1VEJA

Solution structure of rsgi ruh-016, a uba domain from mouse cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
GSSGSSGARACSQSSQTALPTSLFTEGRYQQELEELKALGFANRDANLQALVATDGDIHAAIEMLLGASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords RIKEN cDNA 4931431F19
publication title Solution Structure of RSGI RUH-016, a UBA Domain from mouse cDNA
rcsb
source organism Mus musculus
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vejA00
3LCUA 2DAEA 2RRUA 1VG5A 1KYIA 2HWJA 1WGNA 2JP7A 5DFLA 1YLAA 2BWBA 2EKFA 3T6PA 1OAIA 2DENA 1ZMWA 3E21A 3H4JA 3IHPA 2H5XA 3K9OA 1G41A 1HQYE 2L4EA 2K9DA 3FRIA 2EJSA 2MJ5B 2DAIA 2JZ1A 2LVPC 1HT1E 1OQYA 1P3QQ 1TR8A 1ZMVA 1MN3A 1G3IA 1JR3E 2LBCA 2CP8A 2DKLA 1DV0A 3MMPA 2CWBA 4G3OA 1VEJA 2B3TA 1WHCA 2DI0A 1TTEA 3F92A 3GLGE 5JI2E 2L2DA 1G4AE 2LTUA 1C7YA 1WJ7A 2JY7A 1A5TA 1T43A 4HEOA 3E46A 1PGYA 2LVOC 1WGLA 4DBGB 4UN2B 1NV9A 2HAKA 4Q7JA 4F2LA 1DO0A 2O25A 2LVAA 1ZMUA 2L4FA 2MGWA 2MR9A 2OOBA 1CUKA 1QZEA 1T6OA 1VEKA 1HJPA 2R0IA 2LVQD 2QSFX 3GLFE 1NV8A 3B89A 3K9PA 2ZTCA 1IXSA 1VEGA 4GEWA 2KNVA 2EKKA 2DHYA 4WP2A 3GLHE 1E94E 2K0BX 2DZLA 1R4GA 2KNAA 3LCVB 1HT2E 3GLIE 3IECA 1OKSA 2WZJA 1Y8GA 1EFUB 2JUJA 2LVNC 1IM2A 2DAKA 2DAMA 1XB2B 1VDLA 2G3QA 1Q02A 3FRHA 1AIPC 1XXHE 1ZV1A 2JY5A 1GO5A 1DO2A 2OOAA 1UFZA 1F4IA 3FE3A 2BWEA 1VQ1A 1WR1B 1IFYA 2JY8A 2JY6B 4F1IA 2QHOB 3BBZA 1WIVA 2DNAA 1BVSA 2KNZA 2OO9A 1OTRA 2JZ0A 2JNHA 4R71A 2MROB 1SG9A 2ZTDA 2KHHA 2QNJA 1V92A 2DAGA
chains in the Genus database with same CATH superfamily
4IBFA 3LMMA 3Q8XA 4HLQA 4QHSA 3C58A 4LJAA 3FTEA 1V33A 4AKGA 1R5LA 1VG5A 2ZAMA 3QYEA 4DV4M 1LV7A 3L29A 4XGIA 5KPRA 3A46A 1WGNA 2G8LA 3GLGA 4KLNA 3UMMA 2X8AA 4DV6M 3KS4A 4HL4A 2CRUA 2EKFA 3C3DA 3SAWA 3E9SA 3RE8A 3AOGA 3E21A 1QZMA 4AKIA 2Y20A 3CTWB 3GRVA 3GRUA 4OVZA 2CHVA 1DGFA 2L4EA 4MH0E 1Z59A 4FWDA 3AL0C 2V1CA 5EP4A 3SATA 3HY5A 4LJ9A 3JAMS 5H37D 3U6CA 2R4EA 1OQYA 4DV1M 2Y0QA 2HL7A 3HU3A 4LZJA 3L2AA 1E9RA 1JR3A 2LBCA 3SAUA 1IY1A 4KO8A 3SBJA 3W0FA 4NRVA 5IWAM 1DGGA 4B7HA 2QQ8A 3C9PA 2DI0A 1NJFA 1WHCA 1TTEA 3F92A 3GLGE 2A5YB 2O01F 1ZQ9A 5JI2E 4Y28F 2CV0A 4OX9M 2LTUA 2CUZA 5FSWA 4WW0A 5BPVA 3PFIA 1GL7A 2KA6B 3GLGB 3MJ5A 3GLIA 1I4WA 4CHTB 1SXJA 3E46A 4GIPA 4LFAM 4L4UA 4LF8M 2LVOC 3U60A 1OFIA 5FTLA 1NV9A 2L7HA 3AJIB 2EO2A 3EIHA 1IY2A 2O25A 3U6SA 1E9SA 1NY5A 2KRKA 1ZMUA 3K8ZA 3QWLA 1PJJA 2OOBA 1RU3A 1QZEA 1VEKA 4R3DA 1Q3BA 1WXQA 2R0IA 3J7BA 2DZNB 4GITA 1NV8A 4AKHA 2LNHC 3LW5F 4OW0A 2C9CA 2AHMA 2RGOA 3UJNA 4IBCA 4AW4A 2L09A 1GLNA 2KNVA 1L1ZA 3C3EA 3NWLA 1E94E 2UUAM 1IXRC 3KW6A 1Z5CA 4JI3M 2DZOB 5ITYA 3BXWA 1IXSB 2KNAA 3LCVB 3GLIE 5ITXE 2K6BA 1SXJE 4L16A 3ZQJA 1IN6A 1Y8GA 3U6QA 1GVNA 