1VEJA

Solution structure of rsgi ruh-016, a uba domain from mouse cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
GSSGSSGARACSQSSQTALPTSLFTEGRYQQELEELKALGFANRDANLQALVATDGDIHAAIEMLLGASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIKEN cDNA 4931431F19
publication title Solution Structure of RSGI RUH-016, a UBA Domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vejA00
1JR3E 1IM2A 3LCUA 1T43A 2JNHA 2JP7A 2L4FA 3T6PA 4UN2B 1HQYE 2LVQD 1DO0A 1WIVA 1TTEA 2BWBA 1G41A 1C7YA 1IFYA 2ZTCA 1VEJA 1G4AE 2QHOB 3LCVB 2JY6B 2OOBA 2K9DA 4GEWA 1VEKA 1V92A 2MGWA 1VDLA 1ZMVA 1VEGA 2DZLA 1A5TA 1OTRA 1R4GA 2DAEA 1WGNA 4G3OA 2HAKA 4R71A 2JZ1A 1GO5A 3GLGE 2CWBA 2K0BX 2EKKA 2DI0A 2HWJA 3E46A 2JUJA 3B89A 5JI2E 2QSFX 2KNZA 2LVAA 3GLFE 1DO2A 1HT1E 3GLIE 1SG9A 2LVPC 1AIPC 3FRHA 2OO9A 1WGLA 1XB2B 1G3IA 1PGYA 2DAGA 2LVOC 3E21A 2CP8A 2DNAA 2KHHA 3IECA 1ZV1A 3FE3A 3MMPA 2H5XA 4F2LA 2MR9A 1WR1B 1Q02A 2B3TA 1T6OA 4HEOA 1WHCA 3K9PA 4F1IA 1VG5A 2DENA 4WP2A 2R0IA 2RRUA 4Q7JA 1DV0A 2JY5A 1P3QQ 2JZ0A 2O25A 2LVNC 2JY7A 3GLHE 2BWEA 1QZEA 1IXSA 1UFZA 1WJ7A 2LTUA 1OQYA 2LBCA 1E94E 2MROB 1EFUB 1Y8GA 3H4JA 1OKSA 2QNJA 2KNVA 1CUKA 2DAIA 1OAIA 1F4IA 1ZMUA 2L4EA 1MN3A 1HJPA 2WZJA 2OOAA 3BBZA 1KYIA 2EKFA 2ZTDA 1NV9A 2JY8A 2MJ5B 2G3QA 2L2DA 3FRIA 2DHYA 2DAKA 3IHPA 4DBGB 1XXHE 1TR8A 1BVSA 1YLAA 1VQ1A 2KNAA 3K9OA 2DKLA 1NV8A 1HT2E 2EJSA 3F92A 5DFLA 1ZMWA 2DAMA
chains in the Genus database with same CATH superfamily
2QP9X 2DWLA 1IM2A 4M9SA 4OVZB 4JI8M 1N34M 2WSEF 3GQ5A 2QBYA 5IREB 4WW0A 3VDUA 2LVQD 1DO0A 4KO8A 3D8LA 4M9XA 4R3DA 4PDGA 4D82A 1Z59A 4DV2M 1LV7A 1Q3BA 2LWXA 3PXGA 3SHGB 4IBIA 4OX9M 5E26A 3GLIA 1DGFA 2FS1A 3T1YM 1VEJA 3EIHA 1J09A 4LRSA 5DNYA 1IXRC 1G4AE 1JR3D 2LH0A 2I7NA 3Q8XA 3LCVB 1D0KA 1Z5AA 1T3TA 4FWDA 2VIIA 1IY0A 4IBGA 4DV6M 4IBDA 1NNJA 2MH8A 4GH9A 1N75A 4GEWA 3FTFA 3LMMA 1XXHB 4I5SA 3NBIA 3FTDA 3SAVA 1VEGA 2DZNB 3GRYA 1AUAA 1WGNA 2DWZB 2JZ1A 2CUZA 1KSFX 4IBKA 4WURA 2EKKA 4DV7M 2DWMA 1TDZA 2RKOA 3DZDA 2GNOA 5ITXE 1XNQM 2K47A 2XZUA 4JI7M 4IIWA 2R6FA 4L8RC 3U61B 3SASA 3GLFB 1IXZA 3U6DA 4X65M 2E5LM 1OIZA 3GRRA 4MGIE 1G3IA 3C3EA 3FYCA 1PJQA 2LVOC 3ZH9B 4X62M 4QNMA 2C5RA 3GPPA 1TH4A 3IECA 3TQSA 3T15A 4LG2A 1PJTA 3SC3A 2O01F 1C1KA 1IN8A 1SXJD 2V6ZM 4B08A 3K2LA 1K82A 5EXPA 1YUBA 3SATA 4LZJA 4GKJM 4DR3M 4JN6A 3GP1A 1Z5CA 3K9PA 4RKUF 1S3SA 1R2YA 4MB7A 2UUBM 5IZ7D 4Q7JA 2J7NA 3J80S 4ANRA 1GL6A 2JZ0A 2LXEA 2LHCA 3AKZA 3SBJA 2LNHC 2X49A 3JR4A 1G59A 4B3MM 4NSRA 4L78A 2ZAOA 3GLHE 4W5WA 4EIWA 5FTLA 3U60B 4YY3M 3I04M 1ZQ9A 1N33M 1OQYA 1I4WA 2XFSA 2EUCA 1Y8GA 3AOEA 3HHYA 2N35A 4MGHA 1QDTA 3CF0A 4BBAA 2KEBA 2X4AA 5FLXS 2XEPA 4GC9A 4KODA 5DYGA 