2OQ4A

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
262
structure length
252
Chain Sequence
PQGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGLFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*G*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*GP*G)-3'
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrates and mutations of critical residues
rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 74
structure length 252
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2oq4A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2oq4A01
1L1ZA 1Z5BA 3A45A 1N32M 2HHHM 2XZFA 1IBKM 4LFCM 3TWMA 1KFVA 5ITXE 4NRVA 4LFBM 4G4OA 1N36M 5ITYA 3GPYA 1Q39A 4B3MM 4JI1M 1Z5CA 3GQ5A 1K3XA 4LF8M 4GKJM 4DR3M 3SATA 1TDHA 4ITQA 4DUYM 4LFAM 3SASA 3SAUA 4B3SM 2VQEM 3T1YM 2ZM6M 3TWLA 4JI8M 1L2CA 3A42A 1R2YA 3J7AS 4YHHM 2UU9M 1IBLM 4PCZA 1R2ZA 5ITXA 2UXBM 3OTOM 2VQFM 1N34M 2HKJA 4DR7M 3U6EA 4DV7M 4X66M 4DR4M 1HR0M 3T1HM 4B3RM 3SAVA 4LF7M 4NRWA 2XZUA 4JI2M 1Z5AA 4NXNM 3SBJA 2F5PA 3SARA 4OX9M 3VK7A 4DV1M 4DV0M 1HNXM 5ITUA 4JI4M 3J80S 1L2DA 4LF9M 5FLXS 3GO8A 4JI6M 1MX0A 4PD2A 1HNZM 3U6PA 2UUCM 5ITTA 1TDZA 2ZBKB 5IT9S 2Q2EB 1FJGM 4DV5M 1L2BA 1Q3CA 4CISA 4JI7M 2F4VM 3GQ3A 4K0KM 4JI3M 4B3TM 3GPUA 4JYAM 1EE8A 4X65M 3GQ4A 3U6OA 4LF5M 5IWAM 4MB7A 3U6LA 1PM5A 1Z59A 1NNJA 4G4QA 3DOAA 4G4RA 1K3WA 4DV6M 2UXDM 3C58A 1I94M 4X64M 5A2QS 1J5EM 1XNQM 4X62M 1XNRM 5ITRA 1L1TA 3GP1A 3U6DA 4JI0M 1PJIA 5ITQA 4NXMM 4LF4M 3A46A 3U6SA 5BR8M 2F5SA 4DR5M 2UXCM 1XMOM 5LMUM 4LF6M 1PJJA 3JAMS 2OPFA 3VK8A 2EA0A 3GPXA 4DV4M 3W0FA 4DV3M 3SAWA 4DV2M 4DR2M 4GKKM 3TWKA 4JI5M 1XC8A 2E5LM 2UUAM 4DUZM 3JR4A 4KHPM 3U6MA 2F5OA 1N33M 3JR5A 4PDGA 3J81S 3GPPA 1XMQM 2OQ4A 4G4NA 3U6CA 2F5NA 2F5QA 4DR1M 1Q3BA 1HNWM 4JV5M 2UUBM 4AQYM 4YY3M 1IBMM 4PDIA 1MU5A 4DR6M 3U6QA 5LMNM 1K82A
chains in the Genus database with same CATH superfamily
3LW5F 2C99A 4P16A 2EKKA 2R46A 2HHHM 4LFCM 2P5TA 4ANRA 1KFVA 4NSOB 1QZEA 3IG5A 3KS8A 4L16A 4MGKE 1IM2A 2RRUA 4II7A 3K92A 2XF3A 2EKFA 4MGYE 4OVZB 3IHPA 3L2AA 2KNVA 4DUYM 1D2NA 3SASA 3SAUA 1AUAA 2EO2A 1TF0B 4AW4A 2VQEM 3T1YM 3R9XB 3B7ZA 2R4JA 4GMQA 2CHGA 2OOBA 2V6ZM 1DV0A 1NVMA 2JZ0A 4YHHM 2DWZB 1OTRA 2DAEA 5ITXA 2XH9A 4GITA 3J27B 4I8OA 4FW9A 2DZNB 2MJ5B 1R6BX 4QNRA 3U6EA 4DR7M 2Z8YM 1VEJA 4FD2A 3L29A 2K47A 4Z8XA 4LGYA 3SAVA 2XZUA 3UK6A 4IBJA 1JQJC 4QHTA 2R45A 2N35A 1QUTA 1TR8A 2CRUA 2ZTCA 4DV1M 3VK7A 1BVSA 5ITUA 2RGHA 2WSEF 5FTLA 1ZAEA 3LCUA 2H1RA 2QPAA 4GC9A 1EIJA 3RE8A 3SMSA 2KW0A 4IBEA 4DBGB 3K1JA 2O01F 4DV5M 3SHFA 3FUUA 2F4VM 1KYIA 1PJSA 2HL7A 2Y21A 1OIZA 3M6AA 2R6FA 2CV1A 1WGNA 3GPUA 2J5YA 4X65M 3GQ4A 3U6LA 3ZC7B 1T3TA 3WHLA 3FTDA 3AOEA 3QYBA 3FYCA 3H4JA 1KSFX 3CF6E 5EXSA 1TGUA 2LTUA 2JZ1A 2XGNA 2YQZA 4IBFA 2C98A 1NV9A 1NHGC 3Q8GA 2L09A 3I4YA 1WR1B 1L1TA 3B89A 4UN2B 3GP1A 3GRVA 2GQFA 4L8RC 4L15A 2CV0A 1LTMA 1MN3A 5F3WA 5EJCA 2QSFX 3TQSA 1T43A 3IG8A 3QYEA 4LJ7A 4L4UA 3A46A 4OW0A 3A98B 2F5SA 4M9SA 3E4RA 3QWLA 5LMUM 3KDSE 4LJ8A 2R65A 3MK6A 2FS1A 3FUXA 3W0FA 2Y0QA 3W68A 5KO3A 3TL4X 4DR2M 4GKKM 2X49A 3TWKA 4R3DA 4Z6YA 2DWNA 3AFHA 1N77A 4JI5M 3I04M 4LJ5A 4DUZM 2Z4RA 4B7FA 4TUWA 4FCTA 1TH4A 3HJ8A 1P3QQ 3L25A 3W0LB 3J2PB 1I4WA 3FTFA 1SXJA 1HT2E 3FTCA 4QHSA 3U6CA 1IQPA 1GO5A 1QAQA 5DYGA 2K6BA 3V76A 2CHVA 1MU5A 3U6QA 1H6UA 2BWEA 1SXJB 1L1ZA 2XEPA 1YSYA 3HJSA 1VG5A 4REZA 3CGWA 2FH0A 2XZFA 4JXJA 3TWMA 4D82A 2CWBA 2G8LA 2LNHC 1F4IA 1HQCA 5ITXE 1YUBA 1NV8A 3GPYA 3HKPA 4JI1M 4I5SA 4LZZA 2WSFF 1TH2A 3BBZA 3H4MA 4BBAA 1K3XA 4DR3M 3NBIA 1QZMA 3ZCBB 4BB9A 1OJLA 4LJ4A 3Q8XA 4IBCA 4LCBA 2L4EA 4IBGA 1R5LA 1IXZA 4W5WA 1OAIA 1IN4A 3A42A 4LRTA 2UU9M 3AOGA 1IBLM 2L6OA 2UXBM 3KVWA 1VDDA 3EIHA 3OTOM 1WGLA 1OKSA 2L4FA 2FFJA 1GL6A 1PJTA 4MH0E 4DR4M 2QQ8A 2C9OA 1N78A 4NRWA 2KXEA 2ZAOA 5KQDA 2HAKA 3KW6A 5EXXA 1W5TA 1Z5AA 2D7GA 4LJAA 5DFLA 3UJNA 3GLIA 2F5PA 1JR3A 2JY6B 2KRKA 1GLNA 3SARA 2QCUA 4FCWA 4MGHA 4DV0M 2V1UA 4JI4M 3J80S 1DGBA 1DGHA 