2OQ4A

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
262
structure length
252
Chain Sequence
PQGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGLFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrates and mutations of critical residues
rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords 5'-D(*G*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*GP*G)-3'
total genus 74
structure length 252
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2oq4A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2oq4A01
4DR1M 3VK8A 2UUAM 4ITQA 4B3SM 3JAMS 4YHHM 1IBKM 4KHPM 4NRWA 2F5NA 1IBMM 3JR5A 1MU5A 4DR5M 2E5LM 1L2DA 2UXDM 4DV5M 1PM5A 3T1HM 4NRVA 4PDGA 3SASA 4LFBM 2OPFA 1Z5AA 2F5QA 1Q39A 1HNWM 3JR4A 2UU9M 4DV2M 3C58A 1J5EM 4G4NA 1PJJA 3J80S 1Z59A 1R2ZA 2F5PA 2ZM6M 3U6MA 1K3WA 4DR7M 4PDIA 3GPPA 3SAVA 3U6QA 4PCZA 1TDHA 5ITRA 4DV7M 4GKKM 4LF9M 4OX9M 3U6LA 2XZUA 4DV6M 4JI8M 2OQ4A 1K82A 4JI6M 3A46A 4JYAM 2F4VM 1L2BA 5ITXA 4DR3M 3J7AS 4DV0M 1Z5BA 3DOAA 4X65M 4CISA 4LF4M 1L2CA 4B3TM 1HNZM 1XMQM 4PD2A 3SAUA 3TWLA 1Z5CA 1Q3BA 4JI5M 2VQFM 4DV1M 5IT9S 3SATA 2ZBKB 1I94M 2HKJA 3GQ4A 1EE8A 4LF6M 5ITTA 3GQ3A 2EA0A 3U6PA 4AQYM 3W0FA 5BR8M 1R2YA 1N33M 5LMNM 3GPXA 4JI0M 4DR2M 4JV5M 4G4QA 1XC8A 4X66M 4DV3M 3VK7A 1NNJA 4JI7M 4LFCM 4LF5M 3U6CA 3U6SA 3A42A 2UUCM 2UXCM 3A45A 3U6EA 1N36M 1XNRM 5ITUA 4K0KM 4DV4M 1XMOM 4LF7M 4JI2M 5ITYA 5A2QS 3OTOM 3GP1A 3GQ5A 3U6OA 1K3XA 2VQEM 2HHHM 1HNXM 2F5SA 3J81S 4G4RA 5FLXS 1KFVA 1N32M 3TWMA 5ITXE 4DR6M 5LMUM 4X62M 1FJGM 4NXNM 3GO8A 1IBLM 3U6DA 2XZFA 4G4OA 2UXBM 4X64M 4DUYM 3T1YM 1L1ZA 4GKJM 3TWKA 4B3RM 4LF8M 1N34M 4JI4M 5ITQA 2Q2EB 1Q3CA 4MB7A 3GPYA 1PJIA 1XNQM 5IWAM 3SARA 2UUBM 4NXMM 1TDZA 4YY3M 4DR4M 1MX0A 4LFAM 1HR0M 4B3MM 1L1TA 4JI3M 3SAWA 3SBJA 4JI1M 2F5OA 3GPUA 4DUZM
chains in the Genus database with same CATH superfamily
3MMPA 2RKOA 3BBZA 2QHOB 3BOSA 1NJGA 3KXEC 1DGHA 3LW5F 4XGIA 4CHTB 4ITQA 2LVOC 3B7ZA 3FE3A 4HL4A 4OW0A 5EP1A 2F5NA 1IBMM 1T6OA 1MU5A 1NVMA 3A98B 4IBDA 3C9PA 1MN3A 3AOGA 3HGIA 3LMMA 2LNHC 3T1HM 4PDGA 4LFBM 1DGHB 1Q39A 1QDRA 4LJ9A 4XBOA 5C1BA 1TTEA 2CRUA 2JZ0A 2KEBA 5FTKA 4OU7A 2UU9M 2O25A 1G3IA 2I7NA 2R45A 2LVQD 2R0IA 1PJJA 1R2ZA 3U6MA 3K92A 3GPPA 3W68A 3U6QA 3GLFE 1W5SA 4NSRA 3FUUA 2L2DA 2JZ1A 2Y0TA 3DFZA 4M9SA 1T3TA 4PCZA 4KLNA 4LJAA 3LCUA 1V92A 3GLFA 4DV7M 4LF9M 3MK6A 4JI8M 1E94E 5EXSA 2JNHA 2DAEA 2RGOA 4LJ7A 4DR3M 2C9CA 2KNAA 4DV0M 1Z5BA 3DOAA 4JXJA 4B7HA 1A5TA 2JY5A 1ZMWA 1L2CA 4B3TM 3IG8A 3RGSA 1SXJA 1S3SA 3HJSA 2DWNA 1VEKA 4G6ZA 2JP7A 5EQTA 1QZEA 2VQFM 3GLGA 1OTRA 3GQ4A 3KSXA 4RF0A 3FYCA 5ITTA 2LXEA 3V76A 2EA0A 3U6PA 1IY0A 1QZMA 2KRKA 2DAKA 1IN6A 2HWJA 3HJQA 2C5RA 2XGNA 3QYEA 2AHMA 1XWIA 4IBBA 4WP2A 2KRUA 1PGYA 3THGA 3GRVA 4FD2A 2WZJA 4IBGA 3GLFB 4P17A 3VK7A 1HJPA 4MM3B 1R4GA 2QCUA 4I81A 5FTMA 3SYKA 2UXCM 2FE8A 3L2AA 3CTWB 4LF7M 3OTOM 4BB9A 3T6PA 3J2PB 2HHHM 5DFLA 5DNYA 2KXEA 2JUJA 3U6DA 1PRBA 2MROB 4M0WA 2W82A 2XZFA 2JY7A 3LVWA 3TQSA 3H4MA 2FS1A 1DGBA 3UMMA 1FNNA 2UXBM 3LQQA 3B89A 3T1YM 4GKJM 3CF0A 3R9XB 3TWKA 3ZCBB 4B3RM 3E9SA 1RU3A 5FSWA 3MJ5A 3C3EA 4UN2B 1N34M 1UFZA 2DAIA 3LCVB 1Q3CA 4GIPA 4I8OA 1PJQA 4HEOA 4Z6YA 1QVRA 4QHSA 1QDTA 5EP2A 4I4LA 2K47A 3IG5A 5KPZA 3FTEA 4Y28F 1Z6TA 2BNKA 3FRIA 4GITA 4IIWA 4D81A 3QYBA 4AKHA 3AKZA 4LFAM 3GLIE 4B3MM 2QBYB 1OKSA 4JI1M 2QENA 1GJSA 3LVVA 2X49A 4L8RC 1EIJA 2G8LA 2I7PA 1IN4A 3HX3A 3VK8A 2YQZA 4L4UA 1J09A 3FUWA 3JAMS 3U60A 3SFZA 2LVNC 1TR8A 4Z8XA 2XLJA 3JR5A 5BPVA 4NOOB 3B7NA 4DR5M 3B7QA 1QUTA 3I51A 2BWEA 1IN7A 1GJTA 1DGFA 1QAMA 1TH3A 1OQYA 2DAMA 2JY6B 4GRIA 3F92A 2YR0A 1H6UA 3KS4A 3AL0C 2DWLA 1DO2A 1W5TA 3I01M 5JI3E 4NL4H 1NJFA 3Q8GA 3M6AA 2MH8A 1WGLA 4DV2M 3FTDA 2XEPA 2L7IA 4MGKE 1Z59A 3J80S 2ZM6M 1P3QQ 1WR1B 1IY1A 4DR7M 3L27A 4XK8F 4ZPXA 2J7NA 1XB2B 3VKGA 4LZJA 2O5RA 1IY2A 2VDBB 4GH9A 5DYIA 3RE8A 3H4JA 2L6OA 2R46A 1D2NA 3EIEA 4BLCA 5ITRA 2GQFA 5GKNA 1SXJB 1OIPA 1G4AE 2KHHA 4OX9M 2H1RA 