2WZJA 3SAWA 2YNMD 1NJGA 1TF0B 1E9SA 4G4NA 3BBZA 3U6OA 1R7RA 3U5ZA 3Q8GA 3FKEA 3FUTA 4G4OA 4DV3M 1L8QA 1QAQA 4B7GA 4M9ZA 3C9PA 2G3QA 3UMMA 2L2DA 3KSJA 3FRIA 1NVMA 2ZANA 4LF7M 4DBGB 5EXSA 1L1TA 4GC5A 3W67A 3LQQA 3DA1A 4JI0M 1SXJC 3AJIB 3GPXA 2CEAA 4LJ8A 2BJWA 4QHTA 4XBOA 3LQRA 3GPUA 1ORYB 2Z4RA 5FTMA 2F5QA 3SHFA 2ZAMA 1LTMA 1JQJC 3L27A 1HT2E 2EJSA 2JA2A 1JR3E 2O5RA 2D7EA 2FNAA 1MX0A 2QPAA 4QOSA 4AW4A 2JP7A 2L4FA 3T6PA 4LF5M 1NY6A 3UJNA 4QHSA 3THGA 2VQFM 4UN2B 4IBCA 1OIPA 1L1ZA 4LF8M 2A5YB 1IN6A 2BWBA 4B7FA 2L6OA 2Z8YM 5ITXA 2WSCF 5LMUM 2I7PA 1FNNA 1G41A 2R44A 5FTKA 5C1BA 1IFYA 4MGYE 1IXSB 2CE7A 3VLFB 3R9XB 4G6ZA 4GHAA 2XGNA 2Y20A 2D7GA 2QHOB 1V33A 2VF8A 2JY6B 2XH9A 1RU3A 4MM3B 1GLNA 2RGOA 3ZCBB 1DGHA 1G71A 3FUVA 3KW6A 3FUXA 1ZMVA 1OTRA 4G3OA 4RF1A 4AKHA 3GRVA 2CWBA 4L6V6 3GLGE 4QOZC 1G8PA 2CV1A 4DV4M 4OU7A 3E46A 3SAUA 3B89A 4X64M 1SXJE 3AV0A 3M6AA 5JI2E 2DWNA 1L2BA 3IG8A 3J7BA 4L15A 1HT1E 1QAOA 3B7QA 4II7A 5E6JA 4AKIA 3K1JA 1AIPC 3HZJA 2OO9A 3TL4X 3ILKA 4GMQA 3KOYE 3U6LA 3E21A 3JR5A 1IN7A 3KP1E 5H37D 3GLHA 4LRTA 3VK8A 1ZV1A 3FE3A 4LGYA 1XNRM 1IN5A 2MR9A 4IBJA 3KDSE 2B3TA 4OW0A 1T6OA 5DYIA 3W0FA 4PD2A 4JI3M 5EXTA 4KLNA 3A45A 3I01M 2QBYB 3K8ZA 3IG5A 3HU2A 4NL4H 3H4MA 3L28A 3TPZA 4IJEA 2XZFA 4RNAA 2C9CA 5ITQA 5GKNA 1DV0A 2JY5A 4GRIA 3RGSA 1Q39A 4LFBM 2JY7A 2HHHM 2VDBB 2HL7A 3GLIB 2CV2A 1QZEA 4JV5M 2LTUA 4FWHA 1XWIA 3VK7A 2HCBA 3J27B 3B7ZA 2KW0A 4AG6A 3MHVC 3KS8A 3PFIA 3AOGA 2KNVA 4DUYM 1KFVA 4G4QA 4DV1M 3T38A 2Z4SA 2DZOB 1GKIA 1QVRA 4FVMA 2DHRA 1K3WA 1FJGM 3J7AS 1PRBA 3GQ3A 2OOAA 1JR3A 1OFIA 4P17A 1GL7A 1ZAEA 3TE6A 4LCBA 4JI2M 3GRUA 1XMOM 4NXNM 3VDPA 2F5PA 3MJ5A 4JI6M 3K92A 4AKGA 3B9PA 4HLQA 5IWAM 3SYLA 2WSFF 4X66M 1XXHE 4M0DA 3DFZA 2LHGA 4FCTA 3NBXX 4CIZA 1K3XA 4LJ7A 2J7OA 4I81A 3KOWE 8CATA 3HY5A 4LY6A 1NV8A 1QDRA 4L4UA 2P5TA 1L2CA 5EP3A 5JI3E 5C18A 2DAMA 3LW5F 5EP1A 3BXWA 2YQZA 3LCUA 1T43A 3U6PA 3SFZA 2CHGA 3GQ4A 3GLGA 5BPVA 3B7NA 2KDLA 4IBBA 3CTWB 4JXJA 4D81A 1QZMA 3QYBA 4YHHM 4GHLA 3SMPA 3RFWA 2BNKA 1SXJA 1W5TA 4JI5M 3KFUG 1C7YA 1L2DA 2KXEA 2F5SA 1E9RA 2ZTCA 3L2AA 1QUSA 1OFHA 3A46A 2OOBA 4PDIA 3SMSA 2KZSA 1PM5A 2ZM6M 4AQYM 1H6UA 1VEKA 2MGWA 1YE9A 4HL4A 5KO3A 4DUZM 1VDLA 1V34A 1A5TA 4AG5A 3GO8A 2YFQA 5ITYA 1MU5A 3KOZE 3AL0C 3RGPA 5EJCA 4GKKM 1IY1A 2L7IA 3B74A 3OTOM 4AI6A 2XSZD 4LFAM 3PNVA 1HNWM 1GJSA 4CHTB 2KNZA 2LVAA 2UUAM 3HJSA 1NJFA 3U5ZB 3UZUA 2R18A 4GIPA 3FRHA 2K6BA 3FYDA 1NO1A 1WGLA 2ZBKB 1PGYA 4KT0F 3CF6E 2EA0A 4B3RM 2UXDM 2CP8A 2Z3XA 2KZUA 4FWGA 2KHHA 2NQ8C 1R5LA 3C58A 3J81S 5KQ8A 1X37A 2R46A 1YSYA 3A42A 2FE8A 1GABA 5ITUA 2R45A 3MMPA 1NY5A 2H5XA 4BLCA 5ITTA 1GVNA 1WR1B 3WHLA 1IY2A 3QWLA 1QAMA 5A2QS 