1VEJA

Solution structure of rsgi ruh-016, a uba domain from mouse cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
GSSGSSGARACSQSSQTALPTSLFTEGRYQQELEELKALGFANRDANLQALVATDGDIHAAIEMLLGASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-016, a UBA Domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 4931431F19
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vejA00
2BWBA 1AIPC 2DENA 2OOAA 3E46A 1QZEA 2DAKA 2MROB 1G41A 3E21A 2LTUA 2MJ5B 3K9PA 1PGYA 1V92A 1ZV1A 2EKKA 2MGWA 3H4JA 1EFUB 1VG5A 1VQ1A 1CUKA 3IECA 3F92A 2KHHA 2JZ1A 1WIVA 2DNAA 3K9OA 2CWBA 2EKFA 3BBZA 1ZMUA 2BWEA 2G3QA 4GEWA 3GLGE 2ZTCA 4F2LA 2CP8A 2DAMA 1KYIA 2DZLA 1OKSA 1WJ7A 2L2DA 1OQYA 4HEOA 2KNZA 1C7YA 1BVSA 1R4GA 1E94E 2H5XA 3FRIA 1A5TA 2JZ0A 1NV9A 1OTRA 2WZJA 1GO5A 2K9DA 4UN2B 2KNAA 1P3QQ 1XB2B 1HT2E 3FE3A 3MMPA 1IFYA 1DO2A 2K0BX 1T6OA 2HWJA 1TR8A 1VEJA 2O25A 4WP2A 1MN3A 2LVAA 4DBGB 2LBCA 1YLAA 1ZMVA 2JUJA 2DHYA 1IM2A 3GLHE 3LCUA 3T6PA 1VDLA 2B3TA 1Y8GA 4R71A 2QNJA 2LVPC 2JY6B 1T43A 1HT1E 1VEKA 2LVQD 1NV8A 2JP7A 1Q02A 1IXSA 2DKLA 2HAKA 2DAEA 1OAIA 1WR1B 5JI2E 2DAIA 3LCVB 3GLFE 2QHOB 2JNHA 2JY7A 1ZMWA 2JY5A 1XXHE 1UFZA 1WGLA 1HJPA 2ZTDA 5DFLA 3FRHA 4F1IA 3GLIE 2EJSA 1VEGA 2JY8A 1WGNA 1HQYE 2DAGA 1JR3E 1F4IA 2OOBA 2DI0A 2MR9A 2QSFX 2OO9A 3IHPA 2RRUA 1G3IA 1DO0A 2L4EA 2LVOC 2L4FA 4Q7JA 4G3OA 1SG9A 2LVNC 1WHCA 2R0IA 1DV0A 1G4AE 1TTEA 2KNVA 3B89A
chains in the Genus database with same CATH superfamily
3SYLA 1AIPC 2FNAA 1OJLA 3W0LB 2EUCA 2KA6B 1G41A 1NY6A 4ZPXA 4L78A 3LMMA 4B08A 5C1BA 4QOSA 3PXGA 2O01F 3U6MA 2R65A 3SHFA 2D7GA 3W67A 1V34A 4MB7A 2MH8A 1LV7A 1XMOM 1VQ1A 4DV0M 2DXIA 1W5TA 1GLNA 1ZAEA 2QPAA 3F92A 3GRRA 4IBJA 2Z3XA 4P16A 2DNAA 1NVMA 2M60A 2YFQA 2CWBA 3B7QA 3C3DA 3RE8A 4DR3M 5H37D 1C1KA 4DV4M 3U61A 1ZMUA 2BWEA 1FJGM 1I4WA 4DV3M 3GO8A 3I4YA 1XXHB 2CP8A 1T3TA 3A42A 1DGHA 2R44A 1N34M 2L2DA 1OQYA 3IG5A 2KNZA 5A2QS 2HKJA 3RFWA 2QQ8A 3AOGA 3GPXA 4BB9A 3TWKA 2FH0A 3GLHA 3SHGB 4GC9A 4IJEA 4GC5A 3A98B 3K8ZA 3T15A 2F5SA 4NRVA 2KEBA 3UGJA 1OFHA 4JI2M 1YE9A 4II7A 1P3QQ 2G8LA 3NBXX 1PJTA 4IJFA 5DYIA 3W68A 2Y0QA 3QYEA 4CHTB 1IFYA 4AKHA 3AL0C 2K0BX 2VQEM 3FTCA 1SXJC 1N36M 5KQ8A 4DUYM 1TR8A 5FTLA 2ZAMA 1QDTA 4KHPM 2HHHM 2LWXA 2C96A 4LZZA 4DBGB 1GKIA 1QYRA 1G71A 4LRTA 3SMSA 1D0KA 1TGUA 2R45A 3QWLA 4JI0M 2QCUA 2ZAOA 1PJIA 1K82A 2C98A 2CV0A 2LHCA 4IIWA 3C3EA 3T6PA 2L7HA 1L2CA 3EIHA 1VDLA 4YHHM 3VK8A 3FYDA 2KDLA 2C9OA 4DR7M 2J5YA 4LF8M 2UU9M 3JR5A 1E9RA 1IXRC 7CATA 2UUBM 3A45A 1PRBA 5IWAM 2CRUA 4LGYA 4DV7M 1NNUC 3HU1A 1Q02A 1SXJE 3PNYA 2XH9A 3PNVA 2HAKA 5KO3A 4JI1M 1GJSA 3C9PA 2EO2A 2R62A 2X4AA 3CTWB 2LNHC 3JAMS 1D0LA 2WSEF 4B3TM 3T1YM 2CV2A 