1VEJA

Solution structure of rsgi ruh-016, a uba domain from mouse cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
GSSGSSGARACSQSSQTALPTSLFTEGRYQQELEELKALGFANRDANLQALVATDGDIHAAIEMLLGASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 4931431F19
publication title Solution Structure of RSGI RUH-016, a UBA Domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vejA00
3K9OA 2CP8A 2CWBA 2LVNC 4DBGB 2LVOC 3FE3A 2MJ5B 2JY6B 1OQYA 1SG9A 1HT2E 2KNZA 2LBCA 1G3IA 1VQ1A 2H5XA 2RRUA 2JNHA 2G3QA 4G3OA 2R0IA 1T6OA 1TTEA 1OKSA 4WP2A 2BWEA 3IHPA 3MMPA 1C7YA 4UN2B 3FRHA 1WGNA 1QZEA 1WHCA 3T6PA 2DNAA 1OAIA 1R4GA 2JY8A 2WZJA 1IM2A 2MR9A 1KYIA 2DZLA 4GEWA 1F4IA 1HJPA 1ZMWA 2EKFA 1AIPC 1ZV1A 1Q02A 2O25A 1P3QQ 3LCUA 2JUJA 2OOBA 3FRIA 1V92A 1BVSA 1JR3E 1A5TA 1XB2B 1VEJA 4HEOA 1VEKA 1EFUB 1XXHE 1WR1B 2ZTDA 1ZMVA 2LVPC 2LVAA 2EJSA 3GLHE 1TR8A 3BBZA 2OO9A 1VG5A 3E46A 5DFLA 3GLFE 1DV0A 1WGLA 1HT1E 2L2DA 1GO5A 3E21A 1UFZA 2DAIA 2DAGA 1MN3A 2DENA 2L4FA 2K9DA 2OOAA 2QHOB 2KNVA 1HQYE 2KHHA 1VDLA 1YLAA 2DAKA 1PGYA 1ZMUA 2EKKA 2HWJA 2L4EA 1IFYA 2JY7A 4Q7JA 3GLIE 4R71A 2BWBA 2QNJA 2MGWA 3LCVB 3B89A 2DAMA 2JZ0A 2JZ1A 2MROB 3H4JA 2B3TA 2DI0A 3K9PA 1NV8A 1DO2A 1NV9A 1G41A 2QSFX 2DHYA 2LVQD 1OTRA 2JY5A 4F1IA 1IXSA 2KNAA 3IECA 3F92A 1CUKA 1E94E 1VEGA 3GLGE 1Y8GA 2HAKA 1T43A 1DO0A 2DAEA 2JP7A 4F2LA 1G4AE 5JI2E 1WIVA 1WJ7A 2DKLA 2LTUA 2ZTCA 2K0BX
chains in the Genus database with same CATH superfamily
4YHHM 3DA1A 2J5YA 4B7HA 2CP8A 3FD9A 4MH0E 1IXZA 5FTKA 4DBGB 4B3MM 1X37A 2YQZA 2Z4SA 5EP4A 3D8BA 3SMSA 3I4YA 2R46A 3FE3A 3WHKA 4BB9A 1R6BX 4ITQA 3UK6A 1OQYA 5IREB 1XWIA 4MGHA 1HT2E 4I4LA 4P16A 4JN6A 1VQ1A 2XFTA 3QYEA 4B7GA 2YNMD 2H5XA 2CV2A 4AKIA 2KRKA 4CIZA 2Z8YM 3MHVC 2XLJA 3GPYA 4LRTA 2JNHA 4AQYM 1K3WA 3UZUA 4IJFA 2R0IA 4D82A 2QBYA 1Z59A 3E4RA 4WP2A 3U61B 5IWAM 4JI4M 3JR5A 3M0EA 4AG6A 2X8AA 5FLXS 3SBJA 4EIWA 4JI1M 1QZEA 3AJIB 4IBCA 3FUWA 3A46A 3GPXA 1L2BA 4GHLA 2XFSA 1G71A 3SARA 4LJ9A 4LCBA 4CGYB 2JY8A 4M0DA 1IM2A 3U6SA 2V1UA 1ZQ9A 1HJPA 3TPZA 1F4IA 2EKFA 4NSOB 2ZM6M 3FUXA 1SXJD 2F5PA 4CISA 2UUCM 2C9CA 3LCUA 4LJ7A 2Y20A 1BVSA 4NRVA 1Z5BA 1MJGM 3HHZA 4QHTA 4NOOB 1D2NA 1YSYA 2L7IA 4KODA 2J7OA 1EFUB 4GHAA 2WSFF 3ZC7B 1WR1B 3KFUG 1IY1A 1ZMVA 4FD2A 2VQFM 2LVAA 4LGMA 3FUUA 3HY5A 3GQ5A 3FYCA 1L1TA 2KDLA 2FNAA 1L1ZA 4PCZA 1DV0A 1WGLA 3SASA 1J7KA 4NXMM 4AKHA 2C5RA 2WSEF 1MN3A 4X62M 2RKOA 2DENA 4GRIA 2XEPA 1IY2A 2KNVA 1I4WA 1WXQA 1GJTA 4GC5A 3ZQJA 3EIEA 3J2PB 2CFOA 1GL7A 2BJVA 4M9XA 2QPAA 3SAWA 4PDGA 4R3DA 3TE6A 2C96A 3PXGA 1PJQA 2R18A 1L2CA 1V33A 3RGSA 5ITQA 3GLHA 2F5OA 4Q7JA 3R9XB 1IXSB 2F5NA 2CRUA 2X49A 3GLFA 2A5YB 2GQFA 3D8LA 1PJIA 3L29A 