4PT5A 2L09A 4OVZA 3WHKA 1PJIA 1TH2A 3EIEA 2UUCM 2APLA 2DENA 3HJ8A 4WP2A 2G8LA 1OJLA 3HKPA 2CHQA 2R0IA 2RRUA 2DXIA 1R6BX 2H1RA 4BB9A 1R2ZA 2O25A 4S12A 3W0LB 2L7HA 1D0LA 2V1UA 3SARA 4NXMM 2LVNC 4JI4M 2BWEA 3KXEC 4FCWA 1N78A 1D0MA 4DV5M 4G4RA 2LBCA 2YR0A 4LFCM 2MROB 3HWSA 1EFUB 2OPFA 3QYEA 3U6SA 1DGHB 5IT9S 2Q2EB 1UM8A 3H4JA 3LVVA 5FSWA 3TWKA 1XXHA 2Y21A 4IBEA 2F5OA 2C98A 4Z6YA 2DAIA 4LJAA 1WXQA 2FH0A 3FTEA 2L4EA 1MN3A 1HJPA 3KVWA 1HQCA 3PNYA 4D80A 4MH0E 3E9SA 3V76A 3U61A 1NV9A 3GLFA 2JY8A 3M0EA 2OQ4A 3T1HM 4B3TM 1QQWA 2MJ5B 3VKGA 2GQFA 2DAKA 3R8FA 4ITQA 4L16A 3CF2A 3U6QA 3I4VA 1BVSA 3GLHB 4DR1M 4LJ4A 5EP2A 4I4LA 2J5YA 4LZZA 2FFJA 3F92A 4GITA 4R7GA 3FUWA 2V1CA 2R62A 3K9OA 3VFDA 1PJSA 2DKLA 3L29A 3ZC7B 3J2PB 4LJ9A 5DFLA 1ZMWA 3I51A 5LMNM 5EXXA 2JNHA 3L26A 3E4RA 4Z8XA 1QANA 5EP4A 2CV0A 1NHGC 4KHPM 1WIVA 2QZ4A 3KP0E 4LGMA 4DR5M 1TTEA 1HR0M 4LF4M 4TUWA 4NRVA 2EO2A 2CRUA 3U60A 4JI1M 4LJ5A 3UK6A 3HU3A 2JXNA 4IBFA 1IQPA 1JB0F 1TDHA 1VDDA 3ZQJA 4RF0A 2K9DA 5ITRA 4DR6M 1HNXM 3TWMA 2DVWB 3LVWA 2JWSA 1V92A 2Y0TA 2DZLA 4FD2A 1R4GA 2DAEA 1J5EM 2HAKA 4R71A 3DOAA 1GO5A 2UU9M 2K0BX 3HU1A 2DI0A 2HWJA 2FOIC 2JUJA 1IBKM 1IBLM 2XF3A 2QSFX 3GLFE 4NC6A 3SYKA 2W82A 1DO2A 1Z6TA 1HNZM 3GLIE 4DR2M 2C9OA 3PVSA 1SG9A 1DGBA 2LVPC 2QCUA 3AFHA 4QNRA 1XB2B 2G5GX 2R4EA 5FTJA 1PJJA 3L25A 1I94M 2DAGA 2QENA 4Y28F 2DNAA 4CISA 1XC8A 5FTNA 4I8OA 3A98B 3FD9A 4P16A 2F5NA 2M60A 3M7GA 2X8AA 4F2LA 1TGUA 2C99A 5KPZA 3U6EA 1Q02A 4DR4M 3TWLA 3GPYA 2M5ZA 3AOEC 3D8BA 4HEOA 1WHCA 2R65A 3QAUA 4K0KM 1D2NA 1VG5A 4F1IA 2XLJA 3GLGB 3KOXE 4ZPXA 4MGKE 4MGZE 4LF6M 3W68A 1P3QQ 1SXJB 2HKJA 2KRKA 4REZA 2XFTA 3U6MA 3C3DA 4LJ6A 2RGHA 1TH3A 3HJQA 3JAMS 1XHBA 2BJVA 1UFZA 1IXSA 1WJ7A 1E32A 3HHWA 4IJFA 5F3WA 3HX3A 4B7HA 4CGYB 1E94E 7CATA 1QYRA 2UXCM 1EIJA 2Y0QA 1NNUC 1Q3CA 2AHMA 4XK8F 1MJGM 5KQDA 1OAOC 1OKSA 3HHXA 3NWLA 2QNJA 4XGIA 4FW9A 4JYAM 1IN4A 1J7KA 1EE8A 4A3VB 1CUKA 1IBMM 1OAIA 4NRWA 1F4IA 2ERCA 1ZMUA 1W5SA 1GJTA 2CFOA 3MK6A 3CGWA 1N36M 3HHZA 2F4VM 3KS4A 1KYIA 2VQEM 2KRUA 2EKFA 2ZTDA 2VF7A 3FUUA 1NHWC 3VKHA 2CHVA 5BR8M 5EQTA 5L8RF 4NOOB 2QQ8A 4M0WA 3U6CA 3FTCA 2C96A 4FCVA 3I4YA 2DHYA 1DGGA 3IHPA 2R4JA 1TR8A 5KPRA 1XMQM 4DV0M 1YLAA 2XSZA 3RE8A 4LF9M 1VQ1A 2D7HA 4NSOB 4CJ6A 1QUTA 2KNAA 4AZFA 1N32M 3KSXA 2UXBM 2KA6B 1Z5BA 3BOSA 5KPTA 1NSFA 3UGJA 1N77A 1HQYE 2Z7JA 3HGIA 4B3SM 4DR7M 4PCZA
chains in the Genus database with same CATH topology