3NWLA 5EP4A 4NOOB 2LVAA 3WHKA 5FLXS 3GO8A 4L78A 2V1CA 4PD2A 4JI6M 7CATA 1N75A 2EUCA 5IT9S 4PT5A 2R4EA 3GLIB 1UFZA 1Q02A 4XK8F 2XSZA 4I4LA 1OAOC 4KT0F 1L2BA 1DGHB 1TTEA 3D8BA 4FWDA 1E9SA 4AG6A 3KFUG 4JYAM 2KRUA 2CHQA 1HT1E 1FNNA 3U6OA 2JY7A 4MB7A 2QP9X 1GJSA 1DGFA 2DAKA 4IBDA 4DV6M 2C96A 2WZJA 2JY5A 5JI2E 2DKLA 5A2QS 1A5TA 3QAUA 1GVNA 2G3QA 5DYIA 2G5GX 5EXPA 5ITRA 1G4AE 3TE6A 3FTEA 4LRSA 3B7QA 2LH0A 2QNJA 4JI0M 1UM8A 2BWBA 3EIEA 1Z6TA 2KDLA 5KPRA 4D81A 4B08A 2JXNA 1SXJE 1V92A 1VQ1A 1IY1A 1JB0F 2VIIA 3K8ZA 3VDUA 1D0KA 1IY0A 1QUSA 2OOAA 4IBIA 1XMOM 2O5RA 4NC6A 2C9CA 2OPFA 2K9DA 5BPVA 1TH3A 3GPXA 1G41A 3SAWA 3SC3A 3UMMA 2NQ8C 3E46A 2DZLA 4DV2M 5C1BA 1ZMWA 4AG5A 4LJ6A 3F92A 2E5LM 3D8LA 1E32A 1X37A 1IXSA 3B7NA 4GC5A 1OFHA 4AKIA 1W5SA 2CFOA 4RF1A 2F5OA 5KPZA 1IN8A 3UZUA 3HHZA 2GNOA 1XXHE 3CF0A 4PDGA 3JR5A 2O25A 5FTMA 1EFUB 4NSRA 3ZQJA 2DVWB 4FWGA 1IXSB 1ZMUA 2J7NA 4A3VB 2LVPC 2FE8A 4YY3M 1R4GA 1WHCA 1YE9A 1OIPA 1QANA 3SYLA 4PDIA 1NSFA 4EIWA 4R71A 1Z5BA 2LBCA 3M7GA 3HGIA 4Y28F 3LQQA 3GLFA 3B9PA 3FKEA 3LQRA 3PNVA 3RGPA 1MJGM 2CE7A 4CIZA 2DXIA 3SYKA 1IBKM 1ZQ9A 3C3EA 3U5ZA 4NRVA 4LFBM 4MM3B 2ZAMA 4G4OA 1N36M 2QENA 1ZV1A 1Q39A 3VFDA 4B3MM 4IJEA 1Z5CA 3GQ5A 4L6V6 1R7RA 3FUVA 1VDLA 3SATA 3GLIE 2MR9A 1JR3E 4LFAM 1VEGA 2R18A 2QBYA 4XBOA 3L28A 4KO8A 3HU3A 2Z3XA 4KLNA 1AIPC 1IN6A 1NY6A 1E9RA 4HL4A 3J7AS 5DNYA 2LWXA 2JWSA 3HJQA 3I51A 3MMPA 4PCZA 1WIVA 4QOZC 2VQFM 3R8FA 3J7BA 1N34M 2LHGA 1XWIA 4X66M 2KHHA 4RKUF 2ZANA 2CP8A 1XXHA 2AHMA 5JI3E 4JI2M 5FTKA 4NXNM 1ORYB 2CUZA 2DAGA 3U61A 1L2DA 1NJFA 1NHWC 1GJTA 1MX0A 2UUCM 2QHOB 3BXWA 5ITTA 2W82A 1XXHB 2JA2A 4JN6A 2JNHA 4QOSA 2Q2EB 2KZSA 1XB2B 1FJGM 3HHXA 2DWLA 3AV0A 1DO2A 3U61B 3LCVB 4CISA 4GH9A 4JI7M 4FCVA 4G3OA 3PXGA 2MROB 4B3TM 4RNAA 3GRRA 4LF5M 2KA6B 2FNAA 5IWAM 1PM5A 3KOWE 2CEAA 2Y0TA 2UXDM 3DOAA 1VEKA 4IJFA 4G4RA 1K3WA 2VF7A 2D7EA 2KEBA 1GKIA 1J5EM 4AZFA 1HQYE 3E9SA 1PGYA 3LVVA 4I81A 1XNQM 1XHBA 1G3IA 1XNRM 3I4VA 3B74A 4GHAA 1G8PA 2L7IA 1D0LA 3KOZE 3RFWA 3U6DA 4WP2A 5EP1A 2DAMA 4WURA 5IZ7D 3CF2A 1QDTA 2UXCM 5KPTA 4LF6M 3GLGE 2YR0A 3VK8A 2EA0A 2I7NA 4M9ZA 3T6PA 4DV4M 5IREB 2R62A 4DV3M 4OVZA 2YNMD 2LXEA 3GLFE 3FD9A 3HHYA 2ERCA 3JR4A 2RGOA 3KP0E 4LG2A 2YFQA 2JUJA 3DA1A 4KODA 3FYDA 2Z4SA 3FE3A 3AL0C 2LHCA 3GPPA 5KQ8A 1WXQA 2F5NA 2F5QA 1E94E 1G71A 2H5XA 4DR1M 5EQTA 4JV5M 2R0IA 4LJ9A 1SXJD 4NL4H 1V34A 3GRUA 3HU1A 3KSXA 4AI6A 1IBMM 4M0WA 1PJQA 4AKHA 4LGMA 5ITQA 1K82A 3SMPA 2WSCF 3SHGB 5H37D 1DO0A 1IN7A 3A45A 1YLAA 3AKZA 1WJ7A 1N32M 1NO1A 3GLHA 1NNUC 3MJ5A 4XGIA 2QZ4A 5ITYA 2HWJA 4CGYB 3UGJA 1IXRC 4GIPA 4IIWA 3LMMA 3NBXX 4FVMA 5L8RF 3KOXE 4LF8M 2OO9A 4GKJM 3GLHB 3U60A 1TDHA 1CUKA 1V33A 4ITQA 2M5ZA 3KSJA 4CJ6A 5E26A 4B3SM 4OU7A 3I01M 3SFZA 3GLGA 2ZM6M 3TWLA 3HZJA 4JI8M 5FTJA 3HY5A 1L2CA 1IFYA 1L8QA 3U60B 1R2YA 4MGIE 1QDRA 1PRBA 2Y20A 4LZJA 4MGZE 4RF0A 4WW0A 1Y8GA 1R2ZA 3K2LA 2RKOA 2DHRA 3HX3A 2HKJA 3LVWA 3PFIA 3GLGB 4DV7M 1OFIA 3HU2A 5GKNA 2L2DA 3AOEC 1HR0M 1NJGA 3T1HM 4LF7M 4B3RM 1LV7A 1RU3A 5C18A 2X8AA 4AKGA 2DI0A 4G6ZA 1QYRA 3E21A 4IBKA 3GLFB 3SBJA 1T6OA 4OX9M 2VDBB 3HHWA 8CATA 1HNXM 1QAOA 4M9XA 1JR3D 4LF9M 2DNAA 2BJVA 3DFZA 1HNZM 2BNKA 2DHYA 1GL7A 3U6PA 3U5ZB 2Z7JA 2ZBKB 1TDZA 1QVRA 3CTWB 1J7KA 5EP2A 4S12A 3VKGA 2J7OA 2HCBA 4P17A 1IY2A 1Q3CA 2XSZD 3GQ3A 4K0KM 2JP7A 4JI3M 5FSWA 2M60A 2DWMA 2KNZA 1D0MA 4B7HA 1EE8A 3MHVC 2XLJA 2QBYB 3FRIA 5E6JA 3THGA 4GEWA 3L27A 3L26A 3VLFB 1Z59A 2X4AA 4G4QA 1NNJA 2DZOB 1OQYA 1HJPA 3C58A 1I94M 3FUTA 4X64M 3K9PA 2BJWA 3PNYA 3PVSA 3BOSA 3C3DA 4X62M 1S3SA 1IN5A 3RGSA 2FOIC 3GRYA 5EP3A 2DENA 1SXJC 2CV2A 4QNMA 1C1KA 1PJIA 5EXTA 2XFTA 2EJSA 2MH8A 5FTNA 4NXMM 4LF4M 2KNAA 1G59A 2R44A 3U6SA 5BR8M 4DR5M 4GHLA 3VKHA 1NY5A 1PJJA 1QAMA 2ZTDA 3JAMS 4FWHA 2KZUA 1ZMVA 2MGWA 3KS4A 4B7GA 1C7YA 4M0DA 3M0EA 3K9OA 3FUWA 3AJIB 1XC8A 2UUAM 3KOYE 2A5YB 2B3TA 2LVOC 3ZH9B 3TPZA 4D80A 3GLHE 3T38A 4KHPM 4Q7JA 3C9PA 3U6MA 1QQWA 4GRIA 3DZDA 3FRHA 1N33M 3KP1E 2I7PA 4IBBA 2K0BX 4F2LA 3J81S 2C5RA 1XMQM 1GABA 2DAIA 4R7GA 3VDPA 2OQ4A 4BLCA 4G4NA 2LVNC 1Q3BA 2D7HA 2LVQD 4LY6A 1HNWM 3HWSA 3T15A 2APLA 1DGGA 3IECA 2JY8A 4HEOA 4CHTB 1SG9A 4AQYM 2VF8A 4ZPXA 2UUBM 4DR6M 2XFSA 4F1IA 2L7HA 4HLQA 1J09A 3KXEC 3W67A 5LMNM 3ILKA