2JY7A 4JI8M 4JI3M 1Q3CA 1DGGA 1XXHE 3GRUA 5DFLA 2DWZB 4L16A 1YSYA 4MH0E 1Z5AA 5EP3A 4R7GA 1TH2A 1HQCA 4IBIA 1JR3E 3HHYA 1IXZA 4GHLA 4PDIA 3FUUA 2G5GX 2D7EA 2F4VM 2QSFX 3GRVA 2CEAA 2RRUA 4FCVA 3THGA 2L4EA 1NJGA 1N78A 3HJSA 1Q39A 3MJ5A 2X49A 3NBIA 4D80A 4OX9M 3RGPA 4FVMA 4Q7JA 2OQ4A 4G3OA 3U60A 1Z5CA 4LF7M 3E9SA 1K3XA 4YY3M 4LFBM 3ZQJA 3KOZE 1IN8A 2R0IA 1DV0A 1XC8A 4Z8XA 5KQDA 1F4IA 3KSXA 4I8OA 3LQRA 4LRSA 3W0FA 4G4NA 2VF7A 4LGMA 3CF0A 4M9SA 4GITA 4LJ4A 4PD2A 1QZEA 3R8FA 2N35A 2Z4RA 2DAKA 2MROB 4XBOA 1IN7A 3SYKA 1N75A 3E21A 5ITYA 1KSFX 2QBYB 1XHBA 4KO8A 5FSWA 2MJ5B 4L15A 3BOSA 3K9PA 3VFDA 1SXJD 2MGWA 3GPPA 4K0KM 1HNWM 4IBDA 3BXWA 1R2YA 1QANA 1QAMA 3MK6A 3V76A 3GLFA 3K2LA 4REZA 1QUTA 1WIVA 4JYAM 5ITTA 4IBCA 4L4UA 2EKFA 1J09A 3HU3A 1LTMA 4M9ZA 3KS4A 4I81A 3DFZA 2L7IA 3L29A 5FLXS 5EXSA 2DAMA 4FCTA 1KYIA 4JI7M 1Q3BA 1IY2A 1IN5A 3GQ5A 3TWMA 3HHZA 3U61B 4QHSA 4HEOA 1EE8A 4IBFA 1R4GA 1C7YA 4LF9M 2V1CA 2ERCA 2H5XA 3KOXE 5F3WA 3FRIA 2FE8A 3TQSA 1A5TA 4MM3B 4DV2M 4IBBA 2XGNA 2WZJA 4IBKA 5EP1A 3U60B 2K9DA 2K47A 4UN2B 3T1HM 3GRYA 4RKUF 4FD2A 5BR8M 1H6UA 2F5QA 1QAQA 3FKEA 1NJFA 4AI6A 3U5ZA 1DO2A 3EIEA 2HWJA 3HJQA 1PJJA 1K3WA 1DGBA 4HLQA 2C5RA 4FCWA 4AKIA 4AZFA 4B7HA 1MN3A 4AKGA 2JA2A 4G6ZA 3KFUG 3ZH9B 2XLJA 3FTDA 1DGFA 4JI4M 1NHGC 4NSRA 2QBYA 2UXCM 1J7KA 1RU3A 4MGHA 1G59A 1TH4A 4ANRA 2X8AA 3GLHE 3AV0A 4IBEA 1E32A 1W5SA 4PT5A 2GNOA 1Z6TA 2XZUA 3AOEA 4GRIA 1R2ZA 2I7PA 2LVPC 3DA1A 3HX3A 2DWLA 1VEKA 4AQYM 2LVQD 1NV8A 4LF4M 2GQFA 1IXSA 3R9XB 4WURA 1R5LA 3SAVA 2BJWA 2CFOA 3L27A 2HL7A 1R6BX 1S3SA 3M7GA 3DZDA 4B3RM 2JNHA 2LXEA 1WGLA 1ZQ9A 1Z59A 1GL6A 2AHMA 1SXJB 4F1IA 3GLIE 2EJSA 5LMUM 4D82A 1OFIA 3U6OA 2FS1A 8CATA 3FUXA 3J80S 2I7NA 1X37A 1WXQA 3U6DA 3SMPA 3GLIA 1TDHA 4LJ5A 3SC3A 1XNRM 2R4JA 5EXXA 4GMQA 1GABA 3CF2A 4DR4M 2OO9A 3U5ZB 1G3IA 1DO0A 1N33M 1V33A 2LVOC 3HJ8A 2L4FA 2YR0A 1AUAA 5ITUA 3LVVA 4AG6A 3RGSA 1MU5A 2FFJA 3GQ3A 3I04M 5IZ7D 2HCBA 3U6PA 1I94M 2R4EA 3WHLA 1OIZA 4X66M 1GJTA 3B89A 2BWBA 3FYCA 3ZCBB 2OOAA 3E46A 1N32M 2F5PA 1QUSA 3U6QA 5DNYA 2RKOA 2LH0A 5FTJA 2D7HA 4NXNM 3ILKA 5FTMA 5IREB 2LTUA 4G4OA 2L09A 4M9XA 1PGYA 2VDBB 2UXBM 1ZV1A 2EKKA 2QENA 3J27B 4KLNA 4MGZE 1EFUB 1VG5A 3I4VA 2V1UA 1CUKA 2CHVA 4RNAA 2JZ1A 5L8RF 2EA0A 4BLCA 1XNQM 3UMMA 4LJ6A 4LJ8A 4FW9A 1SXJA 3BBZA 1UM8A 2C99A 3GLFB 2J7OA 5KPRA 3FD9A 4LF5M 1G8PA 3AKZA 2KXEA 1YUBA 2XEPA 3AFHA 4LCBA 3HWSA 3VDUA 1NNJA 4PDGA 4DV5M 3AJIB 4FWGA 3NWLA 1L8QA 4GIPA 1D0MA 1BVSA 4OU7A 3AOEC 1GL7A 1E94E 1L2DA 3L25A 5JI3E 2F5OA 1OTRA 5EXTA 1GO5A 4CISA 2ZBKB 2KNAA 4W5WA 3GQ4A 4JI6M 3FE3A 3B7ZA 1NO1A 1NSFA 3L2AA 3MMPA 3KSJA 2YQZA 3CF6E 1HNZM 4L8RC 4LY6A 1T6OA 1VDDA 2CHQA 2F5NA 