1JR3E 1IM2A 3LCUA 1T43A 2JNHA 2JP7A 2L4FA 3T6PA 4UN2B 1HQYE 2LVQD 1DO0A 1WIVA 1TTEA 2BWBA 1G41A 1C7YA 1IFYA 2ZTCA 1VEJA 1G4AE 2QHOB 3LCVB 2JY6B 2OOBA 2K9DA 4GEWA 1VEKA 1V92A 2MGWA 1VDLA 1ZMVA 1VEGA 2DZLA 1A5TA 1OTRA 1R4GA 2DAEA 1WGNA 4G3OA 2HAKA 4R71A 2JZ1A 1GO5A 3GLGE 2CWBA 2K0BX 2EKKA 2DI0A 2HWJA 3E46A 2JUJA 3B89A 5JI2E 2QSFX 2KNZA 2LVAA 3GLFE 1DO2A 1HT1E 3GLIE 1SG9A 2LVPC 1AIPC 3FRHA 2OO9A 1WGLA 1XB2B 1G3IA 1PGYA 2DAGA 2LVOC 3E21A 2CP8A 2DNAA 2KHHA 3IECA 1ZV1A 3FE3A 3MMPA 2H5XA 4F2LA 2MR9A 1WR1B 1Q02A 2B3TA 1T6OA 4HEOA 1WHCA 3K9PA 4F1IA 1VG5A 2DENA 4WP2A 2R0IA 2RRUA 4Q7JA 1DV0A 2JY5A 1P3QQ 2JZ0A 2O25A 2LVNC 2JY7A 3GLHE 2BWEA 1QZEA 1IXSA 1UFZA 1WJ7A 2LTUA 1OQYA 2LBCA 1E94E 2MROB 1EFUB 1Y8GA 3H4JA 1OKSA 2QNJA 2KNVA 1CUKA 2DAIA 1OAIA 1F4IA 1ZMUA 2L4EA 1MN3A 1HJPA 2WZJA 2OOAA 3BBZA 1KYIA 2EKFA 2ZTDA 1NV9A 2JY8A 2MJ5B 2G3QA 2L2DA 3FRIA 2DHYA 2DAKA 3IHPA 4DBGB 1XXHE 1TR8A 1BVSA 1YLAA 1VQ1A 2KNAA 3K9OA 2DKLA 1NV8A 1HT2E 2EJSA 3F92A 5DFLA 1ZMWA 2DAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR3 E;  1IM2 A;  3LCU A;  1T43 A;  2JNH A;  2JP7 A;  2L4F A;  3T6P A;  4UN2 B;  1HQY E;  2LVQ D;  1DO0 A;  1WIV A;  1TTE A;  2BWB A;  1G41 A;  1C7Y A;  1IFY A;  2ZTC A;  1VEJ A;  1G4A E;  2QHO B;  3LCV B;  2JY6 B;  2OOB A;  2K9D A;  4GEW A;  1VEK A;  1V92 A;  2MGW A;  1VDL A;  1ZMV A;  1VEG A;  2DZL A;  1A5T A;  1OTR A;  1R4G A;  2DAE A;  1WGN A;  4G3O A;  2HAK A;  4R71 A;  2JZ1 A;  1GO5 A;  3GLG E;  2CWB A;  2K0B X;  2EKK A;  2DI0 A;  2HWJ A;  3E46 A;  2JUJ A;  3B89 A;  5JI2 E;  2QSF X;  2KNZ A;  2LVA A;  3GLF E;  1DO2 A;  1HT1 E;  3GLI E;  1SG9 A;  2LVP C;  1AIP C;  3FRH A;  2OO9 A;  1WGL A;  1XB2 B;  1G3I A;  1PGY A;  2DAG A;  2LVO C;  3E21 A;  2CP8 A;  2DNA A;  2KHH A;  3IEC A;  1ZV1 A;  3FE3 A;  3MMP A;  2H5X A;  4F2L A;  2MR9 A;  1WR1 B;  1Q02 A;  2B3T A;  1T6O A;  4HEO A;  1WHC A;  3K9P A;  4F1I A;  1VG5 A;  2DEN A;  4WP2 A;  2R0I A;  2RRU A;  4Q7J A;  1DV0 A;  2JY5 A;  1P3Q Q;  2JZ0 A;  2O25 A;  2LVN C;  2JY7 A;  3GLH E;  2BWE A;  1QZE A;  1IXS A;  1UFZ A;  1WJ7 A;  2LTU A;  1OQY A;  2LBC A;  1E94 E;  2MRO B;  1EFU B;  1Y8G A;  3H4J A;  1OKS A;  2QNJ A;  2KNV A;  1CUK A;  2DAI A;  1OAI A;  1F4I A;  1ZMU A;  2L4E A;  1MN3 A;  1HJP A;  2WZJ A;  2OOA A;  3BBZ A;  1KYI A;  2EKF A;  2ZTD A;  1NV9 A;  2JY8 A;  2MJ5 B;  2G3Q A;  2L2D A;  3FRI A;  2DHY A;  2DAK A;  3IHP A;  4DBG B;  1XXH E;  1TR8 A;  1BVS A;  1YLA A;  1VQ1 A;  2KNA A;  3K9O A;  2DKL A;  1NV8 A;  1HT2 E;  2EJS A;  3F92 A;  5DFL A;  1ZMW A;  2DAM A; 
#chains in the Genus database with same CATH topology