3UK6A 1XB2B 2XEPA 3DOAA 1Q02A 4G4OA 4M0DA 1SXJD 2I7NA 2YFQA 5DYIA 4S12A 3I51A 3GLIB 3QYBA 4MM3B 1FJGM 1SXJB 5C1BA 1GO5A 1UFZA 3U6EA 2J7NA 1MX0A 3I4VA 1IN5A 3KVWA 4QNMA 4IBEA 3U6PA 2QENA 1N32M 2FOIC 1K3XA 4KT0F 5DYGA 3FYCA 4FWGA 4X65M 4DR1M 3DFZA 2H1RA 3KFUG 4DR6M 2KXEA 4BBAA 2JZ0A 4JI1M 1ORYB 5GKNA 3IG8A 1SG9A 2DWMA 2KHHA 4B3SM 4FVMA 2QZ4A 4LGYA 5KPZA 4QHTA 2LWXA 1GJTA 4MGZE 4YHHM 4RKUF 4JI6M 1OIZA 4IBGA 4IBIA 2RRUA 3TWLA 1R7RA 4L6V6 4REZA 3HHYA 1PM5A 1QANA 3I01M 4WURA 5IT9S 4NRWA 1GJSA 4K0KM 2XZFA 2BWBA 1L2BA 3IG5A 2FFJA 3T6PA 2ZANA 4GC9A 3TL4X 4B7GA 3K92A 3H4JA 4IBDA 2D7HA 2FH0A 2R65A 4XBOA 3ZC7B 5EXTA 1LTMA 4NOOB 4ANRA 3KP1E 3D8BA 2XLJA 1NHGC 1L8QA 2MJ5B 2R6FA 3PVSA 2LVPC 4FCWA 3B7ZA 1T3TA 2ZBKB 4YY3M 1P3QQ 3FYDA 2XF3A 3DA1A 2DWZB 3LQRA 1MN3A 1G3IA 3K2LA 2Y0TA 1HNZM 2DHRA 3KOZE 4D82A 3U61B 2DKLA 3BOSA 1DV0A 2CWBA 2C9OA 2ZAOA 4CISA 4TUWA 3KP0E 1IY0A 4G4RA 4LF9M 3GPYA 2HCBA 4RNAA 3E4RA 3L28A 1DGBA 1OAOC 3A98B 5EXSA 1NSFA 3OTOM 3GO8A 3SAVA 1WJ7A 4GMQA 2VQFM 1A5TA 3U6MA 3NBIA 3T38A 4PDIA 3TQSA 5LMNM 1NNJA 1PGYA 1QDTA 1QDRA 5C18A 4RF1A 5DNYA 4G6ZA 4X62M 4UN2B 2R18A 2HAKA 3JR5A 2CV1A 1DO0A 1NVMA 1XWIA 1IXZA 3GPPA 3FUUA 4DUZM 2L4FA 1IQPA 2MGWA 2MR9A 1CUKA 2KEBA 1T6OA 1IBMM 5E26A 4DR5M 4FWHA 2YNMD 2LVQD 2J5YA 1NHWC 1I94M 3FUXA 3VDPA 5EP1A 4JI5M 2ZM6M 1IXSA 1JB0F 3HHWA 4DR7M 4GEWA 1N34M 4RF0A 2EKKA 4AI6A 4I4LA 4JI0M 3U5ZB 1TF0B 2Z8YM 2QPAA 2V1UA 2E5LM 5KO3A 3ILKA 2CEAA 2BNKA 2EUCA 3SYKA 3AKZA 5EP3A 5ITXA 1OKSA 1G59A 3B9PA 2WZJA 3SHFA 8CATA 2F5QA 3V76A 2LVNC 3GRRA 1IBLM 2N35A 4MGHA 4DR2M 2G3QA 2V6ZM 1XXHE 4GH9A 4D81A 2UXDM 4A3VB 1DO2A 1OJLA 1TH4A 2OOAA 3HZJA 5L8RF 3FE3A 1PRBA 3I04M 1VQ1A 1WR1B 4LJ7A 4L78A 1FNNA 1HQCA 1XXHB 4LZZA 4NXNM 4DV5M 4CGYB 4MGKE 2WSCF 3SMSA 1IN7A 3CF2A 2CHQA 4P16A 2XH9A 3GRYA 5EP2A 1R2YA 1PJQA 3SMPA 3SARA 4DR4M 3HGIA 3KOXE 4LF5M 4GHAA 2DAGA 3KXEC 4PD2A 4NC6A 3T15A 3LCUA 2QBYB 2DAEA 4JI7M 2KZUA 3M6AA 1GABA 4W5WA 1E32A 1KYIA 1OFHA 1QVRA 4LFCM 4JI4M 4EIWA 4OU7A 2Z7JA 3W0LB 1V34A 1C1KA 5IZ7D 3HJQA 1N36M 2QP9X 4JI2M 1D0MA 2K47A 3U6DA 3KSXA 4JYAM 4LY6A 1OAIA 2DENA 2OQ4A 1H6UA 1ZMWA 4P17A 1L2DA 2L7IA 2KZSA 3IHPA 1GKIA 4LG2A 3CGWA 3CF0A 3K9OA 5FTJA 2EA0A 3VK8A 1G41A 1HQYE 5FTMA 1L2CA 2DWLA 1TGUA 2K9DA 4G4QA 2LHCA 2M5ZA 3PXGA 3KDSE 3U61A 2XGNA 5F3WA 1HT1E 3W67A 1R2ZA 5FLXS 1PJIA 2LXEA 3ZCBB 1VDDA 3AOEC 3HHZA 2F5PA 4LF6M 4BLCA 1Z5BA 2GQFA 2F5SA 4QNRA 5A2QS 3WHLA 3RFWA 4FCVA 2R46A 2JA2A 4G3OA 1VEJA 1W5TA 4KODA 4MB7A 3L25A 3QAUA 1QAMA 2G5GX 1NO1A 1UM8A 3J2PB 2F5OA 1XHBA 3A45A 2BJWA 2L2DA 1G4AE 4Z6YA 1C7YA 3NBXX 2W82A 3I4YA 3KOYE 2KDLA 3SASA 2UXBM 1T43A 3FTCA 4B7FA 1XNQM 1IN4A 1JQJC 1EIJA 1XNRM 3PNYA 4DBGB 