2CUZA 2O25A 5GKNA 4RF1A 4WP2A 3KS8A 2QP9X 4CIZA 2XFSA 2LHGA 3KP1E 4Y28F 1TF0B 1L1TA 3HZJA 1J5EM 1YLAA 2XF3A 2DZOB 3KVWA 2JUJA 4B3MM 2ZANA 2KW0A 3FUTA 3LCUA 2R18A 4JN6A 5FTNA 2DHRA 4A3VB 2W82A 3A46A 1Y8GA 4S12A 4LFCM 3TWLA 1IBLM 3TL4X 1OAOC 3KOYE 4IBGA 4DUZM 1IN4A 1HT1E 4XGIA 5EQTA 4WW0A 2KRKA 4LF6M 2Y0TA 2DKLA 3HHXA 4KODA 1OAIA 4B7GA 2CE7A 1WR1B 3FUWA 2DAIA 2QZ4A 2V6ZM 1R7RA 2C9CA 5JI2E 5ITRA 4I5SA 3GP1A 3GLFE 1IXSB 2QHOB 4DV6M 3PVSA 3VDPA 1PJSA 1ZMWA 2JY5A 1UFZA 5ITQA 2XFTA 3GPUA 1XMQM 2Y21A 3SASA 3D8BA 1QDRA 1VEGA 3DOAA 3HU2A 3GPYA 3KDSE 2OOBA 2OPFA 2MR9A 3QAUA 2CHGA 3FUVA 3VLFB 3I01M 3JR4A 1OIPA 3C58A 3IHPA 1IQPA 2JWSA 4DR5M 2DWNA 3GLIB 1JB0F 2BJVA 2KZUA 4NL4H 2Y20A 3SFZA 3OTOM 5E26A 1TH3A 2FOIC 5ITXE 3J7AS 1EIJA 3I51A 4AW4A 4GHAA 4LG2A 3SATA 1SG9A 4MGIE 3M0EA 5ITXA 3SAUA 2JXNA 3PFIA 4PCZA 1WHCA 2NQ8C 1TTEA 2KNVA 5EP2A 4OW0A 3UJNA 2DENA 4LZJA 3UZUA 3QYBA 4TUWA 3K92A 4B7FA 2J7NA 1ORYB 1JQJC 2YNMD 2DVWB 1N77A 1V92A 2KRUA 3GLGB 4MGKE 1IBMM 2Z7JA 4X64M 3J81S 5KPZA 3H4JA 5EP4A 1KFVA 5KPTA 3IG8A 3WHKA 1IY0A 3IECA 2H1RA 3MHVC 4FWHA 3VK7A 4KT0F 2KHHA 4NSOB 1QQWA 1XXHA 3K9OA 2VIIA 4I4LA 1DGHB 2P5TA 1IBKM 1E9SA 5FTKA 2WSCF 4P17A 4D81A 2XZFA 2G3QA 4GEWA 3GLGE 2RGHA 2DWMA 2Q2EB 2ZTCA 4F2LA 4DV1M 4QHTA 4M0WA 1HNXM 3M6AA 2DZLA 1OKSA 4DR6M 2UUAM 1WJ7A 3FTEA 4DR1M 4NRWA 1MX0A 3B74A 3TPZA 3KW6A 4JXJA 4OVZA 4JI5M 2E5LM 2XSZD 2JZ0A 1IY1A 1NHWC 1NV9A 4ITQA 4LFAM 2DZNB 3U6CA 3L28A 3T38A 3B7NA 4BBAA 4NXMM 1XB2B 1HT2E 3KXEC 4CGYB 3D8LA 2BNKA 4MGYE 4EIWA 3SBJA 5IT9S 1QVRA 1VEJA 2Z4SA 5DYGA 2CV1A 4X62M 5E6JA 3VKHA 2LVAA 2ZM6M 3J2PB 2LBCA 1PM5A 1ZMVA 4CJ6A 2L6OA 1IN6A 1IM2A 2DHYA 4QNMA 4G4RA 1D2NA 2O5RA 5C18A 3GLGA 4QOZC 1XWIA 1Z5BA 3LW5F 3ZC7B 4GKKM 2B3TA 4GKJM 1MJGM 4QNRA 1L2BA 1JR3A 2R6FA 4R71A 1FNNA 2QNJA 3K1JA 3Q8XA 3VKGA 2M5ZA 2JY6B 1T43A 4GH9A 2XSZA 3E4RA 4LJ9A 3HHWA 3J7BA 2JP7A 3U6SA 3HY5A 4M0DA 4FWDA 1NY5A 2DAEA 2APLA 3B9PA 3SARA 4XK8F 3KP0E 4LJAA 5BPVA 2RGOA 3LCVB 2A5YB 3HKPA 4LJ7A 4HL4A 3U6EA 1JR3D 1HJPA 2ZTDA 3LQQA 3U6LA 2R46A 4OVZB 3FRHA 2UXDM 3HGIA 3H4MA 4NC6A 2JY8A 1WGNA 3LVWA 3SAWA 1HQYE 2DAGA 3TE6A 3UK6A 2DI0A 5LMNM 3L26A 1GVNA 2Z8YM 5EJCA 4RF0A 4JV5M 3Q8GA 1QAOA 4AG5A 1TDZA 3GLHB 5EXPA 1L1ZA 3CGWA 3KOWE 4Z6YA 4B3SM 1PJQA 1HR0M 2KZSA 4NOOB 4L6V6 4X65M 2UUCM 2VQFM 3FTFA 4R3DA 1QZMA 2LVNC 2WSFF 2VF8A 4G4QA 1G4AE 4DR2M 2K6BA
chains in the Genus database with same CATH topology
