1VEJA 3QYBA 4REZA 4MGIE 2R4EA 3HWSA 2L4FA 5E26A 5JI3E 2DWMA 2YQZA 1L1TA 2O25A 1NJGA 1NY5A 4NOOB 4IBGA 4DR1M 2K6BA 4Q7JA 3GLIB 3FUXA 5C1BA 3VKHA 2P5TA 2QBYA 3VFDA 3TWKA 3JAMS 1VQ1A 3GRYA 1QZMA 4IIWA 2F5NA 2O01F 3GRUA 3QWLA 1W5SA 1NV9A 2XSZA 2FNAA 2JNHA 4GC5A 3IHPA 3GRRA 2HAKA 4AG5A 4D82A 2X8AA 2QZ4A 1Q3BA 2QBYB 1DO2A 1Z5CA 2QQ8A 3PNYA 1SXJA 3PVSA 2UUBM 4LJ6A 4S12A 3W68A 2Z8YM 5KPTA 3HHWA 2YR0A 3LVWA 1OIPA 4FWGA 2MROB 2KZUA 2CUZA 1WIVA 2R65A 4LCBA 3AOGA 3SASA 1KYIA 5LMNM 4JI3M 1QZEA 1JR3A 2G5GX 3T15A 4JI1M 3AKZA 3HX3A 3GQ5A 4JI4M 3HU1A 2BJWA 2DXIA 3E9SA 1LTMA 4PCZA 2JZ0A 1PJSA 5E6JA 1NV8A 4FVMA 4EIWA 3I01M 3FUVA 2F4VM 1XXHE 3VLFB 2KHHA 2LH0A 5F3WA 3F92A 4DV3M 1WGNA 2LXEA 1HQYE
chains in the Genus database with same CATH topology
2G3QA 3FRHA 2MJ5B 2H5XA 2LVAA 2K9DA 1IFYA 1VEKA 1OQYA 1HJPA 1HT2E 1DV0A 3T6PA 3FRIA 2OOAA 1ZMWA 4F2LA 3K9OA 2DAGA 1ZV1A 2DI0A 1CUKA 2DAKA 2LVOC 1Y8GA 1YLAA 1G4AE 1OTRA 2DZLA 1ZMUA 1ZMVA 1OKSA 2JUJA 2EKKA 2EJSA 2KNVA 1T6OA 1T43A 2JY6B 1R4GA 1TR8A 2KNAA 2LVQD 3FE3A 2QHOB 1IXSA 2WZJA 3GLHE 1G41A 2LTUA 1UFZA 1VG5A 2CWBA 2R0IA 2BWEA 2L2DA 3K9PA 2HWJA 1JR3E 1GO5A 1WHCA 1EFUB 2RRUA 1C7YA 1AIPC 2BWBA 2K0BX 1XB2B 1V92A 2B3TA 2JP7A 2DHYA 1WR1B 1MN3A 4HEOA 4DBGB 1F4IA 2JY7A 3E21A 2OOBA 1VEJA 2MGWA 1WGLA 2L4FA 2ZTCA 4GEWA 2DAIA 2EKFA 2JY5A 2O25A 4R71A 4Q7JA 3IECA 3LCVB 2DNAA 3GLFE 5JI2E 1WJ7A 1VQ1A 4UN2B 3E46A 2DKLA 2JY8A 2DAMA 1TTEA 1HT1E 1NV9A 1DO0A 2LVNC 1PGYA 2DAEA 2JNHA 3IHPA 1IM2A 2HAKA 2KNZA 2QSFX 1A5TA 2ZTDA 2MR9A 2OO9A 1DO2A 5DFLA 1Q02A 1P3QQ 3H4JA 1E94E 2MROB 2DENA 3LCUA 4F1IA 1G3IA 2QNJA 1WIVA 1BVSA 2LBCA 2JZ1A 4WP2A 1KYIA 1VDLA 2L4EA 3B89A 1QZEA 2CP8A 2JZ0A 1SG9A 1NV8A 1VEGA 1XXHE 3BBZA 2LVPC 3MMPA 2KHHA 3GLGE 3GLIE 3F92A 4G3OA 1WGNA 1OAIA 1HQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3Q A;  3FRH A;  2MJ5 B;  2H5X A;  2LVA A;  2K9D A;  1IFY A;  1VEK A;  1OQY A;  1HJP A;  1HT2 E;  1DV0 A;  3T6P A;  3FRI A;  2OOA A;  1ZMW A;  4F2L A;  3K9O A;  2DAG A;  1ZV1 A;  2DI0 A;  1CUK A;  2DAK A;  2LVO C;  