chains in the Genus database with same CATH topology
2C99A 4P16A 2R46A 2HHHM 4LFCM 2P5TA 1KFVA 4NSOB 3IG5A 3KS8A 4L16A 4MGKE 1IM2A 4II7A 3K92A 2XF3A 4MGYE 4OVZB 3L2AA 4DUYM 1D2NA 3SASA 3SAUA 4AW4A 2EO2A 2VQEM 3T1YM 3R9XB 4GMQA 2R4JA 2CHGA 2V6ZM 1NVMA 4YHHM 2DWZB 5ITXA 2XH9A 4GITA 3J27B 4I8OA 4FW9A 2DZNB 4QNRA 1R6BX 4DR7M 3U6EA 4FD2A 3L29A 2K47A 4Z8XA 4LGYA 3SAVA 2XZUA 3UK6A 4IBJA 1JQJC 4QHTA 2R45A 3VK7A 4DV1M 5ITUA 2RGHA 5FTLA 1ZAEA 2H1RA 2QPAA 4GC9A 3RE8A 3SMSA 2KW0A 4IBEA 3K1JA 4DV5M 3SHFA 3FUUA 2F4VM 1KYIA 2HL7A 2Y21A 3M6AA 2CV1A 3GPUA 4X65M 3GQ4A 3U6LA 3ZC7B 1T3TA 3WHLA 3FTDA 3AOEA 3FYCA 1KSFX 3CF6E 5EXSA 1TGUA 2XGNA 4IBFA 2YQZA 2C98A 1NHGC 2L09A 3I4YA 1L1TA 3GP1A 3GRVA 4L8RC 4L15A 2CV0A 5F3WA 5EJCA 3TQSA 3IG8A 3A46A 4LJ7A 4L4UA 4OW0A 3A98B 2F5SA 4M9SA 3E4RA 3QWLA 5LMUM 3KDSE 4LJ8A 2R65A 3MK6A 3FUXA 3W0FA 2Y0QA 5KO3A 3TL4X 4DR2M 4GKKM 2X49A 3TWKA 4R3DA 4Z6YA 2DWNA 3AFHA 1N77A 4JI5M 4LJ5A 4DUZM 2Z4RA 4B7FA 4TUWA 4FCTA 1TH4A 3HJ8A 3L25A 3W0LB 3J2PB 1I4WA 3FTFA 1SXJA 1HT2E 3FTCA 4QHSA 3U6CA 1IQPA 1QAQA 5DYGA 2CHVA 1MU5A 3U6QA 1H6UA 1SXJB 1L1ZA 2XEPA 1YSYA 3HJSA 4REZA 2XZFA 4JXJA 3TWMA 4D82A 2G8LA 2LNHC 1HQCA 5ITXE 1YUBA 3GPYA 3HKPA 4JI1M 4I5SA 4LZZA 4BBAA 1TH2A 1K3XA 3H4MA 4DR3M 3NBIA 1QZMA 3ZCBB 4BB9A 1OJLA 4LJ4A 3Q8XA 4IBCA 4LCBA 4IBGA 4W5WA 1IXZA 1IN4A 3A42A 4LRTA 2UU9M 3AOGA 1IBLM 2L6OA 2UXBM 3KVWA 1VDDA 3EIHA 3OTOM 2FFJA 1GL6A 4MH0E 4DR4M 2C9OA 1N78A 4NRWA 2KXEA 2ZAOA 5KQDA 3KW6A 5EXXA 1W5TA 1Z5AA 2D7GA 4LJAA 3UJNA 3GLIA 2F5PA 3SARA 1JR3A 2KRKA 1GLNA 2QCUA 4FCWA 4MGHA 4DV0M 2V1UA 4JI4M 3J80S 1DGBA 1DGHA 3NWLA 5EP4A 4NOOB 3WHKA 5FLXS 3GO8A 4JI6M 4L78A 2V1CA 4PD2A 7CATA 1N75A 2EUCA 5IT9S 4PT5A 2R4EA 3GLIB 2XSZA 4I4LA 1L2BA 1DGHB 3D8BA 4FWDA 1E9SA 4AG6A 3KFUG 4JYAM 2KRUA 2CHQA 1HT1E 1FNNA 3U6OA 4MB7A 2QP9X 1DGFA 4IBDA 4DV6M 2C96A 5JI2E 5A2QS 3QAUA 1GVNA 5DYIA 5EXPA 2G5GX 5ITRA 1G4AE 3TE6A 3FTEA 4LRSA 2LH0A 4JI0M 1UM8A 3EIEA 1Z6TA 5KPRA 4D81A 4B08A 1SXJE 1IY1A 2VIIA 3K8ZA 3VDUA 1IY0A 4IBIA 1XMOM 2O5RA 2C9CA 2OPFA 5BPVA 1TH3A 3GPXA 1G41A 3SAWA 3SC3A 3UMMA 2NQ8C 4DV2M 5C1BA 4AG5A 4LJ6A 2E5LM 3D8LA 1E32A 1X37A 4GC5A 1OFHA 4AKIA 1W5SA 2CFOA 4RF1A 2F5OA 5KPZA 1IN8A 3UZUA 3HHZA 3CF0A 4PDGA 3JR5A 5FTMA 4NSRA 2DVWB 4FWGA 1IXSB 2J7NA 4A3VB 2FE8A 4YY3M 1YE9A 3SYLA 1QANA 4PDIA 1NSFA 4EIWA 1Z5BA 3M7GA 3HGIA 3GLFA 3LQQA 3B9PA 3FKEA 3LQRA 3PNVA 3RGPA 2CE7A 2DXIA 3SYKA 1IBKM 1ZQ9A 3U5ZA 4NRVA 4LFBM 4MM3B 2ZAMA 4G4OA 1N36M 2QENA 1Q39A 3VFDA 4B3MM 4IJEA 1Z5CA 3GQ5A 1R7RA 3FUVA 3SATA 4LFAM 2R18A 2QBYA 4XBOA 3L28A 4KO8A 3HU3A 2Z3XA 4KLNA 1IN6A 1NY6A 1E9RA 4HL4A 3J7AS 5DNYA 2LWXA 3HJQA 3I51A 4PCZA 4QOZC 2VQFM 3R8FA 3J7BA 1N34M 1XWIA 4X66M 2ZANA 1XXHA 2AHMA 5JI3E 4JI2M 5FTKA 4NXNM 1ORYB 2CUZA 3U61A 1L2DA 1NJFA 1NHWC 1MX0A 2UUCM 5ITTA 2W82A 1XXHB 2JA2A 4JN6A 4QOSA 2Q2EB 2KZSA 1FJGM 3HHXA 2DWLA 3AV0A 1DO2A 3U61B 4CISA 4JI7M 4GH9A 4FCVA 3PXGA 4B3TM 4RNAA 3GRRA 4LF5M 2KA6B 2FNAA 5IWAM 1PM5A 3KOWE 2CEAA 2Y0TA 2UXDM 3DOAA 4IJFA 4G4RA 1K3WA 2D7EA 2KEBA 1GKIA 1J5EM 4AZFA 1HQYE 3E9SA 4I81A 3LVVA 1XNQM 1XHBA 1G3IA 1XNRM 3I4VA 4GHAA 1G8PA 2L7IA 3KOZE 3RFWA 3U6DA 5EP1A 4WURA 5IZ7D 3CF2A 2UXCM 5KPTA 4LF6M 2YR0A 3VK8A 2EA0A 2I7NA 4M9ZA 4DV4M 5IREB 2R62A 4DV3M 4OVZA 2YNMD 2LXEA 3FD9A 3HHYA 2ERCA 3JR4A 2RGOA 3KP0E 4LG2A 2YFQA 3DA1A 4KODA 3FYDA 2Z4SA 3AL0C 3GPPA 5KQ8A 1WXQA 2F5NA 2F5QA 1E94E 4DR1M 5EQTA 4JV5M 4LJ9A 1SXJD 4NL4H 3GRUA 3HU1A 3KSXA 4AI6A 1IBMM 4M0WA 4AKHA 4LGMA 5ITQA 1K82A 3SMPA 5H37D 3SHGB 1DO0A 1IN7A 3A45A 3AKZA 1N32M 3GLHA 1NNUC 3MJ5A 4XGIA 2QZ4A 5ITYA 4CGYB 3UGJA 1IXRC 4GIPA 4IIWA 3LMMA 4FVMA 3KOXE 4LF8M 4GKJM 3GLHB 3U60A 1TDHA 4ITQA 2M5ZA 3KSJA 5E26A 4B3SM 4OU7A 3SFZA 