2BWBA 1AIPC 2DENA 2OOAA 3E46A 1QZEA 2DAKA 2MROB 1G41A 3E21A 2LTUA 2MJ5B 3K9PA 1PGYA 1V92A 1ZV1A 2EKKA 2MGWA 3H4JA 1EFUB 1VG5A 1VQ1A 1CUKA 3IECA 3F92A 2KHHA 2JZ1A 1WIVA 2DNAA 3K9OA 2CWBA 2EKFA 3BBZA 1ZMUA 2BWEA 2G3QA 4GEWA 3GLGE 2ZTCA 4F2LA 2CP8A 2DAMA 1KYIA 2DZLA 1OKSA 1WJ7A 2L2DA 1OQYA 4HEOA 2KNZA 1C7YA 1BVSA 1R4GA 1E94E 2H5XA 3FRIA 1A5TA 2JZ0A 1NV9A 1OTRA 2WZJA 1GO5A 2K9DA 4UN2B 2KNAA 1P3QQ 1XB2B 1HT2E 3FE3A 3MMPA 1IFYA 1DO2A 2K0BX 1T6OA 2HWJA 1TR8A 1VEJA 2O25A 4WP2A 1MN3A 2LVAA 4DBGB 2LBCA 1YLAA 1ZMVA 2JUJA 2DHYA 1IM2A 3GLHE 3LCUA 3T6PA 1VDLA 2B3TA 1Y8GA 4R71A 2QNJA 2LVPC 2JY6B 1T43A 1HT1E 1VEKA 2LVQD 1NV8A 2JP7A 1Q02A 1IXSA 2DKLA 2HAKA 2DAEA 1OAIA 1WR1B 5JI2E 2DAIA 3LCVB 3GLFE 2QHOB 2JNHA 2JY7A 1ZMWA 2JY5A 1XXHE 1UFZA 1WGLA 1HJPA 2ZTDA 5DFLA 3FRHA 4F1IA 3GLIE 2EJSA 1VEGA 2JY8A 1WGNA 1HQYE 2DAGA 1JR3E 1F4IA 2OOBA 2DI0A 2MR9A 2QSFX 2OO9A 3IHPA 2RRUA 1G3IA 1DO0A 2L4EA 2LVOC 2L4FA 4Q7JA 4G3OA 1SG9A 2LVNC 1WHCA 2R0IA 1DV0A 1G4AE 1TTEA 2KNVA 3B89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWB A;  1AIP C;  2DEN A;  2OOA A;  3E46 A;  1QZE A;  2DAK A;  2MRO B;  1G41 A;  3E21 A;  2LTU A;  2MJ5 B;  3K9P A;  1PGY A;  1V92 A;  1ZV1 A;  2EKK A;  2MGW A;  3H4J A;  1EFU B;  1VG5 A;  1VQ1 A;  1CUK A;  3IEC A;  3F92 A;  2KHH A;  2JZ1 A;  1WIV A;  2DNA A;  3K9O A;  2CWB A;  2EKF A;  3BBZ A;  1ZMU A;  2BWE A;  2G3Q A;  4GEW A;  3GLG E;  2ZTC A;  4F2L A;  2CP8 A;  2DAM A;  1KYI A;  2DZL A;  1OKS A;  1WJ7 A;  2L2D A;  1OQY A;  4HEO A;  2KNZ A;  1C7Y A;  1BVS A;  1R4G A;  1E94 E;  2H5X A;  3FRI A;  1A5T A;  2JZ0 A;  1NV9 A;  1OTR A;  2WZJ A;  1GO5 A;  2K9D A;  4UN2 B;  2KNA A;  1P3Q Q;  1XB2 B;  1HT2 E;  3FE3 A;  3MMP A;  1IFY A;  1DO2 A;  2K0B X;  1T6O A;  2HWJ A;  1TR8 A;  1VEJ A;  2O25 A;  4WP2 A;  1MN3 A;  2LVA A;  4DBG B;  2LBC A;  1YLA A;  1ZMV A;  2JUJ A;  2DHY A;  1IM2 A;  3GLH E;  3LCU A;  3T6P A;  1VDL A;  2B3T A;  1Y8G A;  4R71 A;  2QNJ A;  2LVP C;  2JY6 B;  1T43 A;  1HT1 E;  1VEK A;  2LVQ D;  1NV8 A;  2JP7 A;  1Q02 A;  1IXS A;  2DKL A;  2HAK A;  2DAE A;  1OAI A;  1WR1 B;  5JI2 E;  2DAI A;  3LCV B;  3GLF E;  2QHO B;  2JNH A;  2JY7 A;  1ZMW A;  2JY5 A;  1XXH E;  1UFZ A;  1WGL A;  1HJP A;  2ZTD A;  5DFL A;  3FRH A;  4F1I A;  3GLI E;  2EJS A;  1VEG A;  2JY8 A;  1WGN A;  1HQY E;  2DAG A;  1JR3 E;  1F4I A;  2OOB A;  2DI0 A;  2MR9 A;  2QSF X;  2OO9 A;  3IHP A;  2RRU A;  1G3I A;  1DO0 A;  2L4E A;  2LVO C;  2L4F A;  4Q7J A;  4G3O A;  1SG9 A;  2LVN C;  1WHC A;  2R0I A;  1DV0 A;  1G4A E;  1TTE A;  2KNV A;  3B89 A; 
#chains in the Genus database with same CATH topology