1Y8G A;  1YLA A;  1G4A E;  1OTR A;  2DZL A;  1ZMU A;  1ZMV A;  1OKS A;  2JUJ A;  2EKK A;  2EJS A;  2KNV A;  1T6O A;  1T43 A;  2JY6 B;  1R4G A;  1TR8 A;  2KNA A;  2LVQ D;  3FE3 A;  2QHO B;  1IXS A;  2WZJ A;  3GLH E;  1G41 A;  2LTU A;  1UFZ A;  1VG5 A;  2CWB A;  2R0I A;  2BWE A;  2L2D A;  3K9P A;  2HWJ A;  1JR3 E;  1GO5 A;  1WHC A;  1EFU B;  2RRU A;  1C7Y A;  1AIP C;  2BWB A;  2K0B X;  1XB2 B;  1V92 A;  2B3T A;  2JP7 A;  2DHY A;  1WR1 B;  1MN3 A;  4HEO A;  4DBG B;  1F4I A;  2JY7 A;  3E21 A;  2OOB A;  1VEJ A;  2MGW A;  1WGL A;  2L4F A;  2ZTC A;  4GEW A;  2DAI A;  2EKF A;  2JY5 A;  2O25 A;  4R71 A;  4Q7J A;  3IEC A;  3LCV B;  2DNA A;  3GLF E;  5JI2 E;  1WJ7 A;  1VQ1 A;  4UN2 B;  3E46 A;  2DKL A;  2JY8 A;  2DAM A;  1TTE A;  1HT1 E;  1NV9 A;  1DO0 A;  2LVN C;  1PGY A;  2DAE A;  2JNH A;  3IHP A;  1IM2 A;  2HAK A;  2KNZ A;  2QSF X;  1A5T A;  2ZTD A;  2MR9 A;  2OO9 A;  1DO2 A;  5DFL A;  1Q02 A;  1P3Q Q;  3H4J A;  1E94 E;  2MRO B;  2DEN A;  3LCU A;  4F1I A;  1G3I A;  2QNJ A;  1WIV A;  1BVS A;  2LBC A;  2JZ1 A;  4WP2 A;  1KYI A;  1VDL A;  2L4E A;  3B89 A;  1QZE A;  2CP8 A;  2JZ0 A;  1SG9 A;  1NV8 A;  1VEG A;  1XXH E;  3BBZ A;  2LVP C;  3MMP A;  2KHH A;  3GLG E;  3GLI E;  3F92 A;  4G3O A;  1WGN A;  1OAI A;  1HQY E; 
#chains in the Genus database with same CATH topology
 4M9Z A;  1V34 A;  3FYC A;  3C9P A;  3U60 A;  3SMP A;  2D7H A;  2R44 A;  1L2D A;  4GMQ A;  1XC8 A;  4B3S M;  3EIH A;  4NC6 A;  4KHP M;  1OFI A;  4B3T M;  1IFY A;  2O5R A;  4FCW A;  1GJS A;  1NHG C;  4DV1 M;  1HNX M;  3WHL A;  3W0L B;  4JI6 M;  1E9R A;  1QAO A;  2C99 A;  2VF8 A;  4LRT A;  5KQ8 A;  2QPA A;  4GKJ M;  4F2L A;  2HKJ A;  3L26 A;  2KDL A;  2L6O A;  1GLN A;  2DAG A;  3FTC A;  3SFZ A;  3OTO M;  1N75 A;  1CUK A;  2DAK A;  1N34 M;  3JR5 A;  1OIZ A;  2FS1 A;  1R7R A;  3LW5 F;  3I51 A;  4OVZ A;  2RGO A;  4R3D A;  2Y21 A;  1YLA A;  2HL7 A;  3SYL A;  3U6E A;  3VKG A;  3IG8 A;  4GHA A;  1NVM A;  3LQR A;  1ZMU A;  3KDS E;  4M0D A;  3U6L A;  4RF1 A;  3EIE A;  2J7O A;  1R4G