2JXNA 4LCBA 3FKEA 4JI8M 2LVAA 4LRTA 4PDGA 4D80A 2Q2EB 1PJSA 3TWMA 2ERCA 1D0KA 1HJPA 1S3SA 5FTNA 3GP1A 1IN8A 2XFTA 3U5ZA 1TDHA 3MHVC 3GLFE 2CE7A 4LJ6A 1DGHA 4IBKA 3SYLA 3A42A 3HJ8A 1VEGA 3PNVA 3SHGB 2DHYA 4GKKM 4AG6A 1N78A 4BB9A 1XC8A 4B3TM 3FTFA 3GLFB 2WSEF 1D0LA 3RGPA 2DZLA 2DXIA 4II7A 4DV7M 4M9XA 4NXMM 1EE8A 3KOWE 3KSJA 4IJFA 4DV3M 1Q3CA 3IECA 3W68A 2F4VM 2DWNA 1KSFX 4QOSA 3AOEA 1Z5AA 4MGIE 2XSZD 1IM2A 2DAMA 3TPZA 2R44A 1VDLA 1AUAA 2C99A 4M9SA 1AIPC 3TE6A 1XXHA 2JY5A 3J27B 3L26A 4LF7M 1X37A 1KFVA 1F4IA 3UZUA 1D2NA 4JXJA 2I7PA 4CJ6A 3DZDA 4LJ4A 1PJTA 1TH3A 2NQ8C 3FUTA 2XZUA 2JY6B 3HWSA 4F1IA 1YE9A 3BBZA 3AV0A 3VFDA 2R4JA 1WIVA 2DVWB 2QBYA 1BVSA 3LQQA 3H4MA 1GL6A 1QUTA 4NSOB 1OTRA 1DGHB 4R71A 1TDZA 4GKJM 1G71A 4LGMA 7CATA 2FS1A 2MROB 2Z4SA 3FUVA 4DV2M 2QNJA 1V92A 2P5TA 1TH2A 2VDBB 2RGHA 4QOZC 4FD2A 4I81A 3VLFB 5BR8M 2Z3XA 3HU2A 5LMUM 2CFOA 4PT5A 2C96A 3VDUA 1NY6A 1YUBA 3R8FA 2HWJA 4ZPXA 4B3RM 4LJ5A 2MH8A 5EJCA 2JP7A 4GRIA 5DFLA 3VKGA 1YLAA 4I8OA 3SFZA 3GPXA 5JI3E 1HR0M 2D7GA 2VQEM 3B74A 1K3WA 2D7EA 2WSFF 4L15A 4JV5M 5IREB 3K1JA 2H5XA 5ITRA 4B3MM 2GNOA 4IJEA 1Q39A 4XK8F 3T1HM 1N77A 1XMOM 1NJGA 3FRIA 3R9XB 3EIEA 1G8PA 2Y21A 1N75A 2EJSA 2FNAA 2JWSA 2DAIA 2JZ1A 4LF4M 2UUCM 4OVZB 2C5RA 1W5SA 3T1YM 1TR8A 1ZMVA 2Z4RA 3CF6E 4CIZA 4ITQA 3VKHA 4B08A 3U6OA 1JR3E 5EQTA 5KQDA 3GPUA 3U6LA 2CP8A 2X4AA 5ITTA 3MMPA 4M0WA 1QYRA 1MU5A 2FE8A 3AFHA 4FCTA 4LRSA 2CV2A 1J09A 2RKOA 3MK6A 4NSRA 2B3TA 3GQ5A 1JR3D 3HHXA 3JR4A 4IBJA 4DR3M 3GLHA 5KQ8A 3LVWA 2YR0A 4GHLA 2JY7A 4HEOA 4DV0M 4L8RC 3WHKA 1ZAEA 2YQZA 4LJ8A 4R7GA 3FTDA 3L27A 1WGLA 2VIIA 5ITQA 2X49A 3J80S 2LHGA 4F2LA 4Q7JA 3HU1A 3HJSA 2O5RA 3THGA 3GQ4A 2APLA 4IBBA 4FW9A 3UGJA 3KS8A 3U60B 2CHGA 1QAOA 1MJGM 1QQWA 2VF8A 2QSFX 1L1TA 3GLFA 4KHPM 3HKPA 1N33M 3B89A 1YSYA 3K9PA 2ZTCA 4MGYE 1Z6TA 3J81S 3SC3A 4IIWA 4WP2A 3GLHE 4GC5A 1K82A 1HNXM 5FTKA 3J7AS 2K0BX 2L6OA 2R45A 4AG5A 1R4GA 2XSZA 4NL4H 3B7QA 1R6BX 1HT2E 5EXXA 1XMQM 2UU9M 3GLHB 3M0EA 5EXPA 1EFUB 2JUJA 2DAKA 3Q8GA 1QAQA 5ITUA 4AQYM 3VK7A 1NNUC 2J7OA 3FRHA 3TWKA 2KRUA 1IBKM 3GQ3A 3ZH9B 1HNWM 2C98A 2VF7A 1ZV1A 3RGSA 2BJVA 2R62A 2KW0A 4AZFA 1J5EM 2F5NA 2HHHM 4Z8XA 4JN6A 3FUWA 4DUYM 4PCZA 2HKJA 2BWEA 3HX3A 1J7KA 4G4NA 2M60A 4X64M 1IFYA 2JY8A 1OIPA 2QCUA 5E6JA 2QHOB 3LVVA 3D8LA 3B7NA 4X66M 2XFSA 2DNAA 2KNZA 3FD9A 2OO9A 2UXCM 2LH0A 5KPTA 2JNHA 2OPFA 4I5SA 3M7GA 1QUSA 2ZTDA 2UUBM 4M9ZA 4LFBM 1SXJC
chains in the Genus database with same CATH topology