2X4AA 5EXXA 2XZUA 4KO8A 2R18A 3E21A 2C99A 2WSCF 5ITXA 1GL7A 1G71A 3SYLA 1XHBA 1JQJC 5FTLA 4X65M 2ZTDA 4LG2A 3KSJA 3FTFA 4OVZB 3GLIA 3UZUA 3SAUA 4LZZA 2EO2A 3PVSA 3KP1E 4L6V6 4JI5M 4P16A 4L78A 4DV1M 5IT9S 1JR3A 2ZBKB 3C3DA 4DBGB 1I4WA 1ZMVA 2HKJA 2G3QA 4IBEA 1R2YA 4AQYM 4IBIA 1Y8GA 4WW0A 2QBYA 1N33M 4DR2M 1VDLA 1OAIA 4GHAA 2LBCA 2V6ZM 4LJ5A 4G4QA 1DO0A 2EJSA 4DV3M 2L4EA 4R71A 3K8ZA 4JI7M 3KS8A 4LF5M 3U6SA 2CHQA 3A42A 1HT1E 1JR3D 3KP0E 4BBAA 3GRUA 4FWGA 4REZA 1XNRM 1DV0A 1WJ7A 3AFHA 1XMOM 4JI2M 2FOIC 1VQ1A 3GP1A 2LVPC 1K3XA 4IBKA 2V1UA 2YFQA 3Q8XA 3CGWA 2CFOA 2F5SA 1D0LA 3J81S 4G4RA 1ZV1A 3B9PA 3TE6A 1E9RA 2ERCA 3FUXA 3L29A 4FCWA 5KO3A 5LMUM 1FJGM 1IXRC 4QOSA 3D8BA 3FUTA 4M9XA 5L8RF 2FNAA 4LJ4A 1OIZA 3IECA 2KW0A 3L25A 3KOWE 1JR3E 2N35A 2V1CA 1AIPC 4MH0E 4QOZC 2APLA 2OOAA 4AG6A 4CGYB 2X8AA 5KQDA 2R4EA 3HU2A 3GLIB 4NXMM 4DR4M 3HWSA 1MX0A 1SXJE 2NQ8C 3TPZA 3GLGB 1L1TA 2QZ4A 2CEAA 2VF7A 1VDDA 4JI3M 3SBJA 1LV7A 3QWLA 4M0DA 1QQWA 2J5YA 2H5XA 4RNAA 4MGZE 3ZH9B 3GPUA 2DVWB 1XXHA 1TH4A 3GRRA 3NWLA 3W0LB 4DUZM 4G4NA 2K6BA 2LTUA 2D7HA 4YHHM 1V34A 4B7GA 4GC9A 5KPTA 5F3WA 4B3SM 3UK6A 2Z3XA 4AKIA 2DHYA 1QUSA 3BXWA 4CIZA 1DGGA 1TF0B 1QAQA 4JN6A 2CWBA 3KVWA 4NRVA 2CP8A 2DXIA 2DAGA 4GHLA 2KA6B 3M7GA 3MHVC 1GKIA 1OFHA 2QQ8A 3IHPA 2F5QA 2K0BX 1SXJC 2DWMA 5EP3A 1R6BX 2GNOA 2KZUA 2XF3A 2XH9A 4MGYE 1HNWM 1HQYE 1Q02A 2L09A 3C58A 1J5EM 3PFIA 3WHKA 2DI0A 1D0KA 2D7EA 2F5PA 2DZLA 3KOYE 1NY5A 2BJVA 3SAVA 1SG9A 3UGJA 4FVMA 5KPRA 2JWSA 3FKEA 3J27B 4MGHA 2DZOB 3AOEA 4GKKM 1ZAEA 1OAOC 3U6LA 4IJEA 4PT5A 3ZC7B 5H37D 3A46A 3FYDA 4JYAM 4IBFA 4B08A 1L2BA 2XSZD 1IXZA 1PJSA 1VG5A 1D0MA 4CISA 1WHCA 3VKHA 1NV8A 4PD2A 1XMQM 2EKKA 1Q3BA 3EIHA 3SATA 4AZFA 4LF6M 3HHYA 2DZNB 1WIVA 2G5GX 3D8LA 3KW6A 2QNJA 4JI0M 3K9OA 4OVZA 1VEGA 1YSYA 1ZQ9A 2QSFX 3B74A 3HKPA 1TGUA 3GLHB 2FH0A 1IXSA 3L26A 2O01F 1XC8A 2DNAA 4X66M 2KNZA 3L28A 3M0EA 3U6CA 2XFSA 3A45A 1R5LA 4LY6A 3I4YA 3J7BA 5ITYA 4ANRA 5A2QS 4G3OA 1QYRA 3GQ5A 3U6OA 2CV2A 3DZDA 3SMPA 3I04M 1IQPA 1QANA 4AW4A 1HNXM 2C9OA 2L4FA 4L15A 4FWHA 5FLXS 3U61A 3U5ZA 3VLFB 2Z7JA 3TWMA 5ITXE 2CE7A 4DR6M 1UM8A 1OJLA 4X62M 3SHGB 2LH0A 1IBLM 2VIIA 4NSOB 2EUCA 1KYIA 1WXQA 3CF2A 3VFDA 4X64M 4DUYM 2Y0QA 1YE9A 5E6JA 1GLNA 1L1ZA 3GLHA 4M9ZA 3UJNA 5E26A 1GVNA 1NO1A 2R65A 4AG5A 3K2LA 4A3VB 1N77A 4JI4M 2Q2EB 4LGMA 3GLGE 2JY8A 2OOBA 1XNQM 5IWAM 2UUAM 2R44A 1VEJA 2UUBM 1TDZA 5C18A 2CHGA 3E46A 2CV1A 3SMSA 4L16A 1EFUB 1MJGM 2KNVA 1NHWC 3HJ8A 2C98A 2MR9A 5EJCA 4I5SA 1N32M 1NY6A 1C7YA 2EKFA 3RGPA 4DR1M 4NC6A 2DWZB 1IBKM 3T38A 3SHFA 4NRWA 1IXSB 2CV0A 4HLQA 1GABA 2UXDM 4DV5M 3HHWA 1PM5A 1XXHE 1IN5A 3GRYA 2M60A 2QPAA 3SASA 2CUZA 3PXGA 1GO5A 2OPFA 1Z5AA 3U60B 2DHRA 1G59A 3VDUA 2ZAMA 2HAKA 1QAOA 5EXTA 3JR4A 4KHPM 1L2DA 2A5YB 2R62A 1G41A 3WHLA 1BVSA 1E32A 1R7RA 2Z4RA 4QNMA 1K3WA 2HCBA 3HZJA 4PDIA 4S12A 3W67A 4WURA 4GEWA 3AV0A 4AKGA 5IZ7D 1G8PA 1TDHA 2ZAOA 3FRHA 4FWDA 1TH2A 4B7FA 1NHGC 1NV9A 4DV6M 2VF8A 3KDSE 4LGYA 4EIWA 2OQ4A 4II7A 1K82A 2DKLA 2QP9X 4JI6M 2LHCA 3AJIB 3CF6E 2F4VM 2J7OA 3VDPA 4D80A 5DYGA 2Y20A 4GMQA 3J7AS 2RGHA 7CATA 4LRSA 1F4IA 4F1IA 4LF4M 1HNZM 3ILKA 1AUAA 3I4VA 3TWLA 1Z5CA 2ZANA 1HQCA 1PJTA 2R6FA 4IJFA 1T43A 2K9DA 4RF1A 8CATA 1LTMA 3R8FA 4TUWA 1GL6A 4FCTA 1I94M 3RFWA 3KFUG 1EE8A 1V33A 4LJ6A 5EP4A 3GQ3A 2WSEF 2OO9A 3PNVA 3W0FA 5BR8M 3KOXE 3GLHE 3K1JA 4KT0F 1J7KA 2MJ5B 1CUKA 3GPXA 5LMNM 1NSFA 1C1KA 3NBXX 4LJ8A 4KODA 1IM2A 4JV5M 2XFTA 1WGNA 3AOEC 3HU3A 4LCBA 3U61B 2JXNA 2KDLA 1NNJA 3U5ZB 4LFCM 2LWXA 4RKUF 2D7GA 3FUVA 3TL4X 2UUCM 4MGIE 1X37A 4AI6A 3U6EA 1N36M 4K0KM 5ITUA 4DV4M 3HY5A 2Z8YM 5IREB 2BWBA 3QAUA 2VQEM 2C96A 2Z4SA 2M5ZA 4FCVA 4QHTA 4W5WA 5EXPA 2B3TA 4IBCA 1YLAA 3NBIA 3HHZA 1KFVA 3HU1A 3T15A 3ZQJA 2XSZA 3FTCA 2FFJA 2RRUA 3DA1A 4D82A 2HL7A 1N75A 5KQ8A 4NXNM 3GO8A 4LRTA 1XXHB 4IBJA 4GC5A 3HHXA 4QNRA 4G4OA 1ZMUA 5FTNA 1L8QA 1NNUC 1YUBA 2L7HA 3PNYA 2BJWA 3SC3A 2P5TA 3LQRA 2CHVA 2KZSA 4Q7JA 2DENA 1IN8A 4LF8M 2JA2A 1OFIA 1SXJD 1JB0F 5ITQA 4CJ6A 4MB7A 3GPYA 2LVAA 1PJIA 2MGWA 4F2LA 1N78A 3SARA 4R3DA 1E9SA 2E5LM 2ZTCA 1ORYB 2YNMD 3FD9A 4YY3M 3E4RA 1KSFX 5JI2E 4R7GA 4FW9A 3KOZE 2R4JA 2WSFF 5FTJA 1HR0M 1IFYA 3K9PA 3SAWA 2Y21A 2LHGA 2F5OA 1HT2E
