2OQ4A

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
262
structure length
252
Chain Sequence
PQGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGLFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords 5'-D(*G*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*GP*G)-3'
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrates and mutations of critical residues
rcsb
source organism Escherichia coli
total genus 74
structure length 252
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2oq4A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2oq4A01
3GP1A 5ITYA 2ZM6M 5BR8M 1HNZM 4JI4M 4DV6M 3U6OA 1L2BA 1XMQM 4DUZM 1Q3CA 3JR5A 1Z5BA 4PD2A 3TWKA 4AQYM 1TDHA 1MU5A 1L2DA 1IBKM 4LF5M 1N33M 4JI6M 4PDIA 1N32M 2UUAM 3SAVA 2UXBM 2EA0A 1KFVA 4B3TM 2UUCM 1NNJA 1L1TA 3GPXA 4DV4M 5IWAM 4YY3M 1XC8A 1L1ZA 1FJGM 4GKJM 4LFAM 4DR7M 4YHHM 1PM5A 2F5QA 2VQFM 4X66M 1Q39A 3A42A 2ZBKB 3GPPA 1I94M 1Z5AA 4DR5M 3T1YM 4JI5M 3SAUA 3U6DA 1K3XA 5ITTA 4DR3M 4G4NA 3A45A 4NXMM 3J7AS 4JV5M 2HHHM 1TDZA 3J80S 4LF8M 4NXNM 2E5LM 2UUBM 1MX0A 5ITUA 4DV5M 2UXCM 1K82A 4DV2M 4K0KM 3JAMS 1K3WA 4LF4M 4LFCM 4B3MM 4DV7M 2OQ4A 4B3SM 2F4VM 4JYAM 3SAWA 5A2QS 3TWLA 3GPYA 3VK7A 4DR4M 2F5PA 4X62M 2HKJA 3GPUA 2Q2EB 4LF9M 1XNRM 4GKKM 4OX9M 2F5NA 2F5SA 1PJIA 4PDGA 1R2ZA 1HNXM 4JI0M 1Z59A 3U6QA 1N36M 1XNQM 4NRVA 5IT9S 5ITXE 4JI3M 4G4QA 3GQ4A 2OPFA 4X65M 5ITQA 3GQ5A 4KHPM 4LF6M 3JR4A 4DR2M 3U6EA 3OTOM 5ITXA 3GQ3A 4G4OA 1N34M 4DR6M 1HNWM 1EE8A 3T1HM 4X64M 3SARA 3GO8A 3J81S 4JI1M 3SBJA 1Z5CA 4ITQA 4LF7M 2XZUA 4JI2M 1XMOM 3DOAA 4DR1M 1IBLM 4DV3M 5LMNM 1PJJA 3U6MA 4B3RM 1L2CA 4CISA 4JI8M 4MB7A 2VQEM 2F5OA 1IBMM 4DV0M 3VK8A 2UU9M 3U6SA 1Q3BA 3A46A 4PCZA 3U6CA 3C58A 1HR0M 3TWMA 2UXDM 5ITRA 4JI7M 5FLXS 3SATA 3U6LA 3SASA 2XZFA 4DUYM 3U6PA 5LMUM 4G4RA 1J5EM 4NRWA 3W0FA 4LFBM 4DV1M 1R2YA
chains in the Genus database with same CATH superfamily