 2QP9 X;  2DWL A;  1IM2 A;  4M9S A;  4OVZ B;  4JI8 M;  1N34 M;  2WSE F;  3GQ5 A;  2QBY A;  5IRE B;  4WW0 A;  3VDU A;  2LVQ D;  1DO0 A;  4KO8 A;  3D8L A;  4M9X A;  4R3D A;  4PDG A;  4D82 A;  1Z59 A;  4DV2 M;  1LV7 A;  1Q3B A;  2LWX A;  3PXG A;  3SHG B;  4IBI A;  4OX9 M;  5E26 A;  3GLI A;  1DGF A;  2FS1 A;  3T1Y M;  1VEJ A;  3EIH A;  1J09 A;  4LRS A;  5DNY A;  1IXR C;  1G4A E;  1JR3 D;  2LH0 A;  2I7N A;  3Q8X A;  3LCV B;  1D0K A;  1Z5A A;  1T3T A;  4FWD A;  2VII A;  1IY0 A;  4IBG A;  4DV6 M;  4IBD A;  1NNJ A;  2MH8 A;  4GH9 A;  1N75 A;  4GEW A;  3FTF A;  3LMM A;  1XXH B;  4I5S A;  3NBI A;  3FTD A;  3SAV A;  1VEG A;  2DZN B;  3GRY A;  1AUA A;  1WGN A;  2DWZ B;  2JZ1 A;  2CUZ A;  1KSF X;  4IBK A;  4WUR A;  2EKK A;  4DV7 M;  2DWM A;  1TDZ A;  2RKO A;  3DZD A;  2GNO A;  5ITX E;  1XNQ M;  2K47 A;  2XZU A;  4JI7 M;  4IIW A;  2R6F A;  4L8R C;  3U61 B;  3SAS A;  3GLF B;  1IXZ A;  3U6D A;  4X65 M;  2E5L M;  1OIZ A;  3GRR A;  4MGI E;  1G3I A;  3C3E A;  3FYC A;  1PJQ A;  2LVO C;  3ZH9 B;  4X62 M;  4QNM A;  2C5R A;  3GPP A;  1TH4 A;  3IEC A;  3TQS A;  3T15 A;  4LG2 A;  1PJT A;  3SC3 A;  2O01 F;  1C1K A;  1IN8 A;  1SXJ D;  2V6Z M;  4B08 A;  3K2L A;  1K82 A;  5EXP A;  1YUB A;  3SAT A;  4LZJ A;  4GKJ M;  4DR3 M;  4JN6 A;  3GP1 A;  1Z5C A;  3K9P A;  4RKU F;  1S3S A;  1R2Y A;  4MB7 A;  2UUB M;  5IZ7 D;  4Q7J A;  2J7N A;  3J80 S;  4ANR A;  1GL6 A;  2JZ0 A;  2LXE A;  2LHC A;  3AKZ A;  3SBJ A;  2LNH C;  2X49 A;  3JR4 A;  1G59 A;  4B3M M;  4NSR A;  4L78 A;  2ZAO A;  3GLH E;  4W5W A;  4EIW A;  5FTL A;  3U60 B;  4YY3 M;  3I04 M;  1ZQ9 A;  1N33 M;  1OQY A;  1I4W A;  2XFS A;  2EUC A;  1Y8G A;  3AOE A;  3HHY A;  2N35 A;  4MGH A;  1QDT A;  3CF0 A;  4BBA A;  2KEB A;  2X4A A;  5FLX S;  2XEP A;  4GC9 A;  4KOD A;  5DYG A;  2WZJ A;  3SAW A;  2YNM D;  1NJG A;  1TF0 B;  1E9S A;  4G4N A;  3BBZ A;  3U6O A;  1R7R A;  3U5Z A;  3Q8G A;  3FKE A;  3FUT A;  4G4O A;  4DV3 M;  1L8Q A;  1QAQ A;  4B7G A;  4M9Z A;  3C9P A;  2G3Q A;  3UMM A;  2L2D A;  3KSJ A;  3FRI A;  1NVM A;  2ZAN A;  4LF7 M;  4DBG B;  5EXS A;  1L1T A;  4GC5 A;  3W67 A;  3LQQ A;  3DA1 A;  4JI0 M;  1SXJ C;  3AJI B;  3GPX A;  2CEA A;  4LJ8 A;  2BJW A;  4QHT A;  4XBO A;  3LQR A;  3GPU A;  1ORY B;  2Z4R A;  5FTM A;  2F5Q A;  3SHF A;  2ZAM A;  1LTM A;  1JQJ C;  3L27 A;  1HT2 E;  2EJS A;  2JA2 A;  1JR3 E;  2O5R A;  2D7E A;  2FNA A;  1MX0 A;  2QPA A;  4QOS A;  4AW4 A;  2JP7 A;  2L4F A;  3T6P A;  4LF5 M;  1NY6 A;  3UJN A;  4QHS A;  3THG A;  2VQF M;  4UN2 B;  4IBC A;  1OIP A;  1L1Z A;  4LF8 M;  2A5Y B;  1IN6 A;  2BWB A;  4B7F A;  2L6O A;  2Z8Y M;  5ITX A;  2WSC F;  5LMU M;  2I7P A;  1FNN A;  1G41 A;  2R44 A;  5FTK A;  5C1B A;  1IFY A;  4MGY E;  1IXS B;  2CE7 A;  3VLF B;  3R9X B;  4G6Z A;  4GHA A;  2XGN A;  2Y20 A;  2D7G A;  2QHO B;  1V33 A;  2VF8 A;  2JY6 B;  2XH9 A;  1RU3 A;  4MM3 B;  1GLN A;  2RGO A;  3ZCB B;  1DGH A;  1G71 A;  3FUV A;  3KW6 A;  3FUX A;  1ZMV A;  1OTR