A;  1TR8 A;  2KNA A;  2LVQ D;  5EXT A;  3UGJ A;  2QHO B;  1XWI A;  1D0K A;  2I7P A;  2WZJ A;  4GKK M;  3AFH A;  5FSW A;  4X64 M;  2C96 A;  2D7E A;  3SC3 A;  4JI5 M;  2R0I A;  3KW6 A;  4MGZ E;  4B7G A;  3FTD A;  1TDZ A;  5DNY A;  4B7F A;  2AHM A;  2Y0T A;  3K2L A;  2L7I A;  4QHT A;  1PJQ A;  4IBB A;  5LMU M;  4LF8 M;  3DOA A;  3HY5 A;  3FKE A;  3SBJ A;  1XNQ M;  1AIP C;  4GHL A;  5FLX S;  2CHQ A;  4WW0 A;  3VDP A;  2GNO A;  2JP7 A;  1TH4 A;  4NRV A;  3ZQJ A;  4II7 A;  1NO1 A;  5BPV A;  1NSF A;  2ZTC A;  1TDH A;  2DAI A;  4GEW A;  3KFU G;  3NBI A;  4HLQ A;  1X37 A;  4DR7 M;  2Q2E B;  1J7K A;  4IBI A;  4ZPX A;  3MJ5 A;  5FTM A;  2G8L A;  2JWS A;  5KPZ A;  3GLF E;  5JI2 E;  3HJS A;  2YNM D;  2XZF A;  4W5W A;  2ZM6 M;  4A3V B;  3Q8G A;  1E32 A;  2R18 A;  1DO0 A;  4X62 M;  3V76 A;  4NXM M;  2QP9 X;  2DAE A;  3SAR A;  3PXG A;  1IM2 A;  2KNZ A;  3KOX E;  3VK7 A;  2RGH A;  2OO9 A;  1R2Y A;  1Q02 A;  2LHC A;  4IBE A;  3HU3 A;  4LGM A;  3QAU A;  1IXZ A;  1E94 E;  3HHZ A;  2DEN A;  3C58 A;  1BVS A;  4XK8 F;  5A2Q S;  1AUA A;  3FYD A;  1VDL A;  1EIJ A;  4IJF A;  1N33 M;  4QOZ C;  4GH9 A;  4IJE A;  1Q39 A;  3M7G A;  4B08 A;  2UU9 M;  1OFH A;  3D8L A;  1N32 M;  3TQS A;  5EP3 A;  2X49 A;  4DR4 M;  4IBF A;  4KO8 A;  4CHT B;  4PD2 A;  2CHV A;  3UK6 A;  3TWM A;  1J5E M;  4BLC A;  2F5O A;  2R4J A;  4I81 A;  2WSE F;  2VF7 A;  3BXW A;  3HGI A;  1DGB A;  1WXQ A;  3M0E A;  3MMP A;  5ITX E;  3GLI E;  3SAU A;  4JYA M;  4LG2 A;  1YSY A;  5KPR A;  4AKG A;  2ERC A;  3FD9 A;  2XFS A;  4FWD A;  3JR4 A;  1QDR A;  2MJ5 B;  3THG A;  2XEP A;  3R9X B;  1ZQ9 A;  5ITQ A;  2Z4R A;  3AOE A;  1QQW A;  4CJ6 A;  3BOS A;  3RGP A;  1YE9 A;  1HJP A;  4I5S A;  1NY6 A;  2C98 A;  1PJI A;  1QUT A;  4JI2 M;  2FE8 A;  2LNH C;  2OOA A;  2R46 A;  3ILK A;  2LWX A;  1SXJ B;  2W82 A;  4FCV A;  3U61 A;  3ZC7 B;  1QYR A;  2X4A A;  4M0W A;  2Z4S A;  5FTL A;  1KFV A;  3L29 A;  3NBX X;  3U5Z A;  2LVO C;  2XFT A;  4G4O A;  3CTW B;  3KSJ A;  5KQD A;  3FUW A;  4CGY B;  3UMM A;  5FTK A;  4DV4 