1D0LA 4OVZA 2ZM6M 4JI4M 1Q02A 4DV6M 2CV2A 1ZMVA 1D0KA 1GL6A 2D7HA 2D7EA 3C3EA 4NSOB 4Z6YA 4LJ9A 3HHYA 3SYKA 2ZAMA 1IY1A 1N33M 4B7HA 4KLNA 3ZC7B 3FTFA 1N32M 3VDUA 1IBLM 3FUUA 3GRYA 2DWLA 1NNUC 3FUTA 2DZOB 5EP1A 3PXGA 2MGWA 2ZAOA 4HLQA 3UK6A 1F4IA 3GPXA 4WP2A 1MN3A 1VG5A 3HHXA 3LQQA 4YY3M 1OAOC 2L7IA 3IG5A 3TPZA 3HJ8A 2XLJA 1IXRC 2VQFM 8CATA 3KVWA 4X66M 1Q39A 1ZQ9A 1Z5AA 3KSJA 4FWDA 3T1YM 3U6DA 2DKLA 3RE8A 1TH3A 2EJSA 1K3XA 1MJGM 2Y20A 4IBIA 4GRIA 1SXJE 2RKOA 1P3QQ 3A45A 4XBOA 4XK8F 1C7YA 2CV0A 1GABA 1IFYA 4MGZE 2BJVA 3QAUA 4CHTB 3J7AS 2BWBA 2C9OA 4ANRA 4QNRA 3SYLA 2CE7A 4MGKE 1X37A 1IQPA 2EUCA 2NQ8C 2X49A 2YFQA 1E9SA 2N35A 3H4MA 3JAMS 3H4JA 4LFCM 4GHLA 4EIWA 1QAQA 3SAWA 5A2QS 3GPYA 2DHRA 2R65A 4MGYE 2BJWA 3J7BA 4NC6A 3FD9A 5GKNA 4LZZA 4GMQA 2KNAA 4AW4A 3IHPA 2A5YB 2F5NA 2F5SA 1PJIA 2MROB 1N36M 1QQWA 1TF0B 3HKPA 2VIIA 3HU1A 3VKHA 3LCVB 2R44A 2DAMA 4IBGA 1G71A 2DAEA 3F92A 4IBJA 2RGOA 4FW9A 3U60B 1NHGC 3K8ZA 3GLIE 1OKSA 1E32A 2BNKA 2X4AA 4P16A 4GITA 1Y8GA 3GQ3A 4DR6M 4LJ4A 3VDPA 3T38A 2R0IA 4Y28F 5FTNA 2DWNA 4LGYA 3VKGA 4OU7A 3SARA 1H6UA 4BLCA 3KSXA 4AG6A 4S12A 1AUAA 1Z5CA 4ITQA 3FUWA 4LJ5A 4FWHA 3SHFA 1EFUB 4OW0A 2B3TA 3DOAA 4D81A 3KOZE 2KNVA 1IXSA 1HQCA 1W5SA 1L2CA 2Z8YM 3B74A 3TQSA 4CJ6A 3BOSA 3L2AA 4R3DA 2KZSA 2I7PA 1E9RA 3HU2A 2GNOA 2LHCA 4QHSA 2JY6B 2MJ5B 3B7NA 3KOYE 1QYRA 5H37D 3VK8A 1TH4A 1TH2A 3I04M 3MHVC 2X8AA 1N78A 3A46A 4PCZA 4LGMA 5KQDA 1NY5A 3BBZA 1VEKA 5ITRA 4JI7M 2MH8A 1T43A 2LXEA 3FTCA 3K2LA 5JI3E 2EO2A 2KEBA 1QDTA 1GJTA 2WSCF 4AZFA 3U6PA 4LFBM 2LVPC 3GRUA 4G4RA 2QP9X 2H5XA 3HU3A 2KXEA 3GLFA 5BR8M 1VEJA 2G5GX 7CATA 2XFSA 3W68A 5EXXA 4DUZM 1ZMUA 4GIPA 3GLGA 2FH0A 1OFIA 2DZNB 1G59A 2WZJA 2VF7A 3FYCA 4LF5M 2DAKA 4M9SA 3L29A 5KO3A 5EQTA 1JB0F 1GVNA 2CHQA 3C3DA 1A5TA 2LTUA 3SAVA 3EIEA 4M9XA 3L26A 2UXBM 2FS1A 4I8OA 4AKGA 1WJ7A 1KSFX 2KA6B 1VEGA 2QCUA 4II7A 4DR7M 3U61B 1PM5A 1JQJC 5FSWA 2F5QA 2C9CA 4GEWA 5KPRA 1HT1E 3SHGB 2Y0TA 1TTEA 1OFHA 2L4FA 2ZBKB 3I4YA 5FTKA 1IN7A 5ITUA 5F3WA 1LV7A 1FNNA 1IN6A 5ITTA 3T6PA 1DGGA 2JA2A 4DR3M 2Z3XA 4WURA 4W5WA 2LVOC 2L4EA 4I4LA 2QENA 3AKZA 4LCBA 4LF8M 5FTLA 1JR3E 2CUZA 3KDSE 3KP0E 3KW6A 4QOZC 2R45A 4NOOB 5EXPA 4DV2M 2HAKA 3FE3A 2Z7JA 4HL4A 2JUJA 