3LCUA 2DAEA 2RRUA 1VG5A 1KYIA 2HWJA 1WGNA 2JP7A 5DFLA 1YLAA 2BWBA 2EKFA 3T6PA 1OAIA 2DENA 1ZMWA 3E21A 3H4JA 3IHPA 2H5XA 3K9OA 1G41A 1HQYE 2L4EA 2K9DA 3FRIA 2EJSA 2MJ5B 2DAIA 2JZ1A 2LVPC 1HT1E 1OQYA 1P3QQ 1TR8A 1ZMVA 1MN3A 1G3IA 1JR3E 2LBCA 2CP8A 2DKLA 1DV0A 3MMPA 2CWBA 4G3OA 1VEJA 2B3TA 1WHCA 2DI0A 1TTEA 3F92A 3GLGE 5JI2E 2L2DA 1G4AE 2LTUA 1C7YA 1WJ7A 2JY7A 1A5TA 1T43A 4HEOA 3E46A 1PGYA 2LVOC 1WGLA 4DBGB 4UN2B 1NV9A 2HAKA 4Q7JA 4F2LA 1DO0A 2O25A 2LVAA 1ZMUA 2L4FA 2MGWA 2MR9A 2OOBA 1CUKA 1QZEA 1T6OA 1VEKA 1HJPA 2R0IA 2LVQD 2QSFX 3GLFE 1NV8A 3B89A 3K9PA 2ZTCA 1IXSA 1VEGA 4GEWA 2KNVA 2EKKA 2DHYA 4WP2A 3GLHE 1E94E 2K0BX 2DZLA 1R4GA 2KNAA 3LCVB 1HT2E 3GLIE 3IECA 1OKSA 2WZJA 1Y8GA 1EFUB 2JUJA 2LVNC 1IM2A 2DAKA 2DAMA 1XB2B 1VDLA 2G3QA 1Q02A 3FRHA 1AIPC 1XXHE 1ZV1A 2JY5A 1GO5A 1DO2A 2OOAA 1UFZA 1F4IA 3FE3A 2BWEA 1VQ1A 1WR1B 1IFYA 2JY8A 2JY6B 4F1IA 2QHOB 3BBZA 1WIVA 2DNAA 1BVSA 2KNZA 2OO9A 1OTRA 2JZ0A 2JNHA 4R71A 2MROB 1SG9A 2ZTDA 2KHHA 2QNJA 1V92A 2DAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCU A;  2DAE A;  2RRU A;  1VG5 A;  1KYI A;  2HWJ A;  1WGN A;  2JP7 A;  5DFL A;  1YLA A;  2BWB A;  2EKF A;  3T6P A;  1OAI A;  2DEN A;  1ZMW A;  3E21 A;  3H4J A;  3IHP A;  2H5X A;  3K9O A;  1G41 A;  1HQY E;  2L4E A;  2K9D A;  3FRI A;  2EJS A;  2MJ5 B;  2DAI A;  2JZ1 A;  2LVP C;  1HT1 E;  1OQY A;  1P3Q Q;  1TR8 A;  1ZMV A;  1MN3 A;  1G3I A;  1JR3 E;  2LBC A;  2CP8 A;  2DKL A;  1DV0 A;  3MMP A;  2CWB A;  4G3O A;  1VEJ A;  2B3T A;  1WHC A;  2DI0 A;  1TTE A;  3F92 A;  3GLG E;  5JI2 E;  2L2D A;  1G4A E;  2LTU A;  1C7Y A;  1WJ7 A;  2JY7 A;  1A5T A;  1T43 A;  4HEO A;  3E46 A;  1PGY A;  2LVO C;  1WGL A;  4DBG B;  4UN2 B;  1NV9 A;  2HAK A;  4Q7J A;  4F2L A;  1DO0 A;  2O25 A;  2LVA A;  1ZMU A;  2L4F A;  2MGW A;  2MR9 A;  2OOB A;  1CUK A;  1QZE A;  1T6O A;  1VEK A;  1HJP A;  2R0I A;  2LVQ D;  2QSF X;  3GLF E;  1NV8 A;  3B89 A;  3K9P A;  2ZTC A;  1IXS A;  1VEG A;  4GEW A;  2KNV A;  2EKK A;  2DHY A;  4WP2 A;  3GLH E;  1E94 E;  2K0B X;  2DZL A;  1R4G A;  2KNA A;  3LCV B;  1HT2 E;  3GLI E;  3IEC A;  1OKS A;  2WZJ A;  1Y8G A;  1EFU B;  2JUJ A;  2LVN C;  1IM2 A;  2DAK A;  2DAM A;  1XB2 B;  1VDL A;  2G3Q A;  1Q02 A;  3FRH A;  1AIP C;  1XXH E;  1ZV1 A;  2JY5 A;  1GO5 A;  1DO2 A;  2OOA A;  1UFZ A;  1F4I A;  3FE3 A;  2BWE A;  1VQ1 A;  1WR1 B;  1IFY A;  2JY8 A;  2JY6 B;  4F1I A;  2QHO B;  3BBZ A;  1WIV A;  2DNA A;  1BVS A;  2KNZ A;  2OO9 A;  1OTR A;  2JZ0 A;  2JNH A;  4R71 A;  2MRO B;  1SG9 A;  2ZTD A;  2KHH A;  2QNJ A;  1V92 A;  2DAG A; 
#chains in the Genus database with same CATH topology