3GLGA 2ZM6M 3TWLA 4JI8M 5FTJA 1L2CA 1L8QA 3U60B 1R2YA 4MGIE 2Y20A 4LZJA 4MGZE 4RF0A 4WW0A 1R2ZA 3K2LA 2RKOA 2DHRA 2HKJA 3LVWA 3PFIA 3GLGB 4DV7M 1OFIA 3HU2A 5GKNA 3AOEC 1HR0M 1NJGA 3T1HM 4LF7M 4B3RM 1LV7A 4AKGA 5C18A 2X8AA 4G6ZA 1QYRA 4IBKA 3SBJA 3GLFB 4OX9M 3HHWA 8CATA 1HNXM 1QAOA 4M9XA 1JR3D 4LF9M 2BJVA 3DFZA 1HNZM 2BNKA 3U6PA 1GL7A 3U5ZB 1TDZA 2Z7JA 2ZBKB 1QVRA 3CTWB 1J7KA 5EP2A 4S12A 3VKGA 2J7OA 2HCBA 1IY2A 1Q3CA 2XSZD 3GQ3A 4K0KM 4JI3M 5FSWA 2M60A 2DWMA 4B7HA 1EE8A 3MHVC 2XLJA 2QBYB 5E6JA 3THGA 3L27A 3L26A 3VLFB 1Z59A 2X4AA 4G4QA 1NNJA 2DZOB 3C58A 1I94M 3FUTA 4X64M 2BJWA 3PNYA 3PVSA 3BOSA 4X62M 1S3SA 1IN5A 3RGSA 2FOIC 3GRYA 5EP3A 1SXJC 2CV2A 4QNMA 1C1KA 1PJIA 5EXTA 2XFTA 5FTNA 4NXMM 4LF4M 1G59A 3U6SA 5BR8M 4DR5M 4GHLA 3VKHA 1NY5A 1PJJA 1QAMA 3JAMS 4FWHA 2KZUA 3KS4A 4B7GA 4M0DA 3M0EA 3FUWA 3AJIB 1XC8A 2UUAM 3KOYE 2A5YB 3ZH9B 3TPZA 4D80A 3T38A 4KHPM 3U6MA 1QQWA 4GRIA 3DZDA 1N33M 3KP1E 2I7PA 4IBBA 3J81S 2C5RA 1XMQM 4R7GA 3VDPA 2OQ4A 4BLCA 4G4NA 1Q3BA 2D7HA 4LY6A 1HNWM 3HWSA 3T15A 1DGGA 2UUBM 4CHTB 4AQYM 4ZPXA 4DR6M 2XFSA 2L7HA 4HLQA 1J09A 3KXEC 5LMNM 3ILKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1Z A;  1Z5B A;  3A45 A;  1N32 M;  2HHH M;  2XZF A;  1IBK M;  4LFC M;  3TWM A;  1KFV A;  5ITX E;  4NRV A;  4LFB M;  4G4O A;  1N36 M;  5ITY A;  3GPY A;  1Q39 A;  4B3M M;  4JI1 M;  1Z5C A;  3GQ5 A;  1K3X A;  4LF8 M;  4GKJ M;  4DR3 M;  3SAT A;  1TDH A;  4ITQ A;  4DUY M;  4LFA M;  3SAS A;  3SAU A;  4B3S M;  2VQE M;  3T1Y M;  2ZM6 M;  3TWL A;  4JI8 M;  1L2C A;  3A42 A;  1R2Y A;  3J7A S;  4YHH M;  2UU9 M;  1IBL M;  4PCZ A;  1R2Z A;  5ITX A;  2UXB M;  3OTO M;  2VQF M;  1N34 M;  2HKJ A;  4DR7 M;  3U6E A;  4DV7 M;  4X66 M;  4DR4 M;  1HR0 M;  3T1H M;  4B3R M;  3SAV A;  4LF7 M;  4NRW A;  2XZU A;  4JI2 M;  1Z5A A;  4NXN M;  3SBJ A;  2F5P A;  3SAR A;  4OX9 M;  3VK7 A;  4DV1 M;  4DV0 M;  1HNX M;  5ITU A;  4JI4 M;  3J80 S;  1L2D A;  4LF9 M;  5FLX S;  3GO8 A;  4JI6 M;  1MX0 A;  4PD2 A;  1HNZ M;  3U6P A;  2UUC M;  5ITT A;  1TDZ A;  2ZBK B;  5IT9 S;  2Q2E B;  1FJG M;  4DV5 M;  1L2B A;  1Q3C A;  4CIS A;  4JI7 M;  2F4V M;  3GQ3 A;  4K0K M;  4JI3 M;  4B3T M;  3GPU A;  4JYA M;  1EE8 A;  4X65 M;  3GQ4 A;  3U6O A;  4LF5 M;  5IWA M;  4MB7 A;  3U6L A;  1PM5 A;  1Z59 A;  1NNJ A;  4G4Q A;  3DOA A;  4G4R A;  1K3W A;  4DV6 M;  2UXD M;  3C58 A;  1I94 M;  4X64 M;  5A2Q S;  1J5E M;  1XNQ M;  4X62 M;  1XNR M;  5ITR A;  1L1T A;  3GP1 A;  3U6D A;  4JI0 M;  1PJI A;  5ITQ A;  4NXM M;  4LF4 M;  3A46 A;  3U6S A;  5BR8 M;  2F5S A;  4DR5 M;  2UXC M;  1XMO M;  5LMU M;  4LF6 M;  1PJJ A;  3JAM S;  2OPF A;  3VK8 A;  2EA0 A;  3GPX A;  4DV4 M;  3W0F A;  4DV3 M;  3SAW A;  4DV2 M;  4DR2 M;  4GKK M;  3TWK A;  4JI5 M;  1XC8 A;  2E5L M;  2UUA M;  4DUZ M;  3JR4 A;  4KHP M;  3U6M A;  2F5O A;  1N33 M;  3JR5 A;  4PDG A;  3J81 S;  3GPP A;  1XMQ M;  2OQ4 A;  4G4N A;  3U6C A;  2F5N A;  2F5Q A;  4DR1 M;  1Q3B A;  1HNW M;  4JV5 M;  2UUB M;  4AQY M;  4YY3 M;  1IBM M;  4PDI A;  1MU5 A;  4DR6 M;  3U6Q A;  5LMN M;  1K82 A; 
#chains in the Genus database with same CATH topology
 3LW5 F;  2C99 A;  4P16 A;  2EKK A;  2R46 A;  2HHH M;  4LFC M;  2P5T A;  4ANR A;  1KFV A;  4NSO B;  1QZE A;  3IG5 A;  3KS8 A;  4L16 A;  4MGK E;  1IM2 A;  2RRU A;  4II7 A;  3K92 A;  2XF3 A;  2EKF A;  4MGY E;  4OVZ B;  3IHP A;  3L2A A;  2KNV A;  4DUY M;  1D2N A;  3SAS A;  3SAU A;  1AUA A;  2EO2 A;  1TF0 B;  4AW4 A;  2VQE M;  3T1Y M;  3R9X B;  3B7Z A;  2R4J A;  4GMQ A;  2CHG A;  2OOB A;  2V6Z M;  1DV0 A;  1NVM A;  2JZ0 A;  4YHH M;  2DWZ B;  1OTR A;  2DAE A;  5ITX A;  2XH9 A;  4GIT A;  3J27 B;  4I8O A;  4FW9 A;  2DZN B;  2MJ5 B;  1R6B X;  4QNR A;  3U6E A;  4DR7 M;  2Z8Y M;  1VEJ A;  4FD2 A;  3L29 A;  2K47 A;  4Z8X A;  4LGY A;  3SAV A;  2XZU A;  3UK6 A;  4IBJ A;  1JQJ C;  4QHT A;  2R45 A;  2N35 A;  1QUT A;  1TR8 A;  2CRU A;  2ZTC A;  4DV1 M;  3VK7 A;  1BVS A;  5ITU A;  2RGH A;  2WSE F;  