4IBBA 4NSRA 3J2PB 1R6BX 3PVSA 1XWIA 4JYAM 2DAGA 4MH0E 5IZ7D 3UJNA 3VK7A 4REZA 3PFIA 2F5PA 3A98B 3HJQA 1IXSB 3R8FA 2HKJA 3MMPA 1G4AE 4R71A 3GPUA 4LF9M 2I7NA 3DA1A 1G41A 4OX9M 4PDGA 3FTEA 1TR8A 4JI0M 1Z59A 1PJSA 3SFZA 3U6QA 3UGJA 4NRVA 2QBYA 5DYIA 5KPZA 3RGPA 4G4QA 4LY6A 3M0EA 5DNYA 4X65M 5ITQA 3HHZA 2KRUA 2XSZA 2KRKA 5ITXA 3OTOM 4G4OA 1N34M 1W5TA 2FE8A 3MJ5A 3NBXX 3GLFB 4X64M 3GO8A 1HQYE 3C9PA 3LVWA 3M7GA 3GLGB 4LF7M 4IBCA 2JY5A 3U5ZA 4JI2M 3GLHA 2HL7A 3B7ZA 1QZEA 2M5ZA 3VFDA 3LW5F 3AOEA 3FKEA 5LMNM 3U61A 1OIZA 4IIWA 4B3RM 2XSZD 3V76A 4JI8M 3J27B 2EKFA 2V1CA 4MB7A 2F5OA 3B9PA 5BPVA 1WR1B 1S3SA 2ERCA 1Q3BA 4DV5M 3ZCBB 2R62A 3HX3A 1HR0M 1EIJA 5FLXS 5DYGA 3SATA 3U6LA 3HZJA 2D7GA 3FRIA 4B08A 3AJIB 4DV1M 1R2YA 3KOWE 2AHMA 1V34A 5ITYA 2Y0QA 3I51A 2DXIA 1HNZM 2DNAA 3KOXE 1XMQM 4LJ6A 1L2BA 4CGYB 1Q3CA 2CP8A 1Z5BA 2LH0A 3LMMA 4AQYM 1J7KA 1TDHA 1UM8A 4L15A 1DGHA 1IM2A 1WGLA 3ZH9B 1IN8A 4JXJA 4JI6M 1G3IA 2VDBB 2OO9A 1DGBA 3E9SA 2QNJA 2UUAM 1IXZA 2EA0A 2QQ8A 4MGHA 1KFVA 2UUCM 3K1JA 1NNJA 2XF3A 1XC8A 1PJQA 2QZ4A 2Z4SA 4FD2A 4G3OA 5L8RF 4IBKA 4LFAM 4YHHM 1FJGM 2LVNC 4ZPXA 3R9XB 1ZMWA 2QBYB 1WXQA 3GPPA 2DWMA 3W67A 2LWXA 3L27A 2APLA 4GH9A 4Q7JA 3WHKA 3SAUA 1NJGA 1XXHE 5C18A 5JI2E 2HCBA 2OOAA 3E21A 3LQRA 2KDLA 1L8QA 3D8LA 2K9DA 1HT2E 4G4NA 2DZLA 1N77A 3Q8XA 3DFZA 1WIVA 3UZUA 5KQ8A 4UN2B 4NXMM 4JV5M 4MGIE 3J80S 1GO5A 4NXNM 2E5LM 1QZMA 4PT5A 4L4UA 2UUBM 1MX0A 1NV8A 2XGNA 3GRVA 2OOBA 1SXJA 4JN6A 4LJ7A 5E6JA 5EP4A 4K0KM 2CEAA 1D2NA 1K3WA 4RF0A 4LF4M 3FRHA 4R7GA 2JXNA 3GLHB 4DV7M 3U5ZB 3MK6A 2O25A 3WHLA 5EXTA 1I4WA 4LZJA 1QAMA 2DAIA 2J7OA 4A3VB 1XNRM 2P5TA 3CF6E 1VDDA 3I01M 4QOSA 5EJCA 2O01F 1R2ZA 4DBGB 2V1UA 3PNYA 1QUSA 3CF2A 2QPAA 3W0LB 1SXJD 2DENA 2J5YA 3GQ4A 2KNZA 4KHPM 4WW0A 1V33A 1OJLA 2C5RA 2QSFX 1CUKA 2CWBA 3RFWA 4AG5A 3AV0A 3M6AA 1NSFA 2CHGA 2XH9A 2ZANA 3GLIA 1NHWC 3HJSA 3PNVA 3K9OA 1OTRA 4FCTA 4B7FA 1VQ1A 1TGUA 4RKUF 4D82A 2XEPA 3AOEC 3QYBA 1NO1A 1DGHB 2XZUA 4FWGA 3KXEC 1QDRA 5FTJA 2L7HA 2YNMD 5C1BA 1T6OA 4M0DA 3FUVA 4F1IA 3B89A 5EP2A 4CISA 1PJTA 5EXSA 