chains in the Genus database with same CATH topology
2UUAM 2RKOA 3BOSA 3KXEC 4ITQA 1NJGA 4CHTB 1DGHA 4XGIA 5EP1A 4HL4A 4OW0A 2F5NA 1IBMM 1MU5A 1NVMA 3A98B 4IBDA 3AOGA 3HGIA 3LMMA 2LNHC 3T1HM 4PDGA 4LFBM 1DGHB 1Q39A 4LJ9A 4XBOA 5C1BA 2KEBA 4OU7A 5FTKA 2UU9M 1G3IA 2I7NA 2R45A 1PJJA 1R2ZA 3U6MA 3K92A 3GPPA 3U6QA 1W5SA 4NSRA 3FUUA 2Y0TA 4M9SA 3DFZA 4PCZA 1T3TA 4KLNA 4LJAA 4DV7M 3GLFA 4LF9M 3MK6A 4JI8M 1E94E 5EXSA 2RGOA 4LJ7A 4DR3M 2C9CA 4DV0M 1Z5BA 3DOAA 4JXJA 4B7HA 1L2CA 4B3TM 3IG8A 3RGSA 1SXJA 1S3SA 3HJSA 2DWNA 4G6ZA 2VQFM 5EQTA 3GLGA 3GQ4A 3KSXA 4RF0A 3FYCA 5ITTA 2LXEA 2EA0A 3U6PA 2C5RA 1IY0A 1QZMA 2KRKA 3HJQA 1IN6A 2XGNA 2AHMA 1XWIA 4IBBA 2KRUA 3THGA 3GRVA 4FD2A 4IBGA 3GLFB 3VK7A 4MM3B 2QCUA 4I81A 5FTMA 3SYKA 2UXCM 2FE8A 3L2AA 3CTWB 4LF7M 3OTOM 4BB9A 3J2PB 2HHHM 5DNYA 2KXEA 3U6DA 4M0WA 2W82A 2XZFA 3LVWA 3TQSA 3H4MA 2UXBM 1DGBA 3UMMA 1FNNA 3LQQA 3T1YM 4GKJM 3CF0A 3R9XB 3TWKA 3ZCBB 4B3RM 3E9SA 5FSWA 3MJ5A 1N34M 1Q3CA 4GIPA 4I8OA 4Z6YA 1QVRA 4QHSA 5EP2A 4I4LA 2K47A 3IG5A 5KPZA 3FTEA 1Z6TA 2BNKA 4GITA 4IIWA 4D81A 4AKHA 3AKZA 4LFAM 4B3MM 2QBYB 4JI1M 2QENA 3LVVA 2X49A 4L8RC 2G8LA 2I7PA 1IN4A 3VK8A 2YQZA 4L4UA 1J09A 3FUWA 3JAMS 3U60A 3SFZA 4Z8XA 2XLJA 3JR5A 5BPVA 4NOOB 4DR5M 2E5LM 1L2DA 3I51A 1IN7A 1TH3A 1DGFA 1QAMA 4GRIA 2YR0A 1H6UA 3KS4A 3AL0C 2DWLA 1DO2A 1W5TA 5JI3E 4NL4H 1NJFA 3M6AA 4DV2M 3FTDA 2XEPA 2L7IA 4MGKE 1Z59A 3J80S 2ZM6M 4DR7M 1IY1A 3L27A 4ZPXA 2J7NA 3VKGA 4LZJA 2O5RA 1IY2A 5DYIA 4GH9A 3RE8A 5ITRA 2L6OA 2R46A 1D2NA 3EIEA 4BLCA 5GKNA 1SXJB 1G4AE 4OX9M 2H1RA 2X4AA 5EXXA 2XZUA 4KO8A 2R18A 2C99A 5ITXA 1GL7A 3SYLA 1XHBA 1JQJC 5FTLA 4X65M 4LG2A 3KSJA 3FTFA 4OVZB 3GLIA 3UZUA 3SAUA 4LZZA 2EO2A 3PVSA 3KP1E 4JI5M 4P16A 4L78A 4DV1M 5IT9S 1JR3A 2ZBKB 1I4WA 2HKJA 4IBEA 1R2YA 4AQYM 4IBIA 2QBYA 4WW0A 1N33M 4DR2M 4GHAA 2V6ZM 4LJ5A 4G4QA 1DO0A 4DV3M 3K8ZA 4JI7M 4LF5M 3U6SA 2CHQA 3A42A 1HT1E 1JR3D 3KP0E 4BBAA 3GRUA 4FWGA 4REZA 1XNRM 1XMOM 3AFHA 4JI2M 2FOIC 3GP1A 1K3XA 4IBKA 2V1UA 2YFQA 3Q8XA 2CFOA 2F5SA 3J81S 4G4RA 3B9PA 3TE6A 1E9RA 2ERCA 3FUXA 3L29A 4FCWA 5KO3A 5LMUM 1FJGM 1IXRC 4QOSA 3D8BA 3FUTA 4M9XA 2FNAA 4LJ4A 2KW0A 3L25A 3KOWE 2V1CA 4MH0E 4QOZC 4AG6A 4CGYB 5KQDA 2X8AA 2R4EA 3HU2A 3GLIB 4NXMM 4DR4M 3HWSA 1MX0A 1SXJE 2NQ8C 3TPZA 3GLGB 1L1TA 2QZ4A 2CEAA 1VDDA 4JI3M 3SBJA 1LV7A 3QWLA 4M0DA 1QQWA 3ZH9B 4RNAA 3GPUA 4MGZE 2DVWB 3NWLA 3GRRA 1XXHA 1TH4A 3W0LB 4DUZM 4G4NA 5F3WA 4B3SM 2D7HA 4YHHM 4KHPM 4B7GA 4GC9A 5KPTA 3UK6A 2Z3XA 4AKIA 1DGGA 1QAQA 4JN6A 3KVWA 4NRVA 4GHLA 2DXIA 2KA6B 3M7GA 3MHVC 1GKIA 1OFHA 2F5QA 1SXJC 2DWMA 5EP3A 1R6BX 2XF3A 2KZUA 4MGYE 2XH9A 1HNWM 1HQYE 2L09A 3C58A 1J5EM 3PFIA 3WHKA 2D7EA 2F5PA 3KOYE 1NY5A 2BJVA 3SAVA 3UGJA 4FVMA 5KPRA 3FKEA 3J27B 4MGHA 2DZOB 3AOEA 4GKKM 1ZAEA 3U6LA 4IJEA 4PT5A 3ZC7B 5H37D 3A46A 3FYDA 4JYAM 4IBFA 4B08A 1L2BA 2XSZD 1IXZA 4CISA 3VKHA 1XMQM 4PD2A 1Q3BA 3EIHA 3SATA 4AZFA 4LF6M 3HHYA 2DZNB 2G5GX 3D8LA 3KW6A 4JI0M 4OVZA 1ZQ9A 1YSYA 3HKPA 1TGUA 3GLHB 3L26A 1XC8A 4X66M 3L28A 3M0EA 3U6CA 2XFSA 3A45A 4LY6A 3I4YA 3J7BA 5ITYA 5A2QS 3GQ5A 1QYRA 3U6OA 2CV2A 3DZDA 3SMPA 1IQPA 1QANA 4AW4A 1HNXM 2C9OA 4L15A 5FLXS 4FWHA 3U61A 3U5ZA 3VLFB 2Z7JA 3TWMA 5ITXE 2CE7A 4DR6M 1UM8A 1OJLA 4X62M 3SHGB 2LH0A 1IBLM 2VIIA 4NSOB 2EUCA 1KYIA 1WXQA 3CF2A 3VFDA 4X64M 4DUYM 2Y0QA 1YE9A 5E6JA 1GLNA 1L1ZA 3GLHA 4M9ZA 3UJNA 5E26A 1GVNA 2R65A 4AG5A 3K2LA 4A3VB 1N77A 4JI4M 2Q2EB 4LGMA 1XNQM 5IWAM 2UUBM 1TDZA 5C18A 2CHGA 2CV1A 3SMSA 4L16A 1NHWC 3HJ8A 2C98A 5EJCA 4I5SA 1NY6A 3RGPA 4DR1M 2DWZB 1IBKM 3T38A 3SHFA 4NRWA 1IXSB 2CV0A 4HLQA 2UXDM 4DV5M 3HHWA 1PM5A 1IN5A 3GRYA 2M60A 2QPAA 3SASA 2CUZA 3PXGA 2OPFA 1Z5AA 3U60B 2DHRA 1G59A 3VDUA 2ZAMA 5EXTA 1QAOA 3JR4A 2A5YB 2R62A 1G41A 