 3SYL A;  1AIP C;  2FNA A;  1OJL A;  3W0L B;  2EUC A;  2KA6 B;  1G41 A;  1NY6 A;  4ZPX A;  4L78 A;  3LMM A;  4B08 A;  5C1B A;  4QOS A;  3PXG A;  2O01 F;  3U6M A;  2R65 A;  3SHF A;  2D7G A;  3W67 A;  1V34 A;  4MB7 A;  2MH8 A;  1LV7 A;  1XMO M;  1VQ1 A;  4DV0 M;  2DXI A;  1W5T A;  1GLN A;  1ZAE A;  2QPA A;  3F92 A;  3GRR A;  4IBJ A;  2Z3X A;  4P16 A;  2DNA A;  1NVM A;  2M60 A;  2YFQ A;  2CWB A;  3B7Q A;  3C3D A;  3RE8 A;  4DR3 M;  5H37 D;  1C1K A;  4DV4 M;  3U61 A;  1ZMU A;  2BWE A;  1FJG M;  1I4W A;  4DV3 M;  3GO8 A;  3I4Y A;  1XXH B;  2CP8 A;  1T3T A;  3A42 A;  1DGH A;  2R44 A;  1N34 M;  2L2D A;  1OQY A;  3IG5 A;  2KNZ A;  5A2Q S;  2HKJ A;  3RFW A;  2QQ8 A;  3AOG A;  3GPX A;  4BB9 A;  3TWK A;  2FH0 A;  3GLH A;  3SHG B;  4GC9 A;  4IJE A;  4GC5 A;  3A98 B;  3K8Z A;  3T15 A;  2F5S A;  4NRV A;  2KEB A;  3UGJ A;  1OFH A;  4JI2 M;  1YE9 A;  4II7 A;  1P3Q Q;  2G8L A;  3NBX X;  1PJT A;  4IJF A;  5DYI A;  3W68 A;  2Y0Q A;  3QYE A;  4CHT B;  1IFY A;  4AKH A;  3AL0 C;  2K0B X;  2VQE M;  3FTC A;  1SXJ C;  1N36 M;  5KQ8 A;  4DUY M;  1TR8 A;  5FTL A;  2ZAM A;  1QDT A;  4KHP M;  2HHH M;  2LWX A;  2C96 A;  4LZZ A;  4DBG B;  1GKI A;  1QYR A;  1G71 A;  4LRT A;  3SMS A;  1D0K A;  1TGU A;  2R45 A;  3QWL A;  4JI0 M;  2QCU A;  2ZAO A;  1PJI A;  1K82 A;  2C98 A;  2CV0 A;  2LHC A;  4IIW A;  3C3E A;  3T6P A;  2L7H A;  1L2C A;  3EIH A;  1VDL A;  4YHH M;  3VK8 A;  3FYD A;  2KDL A;  2C9O A;  4DR7 M;  2J5Y A;  4LF8 M;  2UU9 M;  3JR5 A;  1E9R A;  1IXR C;  7CAT A;  2UUB M;  3A45 A;  1PRB A;  5IWA M;  2CRU A;  4LGY A;  4DV7 M;  1NNU C;  3HU1 A;  1Q02 A;  1SXJ E;  3PNY A;  2XH9 A;  3PNV A;  2HAK A;  5KO3 A;  4JI1 M;  1GJS A;  3C9P A;  2EO2 A;  2R62 A;  2X4A A;  3CTW B;  2LNH C;  3JAM S;  1D0L A;  2WSE F;  4B3T M;  3T1Y M;  2CV2 A;  2JY7 A;  4JI8 M;  4JI3 M;  1Q3C A;  1DGG A;  1XXH E;  3GRU A;  5DFL A;  2DWZ B;  4L16 A;  1YSY A;  4MH0 E;  1Z5A A;  5EP3 A;  4R7G A;  1TH2 A;  1HQC A;  4IBI A;  1JR3 E;  3HHY A;  1IXZ A;  4GHL A;  4PDI A;  3FUU A;  2G5G X;  2D7E A;  2F4V M;  2QSF X;  3GRV A;  2CEA A;  2RRU A;  4FCV A;  3THG A;  2L4E A;  1NJG A;  1N78 A;  3HJS A;  1Q39 A;  3MJ5 A;  2X49 A;  3NBI A;  4D80 A;  4OX9 M;  3RGP A;  4FVM A;  4Q7J A;  2OQ4 A;  4G3O A;  3U60 A;  1Z5C A;  4LF7 M;  3E9S A;  1K3X A;  4YY3 M;  4LFB M;  3ZQJ A;  3KOZ E;  1IN8 A;  2R0I A;  1DV0 A;  1XC8 A;  4Z8X A;  5KQD A;  1F4I A;  3KSX A;  4I8O A;  3LQR A;  4LRS A;  3W0F A;  4G4N A;  2VF7 A;  4LGM A;  3CF0 A;  4M9S A;  4GIT A;  4LJ4 A;  4PD2 A;  1QZE A;  3R8F A;  2N35 A;  2Z4R A;  2DAK A;  2MRO B;  4XBO A;  1IN7 A;  3SYK A;  1N75 A;  3E21 A;  5ITY A;  1KSF X;  2QBY B;  1XHB A;  4KO8 A;  5FSW A;  2MJ5 B;  4L15 A;  3BOS A;  3K9P A;  3VFD A;  1SXJ D;  2MGW A;  3GPP A;  4K0K M;  1HNW M;  4IBD A;  3BXW A;  1R2Y A;  1QAN A;  1QAM A;  3MK6 A;  3V76 A;  3GLF A;  3K2L A;  4REZ A;  1QUT A;  1WIV A;  4JYA M;  5ITT A;  4IBC A;  4L4U A;  2EKF A;  1J09 A;  3HU3 A;  