3AL0C 3UMMA 2VQEM 1IBMM 4DV0M 2KW0A 2JZ0A 4IBDA 1WHCA 3ZQJA 3K92A 1IY2A 1BVSA 1C1KA 3FYDA 1GLNA 5E26A 2L6OA 3U6CA 3GLFE 3TWMA 2UXDM 1DV0A 1DO2A 4HEOA 3HWSA 1IN5A 4FCWA 2JZ1A 4L16A 1GKIA 4CIZA 3CF0A 1T3TA 3W0FA 3GLGE 1IN4A 4NRWA 3AFHA 4BBAA 2Z4RA 1R5LA 2VF8A 2R4EA 3GP1A 3U6OA 1E94E 4L6V6 1NVMA 1YLAA 4AI6A 2R18A 1N75A 2JY7A 4NL4H 3SC3A 3TWKA 3VLFB 1ZAEA 2JNHA 4D80A 1MU5A 4IJFA 1SXJB 2FNAA 1L2DA 1IBKM 1YE9A 1PGYA 1XXHA 4PDIA 4M9ZA 4IBEA 4QHTA 1VDLA 2WSEF 1V92A 4I81A 1RU3A 1OIPA 1YSYA 2DVWB 2H1RA 2HWJA 2LBCA 2YR0A 4KT0F 4F2LA 4KODA 4B3TM 3BXWA 2C98A 1L1TA 4GHAA 2R46A 1GJSA 4BB9A 1NJFA 4DV4M 5IWAM 1L1ZA 4GKJM 2XFTA 4LJAA 1R4GA 2FOIC 3KS4A 4LRSA 3KS8A 4TUWA 3ILKA 2L2DA 3A42A 3JR5A 1LTMA 1I94M 2C96A 3D8BA 4KO8A 4G6ZA 4DR5M 4JI5M 2RGHA 1DGFA 4P17A 4L78A 4FCVA 2KZUA 4RNAA 2L09A 2G3QA 5DFLA 4L8RC 1QAOA 2G8LA 1AIPC 3QYEA 1GL7A 2QHOB 2W82A 2M60A 4I5SA 1SXJC 2EKKA 3RGSA 1TDZA 2HHHM 3AOGA 3FUXA 2LVAA 3GLIB 4AKHA 2UXCM 3CTWB 1K82A 4LRTA 1HJPA 2BWEA 4OVZB 4B3MM 3CGWA 4B3SM 5KPTA 2OQ4A 2F4VM 1Z6TA 3KP1E 1JR3A 3TWLA 4Z8XA 3SMSA 4DR4M 4RF1A 4IBFA 4X62M 2ZTDA 1QUTA 1QANA 4LJ8A 2DWZB 3KFUG 2CFOA 2Q2EB 4GKKM 2CV1A 1IY0A 3NWLA 2R6FA 3HGIA 1HNXM 2KHHA 2J7NA 3HY5A 1XNQM 5IT9S 3T15A 5ITXE 4JI3M 1KYIA 2GQFA 2JWSA 3IG8A 3LCUA 1WGNA 4QNMA 2OPFA 2DI0A 3GQ5A 4AKIA 4LF6M 3GRRA 3DZDA 3JR4A 3THGA 1DO0A 2JP7A 1JR3D 3K9PA 4DR2M 2MR9A 3U6EA 3Q8GA 4LG2A 5FTMA 3GLHE 3FTDA 2Y21A 2ZTCA 1HNWM 4FVMA 1NY6A 1EE8A 1SG9A 2LVQD 1ZV1A 3T1HM 2LNHC 1YUBA 3J81S 3IECA 2C99A 4XGIA 4JI1M 3SBJA 2CRUA 3L25A 1QVRA 5EP3A 1XB2B 2CHVA 4GC5A 4PD2A 3EIHA 1XMOM 2V6ZM 3LVVA 3NBIA 4GC9A 2RRUA 4DR1M 1XXHB 4MM3B 3TE6A 2YQZA 4DV3M 1PJJA 1OAIA 1G8PA 1ORYB 2O5RA 3U6MA 1J09A 1R7RA 2FFJA 4M0WA 3E46A 1UFZA 2K6BA 3E4RA 3TL4X 2WSFF 2LHGA 3B7QA 2UU9M 1NV9A 3L28A 3U6SA 3SMPA 2R4JA 3C58A 2K0BX 3I4VA 5IREB 2DHYA 3U60A 1OQYA 4IJEA 2K47A 3HHWA 1PRBA 1D0MA 3QWLA 3SASA 2XZFA 4DUYM 5LMUM 1J5EM 2JY8A 1XHBA 4B7GA
chains in the Genus database with same CATH topology