3WHLA 1E32A 1R7RA 2Z4RA 4QNMA 1K3WA 2HCBA 4PDIA 4S12A 4WURA 3AV0A 4AKGA 5IZ7D 1G8PA 1TDHA 2ZAOA 4FWDA 1TH2A 4B7FA 1NHGC 4DV6M 4LGYA 3KDSE 2OQ4A 4EIWA 1K82A 4II7A 4JI6M 2QP9X 2F4VM 3AJIB 3CF6E 2J7OA 3VDPA 4D80A 5DYGA 2Y20A 4GMQA 3J7AS 2RGHA 7CATA 4LRSA 4LF4M 1HNZM 3ILKA 3I4VA 3TWLA 1Z5CA 2ZANA 1HQCA 4IJFA 4RF1A 8CATA 3KS8A 3R8FA 4TUWA 1GL6A 4FCTA 1I94M 3RFWA 3KFUG 1EE8A 4LJ6A 5EP4A 3GQ3A 3W0FA 3PNVA 5BR8M 3KOXE 3K1JA 3GPXA 1J7KA 5LMNM 4JV5M 1NSFA 1C1KA 4LJ8A 4KODA 1IM2A 2XFTA 3AOEC 3HU3A 4LCBA 3U61B 1NNJA 3U5ZB 4LFCM 2LWXA 2D7GA 3FUVA 3TL4X 2UUCM 4MGIE 1X37A 4AI6A 3U6EA 1N36M 4K0KM 5ITUA 4DV4M 5IREB 3QAUA 2VQEM 2C96A 2Z4SA 2M5ZA 4FCVA 4QHTA 4W5WA 5EXPA 3HHZA 4IBCA 1KFVA 3NBIA 1N32M 3HU1A 3T15A 2XSZA 3FTCA 2FFJA 3DA1A 4D82A 2HL7A 1N75A 5KQ8A 4NXNM 3GO8A 4LRTA 1XXHB 4IBJA 4GC5A 3HHXA 4QNRA 4G4OA 5FTNA 1L8QA 1NNUC 1YUBA 2L7HA 3PNYA 2BJWA 3SC3A 2P5TA 3LQRA 2CHVA 2KZSA 1IN8A 4LF8M 2JA2A 1OFIA 1SXJD 5ITQA 4MB7A 3GPYA 1PJIA 1N78A 3SARA 4R3DA 1E9SA 1ORYB 2YNMD 3FD9A 4YY3M 3E4RA 1KSFX 5JI2E 4R7GA 4FW9A 3KOZE 2R4JA 5FTJA 1HR0M 3SAWA 2Y21A 2F5OA 1HT2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 M;  3VK8 A;  2UUA M;  4ITQ A;  4B3S M;  3JAM S;  4YHH M;  1IBK M;  4KHP M;  4NRW A;  2F5N A;  1IBM M;  3JR5 A;  1MU5 A;  4DR5 M;  2E5L M;  1L2D A;  2UXD M;  4DV5 M;  1PM5 A;  3T1H M;  4NRV A;  4PDG A;  3SAS A;  4LFB M;  2OPF A;  1Z5A A;  2F5Q A;  1Q39 A;  1HNW M;  3JR4 A;  2UU9 M;  4DV2 M;  3C58 A;  1J5E M;  4G4N A;  1PJJ A;  3J80 S;  1Z59 A;  1R2Z A;  2F5P A;  2ZM6 M;  3U6M A;  1K3W A;  4DR7 M;  4PDI A;  3GPP A;  3SAV A;  3U6Q A;  4PCZ A;  1TDH A;  5ITR A;  4DV7 M;  4GKK M;  4LF9 M;  4OX9 M;  3U6L A;  2XZU A;  4DV6 M;  4JI8 M;  2OQ4 A;  1K82 A;  4JI6 M;  3A46 A;  4JYA M;  2F4V M;  1L2B A;  5ITX A;  4DR3 M;  3J7A S;  4DV0 M;  1Z5B A;  3DOA A;  4X65 M;  4CIS A;  4LF4 M;  1L2C A;  4B3T M;  1HNZ M;  1XMQ M;  4PD2 A;  3SAU A;  3TWL A;  1Z5C A;  1Q3B A;  4JI5 M;  2VQF M;  4DV1 M;  5IT9 S;  3SAT A;  2ZBK B;  1I94 M;  2HKJ A;  3GQ4 A;  1EE8 A;  4LF6 M;  5ITT A;  3GQ3 A;  2EA0 A;  3U6P A;  4AQY M;  3W0F A;  5BR8 M;  1R2Y A;  1N33 M;  5LMN M;  3GPX A;  4JI0 M;  4DR2 M;  4JV5 M;  4G4Q A;  1XC8 A;  4X66 M;  4DV3 M;  3VK7 A;  1NNJ A;  4JI7 M;  4LFC M;  4LF5 M;  3U6C A;  3U6S A;  3A42 A;  2UUC M;  2UXC M;  3A45 A;  3U6E A;  1N36 M;  1XNR M;  5ITU A;  4K0K M;  4DV4 M;  1XMO M;  4LF7 M;  4JI2 M;  5ITY A;  5A2Q S;  3OTO M;  3GP1 A;  3GQ5 A;  3U6O A;  1K3X A;  2VQE M;  2HHH M;  1HNX M;  2F5S A;  3J81 S;  4G4R A;  5FLX S;  1KFV A;  1N32 M;  3TWM A;  5ITX E;  4DR6 M;  5LMU M;  4X62 M;  1FJG M;  4NXN M;  3GO8 A;  1IBL M;  3U6D A;  2XZF A;  4G4O A;  2UXB M;  4X64 M;  4DUY M;  3T1Y M;  1L1Z A;  4GKJ M;  3TWK A;  4B3R M;  4LF8 M;  1N34 M;  4JI4 M;  5ITQ A;  2Q2E B;  1Q3C A;  4MB7 A;  3GPY A;  1PJI A;  1XNQ M;  5IWA M;  3SAR A;  2UUB M;  4NXM M;  1TDZ A;  4YY3 M;  4DR4 M;  1MX0 A;  4LFA M;  1HR0 M;  4B3M M;  1L1T A;  4JI3 M;  3SAW A;  3SBJ A;  4JI1 M;  2F5O A;  3GPU A;  4DUZ M; 
#chains in the Genus database with same CATH topology
 3MMP A;  2RKO A;  3BBZ A;  2QHO B;  3BOS A;  1NJG A;  3KXE C;  1DGH A;  3LW5 F;  4XGI A;  4CHT B;  4ITQ A;  2LVO C;  3B7Z A;  3FE3 A;  4HL4 A;  4OW0 A;  5EP1 A;  2F5N A;  1IBM M;  1T6O A;  1MU5 A;  1NVM A;  3A98 B;  4IBD A;  3C9P A;  1MN3 A;  3AOG A;  3HGI A;  3LMM A;  2LNH C;  3T1H M;  4PDG A;  4LFB M;  1DGH B;  1Q39 A;  1QDR A;  4LJ9 A;  4XBO A;  5C1B A;  1TTE A;  2CRU A;  2JZ0 A;  2KEB A;  5FTK A;  4OU7 A;  2UU9 M;  2O25 A;  1G3I A;  2I7N A;  2R45 A;  2LVQ D;  2R0I A;  1PJJ A;  1R2Z A;  3U6M A;  3K92 A;  3GPP A;  3W68 A;  3U6Q A;  3GLF E;  1W5S A;  4NSR A;  3FUU A;  2L2D A;  2JZ1 A;  2Y0T A;  3DFZ A;  4M9S A;  1T3T A;  4PCZ A;  4KLN A;  4LJA A;  3LCU A;  1V92 A;  3GLF A;  4DV7 M;  4LF9 M;  3MK6 A;  4JI8 M;  1E94 E;  5EXS A;  2JNH A;  2DAE A;  2RGO A;  4LJ7 A;  4DR3 M;  2C9C A;  2KNA A;  4DV0 M;  