5FTL A;  1ZAE A;  3LCU A;  2H1R A;  2QPA A;  4GC9 A;  1EIJ A;  3RE8 A;  3SMS A;  2KW0 A;  4IBE A;  4DBG B;  3K1J A;  2O01 F;  4DV5 M;  3SHF A;  3FUU A;  2F4V M;  1KYI A;  1PJS A;  2HL7 A;  2Y21 A;  1OIZ A;  3M6A A;  2R6F A;  2CV1 A;  1WGN A;  3GPU A;  2J5Y A;  4X65 M;  3GQ4 A;  3U6L A;  3ZC7 B;  1T3T A;  3WHL A;  3FTD A;  3AOE A;  3QYB A;  3FYC A;  3H4J A;  1KSF X;  3CF6 E;  5EXS A;  1TGU A;  2LTU A;  2JZ1 A;  2XGN A;  2YQZ A;  4IBF A;  2C98 A;  1NV9 A;  1NHG C;  3Q8G A;  2L09 A;  3I4Y A;  1WR1 B;  1L1T A;  3B89 A;  4UN2 B;  3GP1 A;  3GRV A;  2GQF A;  4L8R C;  4L15 A;  2CV0 A;  1LTM A;  1MN3 A;  5F3W A;  5EJC A;  2QSF X;  3TQS A;  1T43 A;  3IG8 A;  3QYE A;  4LJ7 A;  4L4U A;  3A46 A;  4OW0 A;  3A98 B;  2F5S A;  4M9S A;  3E4R A;  3QWL A;  5LMU M;  3KDS E;  4LJ8 A;  2R65 A;  3MK6 A;  2FS1 A;  3FUX A;  3W0F A;  2Y0Q A;  3W68 A;  5KO3 A;  3TL4 X;  4DR2 M;  4GKK M;  2X49 A;  3TWK A;  4R3D A;  4Z6Y A;  2DWN A;  3AFH A;  1N77 A;  4JI5 M;  3I04 M;  4LJ5 A;  4DUZ M;  2Z4R A;  4B7F A;  4TUW A;  4FCT A;  1TH4 A;  3HJ8 A;  1P3Q Q;  3L25 A;  3W0L B;  3J2P B;  1I4W A;  3FTF A;  1SXJ A;  1HT2 E;  3FTC A;  4QHS A;  3U6C A;  1IQP A;  1GO5 A;  1QAQ A;  5DYG A;  2K6B A;  3V76 A;  2CHV A;  1MU5 A;  3U6Q A;  1H6U A;  2BWE A;  1SXJ B;  1L1Z A;  2XEP A;  1YSY A;  3HJS A;  1VG5 A;  4REZ A;  3CGW A;  2FH0 A;  2XZF A;  4JXJ A;  3TWM A;  4D82 A;  2CWB A;  2G8L A;  2LNH C;  1F4I A;  1HQC A;  5ITX E;  1YUB A;  1NV8 A;  3GPY A;  3HKP A;  4JI1 M;  4I5S A;  4LZZ A;  2WSF F;  1TH2 A;  3BBZ A;  3H4M A;  4BBA A;  1K3X A;  4DR3 M;  3NBI A;  1QZM A;  3ZCB B;  4BB9 A;  1OJL A;  4LJ4 A;  3Q8X A;  4IBC A;  4LCB A;  2L4E A;  4IBG A;  1R5L A;  1IXZ A;  4W5W A;  1OAI A;  1IN4 A;  3A42 A;  4LRT A;  2UU9 M;  3AOG A;  1IBL M;  2L6O A;  2UXB M;  3KVW A;  1VDD A;  3EIH A;  3OTO M;  1WGL A;  1OKS A;  2L4F A;  2FFJ A;  1GL6 A;  1PJT A;  4MH0 E;  4DR4 M;  2QQ8 A;  2C9O A;  1N78 A;  4NRW A;  2KXE A;  2ZAO A;  5KQD A;  2HAK A;  3KW6 A;  5EXX A;  1W5T A;  1Z5A A;  2D7G A;  4LJA A;  5DFL A;  3UJN A;  3GLI A;  2F5P A;  1JR3 A;  2JY6 B;  2KRK A;  1GLN A;  3SAR A;  2QCU A;  4FCW A;  4MGH A;  4DV0 M;  2V1U A;  4JI4 M;  3J80 S;  1DGB A;  1DGH A;  3NWL A;  5EP4 A;  4NOO B;  2LVA A;  3WHK A;  5FLX S;  3GO8 A;  4L78 A;  2V1C A;  4PD2 A;  4JI6 M;  7CAT A;  1N75 A;  2EUC A;  5IT9 S;  4PT5 A;  2R4E A;  3GLI B;  1UFZ A;  1Q02 A;  4XK8 F;  2XSZ A;  4I4L A;  1OAO C;  4KT0 F;  1L2B A;  1DGH B;  1TTE A;  3D8B A;  4FWD A;  1E9S A;  4AG6 A;  3KFU G;  4JYA M;  2KRU A;  2CHQ A;  1HT1 E;  1FNN A;  3U6O A;  2JY7 A;  4MB7 A;  2QP9 X;  1GJS A;  1DGF A;  2DAK A;  4IBD A;  4DV6 M;  2C96 A;  2WZJ A;  2JY5 A;  5JI2 E;  2DKL A;  5A2Q S;  1A5T A;  3QAU A;  1GVN A;  2G3Q A;  5DYI A;  2G5G X;  5EXP A;  5ITR A;  1G4A E;  3TE6 A;  3FTE A;  4LRS A;  3B7Q A;  2LH0 A;  2QNJ A;  4JI0 M;  1UM8 A;  2BWB A;  3EIE A;  1Z6T A;  2KDL A;  5KPR A;  4D81 A;  4B08 A;  2JXN A;  1SXJ E;  1V92 A;  1VQ1 A;  1IY1 A;  1JB0 F;  2VII A;  3K8Z A;  3VDU A;  1D0K A;  1IY0 A;  1QUS A;  2OOA A;  4IBI A;  1XMO M;  2O5R A;  4NC6 A;  2C9C A;  2OPF A;  2K9D A;  5BPV A;  1TH3 A;  3GPX A;  1G41 A;  3SAW A;  3SC3 A;  3UMM A;  2NQ8 C;  3E46 A;  2DZL A;  4DV2 M;  5C1B A;  1ZMW A;  4AG5 A;  4LJ6 A;  3F92 A;  2E5L M;  3D8L A;  1E32 A;  1X37 A;  1IXS A;  3B7N A;  4GC5 A;  1OFH A;  4AKI A;  1W5S A;  2CFO A;  4RF1 A;  2F5O A;  5KPZ A;  1IN8 A;  3UZU A;  3HHZ A;  2GNO A;  1XXH E;  3CF0 A;  4PDG A;  3JR5 A;  2O25 A;  5FTM A;  1EFU B;  4NSR A;  3ZQJ A;  2DVW B;  4FWG A;  1IXS B;  1ZMU A;  2J7N A;  4A3V B;  2LVP C;  2FE8 A;  4YY3 M;  1R4G A;  1WHC A;  1YE9 A;  1OIP A;  1QAN A;  3SYL A;  4PDI A;  1NSF A;  4EIW A;  4R71 A;  1Z5B A;  2LBC A;  3M7G A;  3HGI A;  4Y28 F;  3LQQ A;  3GLF A;  3B9P A;  3FKE A;  3LQR A;  3PNV A;  3RGP A;  1MJG M;  2CE7 A;  4CIZ A;  2DXI A;  3SYK A;  1IBK M;  1ZQ9 A;  3C3E A;  3U5Z A;  4NRV A;  4LFB M;  