4OVZA 2ZM6M 4JI4M 4DV6M 2CV2A 1GL6A 2D7HA 2D7EA 4NSOB 4Z6YA 4LJ9A 3HHYA 3SYKA 2ZAMA 1IY1A 1N33M 4B7HA 4KLNA 3ZC7B 3FTFA 1N32M 3VDUA 3FUUA 3GRYA 2DWLA 1NNUC 3FUTA 2DZOB 5EP1A 3PXGA 2ZAOA 4HLQA 3UK6A 3GPXA 3HHXA 3LQQA 4YY3M 2L7IA 3IG5A 3TPZA 3HJ8A 2XLJA 1IXRC 2VQFM 8CATA 3KVWA 4X66M 1Q39A 1ZQ9A 1Z5AA 3KSJA 4FWDA 3T1YM 3U6DA 3RE8A 1K3XA 1TH3A 2Y20A 4IBIA 4GRIA 1SXJE 2RKOA 3A45A 4XBOA 2CV0A 4MGZE 2BJVA 3QAUA 4CHTB 3J7AS 2C9OA 4QNRA 3SYLA 2CE7A 4MGKE 1X37A 1IQPA 2EUCA 2NQ8C 2X49A 2YFQA 1E9SA 3JAMS 3H4MA 4GHLA 4LFCM 4EIWA 1QAQA 3SAWA 5A2QS 3GPYA 2DHRA 2R65A 4MGYE 2BJWA 3J7BA 3FD9A 5GKNA 4LZZA 4GMQA 4AW4A 2A5YB 2F5NA 2F5SA 1PJIA 1N36M 1QQWA 3HKPA 3HU1A 2VIIA 3VKHA 4IBGA 4IBJA 2RGOA 4FW9A 3U60B 1NHGC 3K8ZA 1E32A 2BNKA 2X4AA 4P16A 4GITA 3GQ3A 4DR6M 4LJ4A 3VDPA 3T38A 5FTNA 2DWNA 4LGYA 3VKGA 4OU7A 3SARA 1H6UA 4BLCA 3KSXA 4AG6A 4S12A 1Z5CA 4ITQA 3FUWA 4LJ5A 4FWHA 3SHFA 4OW0A 3DOAA 4D81A 3KOZE 1HQCA 1W5SA 1L2CA 3TQSA 3BOSA 3L2AA 4R3DA 2KZSA 2I7PA 1E9RA 3HU2A 4QHSA 3KOYE 5H37D 1QYRA 3VK8A 1TH4A 1TH2A 3MHVC 2X8AA 1N78A 3A46A 4PCZA 4LGMA 5KQDA 1NY5A 5ITRA 4JI7M 2LXEA 3FTCA 3K2LA 5JI3E 2EO2A 2KEBA 4AZFA 3U6PA 4LFBM 3GRUA 4G4RA 2QP9X 3HU3A 2KXEA 3GLFA 5BR8M 2G5GX 7CATA 2XFSA 5EXXA 4DUZM 4GIPA 3GLGA 1G59A 1OFIA 2DZNB 3FYCA 4LF5M 4M9SA 3L29A 5KO3A 5EQTA 1GVNA 2CHQA 3SAVA 3EIEA 4M9XA 3L26A 2UXBM 4I8OA 4AKGA 1KSFX 2KA6B 2QCUA 4II7A 4DR7M 3U61B 1PM5A 1JQJC 5FSWA 2F5QA 2C9CA 5KPRA 1HT1E 3SHGB 2Y0TA 1OFHA 3I4YA 2ZBKB 5FTKA 1IN7A 5F3WA 1LV7A 1FNNA 1IN6A 5ITTA 1DGGA 2JA2A 4DR3M 2Z3XA 4WURA 4W5WA 4I4LA 2QENA 3AKZA 4LCBA 4LF8M 5FTLA 2CUZA 3KDSE 3KW6A 3KP0E 4QOZC 2R45A 4NOOB 5EXPA 4DV2M 2Z7JA 4HL4A 4IBBA 4NSRA 3J2PB 1R6BX 3PVSA 1XWIA 4JYAM 4MH0E 5IZ7D 3UJNA 3VK7A 4REZA 3PFIA 2F5PA 3A98B 3HJQA 1IXSB 3R8FA 2HKJA 1G4AE 3GPUA 4LF9M 2I7NA 3DA1A 1G41A 4OX9M 4PDGA 3FTEA 4JI0M 1Z59A 3U6QA 3SFZA 3UGJA 4NRVA 2QBYA 5DYIA 5KPZA 3RGPA 4G4QA 4LY6A 3M0EA 5DNYA 4X65M 5ITQA 3HHZA 2KRUA 2XSZA 2KRKA 5ITXA 3OTOM 4G4OA 1N34M 1W5TA 2FE8A 3MJ5A 3GLFB 4X64M 3GO8A 1HQYE 3LVWA 3M7GA 3GLGB 4LF7M 4IBCA 3U5ZA 4JI2M 3GLHA 2HL7A 2M5ZA 3VFDA 5LMNM 3AOEA 3FKEA 3U61A 