3U6OA 2M5ZA 2UUBM 3GLIB 3FTFA 1D0MA 1R2ZA 3B89A 4OX9M 2JWSA 2JZ0A 4JXJA 3L27A 3K92A 3LMMA 5ITRA 2DHRA 3KVWA 5EP1A 4D80A 1IQPA 4LJ4A 3K9PA 2V6ZM 4IBFA 4DV2M 2UUAM 1G41A 2J7NA 2OPFA 2KW0A 3OTOM 2LVQD 1OTRA 3HU2A 5EP2A 1QZMA 2QQ8A 3A42A 4P17A 4IBIA 1E94E 5C18A 4MGZE 2JXNA 1W5TA 3M7GA 4MM3B 3SMPA 5ITXA 1DO0A 2DAEA 2XSZA 4L16A 4LJ5A 1Q39A 3GLGB 3J80S 1IXRC 3GO8A 2MH8A 3U60B 4RKUF 1KSFX 2CWBA 4FWHA 5C1BA 2ZANA 2JY6B 2Z4RA 4ZPXA 3MJ5A 1XMOM 1SG9A 2DWNA 1Z5AA 2EO2A 4NSRA 1GJSA 2KNZA 1JQJC 2ERCA 3BXWA 1JR3D 2CE7A 2LBCA 3U61A 3IG8A 2CV0A 1UM8A 2P5TA 4XK8F 2LH0A 2LHGA 2GNOA 4Z6YA 3FUTA 3TL4X 2Y0QA 4DUZM 3HU1A 1GKIA 2BWEA 3IHPA 3HJSA 4X66M 4NRWA 3CF0A 1IBKM 4UN2B 2HKJA 4LGYA 4DV5M 1H6UA 1TF0B 3T6PA 1QDTA 1R5LA 3VKHA 3VDUA 3SYKA 4OVZB 3KP1E 4II7A 1OAIA 1MU5A 1R4GA 1TDHA 2M60A 2MR9A 2WZJA 1KYIA 1MX0A 3RFWA 3AL0C 4MGKE 5DYIA 4IJEA 3TWLA 3NBIA 2LHCA 4LF4M 1ZV1A 3I04M 1J5EM 5BR8M 1XNQM 1XHBA 1P3QQ 2JUJA 5E6JA 2K6BA 4LZJA 3JR4A 4GMQA 3TWKA 3T15A 3QYBA 1KFVA 3AOEA 3KSJA 2RGOA 3DOAA 1L2DA 3UMMA 4B08A 2LVPC 3KOZE 2R65A 3FKEA 3TWMA 4LFAM 3GLHE 1NVMA 1NHWC 3QWLA 2YFQA 3BBZA 3NBXX 3HHYA 4PDIA 2O5RA 3VLFB 3GLFE 1G59A 4LG2A 4QOSA 4NL4H 4OW0A 1UFZA 2XZFA 3KOYE 4DV1M 4JI7M 2F4VM 2K9DA 3H4MA 4M9ZA 2YR0A 3PVSA 2QHOB 2DXIA 4DR1M 4LJ8A 3EIHA 2RGHA 3QAUA 2NQ8C 3CF6E 1EIJA 2G8LA 3GP1A 5EXSA 1OFIA 3GQ4A 4RF0A 3ZCBB 1XXHA 4PT5A 3L26A 1E32A 4TUWA 3I01M 1Q3BA 2AHMA 3W0LB 2HL7A 3IG5A 1HQCA 2DZOB 4R71A 2BWBA 4X64M 2CHGA 5JI3E 3U6QA 5ITXE 4L6V6 1ZAEA 2MGWA 3LCVB 1XNRM 4HL4A 5A2QS 3KXEC 2JZ1A 4KO8A 2G5GX 4LY6A 1N77A 2XZUA 1IN7A 3T38A 1K3XA 2L6OA 5ITYA 5FTJA 3W68A 4AI6A 1OJLA 3C9PA 3GRUA 3U6DA 1NY5A 2WSCF 5IZ7D 3SHGB 3KS8A 1NV9A 1SXJA 3NWLA 3AKZA 2FFJA 2UXCM 4L4UA 2R6FA 1NO1A 2JY5A 5KPRA 5EQTA 2LNHC 3GLGA 2BNKA 3HGIA 3IECA 1CUKA 1DGHA 2KZSA 3A98B 5ITTA 3Q8XA 1K82A 1S3SA 2CV1A 1VEGA 3U60A 1XMQM 3L25A 4WW0A 4QNMA 3HX3A 4G4NA 3GRYA 3AFHA 1QAOA 2JP7A 4B7FA 4B3TM 3VFDA 5JI2E 1WJ7A 2ZTCA 1DGFA 2DKLA 4IBKA 3U5ZA 2QBYB 1N32M 4IBEA 5L8RF 1LTMA 3WHLA 4DV0M 5KQDA 3K9OA 4G4RA 3GRVA 1GABA 3HU3A 5IT9S 4FWGA 2OQ4A 2XH9A 3CGWA 4JI6M 2CHQA 3HWSA 4DR4M 2W82A 2FOIC 2L09A 3VDPA 3B74A 3PFIA 1G3IA 4R7GA 1N78A 3FUVA 3T1HM 3A45A 4QHSA 5EP3A 3B9PA 4LFBM 4B3RM 2G3QA 4G3OA 1NNJA 5KPZA 1T6OA 5FSWA 3J81S 4GC9A 4RF1A 3MMPA 4M9SA 1C7YA 2I7NA 3VKGA 1C1KA 1QVRA 3TQSA 1WGNA 3UJNA 1AUAA 3VK8A 2KRUA 3RGPA 3SATA 2HCBA 5KQ8A 2QENA 1N75A 1QAQA 2DZLA 4GEWA 1TDZA 2Z7JA 1ZMWA 2ZAMA 1FNNA 4MGYE 2BJWA 3K8ZA 1Q02A 3FRIA 1V92A 4LF5M 4D81A 2V1CA 2KA6B 4FCWA 1A5TA 1XB2B 3SAUA 1QYRA 2QP9X 1VEKA 8CATA 1TH3A 1XXHE 2O01F 3CF2A 1EE8A 3KOXE 1N34M 1OIPA 4JV5M 4DV6M 3LQQA 2DZNB 2ZTDA 1R2YA 1HNZM 1RU3A 