 4IBF A;  3LMM A;  3Q8X A;  4HLQ A;  4QHS A;  3C58 A;  4LJA A;  3FTE A;  1V33 A;  4AKG A;  1R5L A;  1VG5 A;  2ZAM A;  3QYE A;  4DV4 M;  1LV7 A;  3L29 A;  4XGI A;  5KPR A;  3A46 A;  1WGN A;  2G8L A;  3GLG A;  4KLN A;  3UMM A;  2X8A A;  4DV6 M;  3KS4 A;  4HL4 A;  2CRU A;  2EKF A;  3C3D A;  3SAW A;  3E9S A;  3RE8 A;  3AOG A;  3E21 A;  1QZM A;  4AKI A;  2Y20 A;  3CTW B;  3GRV A;  3GRU A;  4OVZ A;  2CHV A;  1DGF A;  2L4E A;  4MH0 E;  1Z59 A;  4FWD A;  3AL0 C;  2V1C A;  5EP4 A;  3SAT A;  3HY5 A;  4LJ9 A;  3JAM S;  5H37 D;  3U6C A;  2R4E A;  1OQY A;  4DV1 M;  2Y0Q A;  2HL7 A;  3HU3 A;  4LZJ A;  3L2A A;  1E9R A;  1JR3 A;  2LBC A;  3SAU A;  1IY1 A;  4KO8 A;  3SBJ A;  3W0F A;  4NRV A;  5IWA M;  1DGG A;  4B7H A;  2QQ8 A;  3C9P A;  2DI0 A;  1NJF A;  1WHC A;  1TTE A;  3F92 A;  3GLG E;  2A5Y B;  2O01 F;  1ZQ9 A;  5JI2 E;  4Y28 F;  2CV0 A;  4OX9 M;  2LTU A;  2CUZ A;  5FSW A;  4WW0 A;  5BPV A;  3PFI A;  1GL7 A;  2KA6 B;  3GLG B;  3MJ5 A;  3GLI A;  1I4W A;  4CHT B;  1SXJ A;  3E46 A;  4GIP A;  4LFA M;  4L4U A;  4LF8 M;  2LVO C;  3U60 A;  1OFI A;  5FTL A;  1NV9 A;  2L7H A;  3AJI B;  2EO2 A;  3EIH A;  1IY2 A;  2O25 A;  3U6S A;  1E9S A;  1NY5 A;  2KRK A;  1ZMU A;  3K8Z A;  3QWL A;  1PJJ A;  2OOB A;  1RU3 A;  1QZE A;  1VEK A;  4R3D A;  1Q3B A;  1WXQ A;  2R0I A;  3J7B A;  2DZN B;  4GIT A;  1NV8 A;  4AKH A;  2LNH C;  3LW5 F;  4OW0 A;  2C9C A;  2AHM A;  2RGO A;  3UJN A;  4IBC A;  4AW4 A;  2L09 A;  1GLN A;  2KNV A;  1L1Z A;  3C3E A;  3NWL A;  1E94 E;  2UUA M;  1IXR C;  3KW6 A;  1Z5C A;  4JI3 M;  2DZO B;  5ITY A;  3BXW A;  1IXS B;  2KNA A;  3LCV B;  3GLI E;  5ITX E;  2K6B A;  1SXJ E;  4L16 A;  3ZQJ A;  1IN6 A;  1Y8G A;  3U6Q A;  1GVN A;  3UK6 A;  1XB2 B;  2XEP A;  3DOA A;  1Q02 A;  4G4O A;  4M0D A;  1SXJ D;  2I7N A;  2YFQ A;  5DYI A;  4S12 A;  3I51 A;  3GLI B;  3QYB A;  4MM3 B;  1FJG M;  1SXJ B;  5C1B A;  1GO5 A;  1UFZ A;  3U6E A;  2J7N A;  1MX0 A;  3I4V A;  1IN5 A;  3KVW A;  4QNM A;  4IBE A;  3U6P A;  2QEN A;  1N32 M;  2FOI C;  1K3X A;  4KT0 F;  5DYG A;  3FYC A;  4FWG A;  4X65 M;  4DR1 M;  3DFZ A;  2H1R A;  3KFU G;  4DR6 M;  2KXE A;  4BBA A;  2JZ0 A;  4JI1 M;  1ORY B;  5GKN A;  3IG8 A;  1SG9 A;  2DWM A;  2KHH A;  4B3S M;  4FVM A;  2QZ4 A;  4LGY A;  5KPZ A;  4QHT A;  2LWX A;  1GJT A;  4MGZ E;  4YHH M;  4RKU F;  4JI6 M;  1OIZ A;  4IBG A;  4IBI A;  2RRU A;  3TWL A;  1R7R A;  4L6V 6;  4REZ A;  3HHY A;  1PM5 A;  1QAN A;  3I01 M;  4WUR A;  5IT9 S;  4NRW A;  1GJS A;  4K0K M;  2XZF A;  2BWB A;  1L2B A;  3IG5 A;  2FFJ A;  3T6P A;  2ZAN A;  4GC9 A;  3TL4 X;  4B7G A;  3K92 A;  3H4J A;  4IBD A;  2D7H A;  2FH0 A;  2R65 A;  4XBO A;  3ZC7 B;  5EXT A;  1LTM A;  4NOO B;  4ANR A;  3KP1 E;  3D8B A;  2XLJ A;  1NHG C;  1L8Q A;  2MJ5 B;  2R6F A;  3PVS A;  2LVP C;  4FCW A;  3B7Z A;  1T3T A;  2ZBK B;  4YY3 M;  1P3Q Q;  3FYD A;  2XF3 A;  3DA1 A;  2DWZ B;  3LQR A;  1MN3 A;  1G3I A;  3K2L A;  2Y0T A;  1HNZ M;  