A;  4G3O A;  4RF1 A;  4AKH A;  3GRV A;  2CWB A;  4L6V 6;  3GLG E;  4QOZ C;  1G8P A;  2CV1 A;  4DV4 M;  4OU7 A;  3E46 A;  3SAU A;  3B89 A;  4X64 M;  1SXJ E;  3AV0 A;  3M6A A;  5JI2 E;  2DWN A;  1L2B A;  3IG8 A;  3J7B A;  4L15 A;  1HT1 E;  1QAO A;  3B7Q A;  4II7 A;  5E6J A;  4AKI A;  3K1J A;  1AIP C;  3HZJ A;  2OO9 A;  3TL4 X;  3ILK A;  4GMQ A;  3KOY E;  3U6L A;  3E21 A;  3JR5 A;  1IN7 A;  3KP1 E;  5H37 D;  3GLH A;  4LRT A;  3VK8 A;  1ZV1 A;  3FE3 A;  4LGY A;  1XNR M;  1IN5 A;  2MR9 A;  4IBJ A;  3KDS E;  2B3T A;  4OW0 A;  1T6O A;  5DYI A;  3W0F A;  4PD2 A;  4JI3 M;  5EXT A;  4KLN A;  3A45 A;  3I01 M;  2QBY B;  3K8Z A;  3IG5 A;  3HU2 A;  4NL4 H;  3H4M A;  3L28 A;  3TPZ A;  4IJE A;  2XZF A;  4RNA A;  2C9C A;  5ITQ A;  5GKN A;  1DV0 A;  2JY5 A;  4GRI A;  3RGS A;  1Q39 A;  4LFB M;  2JY7 A;  2HHH M;  2VDB B;  2HL7 A;  3GLI B;  2CV2 A;  1QZE A;  4JV5 M;  2LTU A;  4FWH A;  1XWI A;  3VK7 A;  2HCB A;  3J27 B;  3B7Z A;  2KW0 A;  4AG6 A;  3MHV C;  3KS8 A;  3PFI A;  3AOG A;  2KNV A;  4DUY M;  1KFV A;  4G4Q A;  4DV1 M;  3T38 A;  2Z4S A;  2DZO B;  1GKI A;  1QVR A;  4FVM A;  2DHR A;  1K3W A;  1FJG M;  3J7A S;  1PRB A;  3GQ3 A;  2OOA A;  1JR3 A;  1OFI A;  4P17 A;  1GL7 A;  1ZAE A;  3TE6 A;  4LCB A;  4JI2 M;  3GRU A;  1XMO M;  4NXN M;  3VDP A;  2F5P A;  3MJ5 A;  4JI6 M;  3K92 A;  4AKG A;  3B9P A;  4HLQ A;  5IWA M;  3SYL A;  2WSF F;  4X66 M;  1XXH E;  4M0D A;  3DFZ A;  2LHG A;  4FCT A;  3NBX X;  4CIZ A;  1K3X A;  4LJ7 A;  2J7O A;  4I81 A;  3KOW E;  8CAT A;  3HY5 A;  4LY6 A;  1NV8 A;  1QDR A;  4L4U A;  2P5T A;  1L2C A;  5EP3 A;  5JI3 E;  5C18 A;  2DAM A;  3LW5 F;  5EP1 A;  3BXW A;  2YQZ A;  3LCU A;  1T43 A;  3U6P A;  3SFZ A;  2CHG A;  3GQ4 A;  3GLG A;  5BPV A;  3B7N A;  2KDL A;  4IBB A;  3CTW B;  4JXJ A;  4D81 A;  1QZM A;  3QYB A;  4YHH M;  4GHL A;  3SMP A;  3RFW A;  2BNK A;  1SXJ A;  1W5T A;  4JI5 M;  3KFU G;  1C7Y A;  1L2D A;  2KXE A;  2F5S A;  1E9R A;  2ZTC A;  3L2A A;  1QUS A;  1OFH A;  3A46 A;  2OOB A;  4PDI A;  3SMS A;  2KZS A;  1PM5 A;  2ZM6 M;  4AQY M;  1H6U A;  1VEK A;  2MGW A;  1YE9 A;  4HL4 A;  5KO3 A;  4DUZ M;  1VDL A;  1V34 A;  1A5T A;  4AG5 A;  3GO8 A;  2YFQ A;  5ITY A;  1MU5 A;  3KOZ E;  3AL0 C;  3RGP A;  5EJC A;  4GKK M;  1IY1 A;  2L7I A;  3B74 A;  3OTO M;  4AI6 A;  2XSZ D;  4LFA M;  3PNV A;  1HNW M;  1GJS A;  4CHT B;  2KNZ A;  2LVA A;  2UUA M;  3HJS A;  1NJF A;  3U5Z B;  3UZU A;  2R18 A;  4GIP A;  3FRH A;  2K6B A;  3FYD A;  1NO1 A;  1WGL A;  2ZBK B;  1PGY A;  4KT0 F;  3CF6 E;  2EA0 A;  4B3R M;  2UXD M;  2CP8 A;  2Z3X A;  2KZU A;  4FWG A;  2KHH A;  2NQ8 C;  1R5L A;  3C58 A;  3J81 S;  5KQ8 A;  1X37 A;  2R46 A;  