4FCTA 2C9OA 3E9SA 4BBAA 2HHHM 3ILKA 2UU9M 1QAMA 2OO9A 1VG5A 4JI2M 1GVNA 2CUZA 2LXEA 4LF8M 5EJCA 5KO3A 1HT1E 1E9SA 3GLHB 3MK6A 1GO5A 1OFHA 3GLFB 3FYDA 5EXXA 3E21A 3M6AA 4DUYM 2KZUA 4DR7M 2EA0A 2R45A 4JYAM 3AV0A 1GLNA 4LF9M 2KEBA 2Y0TA 1VDLA 7CATA 2DAKA 1JR3A 1PGYA 1SXJE 2EKKA 4M0WA 4XBOA 2R4JA 5KPTA 3V76A 3T1YM 2D7GA 1IBLM 2KXEA 5EXTA 4DV7M 1OIZA 3FTDA 4Y28F 2UXDM 1E9RA 4G6ZA 2VQEM 4YY3M 1Z5CA 4DR3M 3CTWB 2QNJA 4ANRA 1PJJA 4W5WA 4S12A 1R7RA 1HNXM 2DAMA 3HJQA 3C3DA 4JI3M 2FH0A 3L28A 4DR5M 2R44A 1SXJC 4QOZC 5GKNA 2DI0A 4FCVA 1NV8A 3LQRA 3SYLA 3U6PA 4LF7M 2DWZB 1VDDA 4F1IA 1IXSA 1IN5A 2LWXA 1J09A 3F92A 2XGNA 3B7ZA 3GLIA 2FS1A 1QANA 3THGA 2HAKA 2N35A 1T3TA 1NJFA 1TGUA 2R4EA 1TH4A 4F2LA 1G4AE 1IY0A 2LTUA 4CHTB 2JA2A 2K0BX 3LVVA 3GRRA 5FTLA 2LVNC 3HHXA 5LMUM 4G4OA 2LVOC 3LVWA 1ORYB 5FTNA 2C99A 2Z3XA 3W0FA 2MJ5B 3HJ8A 4WURA 2C98A 2K47A 2DWLA 3U6EA 4KHPM 4IBBA 3J27B 3HKPA 1FJGM 2H1RA 1IN4A 4FVMA 4JI5M 4GKJM 1W5SA 1TH2A 1G8PA 2RRUA 1YUBA 4FWDA 3U6LA 4LF6M 1L8QA 3B7NA 1TTEA 1OKSA 3U6MA 1NJGA 4OU7A 5FTMA 4JI8M 2DWMA 3FRHA 4A3VB 3FTCA 1WHCA 2L7HA 4B3SM 2DNAA 5EXPA 5BPVA 3PNVA 4DR2M 2Y21A 4KT0F 1NHGC 5ITUA 2D7HA 2VIIA 1PJSA 1V34A 2F5QA 1LV7A 1AIPC 2APLA 1YE9A 2D7EA 4RNAA 2O25A 3SFZA 3SHFA 4XGIA 4I81A 2OOBA 2ZBKB 4HLQA 2VF7A 4BLCA 1DGGA 4PD2A 2F5SA 4JI0M 4AG5A 4Z8XA 3KSXA 1JR3E 5LMNM 1IN6A 1VEJA 4HEOA 1NNUC 5F3WA 2CHVA 4IIWA 2XSZD 1XXHB 1N36M 2EJSA 4L78A 4OVZA 1N33M 1TR8A 1PJTA 1PRBA 4MGIE 5DFLA 3E46A 4AZFA 2ZAOA 3GQ3A 3AOGA 1QQWA 4FW9A 2L2DA 1IBMM 2FE8A 3J7AS 5H37D 4LZZA 3FTEA 4K0KM 3B7QA 2DAIA 1GL6A 2DAGA 4MB7A 2XF3A 4CJ6A 4G4QA 1Q3CA 2L4FA 2X4AA 5E26A 1D0LA 1NSFA 2OOAA 2QCUA 1OAOC 3GPUA 1HQYE 1HR0M 1DGBA 2I7PA 2KHHA 4LJAA 1YLAA 3KW6A 1JB0F 4QNRA 1ZMUA 3Q8GA 2HWJA 3AOEC 4LJ6A 4IBJA 3J7BA 3JAMS 1SXJB 1XC8A 2L4EA 4DR6M 3DFZA 5DNYA 4NXNM 3KS4A 1I94M 4AKGA 1IFYA 2JY7A 3KOWE 3HHWA 3KP0E 4AW4A 2Q2EB 3GLIE 3C58A 3SAVA 3I4VA 1DGHB 1Z6TA 3GPPA 4I8OA 4DV4M 1D0KA 2MROB 2VDBB 3H4JA 3ZH9B 2DVWB 2B3TA 3L2AA 3LW5F 4GITA 2EUCA 2QZ4A 3U5ZB 3C3EA 3R8FA 4GKKM 1PM5A 1DO2A 1HNWM 4LFCM 3K1JA 4IBDA 3W67A 2QSFX 2DHYA 1QUSA 1QDRA 1QUTA 1NY6A 3RE8A 2CEAA 2KNAA 4GH9A 3U6CA 3SC3A 4KLNA 3PNYA 3GLGE 4DV3M 1Y8GA 4L8RC 2UXBM 1T43A 3I51A 3K2LA 2VF8A 4IBGA 2R62A 3HZJA 4NC6A 3VK7A 3KDSE 4L15A 4I5SA 2E5LM 3UGJA 1WIVA 4GIPA 3BOSA 1IN8A 3DZDA 4LRSA 5DYGA 4REZA 4X65M
chains in the Genus database with same CATH topology