2DHR A;  3KOZ E;  4D82 A;  3U61 B;  2DKL A;  3BOS A;  1DV0 A;  2CWB A;  2C9O A;  2ZAO A;  4CIS A;  4TUW A;  3KP0 E;  1IY0 A;  4G4R A;  4LF9 M;  3GPY A;  2HCB A;  4RNA A;  3E4R A;  3L28 A;  1DGB A;  1OAO C;  3A98 B;  5EXS A;  1NSF A;  3OTO M;  3GO8 A;  3SAV A;  1WJ7 A;  4GMQ A;  2VQF M;  1A5T A;  3U6M A;  3NBI A;  3T38 A;  4PDI A;  3TQS A;  5LMN M;  1NNJ A;  1PGY A;  1QDT A;  1QDR A;  5C18 A;  4RF1 A;  5DNY A;  4G6Z A;  4X62 M;  4UN2 B;  2R18 A;  2HAK A;  3JR5 A;  2CV1 A;  1DO0 A;  1NVM A;  1XWI A;  1IXZ A;  3GPP A;  3FUU A;  4DUZ M;  2L4F A;  1IQP A;  2MGW A;  2MR9 A;  1CUK A;  2KEB A;  1T6O A;  1IBM M;  5E26 A;  4DR5 M;  4FWH A;  2YNM D;  2LVQ D;  2J5Y A;  1NHW C;  1I94 M;  3FUX A;  3VDP A;  5EP1 A;  4JI5 M;  2ZM6 M;  1IXS A;  1JB0 F;  3HHW A;  4DR7 M;  4GEW A;  1N34 M;  4RF0 A;  2EKK A;  4AI6 A;  4I4L A;  4JI0 M;  3U5Z B;  1TF0 B;  2Z8Y M;  2QPA A;  2V1U A;  2E5L M;  5KO3 A;  3ILK A;  2CEA A;  2BNK A;  2EUC A;  3SYK A;  3AKZ A;  5EP3 A;  5ITX A;  1OKS A;  1G59 A;  3B9P A;  2WZJ A;  3SHF A;  8CAT A;  2F5Q A;  3V76 A;  2LVN C;  3GRR A;  1IBL M;  2N35 A;  4MGH A;  4DR2 M;  2G3Q A;  2V6Z M;  1XXH E;  4GH9 A;  4D81 A;  2UXD M;  4A3V B;  1DO2 A;  1OJL A;  1TH4 A;  2OOA A;  3HZJ A;  5L8R F;  3FE3 A;  1PRB A;  3I04 M;  1VQ1 A;  1WR1 B;  4LJ7 A;  4L78 A;  1FNN A;  1HQC A;  1XXH B;  4LZZ A;  4NXN M;  4DV5 M;  4CGY B;  4MGK E;  2WSC F;  3SMS A;  1IN7 A;  3CF2 A;  2CHQ A;  4P16 A;  2XH9 A;  3GRY A;  5EP2 A;  1R2Y A;  1PJQ A;  3SMP A;  3SAR A;  4DR4 M;  3HGI A;  3KOX E;  4LF5 M;  4GHA A;  2DAG A;  3KXE C;  4PD2 A;  4NC6 A;  3T15 A;  3LCU A;  2QBY B;  2DAE A;  4JI7 M;  2KZU A;  3M6A A;  1GAB A;  4W5W A;  1E32 A;  1KYI A;  1OFH A;  1QVR A;  4LFC M;  4JI4 M;  4EIW A;  4OU7 A;  2Z7J A;  3W0L B;  1V34 A;  1C1K A;  5IZ7 D;  3HJQ A;  1N36 M;  2QP9 X;  4JI2 M;  1D0M A;  2K47 A;  3U6D A;  3KSX A;  4JYA M;  4LY6 A;  1OAI A;  2DEN A;  2OQ4 A;  1H6U A;  1ZMW A;  4P17 A;  1L2D A;  2L7I A;  2KZS A;  3IHP A;  1GKI A;  4LG2 A;  3CGW A;  3CF0 A;  3K9O A;  5FTJ A;  2EA0 A;  3VK8 A;  1G41 A;  1HQY E;  5FTM A;  1L2C A;  2DWL A;  1TGU A;  2K9D A;  4G4Q A;  2LHC A;  2M5Z A;  3PXG A;  3KDS E;  3U61 A;  2XGN A;  5F3W A;  1HT1 E;  3W67 A;  1R2Z A;  5FLX S;  1PJI A;  2LXE A;  3ZCB B;  1VDD A;  3AOE C;  3HHZ A;  2F5P A;  4LF6 M;  4BLC A;  1Z5B A;  2GQF A;  2F5S A;  4QNR A;  5A2Q S;  3WHL A;  3RFW A;  4FCV A;  2R46 A;  2JA2 A;  4G3O A;  1VEJ A;  1W5T A;  4KOD A;  4MB7 A;  3L25 A;  3QAU A;  1QAM A;  2G5G X;  1NO1 A;  1UM8 A;  3J2P B;  2F5O A;  1XHB A;  3A45 A;  2BJW A;  2L2D A;  1G4A E;  4Z6Y A;  1C7Y A;  3NBX X;  2W82 A;  3I4Y A;  3KOY E;  2KDL A;  3SAS