1LTM A;  4M9Z A;  3KS4 A;  4I81 A;  3DFZ A;  2L7I A;  3L29 A;  5FLX S;  5EXS A;  2DAM A;  4FCT A;  1KYI A;  4JI7 M;  1Q3B A;  1IY2 A;  1IN5 A;  3GQ5 A;  3TWM A;  3HHZ A;  3U61 B;  4QHS A;  4HEO A;  1EE8 A;  4IBF A;  1R4G A;  1C7Y A;  4LF9 M;  2V1C A;  2ERC A;  2H5X A;  3KOX E;  5F3W A;  3FRI A;  2FE8 A;  3TQS A;  1A5T A;  4MM3 B;  4DV2 M;  4IBB A;  2XGN A;  2WZJ A;  4IBK A;  5EP1 A;  3U60 B;  2K9D A;  2K47 A;  4UN2 B;  3T1H M;  3GRY A;  4RKU F;  4FD2 A;  5BR8 M;  1H6U A;  2F5Q A;  1QAQ A;  3FKE A;  1NJF A;  4AI6 A;  3U5Z A;  1DO2 A;  3EIE A;  2HWJ A;  3HJQ A;  1PJJ A;  1K3W A;  1DGB A;  4HLQ A;  2C5R A;  4FCW A;  4AKI A;  4AZF A;  4B7H A;  1MN3 A;  4AKG A;  2JA2 A;  4G6Z A;  3KFU G;  3ZH9 B;  2XLJ A;  3FTD A;  1DGF A;  4JI4 M;  1NHG C;  4NSR A;  2QBY A;  2UXC M;  1J7K A;  1RU3 A;  4MGH A;  1G59 A;  1TH4 A;  4ANR A;  2X8A A;  3GLH E;  3AV0 A;  4IBE A;  1E32 A;  1W5S A;  4PT5 A;  2GNO A;  1Z6T A;  2XZU A;  3AOE A;  4GRI A;  1R2Z A;  2I7P A;  2LVP C;  3DA1 A;  3HX3 A;  2DWL A;  1VEK A;  4AQY M;  2LVQ D;  1NV8 A;  4LF4 M;  2GQF A;  1IXS A;  3R9X B;  4WUR A;  1R5L A;  3SAV A;  2BJW A;  2CFO A;  3L27 A;  2HL7 A;  1R6B X;  1S3S A;  3M7G A;  3DZD A;  4B3R M;  2JNH A;  2LXE A;  1WGL A;  1ZQ9 A;  1Z59 A;  1GL6 A;  2AHM A;  1SXJ B;  4F1I A;  3GLI E;  2EJS A;  5LMU M;  4D82 A;  1OFI A;  3U6O A;  2FS1 A;  8CAT A;  3FUX A;  3J80 S;  2I7N A;  1X37 A;  1WXQ A;  3U6D A;  3SMP A;  3GLI A;  1TDH A;  4LJ5 A;  3SC3 A;  1XNR M;  2R4J A;  5EXX A;  4GMQ A;  1GAB A;  3CF2 A;  4DR4 M;  2OO9 A;  3U5Z B;  1G3I A;  1DO0 A;  1N33 M;  1V33 A;  2LVO C;  3HJ8 A;  2L4F A;  2YR0 A;  1AUA A;  5ITU A;  3LVV A;  4AG6 A;  3RGS A;  1MU5 A;  2FFJ A;  3GQ3 A;  3I04 M;  5IZ7 D;  2HCB A;  3U6P A;  1I94 M;  2R4E A;  3WHL A;  1OIZ A;  4X66 M;  1GJT A;  3B89 A;  2BWB A;  3FYC A;  3ZCB B;  2OOA A;  3E46 A;  1N32 M;  2F5P A;  1QUS A;  3U6Q A;  5DNY A;  2RKO A;  2LH0 A;  5FTJ A;  2D7H A;  4NXN M;  3ILK A;  5FTM A;  5IRE B;  2LTU A;  4G4O A;  2L09 A;  4M9X A;  1PGY A;  2VDB B;  2UXB M;  1ZV1 A;  2EKK A;  2QEN A;  3J27 B;  4KLN A;  4MGZ E;  1EFU B;  1VG5 A;  3I4V A;  2V1U A;  1CUK A;  2CHV A;  4RNA A;  2JZ1 A;  5L8R F;  2EA0 A;  4BLC A;  1XNQ M;  3UMM A;  4LJ6 A;  4LJ8 A;  4FW9 A;  1SXJ A;  3BBZ A;  1UM8 A;  2C99 A;  3GLF B;  2J7O A;  5KPR A;  3FD9 A;  4LF5 M;  1G8P A;  3AKZ A;  2KXE A;  1YUB A;  2XEP A;  3AFH A;  4LCB A;  3HWS A;  3VDU A;  1NNJ A;  4PDG A;  4DV5 M;  3AJI B;  4FWG A;  3NWL A;  1L8Q A;  4GIP A;  1D0M A;  1BVS A;  4OU7 A;  3AOE C;  1GL7 A;  1E94 E;  1L2D A;  3L25 A;  5JI3 E;  2F5O A;  1OTR A;  5EXT A;  1GO5 A;  4CIS A;  2ZBK B;  2KNA A;  