4MM3 B;  2ZAM A;  4G4O A;  1N36 M;  2QEN A;  1ZV1 A;  1Q39 A;  3VFD A;  4B3M M;  4IJE A;  1Z5C A;  3GQ5 A;  4L6V 6;  1R7R A;  3FUV A;  1VDL A;  3SAT A;  3GLI E;  2MR9 A;  1JR3 E;  4LFA M;  1VEG A;  2R18 A;  2QBY A;  4XBO A;  3L28 A;  4KO8 A;  3HU3 A;  2Z3X A;  4KLN A;  1AIP C;  1IN6 A;  1NY6 A;  1E9R A;  4HL4 A;  3J7A S;  5DNY A;  2LWX A;  2JWS A;  3HJQ A;  3I51 A;  3MMP A;  4PCZ A;  1WIV A;  4QOZ C;  2VQF M;  3R8F A;  3J7B A;  1N34 M;  2LHG A;  1XWI A;  4X66 M;  2KHH A;  4RKU F;  2ZAN A;  2CP8 A;  1XXH A;  2AHM A;  5JI3 E;  4JI2 M;  5FTK A;  4NXN M;  1ORY B;  2CUZ A;  2DAG A;  3U61 A;  1L2D A;  1NJF A;  1NHW C;  1GJT A;  1MX0 A;  2UUC M;  2QHO B;  3BXW A;  5ITT A;  2W82 A;  1XXH B;  2JA2 A;  4JN6 A;  2JNH A;  4QOS A;  2Q2E B;  2KZS A;  1XB2 B;  1FJG M;  3HHX A;  2DWL A;  3AV0 A;  1DO2 A;  3U61 B;  3LCV B;  4CIS A;  4GH9 A;  4JI7 M;  4FCV A;  4G3O A;  3PXG A;  2MRO B;  4B3T M;  4RNA A;  3GRR A;  4LF5 M;  2KA6 B;  2FNA A;  5IWA M;  1PM5 A;  3KOW E;  2CEA A;  2Y0T A;  2UXD M;  3DOA A;  1VEK A;  4IJF A;  4G4R A;  1K3W A;  2VF7 A;  2D7E A;  2KEB A;  1GKI A;  1J5E M;  4AZF A;  1HQY E;  3E9S A;  1PGY A;  3LVV A;  4I81 A;  1XNQ M;  1XHB A;  1G3I A;  1XNR M;  3I4V A;  3B74 A;  4GHA A;  1G8P A;  2L7I A;  1D0L A;  3KOZ E;  3RFW A;  3U6D A;  4WP2 A;  5EP1 A;  2DAM A;  4WUR A;  5IZ7 D;  3CF2 A;  1QDT A;  2UXC M;  5KPT A;  4LF6 M;  3GLG E;  2YR0 A;  3VK8 A;  2EA0 A;  2I7N A;  4M9Z A;  3T6P A;  4DV4 M;  5IRE B;  2R62 A;  4DV3 M;  4OVZ A;  2YNM D;  2LXE A;  3GLF E;  3FD9 A;  3HHY A;  2ERC A;  3JR4 A;  2RGO A;  3KP0 E;  4LG2 A;  2YFQ A;  2JUJ A;  3DA1 A;  4KOD A;  3FYD A;  2Z4S A;  3FE3 A;  3AL0 C;  2LHC A;  3GPP A;  5KQ8 A;  1WXQ A;  2F5N A;  2F5Q A;  1E94 E;  1G71 A;  2H5X A;  4DR1 M;  5EQT A;  4JV5 M;  2R0I A;  4LJ9 A;  1SXJ D;  4NL4 H;  1V34 A;  3GRU A;  3HU1 A;  3KSX A;  4AI6 A;  1IBM M;  4M0W A;  1PJQ A;  4AKH A;  4LGM A;  5ITQ A;  1K82 A;  3SMP A;  2WSC F;  3SHG B;  5H37 D;  1DO0 A;  1IN7 A;  3A45 A;  1YLA A;  3AKZ A;  1WJ7 A;  1N32 M;  1NO1 A;  3GLH A;  1NNU C;  3MJ5 A;  4XGI A;  2QZ4 A;  5ITY A;  2HWJ A;  4CGY B;  3UGJ A;  1IXR C;  4GIP A;  4IIW A;  3LMM A;  3NBX X;  4FVM A;  5L8R F;  3KOX E;  4LF8 M;  2OO9 A;  4GKJ M;  3GLH B;  3U60 A;  1TDH A;  1CUK A;  1V33 A;  4ITQ A;  2M5Z A;  3KSJ A;  4CJ6 A;  5E26 A;  4B3S M;  4OU7 A;  3I01 M;  3SFZ A;  3GLG A;  2ZM6 M;  3TWL A;  3HZJ A;  4JI8 M;  5FTJ A;  3HY5 A;  1L2C A;  1IFY A;  1L8Q A;  3U60 B;  1R2Y A;  4MGI E;  1QDR A;  1PRB A;  2Y20 A;  4LZJ A;  4MGZ E;  4RF0 A;  4WW0 A;  1Y8G A;  1R2Z A;  3K2L A;  2RKO A;  2DHR A;  3HX3 A;  2HKJ A;  3LVW A;  3PFI A;  3GLG B;  4DV7 M;  1OFI A;  3HU2 A;  5GKN A;  2L2D A;  3AOE C;  1HR0 M;  1NJG A;  3T1H M;  4LF7 M;  4B3R M;  1LV7 A;  1RU3 A;  5C18 A;  2X8A A;  4AKG A;  2DI0 A;  4G6Z A;  1QYR A;  3E21 A;  4IBK A;  3GLF B;  3SBJ A;  1T6O A;  4OX9 M;  2VDB B;  3HHW A;  8CAT A;  1HNX M;  1QAO A;  4M9X A;  1JR3 D;  4LF9 M;  2DNA A;  2BJV A;  3DFZ A;  1HNZ M;  2BNK A;  2DHY A;  1GL7 A;  3U6P A;  3U5Z B;  2Z7J A;  2ZBK B;  1TDZ A;  1QVR A;  3CTW B;  1J7K A;  5EP2 A;  4S12 A;  3VKG A;  2J7O A;  2HCB A;  4P17 A;  1IY2 A;  1Q3C A;  2XSZ D;  3GQ3 A;  4K0K M;  2JP7 A;  4JI3 M;  5FSW A;  2M60 A;  2DWM A;  2KNZ A;  1D0M A;  4B7H A;  1EE8 A;  3MHV C;  2XLJ A;  2QBY B;  3FRI A;  5E6J A;  3THG A;  4GEW A;  3L27 A;  3L26 A;  3VLF B;  1Z59 A;  2X4A A;  4G4Q A;  1NNJ A;  2DZO B;  1OQY A;  1HJP A;  3C58 A;  1I94 M;  3FUT A;  4X64 M;  3K9P A;  2BJW A;  3PNY A;  3PVS A;  3BOS A;  3C3D A;  4X62 M;  1S3S A;  1IN5 A;  3RGS A;  2FOI C;  3GRY A;  5EP3 A;  2DEN A;  1SXJ C;  2CV2 A;  4QNM A;  1C1K A;  1PJI A;  5EXT A;  2XFT A;  2EJS A;  2MH8 A;  5FTN A;  4NXM M;  4LF4 M;  2KNA A;  1G59 A;  2R44 A;  3U6S A;  5BR8 M;  4DR5 M;  4GHL A;  3VKH A;  1NY5 A;  1PJJ A;  1QAM A;  2ZTD A;  3JAM S;  4FWH A;  2KZU A;  1ZMV A;  2MGW A;  3KS4 A;  4B7G A;  1C7Y A;  4M0D