3K9OA 2CP8A 2CWBA 2LVNC 4DBGB 2LVOC 3FE3A 2MJ5B 2JY6B 1OQYA 1SG9A 1HT2E 2KNZA 2LBCA 1G3IA 1VQ1A 2H5XA 2RRUA 2JNHA 2G3QA 4G3OA 2R0IA 1T6OA 1TTEA 1OKSA 4WP2A 2BWEA 3IHPA 3MMPA 1C7YA 4UN2B 3FRHA 1WGNA 1QZEA 1WHCA 3T6PA 2DNAA 1OAIA 1R4GA 2JY8A 2WZJA 1IM2A 2MR9A 1KYIA 2DZLA 4GEWA 1F4IA 1HJPA 1ZMWA 2EKFA 1AIPC 1ZV1A 1Q02A 2O25A 1P3QQ 3LCUA 2JUJA 2OOBA 3FRIA 1V92A 1BVSA 1JR3E 1A5TA 1XB2B 1VEJA 4HEOA 1VEKA 1EFUB 1XXHE 1WR1B 2ZTDA 1ZMVA 2LVPC 2LVAA 2EJSA 3GLHE 1TR8A 3BBZA 2OO9A 1VG5A 3E46A 5DFLA 3GLFE 1DV0A 1WGLA 1HT1E 2L2DA 1GO5A 3E21A 1UFZA 2DAIA 2DAGA 1MN3A 2DENA 2L4FA 2K9DA 2OOAA 2QHOB 2KNVA 1HQYE 2KHHA 1VDLA 1YLAA 2DAKA 1PGYA 1ZMUA 2EKKA 2HWJA 2L4EA 1IFYA 2JY7A 4Q7JA 3GLIE 4R71A 2BWBA 2QNJA 2MGWA 3LCVB 3B89A 2DAMA 2JZ0A 2JZ1A 2MROB 3H4JA 2B3TA 2DI0A 3K9PA 1NV8A 1DO2A 1NV9A 1G41A 2QSFX 2DHYA 2LVQD 1OTRA 2JY5A 4F1IA 1IXSA 2KNAA 3IECA 3F92A 1CUKA 1E94E 1VEGA 3GLGE 1Y8GA 2HAKA 1T43A 1DO0A 2DAEA 2JP7A 4F2LA 1G4AE 5JI2E 1WIVA 1WJ7A 2DKLA 2LTUA 2ZTCA 2K0BX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9O A;  2CP8 A;  2CWB A;  2LVN C;  4DBG B;  2LVO C;  3FE3 A;  2MJ5 B;  2JY6 B;  1OQY A;  1SG9 A;  1HT2 E;  2KNZ A;  2LBC A;  1G3I A;  1VQ1 A;  2H5X A;  2RRU A;  2JNH A;  2G3Q A;  4G3O A;  2R0I A;  1T6O A;  1TTE A;  1OKS A;  4WP2 A;  2BWE A;  3IHP A;  3MMP A;  1C7Y A;  4UN2 B;  3FRH A;  1WGN A;  1QZE A;  1WHC A;  3T6P A;  2DNA A;  1OAI A;  1R4G A;  2JY8 A;  2WZJ A;  1IM2 A;  2MR9 A;  1KYI A;  2DZL A;  4GEW A;  1F4I A;  1HJP A;  1ZMW A;  2EKF A;  1AIP C;  1ZV1 A;  1Q02 A;  2O25 A;  1P3Q Q;  3LCU A;  2JUJ A;  2OOB A;  3FRI A;  1V92 A;  1BVS A;  1JR3 E;  1A5T A;  1XB2 B;  1VEJ A;  4HEO A;  1VEK A;  1EFU B;  1XXH E;  1WR1 B;  2ZTD A;  1ZMV A;  2LVP C;  2LVA A;  2EJS A;  3GLH E;  1TR8 A;  3BBZ A;  2OO9 A;  1VG5 A;  3E46 A;  5DFL A;  3GLF E;  1DV0 A;  1WGL A;  1HT1 E;  2L2D A;  1GO5 A;  3E21 A;  1UFZ A;  2DAI A;  2DAG A;  1MN3 A;  2DEN A;  2L4F A;  2K9D A;  2OOA A;  2QHO B;  2KNV A;  1HQY E;  2KHH A;  1VDL A;  1YLA A;  2DAK A;  1PGY A;  1ZMU A;  2EKK A;  2HWJ A;  2L4E A;  1IFY A;  2JY7 A;  4Q7J A;  3GLI E;  4R71 A;  2BWB A;  2QNJ A;  2MGW A;  3LCV B;  3B89 A;  2DAM A;  2JZ0 A;  2JZ1 A;  2MRO B;  3H4J A;  2B3T A;  2DI0 A;  3K9P A;  1NV8 A;  1DO2 A;  1NV9 A;  1G41 A;  2QSF X;  2DHY A;  2LVQ D;  1OTR A;  2JY5 A;  4F1I A;  1IXS A;  2KNA A;  3IEC A;  3F92 A;  1CUK A;  1E94 E;  1VEG A;  3GLG E;  1Y8G A;  2HAK A;  1T43 A;  1DO0 A;  2DAE A;  2JP7 A;  4F2L A;  1G4A E;  5JI2 E;  1WIV A;  1WJ7 A;  2DKL A;  2LTU A;  2ZTC A;  2K0B X; 
#chains in the Genus database with same CATH topology