M;  4G6Z A;  4FD2 A;  1ZMV A;  1HQC A;  1OKS A;  2L7H A;  2DZO B;  5IWA M;  1IBM M;  5DYG A;  4Y28 F;  1R5L A;  3HU2 A;  4M9S A;  4NL4 H;  3GQ3 A;  3RGS A;  5IT9 S;  5EXX A;  2C5R A;  4L6V 6;  3T38 A;  1G59 A;  4DR3 M;  1L8Q A;  1IXS A;  5BR8 M;  2XLJ A;  4LY6 A;  1UFZ A;  1EE8 A;  5ITY A;  5KO3 A;  3Q8X A;  2BWE A;  3MHV C;  2UXC M;  4LJ8 A;  2HWJ A;  2UUA M;  1JR3 E;  5IRE B;  5L8R F;  4Z6Y A;  1PJJ A;  4PDI A;  4B3R M;  3HHX A;  4RKU F;  2FFJ A;  3VK8 A;  5EJC A;  1UM8 A;  2C9C A;  2M60 A;  3NWL A;  3U60 B;  1IXS B;  5C18 A;  3GQ4 A;  4DR2 M;  1K3W A;  1T3T A;  3GLG A;  4JI8 M;  1YUB A;  4G4Q A;  4RF0 A;  2KEB A;  4LJ4 A;  3H4M A;  2Y0Q A;  1NNJ A;  3FTF A;  2XF3 A;  1F4I A;  3E21 A;  1WGL A;  3QYE A;  7CAT A;  3K1J A;  3K8Z A;  2JY5 A;  4BB9 A;  2QEN A;  3B9P A;  3W67 A;  3WHK A;  2OPF A;  4OVZ B;  1R6B X;  5FTJ A;  1L2B A;  1TH2 A;  3IEC A;  3LCV B;  4DUY M;  4TUW A;  3HJ8 A;  3RE8 A;  2UXB M;  4BBA A;  1IY1 A;  2DNA A;  5IZ7 D;  4UN2 B;  5FTN A;  2CV1 A;  2JY8 A;  3U6C A;  2F5Q A;  1Z6T A;  2ZBK B;  2DAM A;  3A42 A;  2RKO A;  1HT1 E;  2M5Z A;  1N77 A;  3L25 A;  4DR6 M;  3LQQ A;  2K47 A;  2QSF X;  3SHF A;  1A5T A;  2ZTD A;  4I4L A;  3E4R A;  3R8F A;  2MH8 A;  3VDU A;  4AKI A;  2EO2 A;  3I4V A;  4IBC A;  1P3Q Q;  4AG6 A;  2J5Y A;  3B7N A;  3GLH A;  2F5S A;  1G3I A;  2XSZ D;  4AZF A;  4LJ9 A;  3KXE C;  4GIP A;  4WP2 A;  1QAN A;  1HNW M;  4FW9 A;  1Z5B A;  1D2N A;  1KSF X;  3B89 A;  4MGY E;  3A45 A;  1L1Z A;  3KOZ E;  2CFO A;  4R7G A;  3LMM A;  4GIT A;  1TH3 A;  4NXN M;  2KW0 A;  3K92 A;  2DVW B;  4LFB M;  2KA6 B;  3GLH B;  3IG5 A;  2BJV A;  4L8R C;  3GPY A;  1SG9 A;  1RU3 A;  4DV2 M;  4MGK E;  1IXR C;  3KS8 A;  1Z59 A;  3BBZ A;  1W5T A;  3L28 A;  1MN3 A;  1JR3 D;  1OAI A;  3LVV A;  3SYK A;  3HHY A;  2CRU A;  3ZCB B;  1PRB A;  2CEA A;  2R6F A;  2KZS A;  3AV0 A;  4XGI A;  2G3Q A;  1I94 M;  2H5X A;  5ITT A;  2K9D A;  4PT5 A;  1R2Z A;  1K3X A;  3ZH9 B;  4MGH A;  1VEK A;  4QNM A;  4Z8X A;  4KOD A;  1QAM A;  3KVW A;  4L15 A;  