4W5W A;  3GQ4 A;  4JI6 M;  3FE3 A;  3B7Z A;  1NO1 A;  1NSF A;  3L2A A;  3MMP A;  3KSJ A;  2YQZ A;  3CF6 E;  1HNZ M;  4L8R C;  4LY6 A;  1T6O A;  1VDD A;  2CHQ A;  2F5N A;  2CUZ A;  2O25 A;  5GKN A;  4RF1 A;  4WP2 A;  3KS8 A;  2QP9 X;  4CIZ A;  2XFS A;  2LHG A;  3KP1 E;  4Y28 F;  1TF0 B;  1L1T A;  3HZJ A;  1J5E M;  1YLA A;  2XF3 A;  2DZO B;  3KVW A;  2JUJ A;  4B3M M;  2ZAN A;  2KW0 A;  3FUT A;  3LCU A;  2R18 A;  4JN6 A;  5FTN A;  2DHR A;  4A3V B;  2W82 A;  3A46 A;  1Y8G A;  4S12 A;  4LFC M;  3TWL A;  1IBL M;  3TL4 X;  1OAO C;  3KOY E;  4IBG A;  4DUZ M;  1IN4 A;  1HT1 E;  4XGI A;  5EQT A;  4WW0 A;  2KRK A;  4LF6 M;  2Y0T A;  2DKL A;  3HHX A;  4KOD A;  1OAI A;  4B7G A;  2CE7 A;  1WR1 B;  3FUW A;  2DAI A;  2QZ4 A;  2V6Z M;  1R7R A;  2C9C A;  5JI2 E;  5ITR A;  4I5S A;  3GP1 A;  3GLF E;  1IXS B;  2QHO B;  4DV6 M;  3PVS A;  3VDP A;  1PJS A;  1ZMW A;  2JY5 A;  1UFZ A;  5ITQ A;  2XFT A;  3GPU A;  1XMQ M;  2Y21 A;  3SAS A;  3D8B A;  1QDR A;  1VEG A;  3DOA A;  3HU2 A;  3GPY A;  3KDS E;  2OOB A;  2OPF A;  2MR9 A;  3QAU A;  2CHG A;  3FUV A;  3VLF B;  3I01 M;  3JR4 A;  1OIP A;  3C58 A;  3IHP A;  1IQP A;  2JWS A;  4DR5 M;  2DWN A;  3GLI B;  1JB0 F;  2BJV A;  2KZU A;  4NL4 H;  2Y20 A;  3SFZ A;  3OTO M;  5E26 A;  1TH3 A;  2FOI C;  5ITX E;  3J7A S;  1EIJ A;  3I51 A;  4AW4 A;  4GHA A;  4LG2 A;  3SAT A;  1SG9 A;  4MGI E;  3M0E A;  5ITX A;  3SAU A;  2JXN A;  3PFI A;  4PCZ A;  1WHC A;  2NQ8 C;  1TTE A;  2KNV A;  5EP2 A;  4OW0 A;  3UJN A;  2DEN A;  4LZJ A;  3UZU A;  3QYB A;  4TUW A;  3K92 A;  4B7F A;  2J7N A;  1ORY B;  1JQJ C;  2YNM D;  2DVW B;  1N77 A;  1V92 A;  2KRU A;  3GLG B;  4MGK E;  1IBM M;  2Z7J A;  4X64 M;  3J81 S;  5KPZ A;  3H4J A;  5EP4 A;  1KFV A;  5KPT A;  3IG8 A;  3WHK A;  1IY0 A;  3IEC A;  2H1R A;  3MHV C;  4FWH A;  3VK7 A;  4KT0 F;  2KHH A;  4NSO B;  1QQW A;  1XXH A;  3K9O A;  2VII A;  4I4L A;  1DGH B;  2P5T A;  1IBK M;  1E9S A;  5FTK A;  2WSC F;  4P17 A;  4D81 A;  2XZF A;  2G3Q A;  4GEW A;  3GLG E;  2RGH A;  2DWM A;  2Q2E B;  2ZTC A;  4F2L A;  4DV1 M;  4QHT A;  4M0W A;  1HNX M;  3M6A A;  2DZL A;  1OKS A;  4DR6 M;  2UUA M;  1WJ7 A;  3FTE A;  4DR1 M;  4NRW A;  1MX0 A;  3B74 A;  3TPZ A;  3KW6 A;  4JXJ A;  4OVZ A;  4JI5 M;  2E5L M;  2XSZ D;  2JZ0 A;  1IY1 A;  1NHW C;  1NV9 A;  4ITQ A;  4LFA M;  2DZN B;  3U6C A;  3L28 A;  3T38 A;  3B7N A;  4BBA A;  4NXM M;  1XB2 B;  1HT2 E;  3KXE C;  4CGY B;  3D8L A;  2BNK A;  4MGY E;  4EIW A;  3SBJ A;  5IT9 S;  1QVR A;  1VEJ A;  2Z4S A;  5DYG A;  2CV1 A;  4X62 M;  5E6J A;  3VKH A;  2LVA A;  2ZM6 M;  3J2P B;  2LBC A;  1PM5 A;  1ZMV A;  4CJ6 A;  2L6O A;  1IN6 A;  1IM2 A;  2DHY A;  4QNM