A;  3M0E A;  3K9O A;  3FUW A;  3AJI B;  1XC8 A;  2UUA M;  3KOY E;  2A5Y B;  2B3T A;  2LVO C;  3ZH9 B;  3TPZ A;  4D80 A;  3GLH E;  3T38 A;  4KHP M;  4Q7J A;  3C9P A;  3U6M A;  1QQW A;  4GRI A;  3DZD A;  3FRH A;  1N33 M;  3KP1 E;  2I7P A;  4IBB A;  2K0B X;  4F2L A;  3J81 S;  2C5R A;  1XMQ M;  1GAB A;  2DAI A;  4R7G A;  3VDP A;  2OQ4 A;  4BLC A;  4G4N A;  2LVN C;  1Q3B A;  2D7H A;  2LVQ D;  4LY6 A;  1HNW M;  3HWS A;  3T15 A;  2APL A;  1DGG A;  3IEC A;  2JY8 A;  4HEO A;  4CHT B;  1SG9 A;  4AQY M;  2VF8 A;  4ZPX A;  2UUB M;  4DR6 M;  2XFS A;  4F1I A;  2L7H A;  4HLQ A;  1J09 A;  3KXE C;  3W67 A;  5LMN M;  3ILK A; 
#chains in the Genus database with same CATH homology
 2C99 A;  4P16 A;  2R46 A;  2HHH M;  4LFC M;  2P5T A;  1KFV A;  4NSO B;  3IG5 A;  3KS8 A;  4L16 A;  4MGK E;  1IM2 A;  4II7 A;  3K92 A;  2XF3 A;  4MGY E;  4OVZ B;  3L2A A;  4DUY M;  1D2N A;  3SAS A;  3SAU A;  4AW4 A;  2EO2 A;  2VQE M;  3T1Y M;  3R9X B;  4GMQ A;  2R4J A;  2CHG A;  2V6Z M;  1NVM A;  4YHH M;  2DWZ B;  5ITX A;  2XH9 A;  4GIT A;  3J27 B;  4I8O A;  4FW9 A;  2DZN B;  4QNR A;  1R6B X;  4DR7 M;  3U6E A;  4FD2 A;  3L29 A;  2K47 A;  4Z8X A;  4LGY A;  3SAV A;  2XZU A;  3UK6 A;  4IBJ A;  1JQJ C;  4QHT A;  2R45 A;  3VK7 A;  4DV1 M;  5ITU A;  2RGH A;  5FTL A;  1ZAE A;  2H1R A;  2QPA A;  4GC9 A;  3RE8 A;  3SMS A;  2KW0 A;  4IBE A;  3K1J A;  4DV5 M;  3SHF A;  3FUU A;  2F4V M;  1KYI A;  2HL7 A;  2Y21 A;  3M6A A;  2CV1 A;  3GPU A;  4X65 M;  3GQ4 A;  3U6L A;  3ZC7 B;  1T3T A;  3WHL A;  3FTD A;  3AOE A;  3FYC A;  1KSF X;  3CF6 E;  5EXS A;  1TGU A;  2XGN A;  4IBF A;  2YQZ A;  2C98 A;  1NHG C;  2L09 A;  3I4Y A;  1L1T A;  3GP1 A;  3GRV A;  4L8R C;  4L15 A;  2CV0 A;  5F3W A;  5EJC A;  3TQS A;  3IG8 A;  3A46 A;  4LJ7 A;  4L4U A;  4OW0 A;  3A98 B;  2F5S A;  4M9S A;  3E4R A;  3QWL A;  5LMU M;  3KDS E;  4LJ8 A;  2R65 A;  3MK6 A;  3FUX A;  3W0F A;  2Y0Q A;  5KO3 A;  3TL4 X;  4DR2 M;  4GKK M;  2X49 A;  3TWK A;  4R3D A;  4Z6Y A;  2DWN A;  3AFH A;  1N77 A;  4JI5 M;  4LJ5 A;  4DUZ M;  2Z4R A;  4B7F A;  4TUW A;  4FCT A;  1TH4 A;  3HJ8 A;  3L25 A;  3W0L B;  3J2P B;  1I4W A;  3FTF A;  1SXJ A;  1HT2 E;  3FTC A;  4QHS A;  3U6C A;  1IQP A;  1QAQ A;  5DYG A;  2CHV A;  1MU5 A;  3U6Q A;  1H6U A;  1SXJ B;  1L1Z A;  2XEP A;  1YSY A;  3HJS A;  4REZ A;  2XZF A;  4JXJ A;  3TWM A;  4D82 A;  2G8L A;  2LNH C;  1HQC A;  5ITX E;  1YUB A;  3GPY A;  3HKP A;  4JI1 M;  4I5S A;  4LZZ A;  4BBA A;  1TH2 A;  1K3X A;  3H4M A;  4DR3 M;  3NBI A;  1QZM A;  3ZCB B;  4BB9 A;  1OJL A;  4LJ4 A;  3Q8X A;  4IBC A;  4LCB A;  4IBG A;  4W5W A;  1IXZ A;  1IN4 A;  3A42 A;  4LRT A;  2UU9 M;  3AOG A;  1IBL M;  2L6O A;  2UXB M;  3KVW A;  1VDD A;  3EIH A;  3OTO M;  2FFJ A;  1GL6 A;  4MH0 E;  4DR4 M;  2C9O A;  1N78 A;  4NRW A;  2KXE A;  2ZAO A;  5KQD A;  3KW6 A;  5EXX A;  1W5T A;  1Z5A A;  2D7G A;  4LJA A;  3UJN A;  3GLI A;  2F5P A;  3SAR A;  1JR3 A;  2KRK A;  1GLN A;  2QCU A;  4FCW A;  4MGH A;  4DV0 M;  2V1U A;  4JI4 M;  3J80 S;  1DGB A;  1DGH A;  3NWL A;  5EP4 A;  4NOO B;  3WHK A;  5FLX S;  3GO8 A;  4JI6 M;  4L78 A;  2V1C A;  4PD2 A;  7CAT A;  1N75 A;  2EUC A;  5IT9 S;  4PT5 A;  2R4E A;  3GLI B;  2XSZ A;  4I4L A;  1L2B A;  1DGH B;  3D8B A;  4FWD A;  1E9S A;  4AG6 A;  3KFU G;  4JYA M;  2KRU A;  2CHQ A;  1HT1 E;  1FNN A;  3U6O A;  4MB7 A;  2QP9 X;  1DGF A;  4IBD A;  4DV6 M;  2C96 A;  5JI2 E;  5A2Q S;  3QAU A;  1GVN A;  5DYI A;  5EXP A;  2G5G X;  5ITR A;  1G4A E;  3TE6 A;  3FTE A;  4LRS A;  2LH0 A;  4JI0 M;  1UM8 A;  3EIE A;  1Z6T A;  5KPR A;  4D81 A;  4B08 A;  1SXJ E;  1IY1 A;  2VII A;  3K8Z A;  3VDU A;  1IY0 A;  4IBI A;  1XMO M;  2O5R A;  2C9C A;  2OPF A;  5BPV A;  1TH3 A;  3GPX A;  1G41 A;  3SAW A;  3SC3 A;  3UMM A;  2NQ8 C;  4DV2 M;  5C1B A;  4AG5 A;  4LJ6 A;  2E5L M;  3D8L A;  1E32 A;  1X37 A;  4GC5 A;  1OFH A;  4AKI A;  1W5S A;  2CFO A;  4RF1 A;  2F5O A;  5KPZ A;  1IN8 A;  3UZU A;  3HHZ A;  3CF0 