2EUC A;  3GRV A;  4LJ7 A;  1DV0 A;  3J27 B;  2UXD M;  4FWH A;  4QOS A;  3D8B A;  3K9O A;  4IBD A;  2VQF M;  1GL6 A;  3DFZ A;  3U6P A;  4CIS A;  1J09 A;  2NQ8 C;  2E5L M;  2LHG A;  3J80 S;  2DZL A;  8CAT A;  3U6S A;  2JUJ A;  3C3E A;  3TPZ A;  2XGN A;  2N35 A;  4DUZ M;  3I04 M;  2CE7 A;  2UUC M;  3FE3 A;  3L27 A;  4LJ5 A;  3DZD A;  2A5Y B;  2FH0 A;  1IQP A;  1NHW C;  4L16 A;  4ANR A;  1XMQ M;  4DV7 M;  2LTU A;  1GAB A;  1VG5 A;  2CWB A;  2DWZ B;  3GPU A;  3TE6 A;  3K9P A;  5EXP A;  1LV7 A;  3KP0 E;  3T1Y M;  2XH9 A;  4LFC M;  2V1U A;  3TL4 X;  4AW4 A;  3MK6 A;  1C7Y A;  1OJL A;  1ORY B;  3HJQ A;  1IN8 A;  1XXH A;  4ITQ A;  1V92 A;  4IBK A;  3DA1 A;  2B3T A;  3KP1 E;  5EQT A;  1DGG A;  3B74 A;  4QHS A;  2DHY A;  4JI0 M;  4HEO A;  1MU5 A;  3KS4 A;  1H6U A;  3HKP A;  2MGW A;  4OX9 M;  3U61 B;  1IN4 A;  1SXJ E;  2OQ4 A;  4LZJ A;  4DV6 M;  1IBL M;  1V33 A;  2EKF A;  2CHG A;  1OAO C;  3SMS A;  4R71 A;  5ITU A;  3U6O A;  1XXH B;  4LJA A;  3U5Z B;  5EP2 A;  4M9X A;  2XZU A;  4KT0 F;  1WJ7 A;  3E46 A;  2DKL A;  2VQE M;  1GKI A;  3T1H M;  5H37 D;  4LF7 M;  1TTE A;  4D81 A;  4WUR A;  1TF0 B;  3W0F A;  2LVN C;  1PGY A;  1G71 A;  3A46 A;  1JQJ C;  1NNU C;  2Z3X A;  1GL7 A;  3SAW A;  1C1K A;  1PJT A;  2MR9 A;  1N36 M;  1XNR M;  3PNV A;  2BNK A;  5DFL A;  4YHH M;  3H4J A;  1S3S A;  2R62 A;  1TGU A;  2ZAN A;  1PM5 A;  3LCU A;  4F1I A;  2V1C A;  3HZJ A;  1D0M A;  1XHB A;  1GJT A;  2QNJ A;  3KOW E;  2D7G A;  4QNR A;  2LBC A;  3PFI A;  3GO8 A;  2JZ1 A;  2I7N A;  4L4U A;  1L2C A;  4GC9 A;  3GLG B;  1DGH A;  2L4E A;  3UZU A;  1G8P A;  2CV2 A;  5EP1 A;  4DV0 M;  3UJN A;  4DR5 M;  4LGY A;  4DV5 M;  2KRU A;  3CF6 E;  3U6M A;  4NSR A;  4LF9 M;  4X65 M;  3CGW A;  2CP8 A;  4MM3 B;  1QUS A;  1QVR A;  3GPP A;  3U6Q A;  1NJF A;  4JN6 A;  4B7H A;  3SHG B;  4D80 A;  3J7A S;  4P16 A;  4K0K M;  1IN7 A;  1GVN A;  1VEG A;  1DGH B;  5EXS A;  2DWN A;  3KSX A;  4JV5 M;  3GLG E;  4P17 A;  2LVP C;  2FOI C;  2APL A;  2JA2 A;  2EA0 A;  1HNZ M;  1VDD A;  4G3O A;  1I4W A;  