4B3RM 4IIWA 2XSZD 4JI8M 3J27B 2V1CA 4MB7A 2F5OA 3B9PA 5BPVA 1S3SA 2ERCA 1Q3BA 3ZCBB 2R62A 1HR0M 5FLXS 5DYGA 3SATA 3U6LA 2D7GA 4B08A 3AJIB 4DV1M 1R2YA 3KOWE 2AHMA 5ITYA 2Y0QA 3I51A 2DXIA 1HNZM 3KOXE 1XMQM 4LJ6A 1L2BA 4CGYB 1Q3CA 2LH0A 1Z5BA 3LMMA 4AQYM 1J7KA 1TDHA 1UM8A 4L15A 1DGHA 1IM2A 3ZH9B 1IN8A 4JXJA 4JI6M 1G3IA 1DGBA 3E9SA 2UUAM 1IXZA 2EA0A 4MGHA 1KFVA 2UUCM 3K1JA 1NNJA 2XF3A 1XC8A 2QZ4A 2Z4SA 4FD2A 1FJGM 4IBKA 4LFAM 4YHHM 4ZPXA 3R9XB 2QBYB 1WXQA 3GPPA 2DWMA 2LWXA 3L27A 4GH9A 3WHKA 3SAUA 1NJGA 5C18A 5JI2E 2HCBA 3LQRA 1L8QA 3D8LA 4G4NA 1HT2E 1N77A 3Q8XA 3DFZA 3UZUA 5KQ8A 4NXMM 4JV5M 4MGIE 3J80S 4NXNM 2E5LM 1QZMA 4PT5A 4L4UA 2UUBM 1MX0A 3GRVA 2XGNA 4JN6A 4LJ7A 1SXJA 5E6JA 5EP4A 5ITUA 4DV5M 4K0KM 2CEAA 1D2NA 1K3WA 4RF0A 4LF4M 4R7GA 3U5ZB 3GLHB 4DV7M 3MK6A 3WHLA 5EXTA 1I4WA 4LZJA 1QAMA 2J7OA 4A3VB 1XNRM 2P5TA 3CF6E 1VDDA 4QOSA 5EJCA 1R2ZA 2V1UA 3PNYA 3CF2A 2QPAA 3W0LB 1SXJD 3GQ4A 4KHPM 4WW0A 1OJLA 2C5RA 3RFWA 4AG5A 3AV0A 3M6AA 1NSFA 2CHGA 2XH9A 2ZANA 3GLIA 1NHWC 3HJSA 3PNVA 4FCTA 4B7FA 4D82A 1TGUA 2XEPA 3AOEC 2XZUA 1DGHB 4FWGA 3KXEC 5FTJA 2L7HA 2YNMD 5C1BA 4M0DA 3FUVA 5EP2A 4CISA 5EXSA 3AL0C 3UMMA 2VQEM 1IBMM 4DV0M 2KW0A 4IBDA 3K92A 1IY2A 1C1KA 3FYDA 1GLNA 5E26A 2L6OA 3U6CA 3TWMA 2UXDM 1DO2A 3HWSA 1IN5A 4FCWA 4L16A 1GKIA 4NRWA 3CF0A 1T3TA 3W0FA 1IN4A 3AFHA 4BBAA 2Z4RA 3GP1A 2R4EA 3U6OA 1E94E 1NVMA 4AI6A 2R18A 1N75A 4NL4H 4D80A 3SC3A 3TWKA 3VLFB 1ZAEA 4PD2A 3JR5A 1MU5A 4IJFA 1SXJB 2FNAA 1L2DA 1IBKM 1YE9A 1XXHA 4PDIA 4M9ZA 4IBEA 4QHTA 4I81A 2YR0A 1YSYA 2DVWB 2H1RA 4B3TM 4KODA 2C98A 1L1TA 4GHAA 2R46A 4BB9A 1NJFA 4DV4M 5IWAM 1L1ZA 4GKJM 2XFTA 4LJAA 2FOIC 3KS4A 4LRSA 3KS8A 4TUWA 3ILKA 3A42A 1I94M 2C96A 3D8BA 4KO8A 4G6ZA 4DR5M 4JI5M 2RGHA 1DGFA 4L78A 4FCVA 2KZUA 4RNAA 2L09A 4L8RC 1QAOA 2G8LA 1GL7A 2W82A 2M60A 4I5SA 1SXJC 3RGSA 1TDZA 2HHHM 3AOGA 3FUXA 3GLIB 4AKHA 2UXCM 3CTWB 1K82A 4LRTA 4OVZB 4B3MM 4B3SM 5KPTA 2OQ4A 2F4VM 1Z6TA 3KP1E 1JR3A 3TWLA 4Z8XA 3SMSA 4DR4M 4RF1A 4IBFA 4X62M 1QANA 4LJ8A 2DWZB 3KFUG 2CFOA 2Q2EB 4GKKM 2CV1A 1IY0A 3NWLA 3HGIA 