 4YHH M;  3DA1 A;  2J5Y A;  4B7H A;  2CP8 A;  3FD9 A;  4MH0 E;  1IXZ A;  5FTK A;  4DBG B;  4B3M M;  1X37 A;  2YQZ A;  2Z4S A;  5EP4 A;  3D8B A;  3SMS A;  3I4Y A;  2R46 A;  3FE3 A;  3WHK A;  4BB9 A;  1R6B X;  4ITQ A;  3UK6 A;  1OQY A;  5IRE B;  1XWI A;  4MGH A;  1HT2 E;  4I4L A;  4P16 A;  4JN6 A;  1VQ1 A;  2XFT A;  3QYE A;  4B7G A;  2YNM D;  2H5X A;  2CV2 A;  4AKI A;  2KRK A;  4CIZ A;  2Z8Y M;  3MHV C;  2XLJ A;  3GPY A;  4LRT A;  2JNH A;  4AQY M;  1K3W A;  3UZU A;  4IJF A;  2R0I A;  4D82 A;  2QBY A;  1Z59 A;  3E4R A;  4WP2 A;  3U61 B;  5IWA M;  4JI4 M;  3JR5 A;  3M0E A;  4AG6 A;  2X8A A;  5FLX S;  3SBJ A;  4EIW A;  4JI1 M;  1QZE A;  3AJI B;  4IBC A;  3FUW A;  3A46 A;  3GPX A;  1L2B A;  4GHL A;  2XFS A;  1G71 A;  3SAR A;  4LJ9 A;  4LCB A;  4CGY B;  2JY8 A;  4M0D A;  1IM2 A;  3U6S A;  2V1U A;  1ZQ9 A;  1HJP A;  3TPZ A;  1F4I A;  2EKF A;  4NSO B;  2ZM6 M;  3FUX A;  1SXJ D;  2F5P A;  4CIS A;  2UUC M;  2C9C A;  3LCU A;  4LJ7 A;  2Y20 A;  1BVS A;  4NRV A;  1Z5B A;  1MJG M;  3HHZ A;  4QHT A;  4NOO B;  1D2N A;  1YSY A;  2L7I A;  4KOD A;  2J7O A;  1EFU B;  4GHA A;  2WSF F;  3ZC7 B;  1WR1 B;  3KFU G;  1IY1 A;  1ZMV A;  4FD2 A;  2VQF M;  2LVA A;  4LGM A;  3FUU A;  3HY5 A;  3GQ5 A;  3FYC A;  1L1T A;  2KDL A;  2FNA A;  1L1Z A;  4PCZ A;  1DV0 A;  1WGL A;  3SAS A;  1J7K A;  4NXM M;  4AKH A;  2C5R A;  2WSE F;  1MN3 A;  4X62 M;  2RKO A;  2DEN A;  4GRI A;  2XEP A;  1IY2 A;  2KNV A;  1I4W A;  1WXQ A;  1GJT A;  4GC5 A;  3ZQJ A;  3EIE A;  3J2P B;  2CFO A;  1GL7 A;  2BJV A;  4M9X A;  2QPA A;  3SAW A;  4PDG A;  4R3D A;  3TE6 A;  2C96 A;  3PXG A;  1PJQ A;  2R18 A;  1L2C A;  1V33 A;  3RGS A;  5ITQ A;  3GLH A;  2F5O A;  4Q7J A;  3R9X B;  1IXS B;  2F5N A;  2CRU A;  2X49 A;  3GLF A;  2A5Y B;  2GQF A;  3D8L A;  1PJI A;  3L29 A;  3U6O A;  2M5Z A;  2UUB M;  3GLI B;  3FTF A;  1D0M A;  1R2Z A;  3B89 A;  4OX9 M;  2JWS A;  2JZ0 A;  4JXJ A;  3L27 A;  3K92 A;  3LMM A;  5ITR A;  2DHR A;  3KVW A;  5EP1 A;  4D80 A;  1IQP A;  4LJ4 A;  3K9P A;  2V6Z M;  4IBF A;  4DV2 M;  2UUA M;  1G41 A;  2J7N A;  2OPF A;  2KW0 A;  3OTO M;  2LVQ D;  1OTR A;  3HU2 A;  5EP2 A;  1QZM A;  2QQ8 A;  3A42 A;  4P17 A;  4IBI A;  1E94 E;  5C18 A;  4MGZ E;  2JXN A;  1W5T A;  3M7G A;  4MM3 B;  3SMP A;  5ITX A;  1DO0 A;  2DAE A;  2XSZ A;  4L16 A;  4LJ5 A;  1Q39 A;  3GLG B;  3J80 S;  1IXR C;  3GO8 A;  2MH8 A;  3U60 B;  4RKU F;  1KSF X;  2CWB A;  4FWH A;  5C1B A;  2ZAN A;  2JY6 B;  2Z4R A;  4ZPX A;  3MJ5 A;  1XMO M;  1SG9 A;  2DWN A;  1Z5A A;  2EO2 A;  4NSR A;  1GJS A;  2KNZ A;  1JQJ C;  2ERC A;  3BXW A;  1JR3 D;  2CE7 A;  2LBC A;  3U61 A;  3IG8 A;  2CV0 A;  1UM8 A;  2P5T A;  4XK8 F;  2LH0 A;  2LHG A;  2GNO A;  4Z6Y A;  3FUT A;  3TL4 X;  2Y0Q A;  4DUZ M;  3HU1 A;  1GKI A;  2BWE A;  3IHP A;  3HJS A;  4X66 M;  4NRW A;  3CF0 A;  1IBK M;  4UN2 B;  2HKJ A;  4LGY A;  4DV5 M;  1H6U A;  1TF0 B;  3T6P A;  1QDT A;  1R5L A;  3VKH A;  3VDU A;  3SYK A;  4OVZ B;  3KP1 E;  