3M6A A;  4AQY M;  4LF6 M;  3FRH A;  4RNA A;  2J7N A;  1Z5A A;  2QCU A;  4MH0 E;  4X66 M;  4OU7 A;  2LVA A;  4CIZ A;  2DWL A;  3C3D A;  2HHH M;  3GP1 A;  1OQY A;  3TWL A;  3SAV A;  2JXN A;  1HT2 E;  3CF0 A;  4I8O A;  1IN6 A;  3J7B A;  4YY3 M;  1IN5 A;  3A98 B;  3GLF A;  1DGF A;  3T6P A;  4PDG A;  4G4R A;  3FRI A;  4JI7 M;  4HL4 A;  1ZAE A;  1N78 A;  2Y20 A;  1ZMW A;  4NRW A;  1SXJ D;  2YFQ A;  2L09 A;  1ZV1 A;  3I4Y A;  2DI0 A;  4LZZ A;  3KOY E;  4B3M M;  4LF4 M;  4L78 A;  4IBJ A;  3L2A A;  1Y8G A;  4NSO B;  1FNN A;  3J2P B;  1QDT A;  2KXE A;  1G4A E;  1OTR A;  2V6Z M;  3B7Z A;  4LRS A;  1MJG M;  3GLF B;  5EP4 A;  2HCB A;  2VII A;  1E9S A;  1K82 A;  2EKK A;  2EJS A;  3AJI B;  4XBO A;  3FTE A;  1D0L A;  2KNV A;  1MX0 A;  1QAQ A;  3FUT A;  1T6O A;  4AI6 A;  2H1R A;  3CF2 A;  1T43 A;  2JY6 B;  4KLN A;  3J81 S;  3FUU A;  4MB7 A;  1JB0 F;  2CV0 A;  1IBK M;  2KRK A;  3GLH E;  1G41 A;  1XMO M;  2R45 A;  5GKN A;  5ITR A;  4LFA M;  4OW0 A;  4AKH A;  2ZAM A;  2L2D A;  2WSC F;  4JXJ A;  3U6D A;  5DYI A;  4FCT A;  3GPX A;  1SXJ C;  4LF5 M;  2Z7J A;  2DZN B;  2DHR A;  2C9O A;  1GO5 A;  3RFW A;  1WHC A;  4GRI A;  1EFU B;  1Q3C A;  2RRU A;  3AOE C;  1FJG M;  3AL0 C;  2BWB A;  2K0B X;  1IY0 A;  1XB2 B;  2GQF A;  5ITX A;  3GLI A;  4G4N A;  1HR0 M;  2WSF F;  3B7Q A;  3SAT A;  2ZAO A;  1WR1 B;  4DBG B;  2VDB B;  1IY2 A;  2JY7 A;  2F5P A;  2OOB A;  1VEJ A;  3QYB A;  4REZ A;  4MGI E;  2R4E A;  3HWS A;  2L4F A;  5E26 A;  5JI3 E;  2DWM A;  2YQZ A;  1L1T A;  2O25 A;  1NJG A;  1NY5 A;  4NOO B;  4IBG A;  4DR1 M;  2K6B A;  4Q7J A;  3GLI B;  3FUX A;  5C1B A;  3VKH A;  2P5T A;  2QBY A;  3VFD A;  3TWK A;  3JAM S;  1VQ1 A;  3GRY A;  1QZM A;  4IIW A;  2F5N A;  2O01 F;  3GRU A;  3QWL A;  1W5S A;  1NV9 A;  2XSZ A;  2FNA A;  2JNH A;  4GC5 A;  3IHP A;  3GRR A;  2HAK A;  4AG5 A;  4D82 A;  2X8A A;  2QZ4 A;  1Q3B A;  2QBY B;  1DO2 A;  1Z5C A;  2QQ8 A;  3PNY A;  1SXJ A;  3PVS A;  2UUB M;  4LJ6 A;  4S12 A;  3W68 A;  2Z8Y M;  5KPT A;  3HHW A;  2YR0 A;  3LVW A;  1OIP A;  