A;  4G4R A;  1D2N A;  2O5R A;  5C18 A;  3GLG A;  4QOZ C;  1XWI A;  1Z5B A;  3LW5 F;  3ZC7 B;  4GKK M;  2B3T A;  4GKJ M;  1MJG M;  4QNR A;  1L2B A;  1JR3 A;  2R6F A;  4R71 A;  1FNN A;  2QNJ A;  3K1J A;  3Q8X A;  3VKG A;  2M5Z A;  2JY6 B;  1T43 A;  4GH9 A;  2XSZ A;  3E4R A;  4LJ9 A;  3HHW A;  3J7B A;  2JP7 A;  3U6S A;  3HY5 A;  4M0D A;  4FWD A;  1NY5 A;  2DAE A;  2APL A;  3B9P A;  3SAR A;  4XK8 F;  3KP0 E;  4LJA A;  5BPV A;  2RGO A;  3LCV B;  2A5Y B;  3HKP A;  4LJ7 A;  4HL4 A;  3U6E A;  1JR3 D;  1HJP A;  2ZTD A;  3LQQ A;  3U6L A;  2R46 A;  4OVZ B;  3FRH A;  2UXD M;  3HGI A;  3H4M A;  4NC6 A;  2JY8 A;  1WGN A;  3LVW A;  3SAW A;  1HQY E;  2DAG A;  3TE6 A;  3UK6 A;  2DI0 A;  5LMN M;  3L26 A;  1GVN A;  2Z8Y M;  5EJC A;  4RF0 A;  4JV5 M;  3Q8G A;  1QAO A;  4AG5 A;  1TDZ A;  3GLH B;  5EXP A;  1L1Z A;  3CGW A;  3KOW E;  4Z6Y A;  4B3S M;  1PJQ A;  1HR0 M;  2KZS A;  4NOO B;  4L6V 6;  4X65 M;  2UUC M;  2VQF M;  3FTF A;  4R3D A;  1QZM A;  2LVN C;  2WSF F;  2VF8 A;  4G4Q A;  1G4A E;  4DR2 M;  2K6B A; 
#chains in the Genus database with same CATH homology
 2BWB A;  1AIP C;  2DEN A;  2OOA A;  3E46 A;  1QZE A;  2DAK A;  2MRO B;  1G41 A;  3E21 A;  2LTU A;  2MJ5 B;  3K9P A;  1PGY A;  1V92 A;  1ZV1 A;  2EKK A;  2MGW A;  3H4J A;  1EFU B;  1VG5 A;  1VQ1 A;  1CUK A;  3IEC A;  3F92 A;  2KHH A;  2JZ1 A;  1WIV A;  2DNA A;  3K9O A;  2CWB A;  2EKF A;  3BBZ A;  1ZMU A;  2BWE A;  2G3Q A;  4GEW A;  3GLG E;  2ZTC A;  4F2L A;  2CP8 A;  2DAM A;  1KYI A;  2DZL A;  1OKS A;  1WJ7 A;  2L2D A;  1OQY A;  4HEO A;  2KNZ A;  1C7Y A;  1BVS A;  1R4G A;  1E94 E;  2H5X A;  3FRI A;  1A5T A;  2JZ0 A;  1NV9 A;  1OTR A;  2WZJ A;  1GO5 A;  2K9D A;  4UN2 B;  2KNA A;  1P3Q Q;  1XB2 B;  1HT2 E;  3FE3 A;  3MMP A;  1IFY A;  1DO2 A;  2K0B X;  1T6O A;  2HWJ A;  1TR8 A;  1VEJ A;  2O25 A;  4WP2 A;  1MN3 A;  2LVA A;  4DBG B;  2LBC A;  1YLA A;  1ZMV A;  2JUJ A;  2DHY A;  1IM2 A;  3GLH E;  3LCU A;  3T6P A;  1VDL A;  2B3T A;  1Y8G A;  4R71 A;  2QNJ A;  2LVP C;  2JY6 B;  1T43 A;  1HT1 E;  1VEK A;  2LVQ D;  1NV8 A;  2JP7 A;  1Q02 A;  1IXS A;  2DKL A;  2HAK A;  2DAE A;  1OAI A;  1WR1 B;  5JI2 E;  2DAI A;  3LCV B;  3GLF E;  2QHO B;  2JNH A;  2JY7 A;  1ZMW A;  2JY5 A;  1XXH E;  1UFZ A;  1WGL A;  1HJP A;  2ZTD A;  5DFL A;  3FRH A;  4F1I A;  3GLI E;  2EJS A;  1VEG A;  2JY8 A;  1WGN A;  1HQY E;  2DAG A;  1JR3 E;  1F4I A;  2OOB A;  2DI0 A;  2MR9 A;  2QSF X;  2OO9 A;  3IHP A;  2RRU A;  1G3I A;  1DO0 A;  2L4E A;  2LVO C;  2L4F A;  4Q7J A;  4G3O A;  1SG9 A;  2LVN C;  1WHC A;  2R0I A;  1DV0 A;  1G4A E;  1TTE A;  2KNV A;  3B89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...