4II7 A;  1OAI A;  1MU5 A;  1R4G A;  1TDH A;  2M60 A;  2MR9 A;  2WZJ A;  1KYI A;  1MX0 A;  3RFW A;  3AL0 C;  4MGK E;  5DYI A;  4IJE A;  3TWL A;  3NBI A;  2LHC A;  4LF4 M;  1ZV1 A;  3I04 M;  1J5E M;  5BR8 M;  1XNQ M;  1XHB A;  1P3Q Q;  2JUJ A;  5E6J A;  2K6B A;  4LZJ A;  3JR4 A;  4GMQ A;  3TWK A;  3T15 A;  3QYB A;  1KFV A;  3AOE A;  3KSJ A;  2RGO A;  3DOA A;  1L2D A;  3UMM A;  4B08 A;  2LVP C;  3KOZ E;  2R65 A;  3FKE A;  3TWM A;  4LFA M;  3GLH E;  1NVM A;  1NHW C;  3QWL A;  2YFQ A;  3BBZ A;  3NBX X;  3HHY A;  4PDI A;  2O5R A;  3VLF B;  3GLF E;  1G59 A;  4LG2 A;  4QOS A;  4NL4 H;  4OW0 A;  1UFZ A;  2XZF A;  3KOY E;  4DV1 M;  4JI7 M;  2F4V M;  2K9D A;  3H4M A;  4M9Z A;  2YR0 A;  3PVS A;  2QHO B;  2DXI A;  4DR1 M;  4LJ8 A;  3EIH A;  2RGH A;  3QAU A;  2NQ8 C;  3CF6 E;  1EIJ A;  2G8L A;  3GP1 A;  5EXS A;  1OFI A;  3GQ4 A;  4RF0 A;  3ZCB B;  1XXH A;  4PT5 A;  3L26 A;  1E32 A;  4TUW A;  3I01 M;  1Q3B A;  2AHM A;  3W0L B;  2HL7 A;  3IG5 A;  1HQC A;  2DZO B;  4R71 A;  2BWB A;  4X64 M;  2CHG A;  5JI3 E;  3U6Q A;  5ITX E;  4L6V 6;  1ZAE A;  2MGW A;  3LCV B;  1XNR M;  4HL4 A;  5A2Q S;  3KXE C;  2JZ1 A;  4KO8 A;  2G5G X;  4LY6 A;  1N77 A;  2XZU A;  1IN7 A;  3T38 A;  1K3X A;  2L6O A;  5ITY A;  5FTJ A;  3W68 A;  4AI6 A;  1OJL A;  3C9P A;  3GRU A;  3U6D A;  1NY5 A;  2WSC F;  5IZ7 D;  3SHG B;  3KS8 A;  1NV9 A;  1SXJ A;  3NWL A;  3AKZ A;  2FFJ A;  2UXC M;  4L4U A;  2R6F A;  1NO1 A;  2JY5 A;  5KPR A;  5EQT A;  2LNH C;  3GLG A;  2BNK A;  3HGI A;  3IEC A;  1CUK A;  1DGH A;  2KZS A;  3A98 B;  5ITT A;  3Q8X A;  1K82 A;  1S3S A;  2CV1 A;  1VEG A;  3U60 A;  1XMQ M;  3L25 A;  4WW0 A;  4QNM A;  3HX3 A;  4G4N A;  3GRY A;  3AFH A;  1QAO A;  2JP7 A;  4B7F A;  4B3T M;  3VFD A;  5JI2 E;  1WJ7 A;  2ZTC A;  1DGF A;  2DKL A;  4IBK A;  3U5Z A;  2QBY B;  1N32 M;  4IBE A;  5L8R F;  1LTM A;  3WHL A;  4DV0 M;  5KQD A;  3K9O A;  4G4R A;  3GRV A;  1GAB A;  3HU3 A;  5IT9 S;  4FWG A;  2OQ4 A;  2XH9 A;  3CGW A;  4JI6 M;  2CHQ A;  3HWS A;  4DR4 M;  2W82 A;  2FOI C;  2L09 A;  3VDP A;  3B74 A;  3PFI A;  1G3I A;  4R7G A;  1N78 A;  3FUV A;  3T1H M;  3A45 A;  4QHS A;  5EP3 A;  3B9P A;  4LFB M;  4B3R M;  2G3Q A;  4G3O A;  1NNJ A;  5KPZ A;  1T6O A;  5FSW A;  3J81 S;  4GC9 A;  4RF1 A;  3MMP A;  4M9S A;  1C7Y A;  2I7N A;  3VKG A;  1C1K A;  1QVR A;  3TQS A;  1WGN A;  3UJN A;  1AUA A;  3VK8 A;  2KRU A;  3RGP A;  3SAT A;  2HCB A;  5KQ8 A;  2QEN A;  1N75 A;  1QAQ A;  2DZL A;  4GEW A;  1TDZ A;  2Z7J A;  1ZMW A;  2ZAM A;  1FNN A;  4MGY E;  2BJW A;  3K8Z A;  1Q02 A;  3FRI A;  1V92 A;  4LF5 M;  4D81 A;  2V1C A;  2KA6 B;  4FCW A;  1A5T A;  1XB2 B;  3SAU A;  1QYR A;  2QP9 