4FWG A;  2MRO B;  2KZU A;  2CUZ A;  1WIV A;  2R65 A;  4LCB A;  3AOG A;  3SAS A;  1KYI A;  5LMN M;  4JI3 M;  1QZE A;  1JR3 A;  2G5G X;  3T15 A;  4JI1 M;  3AKZ A;  3HX3 A;  3GQ5 A;  4JI4 M;  3HU1 A;  2BJW A;  2DXI A;  3E9S A;  1LTM A;  4PCZ A;  2JZ0 A;  1PJS A;  5E6J A;  1NV8 A;  4FVM A;  4EIW A;  3I01 M;  3FUV A;  2F4V M;  1XXH E;  3VLF B;  2KHH A;  2LH0 A;  5F3W A;  3F92 A;  4DV3 M;  1WGN A;  2LXE A;  1HQY E; 
#chains in the Genus database with same CATH homology
 2G3Q A;  3FRH A;  2MJ5 B;  2H5X A;  2LVA A;  2K9D A;  1IFY A;  1VEK A;  1OQY A;  1HJP A;  1HT2 E;  1DV0 A;  3T6P A;  3FRI A;  2OOA A;  1ZMW A;  4F2L A;  3K9O A;  2DAG A;  1ZV1 A;  2DI0 A;  1CUK A;  2DAK A;  2LVO C;  1Y8G A;  1YLA A;  1G4A E;  1OTR A;  2DZL A;  1ZMU A;  1ZMV A;  1OKS A;  2JUJ A;  2EKK A;  2EJS A;  2KNV A;  1T6O A;  1T43 A;  2JY6 B;  1R4G A;  1TR8 A;  2KNA A;  2LVQ D;  3FE3 A;  2QHO B;  1IXS A;  2WZJ A;  3GLH E;  1G41 A;  2LTU A;  1UFZ A;  1VG5 A;  2CWB A;  2R0I A;  2BWE A;  2L2D A;  3K9P A;  2HWJ A;  1JR3 E;  1GO5 A;  1WHC A;  1EFU B;  2RRU A;  1C7Y A;  1AIP C;  2BWB A;  2K0B X;  1XB2 B;  1V92 A;  2B3T A;  2JP7 A;  2DHY A;  1WR1 B;  1MN3 A;  4HEO A;  4DBG B;  1F4I A;  2JY7 A;  3E21 A;  2OOB A;  1VEJ A;  2MGW A;  1WGL A;  2L4F A;  2ZTC A;  4GEW A;  2DAI A;  2EKF A;  2JY5 A;  2O25 A;  4R71 A;  4Q7J A;  3IEC A;  3LCV B;  2DNA A;  3GLF E;  5JI2 E;  1WJ7 A;  1VQ1 A;  4UN2 B;  3E46 A;  2DKL A;  2JY8 A;  2DAM A;  1TTE A;  1HT1 E;  1NV9 A;  1DO0 A;  2LVN C;  1PGY A;  2DAE A;  2JNH A;  3IHP A;  1IM2 A;  2HAK A;  2KNZ A;  2QSF X;  1A5T A;  2ZTD A;  2MR9 A;  2OO9 A;  1DO2 A;  5DFL A;  1Q02 A;  1P3Q Q;  3H4J A;  1E94 E;  2MRO B;  2DEN A;  3LCU A;  4F1I A;  1G3I A;  2QNJ A;  1WIV A;  1BVS A;  2LBC A;  2JZ1 A;  4WP2 A;  1KYI A;  1VDL A;  2L4E A;  3B89 A;  1QZE A;  2CP8 A;  2JZ0 A;  1SG9 A;  1NV8 A;  1VEG A;  1XXH E;  3BBZ A;  2LVP C;  3MMP A;  2KHH A;  3GLG E;  3GLI E;  3F92 A;  4G3O A;  1WGN A;  1OAI A;  1HQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...