A;  2UXB M;  1T43 A;  3FTC A;  4B7F A;  1XNQ M;  1IN4 A;  1JQJ C;  1EIJ A;  1XNR M;  3PNY A;  4DBG B;  2JXN A;  4LCB A;  3FKE A;  4JI8 M;  2LVA A;  4LRT A;  4PDG A;  4D80 A;  2Q2E B;  1PJS A;  3TWM A;  2ERC A;  1D0K A;  1HJP A;  1S3S A;  5FTN A;  3GP1 A;  1IN8 A;  2XFT A;  3U5Z A;  1TDH A;  3MHV C;  3GLF E;  2CE7 A;  4LJ6 A;  1DGH A;  4IBK A;  3SYL A;  3A42 A;  3HJ8 A;  1VEG A;  3PNV A;  3SHG B;  2DHY A;  4GKK M;  4AG6 A;  1N78 A;  4BB9 A;  1XC8 A;  4B3T M;  3FTF A;  3GLF B;  2WSE F;  1D0L A;  3RGP A;  2DZL A;  2DXI A;  4II7 A;  4DV7 M;  4M9X A;  4NXM M;  1EE8 A;  3KOW E;  3KSJ A;  4IJF A;  4DV3 M;  1Q3C A;  3IEC A;  3W68 A;  2F4V M;  2DWN A;  1KSF X;  4QOS A;  3AOE A;  1Z5A A;  4MGI E;  2XSZ D;  1IM2 A;  2DAM A;  3TPZ A;  2R44 A;  1VDL A;  1AUA A;  2C99 A;  4M9S A;  1AIP C;  3TE6 A;  1XXH A;  2JY5 A;  3J27 B;  3L26 A;  4LF7 M;  1X37 A;  1KFV A;  1F4I A;  3UZU A;  1D2N A;  4JXJ A;  2I7P A;  4CJ6 A;  3DZD A;  4LJ4 A;  1PJT A;  1TH3 A;  2NQ8 C;  3FUT A;  2XZU A;  2JY6 B;  3HWS A;  4F1I A;  1YE9 A;  3BBZ A;  3AV0 A;  3VFD A;  2R4J A;  1WIV A;  2DVW B;  2QBY A;  1BVS A;  3LQQ A;  3H4M A;  1GL6 A;  1QUT A;  4NSO B;  1OTR A;  1DGH B;  4R71 A;  1TDZ A;  4GKJ M;  1G71 A;  4LGM A;  7CAT A;  2FS1 A;  2MRO B;  2Z4S A;  3FUV A;  4DV2 M;  2QNJ A;  1V92 A;  2P5T A;  1TH2 A;  2VDB B;  2RGH A;  4QOZ C;  4FD2 A;  4I81 A;  3VLF B;  5BR8 M;  2Z3X A;  3HU2 A;  5LMU M;  2CFO A;  4PT5 A;  2C96 A;  3VDU A;  1NY6 A;  1YUB A;  3R8F A;  2HWJ A;  4ZPX A;  4B3R M;  4LJ5 A;  2MH8 A;  5EJC A;  2JP7 A;  4GRI A;  5DFL A;  3VKG A;  1YLA A;  4I8O A;  3SFZ A;  3GPX A;  5JI3 E;  1HR0 M;  2D7G A;  2VQE M;  3B74 A;  1K3W A;  2D7E A;  2WSF F;  4L15 A;  4JV5 M;  5IRE B;  3K1J A;  2H5X A;  5ITR A;  4B3M M;  2GNO A;  4IJE A;  1Q39 A;  4XK8 F;  3T1H M;  1N77 A;  1XMO M;  1NJG A;  3FRI A;  3R9X B;  3EIE A;  1G8P A;  2Y21 A;  1N75 A;  2EJS A;  2FNA A;  2JWS A;  2DAI A;  2JZ1 A;  4LF4 M;  2UUC M;  4OVZ B;  2C5R A;  1W5S A;  3T1Y M;  1TR8 A;  1ZMV A;  2Z4R A;  3CF6 E;  4CIZ A;  4ITQ A;  3VKH A;  4B08 A;  3U6O A;  1JR3 E;  5EQT A;  5KQD A;  3GPU A;  3U6L A;  2CP8 A;  2X4A A;  5ITT A;  3MMP A;  4M0W A;  1QYR A;  1MU5 A;  2FE8 A;  3AFH A;  4FCT A;  4LRS A;  2CV2 A;  1J09 A;  2RKO A;  3MK6 A;  4NSR A;  2B3T A;  3GQ5 A;  1JR3 D;  3HHX A;  3JR4 A;  4IBJ A;  4DR3 M;  3GLH A;  5KQ8 A;  3LVW A;  2YR0 A;  4GHL A;  2JY7 A;  4HEO A;  4DV0 M;  4L8R C;  3WHK A;  1ZAE A;  2YQZ A;  4LJ8 A;  4R7G A;  3FTD A;  3L27 A;  1WGL A;  2VII A;  5ITQ A;  2X49 A;  3J80 S;  2LHG A;  4F2L A;  4Q7J A;  3HU1 A;  3HJS A;  2O5R A;  3THG A;  3GQ4 A;  2APL A;  4IBB A;  4FW9 A;  3UGJ A;  3KS8 