1YSY A;  3A42 A;  2FE8 A;  1GAB A;  5ITU A;  2R45 A;  3MMP A;  1NY5 A;  2H5X A;  4BLC A;  5ITT A;  1GVN A;  1WR1 B;  3WHL A;  1IY2 A;  3QWL A;  1QAM A;  5A2Q S;  4PT5 A;  2L09 A;  4OVZ A;  3WHK A;  1PJI A;  1TH2 A;  3EIE A;  2UUC M;  2APL A;  2DEN A;  3HJ8 A;  4WP2 A;  2G8L A;  1OJL A;  3HKP A;  2CHQ A;  2R0I A;  2RRU A;  2DXI A;  1R6B X;  2H1R A;  4BB9 A;  1R2Z A;  2O25 A;  4S12 A;  3W0L B;  2L7H A;  1D0L A;  2V1U A;  3SAR A;  4NXM M;  2LVN C;  4JI4 M;  2BWE A;  3KXE C;  4FCW A;  1N78 A;  1D0M A;  4DV5 M;  4G4R A;  2LBC A;  2YR0 A;  4LFC M;  2MRO B;  3HWS A;  1EFU B;  2OPF A;  3QYE A;  3U6S A;  1DGH B;  5IT9 S;  2Q2E B;  1UM8 A;  3H4J A;  3LVV A;  5FSW A;  3TWK A;  1XXH A;  2Y21 A;  4IBE A;  2F5O A;  2C98 A;  4Z6Y A;  2DAI A;  4LJA A;  1WXQ A;  2FH0 A;  3FTE A;  2L4E A;  1MN3 A;  1HJP A;  3KVW A;  1HQC A;  3PNY A;  4D80 A;  4MH0 E;  3E9S A;  3V76 A;  3U61 A;  1NV9 A;  3GLF A;  2JY8 A;  3M0E A;  2OQ4 A;  3T1H M;  4B3T M;  1QQW A;  2MJ5 B;  3VKG A;  2GQF A;  2DAK A;  3R8F A;  4ITQ A;  4L16 A;  3CF2 A;  3U6Q A;  3I4V A;  1BVS A;  3GLH B;  4DR1 M;  4LJ4 A;  5EP2 A;  4I4L A;  2J5Y A;  4LZZ A;  2FFJ A;  3F92 A;  4GIT A;  4R7G A;  3FUW A;  2V1C A;  2R62 A;  3K9O A;  3VFD A;  1PJS A;  2DKL A;  3L29 A;  3ZC7 B;  3J2P B;  4LJ9 A;  5DFL A;  1ZMW A;  3I51 A;  5LMN M;  5EXX A;  2JNH A;  3L26 A;  3E4R A;  4Z8X A;  1QAN A;  5EP4 A;  2CV0 A;  1NHG C;  4KHP M;  1WIV A;  2QZ4 A;  3KP0 E;  4LGM A;  4DR5 M;  1TTE A;  1HR0 M;  4LF4 M;  4TUW A;  4NRV A;  2EO2 A;  2CRU A;  3U60 A;  4JI1 M;  4LJ5 A;  3UK6 A;  3HU3 A;  2JXN A;  4IBF A;  1IQP A;  1JB0 F;  1TDH A;  1VDD A;  3ZQJ A;  4RF0 A;  2K9D A;  5ITR A;  4DR6 M;  1HNX M;  3TWM A;  2DVW B;  3LVW A;  2JWS A;  1V92 A;  2Y0T A;  2DZL A;  4FD2 A;  1R4G A;  2DAE A;  1J5E M;  2HAK A;  4R71 A;  3DOA A;  1GO5 A;  2UU9 M;  2K0B X;  3HU1 A;  2DI0 A;  2HWJ A;  2FOI C;  2JUJ A;  1IBK M;  1IBL M;  2XF3 A;  2QSF X;  3GLF E;  4NC6 A;  3SYK A;  2W82 A;  1DO2 A;  1Z6T A;  1HNZ M;  3GLI E;  4DR2 M;  2C9O A;  3PVS A;  1SG9 A;  1DGB A;  2LVP C;  2QCU A;  3AFH A;  4QNR A;  1XB2 B;  2G5G X;  2R4E A;  5FTJ A;  1PJJ A;  3L25 A;  1I94 M;  2DAG A;  2QEN A;  4Y28 F;  2DNA A;  4CIS A;  1XC8 A;  5FTN A;  4I8O A;  3A98 B;  3FD9 A;  4P16 A;  2F5N A;  2M60 A;  3M7G A;  2X8A A;  4F2L A;  1TGU A;  2C99 A;  5KPZ A;  3U6E A;  1Q02 A;  4DR4 M;  3TWL A;  3GPY A;  2M5Z A;  3AOE C;  3D8B A;  4HEO A;  1WHC A;  2R65 A;  3QAU A;  4K0K M;  1D2N A;  1VG5 A;  4F1I A;  2XLJ A;  3GLG B;  3KOX E;  4ZPX A;  4MGK E;  4MGZ E;  4LF6 M;  3W68 A;  1P3Q Q;  1SXJ B;  2HKJ A;  2KRK A;  4REZ A;  2XFT A;  3U6M A;  3C3D A;  4LJ6 A;  2RGH