X;  1VEK A;  8CAT A;  1TH3 A;  1XXH E;  2O01 F;  3CF2 A;  1EE8 A;  3KOX E;  1N34 M;  1OIP A;  4JV5 M;  4DV6 M;  3LQQ A;  2DZN B;  2ZTD A;  1R2Y A;  1HNZ M;  1RU3 A;  4FCT A;  2C9O A;  3E9S A;  4BBA A;  2HHH M;  3ILK A;  2UU9 M;  1QAM A;  2OO9 A;  1VG5 A;  4JI2 M;  1GVN A;  2CUZ A;  2LXE A;  4LF8 M;  5EJC A;  5KO3 A;  1HT1 E;  1E9S A;  3GLH B;  3MK6 A;  1GO5 A;  1OFH A;  3GLF B;  3FYD A;  5EXX A;  3E21 A;  3M6A A;  4DUY M;  2KZU A;  4DR7 M;  2EA0 A;  2R45 A;  4JYA M;  3AV0 A;  1GLN A;  4LF9 M;  2KEB A;  2Y0T A;  1VDL A;  7CAT A;  2DAK A;  1JR3 A;  1PGY A;  1SXJ E;  2EKK A;  4M0W A;  4XBO A;  2R4J A;  5KPT A;  3V76 A;  3T1Y M;  2D7G A;  1IBL M;  2KXE A;  5EXT A;  4DV7 M;  1OIZ A;  3FTD A;  4Y28 F;  2UXD M;  1E9R A;  4G6Z A;  2VQE M;  4YY3 M;  1Z5C A;  4DR3 M;  3CTW B;  2QNJ A;  4ANR A;  1PJJ A;  4W5W A;  4S12 A;  1R7R A;  1HNX M;  2DAM A;  3HJQ A;  3C3D A;  4JI3 M;  2FH0 A;  3L28 A;  4DR5 M;  2R44 A;  1SXJ C;  4QOZ C;  5GKN A;  2DI0 A;  4FCV A;  1NV8 A;  3LQR A;  3SYL A;  3U6P A;  4LF7 M;  2DWZ B;  1VDD A;  4F1I A;  1IXS A;  1IN5 A;  2LWX A;  1J09 A;  3F92 A;  2XGN A;  3B7Z A;  3GLI A;  2FS1 A;  1QAN A;  3THG A;  2HAK A;  2N35 A;  1T3T A;  1NJF A;  1TGU A;  2R4E A;  1TH4 A;  4F2L A;  1G4A E;  1IY0 A;  2LTU A;  4CHT B;  2JA2 A;  2K0B X;  3LVV A;  3GRR A;  5FTL A;  2LVN C;  3HHX A;  5LMU M;  4G4O A;  2LVO C;  3LVW A;  1ORY B;  5FTN A;  2C99 A;  2Z3X A;  3W0F A;  2MJ5 B;  3HJ8 A;  4WUR A;  2C98 A;  2K47 A;  2DWL A;  3U6E A;  4KHP M;  4IBB A;  3J27 B;  3HKP A;  1FJG M;  2H1R A;  1IN4 A;  4FVM A;  4JI5 M;  4GKJ M;  1W5S A;  1TH2 A;  1G8P A;  2RRU A;  1YUB A;  4FWD A;  3U6L A;  4LF6 M;  1L8Q A;  3B7N A;  1TTE A;  1OKS A;  3U6M A;  1NJG A;  4OU7 A;  5FTM A;  4JI8 M;  2DWM A;  3FRH A;  4A3V B;  3FTC A;  1WHC A;  2L7H A;  4B3S M;  2DNA A;  5EXP A;  5BPV A;  3PNV A;  4DR2 M;  2Y21 A;  4KT0 F;  1NHG C;  5ITU A;  2D7H A;  2VII A;  1PJS A;  1V34 A;  2F5Q A;  1LV7 A;  1AIP C;  2APL A;  1YE9 A;  2D7E A;  4RNA A;  2O25 A;  3SFZ A;  3SHF A;  4XGI A;  4I81 A;  2OOB A;  2ZBK B;  4HLQ A;  2VF7 A;  4BLC A;  1DGG A;  4PD2 A;  2F5S A;  4JI0 M;  4AG5 A;  4Z8X A;  3KSX A;  1JR3 E;  5LMN M;  1IN6 A;  1VEJ A;  4HEO A;  1NNU C;  5F3W A;  2CHV A;  4IIW A;  2XSZ D;  1XXH B;  1N36 M;  2EJS A;  4L78 A;  4OVZ A;  1N33 M;  1TR8 A;  1PJT A;  1PRB A;  4MGI E;  5DFL A;  3E46 A;  4AZF A;  2ZAO A;  3GQ3 A;  3AOG A;  1QQW A;  4FW9 A;  2L2D A;  1IBM M;  2FE8 A;  3J7A S;  5H37 D;  4LZZ A;  3FTE A;  4K0K M;  3B7Q A;  2DAI A;  1GL6 A;  2DAG A;  4MB7 A;  2XF3 A;  4CJ6 A;  4G4Q A;  1Q3C A;  2L4F A;  2X4A A;  5E26 A;  1D0L A;  1NSF A;  2OOA A;  2QCU