A;  3U60 B;  2CHG A;  1QAO A;  1MJG M;  1QQW A;  2VF8 A;  2QSF X;  1L1T A;  3GLF A;  4KHP M;  3HKP A;  1N33 M;  3B89 A;  1YSY A;  3K9P A;  2ZTC A;  4MGY E;  1Z6T A;  3J81 S;  3SC3 A;  4IIW A;  4WP2 A;  3GLH E;  4GC5 A;  1K82 A;  1HNX M;  5FTK A;  3J7A S;  2K0B X;  2L6O A;  2R45 A;  4AG5 A;  1R4G A;  2XSZ A;  4NL4 H;  3B7Q A;  1R6B X;  1HT2 E;  5EXX A;  1XMQ M;  2UU9 M;  3GLH B;  3M0E A;  5EXP A;  1EFU B;  2JUJ A;  2DAK A;  3Q8G A;  1QAQ A;  5ITU A;  4AQY M;  3VK7 A;  1NNU C;  2J7O A;  3FRH A;  3TWK A;  2KRU A;  1IBK M;  3GQ3 A;  3ZH9 B;  1HNW M;  2C98 A;  2VF7 A;  1ZV1 A;  3RGS A;  2BJV A;  2R62 A;  2KW0 A;  4AZF A;  1J5E M;  2F5N A;  2HHH M;  4Z8X A;  4JN6 A;  3FUW A;  4DUY M;  4PCZ A;  2HKJ A;  2BWE A;  3HX3 A;  1J7K A;  4G4N A;  2M60 A;  4X64 M;  1IFY A;  2JY8 A;  1OIP A;  2QCU A;  5E6J A;  2QHO B;  3LVV A;  3D8L A;  3B7N A;  4X66 M;  2XFS A;  2DNA A;  2KNZ A;  3FD9 A;  2OO9 A;  2UXC M;  2LH0 A;  5KPT A;  2JNH A;  2OPF A;  4I5S A;  3M7G A;  1QUS A;  2ZTD A;  2UUB M;  4M9Z A;  4LFB M;  1SXJ C; 
#chains in the Genus database with same CATH homology
 3LCU A;  2DAE A;  2RRU A;  1VG5 A;  1KYI A;  2HWJ A;  1WGN A;  2JP7 A;  5DFL A;  1YLA A;  2BWB A;  2EKF A;  3T6P A;  1OAI A;  2DEN A;  1ZMW A;  3E21 A;  3H4J A;  3IHP A;  2H5X A;  3K9O A;  1G41 A;  1HQY E;  2L4E A;  2K9D A;  3FRI A;  2EJS A;  2MJ5 B;  2DAI A;  2JZ1 A;  2LVP C;  1HT1 E;  1OQY A;  1P3Q Q;  1TR8 A;  1ZMV A;  1MN3 A;  1G3I A;  1JR3 E;  2LBC A;  2CP8 A;  2DKL A;  1DV0 A;  3MMP A;  2CWB A;  4G3O A;  1VEJ A;  2B3T A;  1WHC A;  2DI0 A;  1TTE A;  3F92 A;  3GLG E;  5JI2 E;  2L2D A;  1G4A E;  2LTU A;  1C7Y A;  1WJ7 A;  2JY7 A;  1A5T A;  1T43 A;  4HEO A;  3E46 A;  1PGY A;  2LVO C;  1WGL A;  4DBG B;  4UN2 B;  1NV9 A;  2HAK A;  4Q7J A;  4F2L A;  1DO0 A;  2O25 A;  2LVA A;  1ZMU A;  2L4F A;  2MGW A;  2MR9 A;  2OOB A;  1CUK A;  1QZE A;  1T6O A;  1VEK A;  1HJP A;  2R0I A;  2LVQ D;  2QSF X;  3GLF E;  1NV8 A;  3B89 A;  3K9P A;  2ZTC A;  1IXS A;  1VEG A;  4GEW A;  2KNV A;  2EKK A;  2DHY A;  4WP2 A;  3GLH E;  1E94 E;  2K0B X;  2DZL A;  1R4G A;  2KNA A;  3LCV B;  1HT2 E;  3GLI E;  3IEC A;  1OKS A;  2WZJ A;  1Y8G A;  1EFU B;  2JUJ A;  2LVN C;  1IM2 A;  2DAK A;  2DAM A;  1XB2 B;  1VDL A;  2G3Q A;  1Q02 A;  3FRH A;  1AIP C;  1XXH E;  1ZV1 A;  2JY5 A;  1GO5 A;  1DO2 A;  2OOA A;  1UFZ A;  1F4I A;  3FE3 A;  2BWE A;  1VQ1 A;  1WR1 B;  1IFY A;  2JY8 A;  2JY6 B;  4F1I A;  2QHO B;  3BBZ A;  1WIV A;  2DNA A;  1BVS A;  2KNZ A;  2OO9 A;  1OTR A;  2JZ0 A;  2JNH A;  4R71 A;  2MRO B;  1SG9 A;  2ZTD A;  2KHH A;  2QNJ A;  1V92 A;  2DAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...