1Z5B A;  3DOA A;  4JXJ A;  4B7H A;  1A5T A;  2JY5 A;  1ZMW A;  1L2C A;  4B3T M;  3IG8 A;  3RGS A;  1SXJ A;  1S3S A;  3HJS A;  2DWN A;  1VEK A;  4G6Z A;  2JP7 A;  5EQT A;  1QZE A;  2VQF M;  3GLG A;  1OTR A;  3GQ4 A;  3KSX A;  4RF0 A;  3FYC A;  5ITT A;  2LXE A;  3V76 A;  2EA0 A;  3U6P A;  1IY0 A;  1QZM A;  2KRK A;  2DAK A;  1IN6 A;  2HWJ A;  3HJQ A;  2C5R A;  2XGN A;  3QYE A;  2AHM A;  1XWI A;  4IBB A;  4WP2 A;  2KRU A;  1PGY A;  3THG A;  3GRV A;  4FD2 A;  2WZJ A;  4IBG A;  3GLF B;  4P17 A;  3VK7 A;  1HJP A;  4MM3 B;  1R4G A;  2QCU A;  4I81 A;  5FTM A;  3SYK A;  2UXC M;  2FE8 A;  3L2A A;  3CTW B;  4LF7 M;  3OTO M;  4BB9 A;  3T6P A;  3J2P B;  2HHH M;  5DFL A;  5DNY A;  2KXE A;  2JUJ A;  3U6D A;  1PRB A;  2MRO B;  4M0W A;  2W82 A;  2XZF A;  2JY7 A;  3LVW A;  3TQS A;  3H4M A;  2FS1 A;  1DGB A;  3UMM A;  1FNN A;  2UXB M;  3LQQ A;  3B89 A;  3T1Y M;  4GKJ M;  3CF0 A;  3R9X B;  3TWK A;  3ZCB B;  4B3R M;  3E9S A;  1RU3 A;  5FSW A;  3MJ5 A;  3C3E A;  4UN2 B;  1N34 M;  1UFZ A;  2DAI A;  3LCV B;  1Q3C A;  4GIP A;  4I8O A;  1PJQ A;  4HEO A;  4Z6Y A;  1QVR A;  4QHS A;  1QDT A;  5EP2 A;  4I4L A;  2K47 A;  3IG5 A;  5KPZ A;  3FTE A;  4Y28 F;  1Z6T A;  2BNK A;  3FRI A;  4GIT A;  4IIW A;  4D81 A;  3QYB A;  4AKH A;  3AKZ A;  4LFA M;  3GLI E;  4B3M M;  2QBY B;  1OKS A;  4JI1 M;  2QEN A;  1GJS A;  3LVV A;  2X49 A;  4L8R C;  1EIJ A;  2G8L A;  2I7P A;  1IN4 A;  3HX3 A;  3VK8 A;  2YQZ A;  4L4U A;  1J09 A;  3FUW A;  3JAM S;  3U60 A;  3SFZ A;  2LVN C;  1TR8 A;  4Z8X A;  2XLJ A;  3JR5 A;  5BPV A;  4NOO B;  3B7N A;  4DR5 M;  3B7Q A;  1QUT A;  3I51 A;  2BWE A;  1IN7 A;  1GJT A;  1DGF A;  1QAM A;  1TH3 A;  1OQY A;  2DAM A;  2JY6 B;  4GRI A;  3F92 A;  2YR0 A;  1H6U A;  3KS4 A;  3AL0 C;  2DWL A;  1DO2 A;  1W5T A;  3I01 M;  5JI3 E;  4NL4 H;  1NJF A;  3Q8G A;  3M6A A;  2MH8 A;  1WGL A;  4DV2 M;  3FTD A;  2XEP A;  2L7I A;  4MGK E;  1Z59 A;  3J80 S;  2ZM6 M;  1P3Q Q;  1WR1 B;  1IY1 A;  4DR7 M;  3L27 A;  4XK8 F;  4ZPX A;  2J7N A;  1XB2 B;  3VKG A;  4LZJ A;  2O5R A;  1IY2 A;  2VDB B;  4GH9 A;  5DYI A;  3RE8 A;  3H4J A;  2L6O A;  2R46 A;  1D2N A;  3EIE A;  4BLC A;  5ITR A;  2GQF A;  5GKN A;  1SXJ B;  1OIP A;  1G4A E;  2KHH A;  4OX9 M;  2H1R A;  2X4A A;  5EXX A;  2XZU A;  4KO8 A;  2R18 A;  3E21 A;  2C99 A;  2WSC F;  5ITX A;  1GL7 A;  1G71 A;  3SYL A;  1XHB A;  1JQJ C;  5FTL A;  4X65 M;  2ZTD A;  4LG2 A;  3KSJ A;  3FTF A;  4OVZ B;  3GLI A;  3UZU A;  3SAU A;  4LZZ A;  2EO2 A;  3PVS A;  3KP1 E;  4L6V 6;  4JI5 M;  4P16 A;  4L78 A;  4DV1 M;  5IT9 S;  1JR3 A;  2ZBK B;  3C3D A;  4DBG B;  1I4W A;  1ZMV A;  2HKJ A;  2G3Q A;  4IBE A;  1R2Y A;  4AQY M;  4IBI A;  1Y8G A;  4WW0 A;  2QBY A;  1N33 M;  4DR2 M;  1VDL A;  1OAI A;  4GHA A;  2LBC A;  2V6Z M;  4LJ5 A;  4G4Q A;  1DO0 A;  2EJS A;  4DV3 M;  2L4E A;  4R71 A;  3K8Z A;  4JI7 M;  3KS8 A;  4LF5 M;  3U6S A;  2CHQ A;  3A42 A;  1HT1 E;  1JR3 D;  3KP0 E;  4BBA A;  3GRU A;  4FWG A;  4REZ A;  1XNR M;  1DV0 A;  1WJ7 A;  3AFH A;  1XMO M;  4JI2 M;  2FOI C;  1VQ1 A;  3GP1 A;  2LVP C;  1K3X A;  4IBK A;  2V1U A;  2YFQ A;  3Q8X A;  3CGW A;  2CFO A;  2F5S A;  1D0L A;  3J81 S;  4G4R A;  1ZV1 A;  3B9P A;  3TE6 A;  1E9R A;  2ERC A;  3FUX A;  3L29 A;  4FCW A;  5KO3 A;  5LMU M;  1FJG M;  1IXR C;  4QOS A;  3D8B A;  3FUT A;  4M9X A;  5L8R F;  2FNA A;  4LJ4 A;  1OIZ A;  3IEC A;  2KW0 A;  3L25 A;  3KOW E;  1JR3 E;  2N35 A;  2V1C A;  1AIP C;  4MH0 E;  4QOZ C;  2APL A;  2OOA A;  4AG6 A;  4CGY B;  2X8A A;  5KQD A;  2R4E A;  3HU2 A;  3GLI B;  4NXM M;  4DR4 M;  3HWS A;  1MX0 A;  1SXJ E;  2NQ8 C;  3TPZ A;  3GLG B;  1L1T A;  2QZ4 A;  2CEA A;  2VF7 A;  1VDD A;  4JI3 M;  3SBJ A;  1LV7 A;  3QWL A;  4M0D A;  1QQW A;  2J5Y A;  2H5X A;  4RNA A;  4MGZ E;  3ZH9 B;  3GPU A;  2DVW B;  1XXH A;  1TH4 A;  3GRR A;  3NWL A;  3W0L B;  4DUZ M;  4G4N A;  2K6B A;  2LTU A;  2D7H A;  4YHH M;  1V34 A;  4B7G A;  4GC9 A;  5KPT A;  5F3W A;  4B3S