A;  1OAO C;  3GPU A;  1HQY E;  1HR0 M;  1DGB A;  2I7P A;  2KHH A;  4LJA A;  1YLA A;  3KW6 A;  1JB0 F;  4QNR A;  1ZMU A;  3Q8G A;  2HWJ A;  3AOE C;  4LJ6 A;  4IBJ A;  3J7B A;  3JAM S;  1SXJ B;  1XC8 A;  2L4E A;  4DR6 M;  3DFZ A;  5DNY A;  4NXN M;  3KS4 A;  1I94 M;  4AKG A;  1IFY A;  2JY7 A;  3KOW E;  3HHW A;  3KP0 E;  4AW4 A;  2Q2E B;  3GLI E;  3C58 A;  3SAV A;  3I4V A;  1DGH B;  1Z6T A;  3GPP A;  4I8O A;  4DV4 M;  1D0K A;  2MRO B;  2VDB B;  3H4J A;  3ZH9 B;  2DVW B;  2B3T A;  3L2A A;  3LW5 F;  4GIT A;  2EUC A;  2QZ4 A;  3U5Z B;  3C3E A;  3R8F A;  4GKK M;  1PM5 A;  1DO2 A;  1HNW M;  4LFC M;  3K1J A;  4IBD A;  3W67 A;  2QSF X;  2DHY A;  1QUS A;  1QDR A;  1QUT A;  1NY6 A;  3RE8 A;  2CEA A;  2KNA A;  4GH9 A;  3U6C A;  3SC3 A;  4KLN A;  3PNY A;  3GLG E;  4DV3 M;  1Y8G A;  4L8R C;  2UXB M;  1T43 A;  3I51 A;  3K2L A;  2VF8 A;  4IBG A;  2R62 A;  3HZJ A;  4NC6 A;  3VK7 A;  3KDS E;  4L15 A;  4I5S A;  2E5L M;  3UGJ A;  1WIV A;  4GIP A;  3BOS A;  1IN8 A;  3DZD A;  4LRS A;  5DYG A;  4REZ A;  4X65 M; 
#chains in the Genus database with same CATH homology
 3K9O A;  2CP8 A;  2CWB A;  2LVN C;  4DBG B;  2LVO C;  3FE3 A;  2MJ5 B;  2JY6 B;  1OQY A;  1SG9 A;  1HT2 E;  2KNZ A;  2LBC A;  1G3I A;  1VQ1 A;  2H5X A;  2RRU A;  2JNH A;  2G3Q A;  4G3O A;  2R0I A;  1T6O A;  1TTE A;  1OKS A;  4WP2 A;  2BWE A;  3IHP A;  3MMP A;  1C7Y A;  4UN2 B;  3FRH A;  1WGN A;  1QZE A;  1WHC A;  3T6P A;  2DNA A;  1OAI A;  1R4G A;  2JY8 A;  2WZJ A;  1IM2 A;  2MR9 A;  1KYI A;  2DZL A;  4GEW A;  1F4I A;  1HJP A;  1ZMW A;  2EKF A;  1AIP C;  1ZV1 A;  1Q02 A;  2O25 A;  1P3Q Q;  3LCU A;  2JUJ A;  2OOB A;  3FRI A;  1V92 A;  1BVS A;  1JR3 E;  1A5T A;  1XB2 B;  1VEJ A;  4HEO A;  1VEK A;  1EFU B;  1XXH E;  1WR1 B;  2ZTD A;  1ZMV A;  2LVP C;  2LVA A;  2EJS A;  3GLH E;  1TR8 A;  3BBZ A;  2OO9 A;  1VG5 A;  3E46 A;  5DFL A;  3GLF E;  1DV0 A;  1WGL A;  1HT1 E;  2L2D A;  1GO5 A;  3E21 A;  1UFZ A;  2DAI A;  2DAG A;  1MN3 A;  2DEN A;  2L4F A;  2K9D A;  2OOA A;  2QHO B;  2KNV A;  1HQY E;  2KHH A;  1VDL A;  1YLA A;  2DAK A;  1PGY A;  1ZMU A;  2EKK A;  2HWJ A;  2L4E A;  1IFY A;  2JY7 A;  4Q7J A;  3GLI E;  4R71 A;  2BWB A;  2QNJ A;  2MGW A;  3LCV B;  3B89 A;  2DAM A;  2JZ0 A;  2JZ1 A;  2MRO B;  3H4J A;  2B3T A;  2DI0 A;  3K9P A;  1NV8 A;  1DO2 A;  1NV9 A;  1G41 A;  2QSF X;  2DHY A;  2LVQ D;  1OTR A;  2JY5 A;  4F1I A;  1IXS A;  2KNA A;  3IEC A;  3F92 A;  1CUK A;  1E94 E;  1VEG A;  3GLG E;  1Y8G A;  2HAK A;  1T43 A;  1DO0 A;  2DAE A;  2JP7 A;  4F2L A;  1G4A E;  5JI2 E;  1WIV A;  1WJ7 A;  2DKL A;  2LTU A;  2ZTC A;  2K0B X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...