1HNXM 2J7NA 1XNQM 5IT9S 3T15A 5ITXE 4JI3M 1KYIA 3IG8A 4QNMA 2OPFA 3GQ5A 4AKIA 4LF6M 3GRRA 3DZDA 3JR4A 3THGA 1DO0A 1JR3D 4DR2M 3U6EA 4LG2A 5FTMA 3FTDA 2Y21A 1HNWM 4FVMA 1NY6A 1EE8A 3T1HM 2LNHC 1YUBA 3J81S 2C99A 4XGIA 4JI1M 3SBJA 3L25A 1QVRA 5EP3A 2CHVA 4GC5A 3EIHA 1XMOM 2V6ZM 3LVVA 3NBIA 4GC9A 4DR1M 1IBLM 1XXHB 4MM3B 3TE6A 2YQZA 4DV3M 1PJJA 1G8PA 1ORYB 2O5RA 3U6MA 1J09A 1R7RA 2FFJA 4M0WA 3E4RA 3TL4X 2UU9M 3L28A 3U6SA 3SMPA 2R4JA 3C58A 3I4VA 5IREB 3U60A 4IJEA 2K47A 3HHWA 3QWLA 3SASA 2XZFA 4DUYM 5LMUM 1J5EM 1XHBA 4B7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP1 A;  5ITY A;  2ZM6 M;  5BR8 M;  1HNZ M;  4JI4 M;  4DV6 M;  3U6O A;  1L2B A;  1XMQ M;  4DUZ M;  1Q3C A;  3JR5 A;  1Z5B A;  4PD2 A;  3TWK A;  4AQY M;  1TDH A;  1MU5 A;  1L2D A;  1IBK M;  4LF5 M;  1N33 M;  4JI6 M;  4PDI A;  1N32 M;  2UUA M;  3SAV A;  2UXB M;  2EA0 A;  1KFV A;  4B3T M;  2UUC M;  1NNJ A;  1L1T A;  3GPX A;  4DV4 M;  5IWA M;  4YY3 M;  1XC8 A;  1L1Z A;  1FJG M;  4GKJ M;  4LFA M;  4DR7 M;  4YHH M;  1PM5 A;  2F5Q A;  2VQF M;  4X66 M;  1Q39 A;  3A42 A;  2ZBK B;  3GPP A;  1I94 M;  1Z5A A;  4DR5 M;  3T1Y M;  4JI5 M;  3SAU A;  3U6D A;  1K3X A;  5ITT A;  4DR3 M;  4G4N A;  3A45 A;  4NXM M;  3J7A S;  4JV5 M;  2HHH M;  1TDZ A;  3J80 S;  4LF8 M;  4NXN M;  2E5L M;  2UUB M;  1MX0 A;  5ITU A;  4DV5 M;  2UXC M;  1K82 A;  4DV2 M;  4K0K M;  3JAM S;  1K3W A;  4LF4 M;  4LFC M;  4B3M M;  4DV7 M;  2OQ4 A;  4B3S M;  2F4V M;  4JYA M;  3SAW A;  5A2Q S;  3TWL A;  3GPY A;  3VK7 A;  4DR4 M;  2F5P A;  4X62 M;  2HKJ A;  3GPU A;  2Q2E B;  4LF9 M;  1XNR M;  4GKK M;  4OX9 M;  2F5N A;  2F5S A;  1PJI A;  4PDG A;  1R2Z A;  1HNX M;  4JI0 M;  1Z59 A;  3U6Q A;  1N36 M;  1XNQ M;  4NRV A;  5IT9 S;  5ITX E;  4JI3 M;  4G4Q A;  3GQ4 A;  2OPF A;  4X65 M;  5ITQ A;  3GQ5 A;  4KHP M;  4LF6 M;  3JR4 A;  4DR2 M;  3U6E A;  3OTO M;  5ITX A;  3GQ3 A;  4G4O A;  1N34 M;  4DR6 M;  1HNW M;  1EE8 A;  3T1H M;  4X64 M;  3SAR A;  3GO8 A;  3J81 S;  4JI1 M;  3SBJ A;  1Z5C A;  4ITQ A;  4LF7 M;  2XZU A;  4JI2 M;  1XMO M;  3DOA A;  