M;  3UK6 A;  2Z3X A;  4AKI A;  2DHY A;  1QUS A;  3BXW A;  4CIZ A;  1DGG A;  1TF0 B;  1QAQ A;  4JN6 A;  2CWB A;  3KVW A;  4NRV A;  2CP8 A;  2DXI A;  2DAG A;  4GHL A;  2KA6 B;  3M7G A;  3MHV C;  1GKI A;  1OFH A;  2QQ8 A;  3IHP A;  2F5Q A;  2K0B X;  1SXJ C;  2DWM A;  5EP3 A;  1R6B X;  2GNO A;  2KZU A;  2XF3 A;  2XH9 A;  4MGY E;  1HNW M;  1HQY E;  1Q02 A;  2L09 A;  3C58 A;  1J5E M;  3PFI A;  3WHK A;  2DI0 A;  1D0K A;  2D7E A;  2F5P A;  2DZL A;  3KOY E;  1NY5 A;  2BJV A;  3SAV A;  1SG9 A;  3UGJ A;  4FVM A;  5KPR A;  2JWS A;  3FKE A;  3J27 B;  4MGH A;  2DZO B;  3AOE A;  4GKK M;  1ZAE A;  1OAO C;  3U6L A;  4IJE A;  4PT5 A;  3ZC7 B;  5H37 D;  3A46 A;  3FYD A;  4JYA M;  4IBF A;  4B08 A;  1L2B A;  2XSZ D;  1IXZ A;  1PJS A;  1VG5 A;  1D0M A;  4CIS A;  1WHC A;  3VKH A;  1NV8 A;  4PD2 A;  1XMQ M;  2EKK A;  1Q3B A;  3EIH A;  3SAT A;  4AZF A;  4LF6 M;  3HHY A;  2DZN B;  1WIV A;  2G5G X;  3D8L A;  3KW6 A;  2QNJ A;  4JI0 M;  3K9O A;  4OVZ A;  1VEG A;  1YSY A;  1ZQ9 A;  2QSF X;  3B74 A;  3HKP A;  1TGU A;  3GLH B;  2FH0 A;  1IXS A;  3L26 A;  2O01 F;  1XC8 A;  2DNA A;  4X66 M;  2KNZ A;  3L28 A;  3M0E A;  3U6C A;  2XFS A;  3A45 A;  1R5L A;  4LY6 A;  3I4Y A;  3J7B A;  5ITY A;  4ANR A;  5A2Q S;  4G3O A;  1QYR A;  3GQ5 A;  3U6O A;  2CV2 A;  3DZD A;  3SMP A;  3I04 M;  1IQP A;  1QAN A;  4AW4 A;  1HNX M;  2C9O A;  2L4F A;  4L15 A;  4FWH A;  5FLX S;  3U61 A;  3U5Z A;  3VLF B;  2Z7J A;  3TWM A;  5ITX E;  2CE7 A;  4DR6 M;  1UM8 A;  1OJL A;  4X62 M;  3SHG B;  2LH0 A;  1IBL M;  2VII A;  4NSO B;  2EUC A;  1KYI A;  1WXQ A;  3CF2 A;  3VFD A;  4X64 M;  4DUY M;  2Y0Q A;  1YE9 A;  5E6J A;  1GLN A;  1L1Z A;  3GLH A;  4M9Z A;  3UJN A;  5E26 A;  1GVN A;  1NO1 A;  2R65 A;  4AG5 A;  3K2L A;  4A3V B;  1N77 A;  4JI4 M;  2Q2E B;  4LGM A;  3GLG E;  2JY8 A;  2OOB A;  1XNQ M;  5IWA M;  2UUA M;  2R44 A;  1VEJ A;  2UUB M;  1TDZ A;  5C18 A;  2CHG A;  3E46 A;  2CV1 A;  3SMS A;  4L16 A;  1EFU B;  1MJG M;  2KNV A;  1NHW C;  3HJ8 A;  2C98 A;  2MR9 A;  5EJC A;  4I5S A;  1N32 M;  1NY6 A;  1C7Y A;  2EKF A;  3RGP A;  4DR1 M;  4NC6 A;  2DWZ B;  1IBK M;  3T38 A;  3SHF A;  4NRW A;  1IXS B;  2CV0 A;  4HLQ A;  1GAB A;  2UXD M;  4DV5 M;  3HHW A;  1PM5 A;  1XXH E;  1IN5 A;  3GRY A;  2M60 A;  2QPA A;  3SAS A;  2CUZ A;  3PXG A;  1GO5 A;  2OPF A;  1Z5A A;  3U60 B;  2DHR A;  1G59 A;  3VDU A;  2ZAM A;  2HAK A;  1QAO A;  5EXT A;  3JR4 A;  4KHP M;  1L2D A;  2A5Y B;  2R62 A;  1G41 A;  3WHL A;  1BVS A;  1E32 A;  1R7R A;  2Z4R A;  4QNM A;  1K3W A;  2HCB A;  3HZJ A;  4PDI A;  4S12 A;  3W67 A;  4WUR A;  4GEW A;  3AV0 A;  4AKG A;  5IZ7 D;  1G8P A;  1TDH A;  2ZAO A;  3FRH A;  4FWD A;  1TH2 A;  4B7F A;  1NHG C;  1NV9 A;  4DV6 M;  2VF8 A;  3KDS E;  4LGY A;  4EIW A;  2OQ4 A;  4II7 A;  1K82 A;  2DKL A;  2QP9 X;  4JI6 M;  2LHC A;  3AJI B;  3CF6 E;  2F4V M;  2J7O A;  3VDP A;  4D80 A;  5DYG A;  2Y20 A;  4GMQ A;  3J7A S;  2RGH A;  7CAT A;  4LRS A;  1F4I A;  4F1I A;  4LF4 M;  1HNZ M;  3ILK A;  1AUA A;  3I4V A;  3TWL A;  1Z5C A;  2ZAN A;  1HQC A;  1PJT A;  2R6F A;  4IJF A;  1T43 A;  2K9D A;  4RF1 A;  8CAT A;  1LTM A;  3R8F A;  4TUW A;  1GL6 A;  4FCT A;  1I94 M;  3RFW A;  3KFU G;  1EE8 A;  1V33 A;  4LJ6 A;  5EP4 A;  3GQ3 A;  2WSE F;  2OO9 A;  3PNV A;  3W0F A;  5BR8 M;  3KOX E;  3GLH E;  3K1J A;  4KT0 F;  1J7K A;  2MJ5 B;  1CUK A;  3GPX A;  5LMN M;  1NSF A;  1C1K A;  3NBX X;  4LJ8 A;  4KOD A;  1IM2 A;  4JV5 M;  2XFT A;  1WGN A;  3AOE C;  3HU3 A;  4LCB A;  3U61 B;  2JXN A;  2KDL A;  1NNJ A;  3U5Z B;  4LFC M;  2LWX A;  4RKU F;  2D7G A;  3FUV A;  3TL4 X;  2UUC M;  4MGI E;  1X37 A;  4AI6 A;  3U6E A;  1N36 M;  4K0K M;  5ITU A;  4DV4 M;  3HY5 A;  2Z8Y M;  5IRE B;  2BWB A;  3QAU A;  2VQE M;  2C96 A;  2Z4S A;  2M5Z A;  4FCV A;  4QHT A;  4W5W A;  5EXP A;  2B3T A;  4IBC A;  1YLA A;  3NBI A;  3HHZ A;  1KFV A;  3HU1 A;  3T15 A;  3ZQJ A;  2XSZ A;  3FTC A;  2FFJ A;  2RRU A;  3DA1 A;  4D82 A;  2HL7 