A;  4PDG A;  3JR5 A;  5FTM A;  4NSR A;  2DVW B;  4FWG A;  1IXS B;  2J7N A;  4A3V B;  2FE8 A;  4YY3 M;  1YE9 A;  3SYL A;  1QAN A;  4PDI A;  1NSF A;  4EIW A;  1Z5B A;  3M7G A;  3HGI A;  3GLF A;  3LQQ A;  3B9P A;  3FKE A;  3LQR A;  3PNV A;  3RGP A;  2CE7 A;  2DXI A;  3SYK A;  1IBK M;  1ZQ9 A;  3U5Z A;  4NRV A;  4LFB M;  4MM3 B;  2ZAM A;  4G4O A;  1N36 M;  2QEN A;  1Q39 A;  3VFD A;  4B3M M;  4IJE A;  1Z5C A;  3GQ5 A;  1R7R A;  3FUV A;  3SAT A;  4LFA M;  2R18 A;  2QBY A;  4XBO A;  3L28 A;  4KO8 A;  3HU3 A;  2Z3X A;  4KLN A;  1IN6 A;  1NY6 A;  1E9R A;  4HL4 A;  3J7A S;  5DNY A;  2LWX A;  3HJQ A;  3I51 A;  4PCZ A;  4QOZ C;  2VQF M;  3R8F A;  3J7B A;  1N34 M;  1XWI A;  4X66 M;  2ZAN A;  1XXH A;  2AHM A;  5JI3 E;  4JI2 M;  5FTK A;  4NXN M;  1ORY B;  2CUZ A;  3U61 A;  1L2D A;  1NJF A;  1NHW C;  1MX0 A;  2UUC M;  5ITT A;  2W82 A;  1XXH B;  2JA2 A;  4JN6 A;  4QOS A;  2Q2E B;  2KZS A;  1FJG M;  3HHX A;  2DWL A;  3AV0 A;  1DO2 A;  3U61 B;  4CIS A;  4JI7 M;  4GH9 A;  4FCV A;  3PXG A;  4B3T M;  4RNA A;  3GRR A;  4LF5 M;  2KA6 B;  2FNA A;  5IWA M;  1PM5 A;  3KOW E;  2CEA A;  2Y0T A;  2UXD M;  3DOA A;  4IJF A;  4G4R A;  1K3W A;  2D7E A;  2KEB A;  1GKI A;  1J5E M;  4AZF A;  1HQY E;  3E9S A;  4I81 A;  3LVV A;  1XNQ M;  1XHB A;  1G3I A;  1XNR M;  3I4V A;  4GHA A;  1G8P A;  2L7I A;  3KOZ E;  3RFW A;  3U6D A;  5EP1 A;  4WUR A;  5IZ7 D;  3CF2 A;  2UXC M;  5KPT A;  4LF6 M;  2YR0 A;  3VK8 A;  2EA0 A;  2I7N A;  4M9Z A;  4DV4 M;  5IRE B;  2R62 A;  4DV3 M;  4OVZ A;  2YNM D;  2LXE A;  3FD9 A;  3HHY A;  2ERC A;  3JR4 A;  2RGO A;  3KP0 E;  4LG2 A;  2YFQ A;  3DA1 A;  4KOD A;  3FYD A;  2Z4S A;  3AL0 C;  3GPP A;  5KQ8 A;  1WXQ A;  2F5N A;  2F5Q A;  1E94 E;  4DR1 M;  5EQT A;  4JV5 M;  4LJ9 A;  1SXJ D;  4NL4 H;  3GRU A;  3HU1 A;  3KSX A;  4AI6 A;  1IBM M;  4M0W A;  4AKH A;  4LGM A;  5ITQ A;  1K82 A;  3SMP A;  5H37 D;  3SHG B;  1DO0 A;  1IN7 A;  3A45 A;  3AKZ A;  1N32 M;  3GLH A;  1NNU C;  3MJ5 A;  4XGI A;  2QZ4 A;  5ITY A;  4CGY B;  3UGJ A;  1IXR C;  4GIP A;  4IIW A;  3LMM A;  4FVM A;  3KOX E;  4LF8 M;  4GKJ M;  3GLH B;  3U60 A;  1TDH A;  4ITQ A;  2M5Z A;  3KSJ A;  5E26 A;  4B3S M;  4OU7 A;  3SFZ A;  3GLG A;  2ZM6 M;  3TWL A;  4JI8 M;  5FTJ A;  1L2C A;  1L8Q A;  3U60 B;  1R2Y A;  4MGI E;  2Y20 A;  4LZJ A;  4MGZ E;  4RF0 A;  4WW0 A;  1R2Z A;  3K2L A;  2RKO A;  2DHR A;  2HKJ A;  3LVW A;  3PFI A;  3GLG B;  4DV7 M;  1OFI A;  3HU2 A;  5GKN A;  3AOE C;  1HR0 M;  1NJG A;  3T1H M;  4LF7 M;  4B3R M;  1LV7 A;  4AKG A;  5C18 A;  2X8A A;  4G6Z A;  1QYR A;  4IBK A;  3SBJ A;  3GLF B;  4OX9 M;  3HHW A;  8CAT A;  1HNX M;  1QAO A;  4M9X A;  1JR3 D;  4LF9 M;  2BJV A;  3DFZ A;  1HNZ M;  2BNK A;  3U6P A;  1GL7 A;  3U5Z B;  1TDZ A;  2Z7J A;  2ZBK B;  1QVR A;  3CTW B;  1J7K A;  5EP2 A;  4S12 A;  3VKG A;  2J7O A;  2HCB A;  1IY2 A;  1Q3C A;  2XSZ D;  3GQ3 A;  4K0K M;  4JI3 M;  5FSW A;  2M60 A;  2DWM A;  4B7H A;  1EE8 A;  3MHV C;  2XLJ A;  2QBY B;  5E6J A;  3THG A;  3L27 A;  3L26 A;  3VLF B;  1Z59 A;  2X4A A;  4G4Q A;  1NNJ A;  2DZO B;  3C58 A;  1I94 M;  3FUT A;  4X64 M;  2BJW A;  3PNY A;  3PVS A;  3BOS A;  4X62 M;  1S3S A;  1IN5 A;  3RGS A;  2FOI C;  3GRY A;  5EP3 A;  1SXJ C;  2CV2 A;  4QNM A;  1C1K A;  1PJI A;  5EXT A;  2XFT A;  5FTN A;  4NXM M;  4LF4 M;  1G59 A;  3U6S A;  5BR8 M;  4DR5 M;  4GHL A;  3VKH A;  1NY5 A;  1PJJ A;  1QAM A;  3JAM S;  4FWH A;  2KZU A;  3KS4 A;  4B7G A;  4M0D A;  3M0E A;  3FUW A;  3AJI B;  1XC8 A;  2UUA M;  3KOY E;  2A5Y B;  3ZH9 B;  3TPZ A;  4D80 A;  3T38 A;  4KHP M;  3U6M A;  1QQW A;  4GRI A;  3DZD A;  1N33 M;  3KP1 E;  2I7P A;  4IBB A;  3J81 S;  2C5R A;  1XMQ M;  4R7G A;  3VDP A;  2OQ4 A;  4BLC A;  4G4N A;  1Q3B A;  2D7H A;  4LY6 A;  1HNW M;  3HWS A;  3T15 A;  1DGG A;  2UUB M;  4CHT B;  4AQY M;  4ZPX A;  4DR6 M;  2XFS A;  2L7H A;  4HLQ A;  1J09 A;  3KXE C;  5LMN M;  3ILK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...