A;  1TH3 A;  3HJQ A;  3JAM S;  1XHB A;  2BJV A;  1UFZ A;  1IXS A;  1WJ7 A;  1E32 A;  3HHW A;  4IJF A;  5F3W A;  3HX3 A;  4B7H A;  4CGY B;  1E94 E;  7CAT A;  1QYR A;  2UXC M;  1EIJ A;  2Y0Q A;  1NNU C;  1Q3C A;  2AHM A;  4XK8 F;  1MJG M;  5KQD A;  1OAO C;  1OKS A;  3HHX A;  3NWL A;  2QNJ A;  4XGI A;  4FW9 A;  4JYA M;  1IN4 A;  1J7K A;  1EE8 A;  4A3V B;  1CUK A;  1IBM M;  1OAI A;  4NRW A;  1F4I A;  2ERC A;  1ZMU A;  1W5S A;  1GJT A;  2CFO A;  3MK6 A;  3CGW A;  1N36 M;  3HHZ A;  2F4V M;  3KS4 A;  1KYI A;  2VQE M;  2KRU A;  2EKF A;  2ZTD A;  2VF7 A;  3FUU A;  1NHW C;  3VKH A;  2CHV A;  5BR8 M;  5EQT A;  5L8R F;  4NOO B;  2QQ8 A;  4M0W A;  3U6C A;  3FTC A;  2C96 A;  4FCV A;  3I4Y A;  2DHY A;  1DGG A;  3IHP A;  2R4J A;  1TR8 A;  5KPR A;  1XMQ M;  4DV0 M;  1YLA A;  2XSZ A;  3RE8 A;  4LF9 M;  1VQ1 A;  2D7H A;  4NSO B;  4CJ6 A;  1QUT A;  2KNA A;  4AZF A;  1N32 M;  3KSX A;  2UXB M;  2KA6 B;  1Z5B A;  3BOS A;  5KPT A;  1NSF A;  3UGJ A;  1N77 A;  1HQY E;  2Z7J A;  3HGI A;  4B3S M;  4DR7 M;  4PCZ A; 
#chains in the Genus database with same CATH homology
 1JR3 E;  1IM2 A;  3LCU A;  1T43 A;  2JNH A;  2JP7 A;  2L4F A;  3T6P A;  4UN2 B;  1HQY E;  2LVQ D;  1DO0 A;  1WIV A;  1TTE A;  2BWB A;  1G41 A;  1C7Y A;  1IFY A;  2ZTC A;  1VEJ A;  1G4A E;  2QHO B;  3LCV B;  2JY6 B;  2OOB A;  2K9D A;  4GEW A;  1VEK A;  1V92 A;  2MGW A;  1VDL A;  1ZMV A;  1VEG A;  2DZL A;  1A5T A;  1OTR A;  1R4G A;  2DAE A;  1WGN A;  4G3O A;  2HAK A;  4R71 A;  2JZ1 A;  1GO5 A;  3GLG E;  2CWB A;  2K0B X;  2EKK A;  2DI0 A;  2HWJ A;  3E46 A;  2JUJ A;  3B89 A;  5JI2 E;  2QSF X;  2KNZ A;  2LVA A;  3GLF E;  1DO2 A;  1HT1 E;  3GLI E;  1SG9 A;  2LVP C;  1AIP C;  3FRH A;  2OO9 A;  1WGL A;  1XB2 B;  1G3I A;  1PGY A;  2DAG A;  2LVO C;  3E21 A;  2CP8 A;  2DNA A;  2KHH A;  3IEC A;  1ZV1 A;  3FE3 A;  3MMP A;  2H5X A;  4F2L A;  2MR9 A;  1WR1 B;  1Q02 A;  2B3T A;  1T6O A;  4HEO A;  1WHC A;  3K9P A;  4F1I A;  1VG5 A;  2DEN A;  4WP2 A;  2R0I A;  2RRU A;  4Q7J A;  1DV0 A;  2JY5 A;  1P3Q Q;  2JZ0 A;  2O25 A;  2LVN C;  2JY7 A;  3GLH E;  2BWE A;  1QZE A;  1IXS A;  1UFZ A;  1WJ7 A;  2LTU A;  1OQY A;  2LBC A;  1E94 E;  2MRO B;  1EFU B;  1Y8G A;  3H4J A;  1OKS A;  2QNJ A;  2KNV A;  1CUK A;  2DAI A;  1OAI A;  1F4I A;  1ZMU A;  2L4E A;  1MN3 A;  1HJP A;  2WZJ A;  2OOA A;  3BBZ A;  1KYI A;  2EKF A;  2ZTD A;  1NV9 A;  2JY8 A;  2MJ5 B;  2G3Q A;  2L2D A;  3FRI A;  2DHY A;  2DAK A;  3IHP A;  4DBG B;  1XXH E;  1TR8 A;  1BVS A;  1YLA A;  1VQ1 A;  2KNA A;  3K9O A;  2DKL A;  1NV8 A;  1HT2 E;  2EJS A;  3F92 A;  5DFL A;  1ZMW A;  2DAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...