A;  1N75 A;  5KQ8 A;  4NXN M;  3GO8 A;  4LRT A;  1XXH B;  4IBJ A;  4GC5 A;  3HHX A;  4QNR A;  4G4O A;  1ZMU A;  5FTN A;  1L8Q A;  1NNU C;  1YUB A;  2L7H A;  3PNY A;  2BJW A;  3SC3 A;  2P5T A;  3LQR A;  2CHV A;  2KZS A;  4Q7J A;  2DEN A;  1IN8 A;  4LF8 M;  2JA2 A;  1OFI A;  1SXJ D;  1JB0 F;  5ITQ A;  4CJ6 A;  4MB7 A;  3GPY A;  2LVA A;  1PJI A;  2MGW A;  4F2L A;  1N78 A;  3SAR A;  4R3D A;  1E9S A;  2E5L M;  2ZTC A;  1ORY B;  2YNM D;  3FD9 A;  4YY3 M;  3E4R A;  1KSF X;  5JI2 E;  4R7G A;  4FW9 A;  3KOZ E;  2R4J A;  2WSF F;  5FTJ A;  1HR0 M;  1IFY A;  3K9P A;  3SAW A;  2Y21 A;  2LHG A;  2F5O A;  1HT2 E; 
#chains in the Genus database with same CATH homology
 2UUA M;  2RKO A;  3BOS A;  3KXE C;  4ITQ A;  1NJG A;  4CHT B;  1DGH A;  4XGI A;  5EP1 A;  4HL4 A;  4OW0 A;  2F5N A;  1IBM M;  1MU5 A;  1NVM A;  3A98 B;  4IBD A;  3AOG A;  3HGI A;  3LMM A;  2LNH C;  3T1H M;  4PDG A;  4LFB M;  1DGH B;  1Q39 A;  4LJ9 A;  4XBO A;  5C1B A;  2KEB A;  4OU7 A;  5FTK A;  2UU9 M;  1G3I A;  2I7N A;  2R45 A;  1PJJ A;  1R2Z A;  3U6M A;  3K92 A;  3GPP A;  3U6Q A;  1W5S A;  4NSR A;  3FUU A;  2Y0T A;  4M9S A;  3DFZ A;  4PCZ A;  1T3T A;  4KLN A;  4LJA A;  4DV7 M;  3GLF A;  4LF9 M;  3MK6 A;  4JI8 M;  1E94 E;  5EXS A;  2RGO A;  4LJ7 A;  4DR3 M;  2C9C A;  4DV0 M;  1Z5B A;  3DOA A;  4JXJ A;  4B7H A;  1L2C A;  4B3T M;  3IG8 A;  3RGS A;  1SXJ A;  1S3S A;  3HJS A;  2DWN A;  4G6Z A;  2VQF M;  5EQT A;  3GLG A;  3GQ4 A;  3KSX A;  4RF0 A;  3FYC A;  5ITT A;  2LXE A;  2EA0 A;  3U6P A;  2C5R A;  1IY0 A;  1QZM A;  2KRK A;  3HJQ A;  1IN6 A;  2XGN A;  2AHM A;  1XWI A;  4IBB A;  2KRU A;  3THG A;  3GRV A;  4FD2 A;  4IBG A;  3GLF B;  3VK7 A;  4MM3 B;  2QCU A;  4I81 A;  5FTM A;  3SYK A;  2UXC M;  2FE8 A;  3L2A A;  3CTW B;  4LF7 M;  3OTO M;  4BB9 A;  3J2P B;  2HHH M;  5DNY A;  2KXE A;  3U6D A;  4M0W A;  2W82 A;  2XZF A;  3LVW A;  3TQS A;  3H4M A;  2UXB M;  1DGB A;  3UMM A;  1FNN A;  3LQQ A;  3T1Y M;  4GKJ M;  3CF0 A;  3R9X B;  3TWK A;  3ZCB B;  4B3R M;  3E9S A;  5FSW A;  3MJ5 A;  1N34 M;  1Q3C A;  4GIP A;  4I8O A;  4Z6Y A;  1QVR A;  4QHS A;  5EP2 A;  4I4L A;  2K47 A;  3IG5 A;  5KPZ A;  3FTE A;  1Z6T A;  2BNK A;  4GIT A;  4IIW A;  4D81 A;  4AKH A;  3AKZ A;  4LFA M;  4B3M M;  2QBY B;  4JI1 M;  2QEN A;  3LVV A;  2X49 A;  4L8R C;  2G8L A;  2I7P A;  1IN4 A;  3VK8 A;  2YQZ A;  4L4U A;  1J09 A;  3FUW A;  3JAM S;  3U60 A;  3SFZ A;  4Z8X A;  2XLJ A;  3JR5 A;  5BPV A;  4NOO B;  4DR5 M;  2E5L M;  1L2D A;  3I51 A;  1IN7 A;  1TH3 A;  1DGF A;  1QAM A;  4GRI A;  2YR0 A;  1H6U A;  3KS4 A;  3AL0 C;  2DWL A;  1DO2 A;  1W5T A;  5JI3 E;  4NL4 H;  1NJF A;  3M6A A;  4DV2 M;  3FTD A;  2XEP A;  2L7I A;  4MGK E;  1Z59 A;  3J80 S;  2ZM6 M;  4DR7 M;  1IY1 A;  3L27 A;  4ZPX A;  2J7N A;  3VKG A;  4LZJ A;  2O5R A;  1IY2 A;  5DYI A;  4GH9 A;  3RE8 A;  5ITR A;  2L6O A;  2R46 A;  1D2N A;  3EIE A;  4BLC A;  5GKN A;  1SXJ B;  1G4A E;  4OX9 M;  2H1R A;  2X4A A;  5EXX A;  2XZU A;  4KO8 A;  2R18 A;  2C99 A;  5ITX A;  1GL7 A;  3SYL A;  1XHB A;  1JQJ C;  5FTL A;  4X65 M;  4LG2 A;  3KSJ A;  3FTF A;  4OVZ B;  3GLI A;  3UZU A;  3SAU A;  4LZZ A;  2EO2 A;  3PVS A;  3KP1 E;  4JI5 M;  4P16 A;  4L78 A;  4DV1 M;  5IT9 S;  1JR3 A;  2ZBK B;  1I4W A;  2HKJ A;  4IBE A;  1R2Y A;  4AQY M;  4IBI A;  2QBY A;  4WW0 A;  1N33 M;  4DR2 M;  4GHA A;  2V6Z M;  4LJ5 A;  4G4Q A;  1DO0 A;  4DV3 M;  3K8Z A;  4JI7 M;  4LF5 M;  3U6S A;  2CHQ A;  3A42 A;  1HT1 E;  1JR3 D;  3KP0 E;  4BBA A;  3GRU A;  4FWG A;  4REZ A;  1XNR M;  1XMO M;  3AFH A;  4JI2 M;  2FOI C;  3GP1 A;  1K3X A;  4IBK A;  2V1U A;  2YFQ A;  3Q8X A;  2CFO A;  2F5S A;  3J81 S;  4G4R A;  3B9P A;  3TE6 A;  1E9R A;  2ERC A;  3FUX A;  3L29 A;  4FCW A;  5KO3 A;  5LMU M;  1FJG M;  1IXR C;  4QOS A;  3D8B A;  3FUT A;  4M9X A;  2FNA A;  4LJ4 A;  2KW0 A;  3L25 A;  3KOW E;  2V1C A;  4MH0 E;  4QOZ C;  4AG6 A;  4CGY B;  5KQD A;  2X8A A;  2R4E A;  3HU2 A;  3GLI B;  4NXM M;  4DR4 M;  3HWS A;  1MX0 A;  1SXJ E;  2NQ8 C;  3TPZ A;  3GLG B;  1L1T A;  2QZ4 A;  2CEA A;  1VDD A;  4JI3 M;  3SBJ A;  1LV7 A;  3QWL A;  4M0D A;  1QQW A;  3ZH9 B;  4RNA A;  3GPU A;  4MGZ E;  2DVW B;  3NWL A;  3GRR A;  1XXH A;  1TH4 A;  3W0L B;  4DUZ M;  4G4N A;  5F3W A;  4B3S M;  2D7H A;  4YHH M;  4KHP M;  4B7G A;  4GC9 A;  5KPT A;  3UK6 A;  2Z3X A;  4AKI A;  1DGG A;  1QAQ A;  4JN6 A;  3KVW A;  4NRV A;  4GHL A;  2DXI A;  2KA6 B;  3M7G A;  3MHV C;  1GKI A;  1OFH A;  2F5Q A;  1SXJ C;  2DWM A;  5EP3 A;  1R6B X;  2XF3 A;  2KZU A;  4MGY E;  2XH9 A;  1HNW M;  1HQY E;  2L09 A;  3C58 A;  1J5E M;  3PFI A;  3WHK A;  2D7E A;  2F5P A;  3KOY E;  1NY5 A;  2BJV A;  3SAV A;  3UGJ A;  4FVM A;  5KPR A;  3FKE A;  3J27 B;  4MGH A;  2DZO B;  3AOE A;  4GKK M;  1ZAE A;  3U6L A;  4IJE A;  4PT5 A;  3ZC7 B;  5H37 D;  3A46 A;  3FYD A;  4JYA M;  4IBF A;  4B08 A;  1L2B A;  2XSZ D;  1IXZ A;  4CIS A;  3VKH A;  1XMQ M;  4PD2 A;  1Q3B A;  3EIH A;  3SAT A;  4AZF A;  4LF6 M;  3HHY A;  2DZN B;  2G5G X;  3D8L A;  3KW6 A;  4JI0 M;  4OVZ A;  1ZQ9 A;  1YSY A;  3HKP A;  1TGU A;  3GLH B;  3L26 A;  1XC8 A;  4X66 M;  3L28 A;  3M0E A;  3U6C A;  2XFS A;  3A45 A;  4LY6 A;  3I4Y A;  3J7B A;  5ITY A;  5A2Q S;  3GQ5 A;  1QYR A;  3U6O A;  2CV2 A;  3DZD A;  3SMP A;  1IQP A;  1QAN A;  4AW4 A;  1HNX M;  2C9O A;  4L15 A;  5FLX S;  4FWH A;  3U61 A;  3U5Z A;  3VLF B;  2Z7J A;  3TWM A;  5ITX E;  2CE7 A;  4DR6 M;  1UM8 A;  1OJL A;  4X62 M;  3SHG B;  2LH0 A;  1IBL M;  2VII A;  4NSO B;  2EUC A;  1KYI A;  1WXQ A;  3CF2 A;  3VFD A;  4X64 M;  4DUY M;  2Y0Q A;  1YE9 A;  5E6J A;  1GLN A;  1L1Z A;  3GLH A;  4M9Z A;  3UJN A;  5E26 A;  1GVN A;  2R65 A;  4AG5 A;  3K2L A;  4A3V B;  1N77 A;  4JI4 M;  2Q2E B;  4LGM A;  1XNQ M;  5IWA M;  2UUB M;  1TDZ A;  5C18 A;  2CHG A;  2CV1 A;  3SMS A;  4L16 A;  1NHW C;  3HJ8 A;  2C98 A;  5EJC A;  4I5S A;  1NY6 A;  3RGP A;  4DR1 M;  2DWZ B;  1IBK M;  3T38 A;  3SHF A;  4NRW A;  1IXS B;  2CV0 A;  4HLQ A;  2UXD M;  4DV5 M;  3HHW A;  1PM5 A;  1IN5 A;  3GRY A;  2M60 A;  2QPA A;  3SAS A;  2CUZ A;  3PXG A;  2OPF A;  1Z5A A;  3U60 B;  2DHR A;  1G59 A;  3VDU A;  2ZAM A;  5EXT A;  1QAO A;  3JR4 A;  2A5Y B;  2R62 A;  1G41 A;  3WHL A;  1E32 A;  1R7R A;  2Z4R A;  4QNM A;  1K3W A;  2HCB A;  4PDI A;  4S12 A;  4WUR A;  3AV0 A;  4AKG A;  5IZ7 D;  1G8P A;  1TDH A;  2ZAO A;  4FWD A;  1TH2 A;  4B7F A;  1NHG C;  4DV6 M;  4LGY A;  3KDS E;  2OQ4 A;  4EIW A;  1K82 A;  4II7 A;  4JI6 M;  2QP9 X;  2F4V M;  3AJI B;  3CF6 E;  2J7O A;  3VDP A;  4D80 A;  5DYG A;  2Y20 A;  4GMQ A;  3J7A S;  2RGH A;  7CAT A;  4LRS A;  4LF4 M;  1HNZ M;  3ILK A;  3I4V A;  3TWL A;  1Z5C A;  2ZAN A;  1HQC A;  4IJF A;  4RF1 A;  8CAT A;  3KS8 A;  3R8F A;  4TUW A;  1GL6 A;  4FCT A;  1I94 M;  3RFW A;  3KFU G;  1EE8 A;  4LJ6 A;  5EP4 A;  3GQ3 A;  3W0F A;  3PNV A;  5BR8 M;  3KOX E;  3K1J A;  3GPX A;  1J7K A;  5LMN M;  4JV5 M;  1NSF A;  1C1K A;  4LJ8 A;  4KOD A;  1IM2 A;  2XFT A;  3AOE C;  3HU3 A;  4LCB A;  3U61 B;  1NNJ A;  3U5Z B;  4LFC M;  2LWX A;  2D7G A;  3FUV A;  3TL4 X;  2UUC M;  4MGI E;  1X37 A;  4AI6 A;  3U6E A;  1N36 M;  4K0K M;  5ITU A;  4DV4 M;  5IRE B;  3QAU A;  2VQE M;  2C96 A;  2Z4S A;  2M5Z A;  4FCV A;  4QHT A;  4W5W A;  5EXP A;  3HHZ A;  4IBC A;  1KFV A;  3NBI A;  1N32 M;  3HU1 A;  3T15 A;  2XSZ A;  3FTC A;  2FFJ A;  3DA1 A;  4D82 A;  2HL7 A;  1N75 A;  5KQ8 A;  4NXN M;  3GO8 A;  4LRT A;  1XXH B;  4IBJ A;  4GC5 A;  3HHX A;  4QNR A;  4G4O A;  5FTN A;  1L8Q A;  1NNU C;  1YUB A;  2L7H A;  3PNY A;  2BJW A;  3SC3 A;  2P5T A;  3LQR A;  2CHV A;  2KZS A;  1IN8 A;  4LF8 M;  2JA2 A;  1OFI A;  1SXJ D;  5ITQ A;  4MB7 A;  3GPY A;  1PJI A;  1N78 A;  3SAR A;  4R3D A;  1E9S A;  1ORY B;  2YNM D;  3FD9 A;  4YY3 M;  3E4R A;  1KSF X;  5JI2 E;  4R7G A;  4FW9 A;  3KOZ E;  2R4J A;  5FTJ A;  1HR0 M;  3SAW A;  2Y21 A;  2F5O A;  1HT2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...