4DR1 M;  1IBL M;  4DV3 M;  5LMN M;  1PJJ A;  3U6M A;  4B3R M;  1L2C A;  4CIS A;  4JI8 M;  4MB7 A;  2VQE M;  2F5O A;  1IBM M;  4DV0 M;  3VK8 A;  2UU9 M;  3U6S A;  1Q3B A;  3A46 A;  4PCZ A;  3U6C A;  3C58 A;  1HR0 M;  3TWM A;  2UXD M;  5ITR A;  4JI7 M;  5FLX S;  3SAT A;  3U6L A;  3SAS A;  2XZF A;  4DUY M;  3U6P A;  5LMU M;  4G4R A;  1J5E M;  4NRW A;  3W0F A;  4LFB M;  4DV1 M;  1R2Y A; 
#chains in the Genus database with same CATH topology
 1D0L A;  4OVZ A;  2ZM6 M;  4JI4 M;  1Q02 A;  4DV6 M;  2CV2 A;  1ZMV A;  1D0K A;  1GL6 A;  2D7H A;  2D7E A;  3C3E A;  4NSO B;  4Z6Y A;  4LJ9 A;  3HHY A;  3SYK A;  2ZAM A;  1IY1 A;  1N33 M;  4B7H A;  4KLN A;  3ZC7 B;  3FTF A;  1N32 M;  3VDU A;  1IBL M;  3FUU A;  3GRY A;  2DWL A;  1NNU C;  3FUT A;  2DZO B;  5EP1 A;  3PXG A;  2MGW A;  2ZAO A;  4HLQ A;  3UK6 A;  1F4I A;  3GPX A;  4WP2 A;  1MN3 A;  1VG5 A;  3HHX A;  3LQQ A;  4YY3 M;  1OAO C;  2L7I A;  3IG5 A;  3TPZ A;  3HJ8 A;  2XLJ A;  1IXR C;  2VQF M;  8CAT A;  3KVW A;  4X66 M;  1Q39 A;  1ZQ9 A;  1Z5A A;  3KSJ A;  4FWD A;  3T1Y M;  3U6D A;  2DKL A;  3RE8 A;  1TH3 A;  2EJS A;  1K3X A;  1MJG M;  2Y20 A;  4IBI A;  4GRI A;  1SXJ E;  2RKO A;  1P3Q Q;  3A45 A;  4XBO A;  4XK8 F;  1C7Y A;  2CV0 A;  1GAB A;  1IFY A;  4MGZ E;  2BJV A;  3QAU A;  4CHT B;  3J7A S;  2BWB A;  2C9O A;  4ANR A;  4QNR A;  3SYL A;  2CE7 A;  4MGK E;  1X37 A;  1IQP A;  2EUC A;  2NQ8 C;  2X49 A;  2YFQ A;  1E9S A;  2N35 A;  3H4M A;  3JAM S;  3H4J A;  4LFC M;  4GHL A;  4EIW A;  1QAQ A;  3SAW A;  5A2Q S;  3GPY A;  2DHR A;  2R65 A;  4MGY E;  2BJW A;  3J7B A;  4NC6 A;  3FD9 A;  5GKN A;  4LZZ A;  4GMQ A;  2KNA A;  4AW4 A;  3IHP A;  2A5Y B;  2F5N A;  2F5S A;  1PJI A;  2MRO B;  1N36 M;  1QQW A;  1TF0 B;  3HKP A;  2VII A;  3HU1 A;  3VKH A;  3LCV B;  2R44 A;  2DAM A;  4IBG A;  1G71 A;  2DAE A;  3F92 A;  4IBJ A;  2RGO A;  4FW9 A;  3U60 B;  1NHG C;  3K8Z A;  3GLI E;  1OKS A;  1E32 A;  2BNK A;  2X4A A;  4P16 A;  4GIT A;  1Y8G A;  3GQ3 A;  4DR6 M;  4LJ4 A;  3VDP A;  3T38 A;  2R0I A;  4Y28 F;  5FTN A;  2DWN A;  4LGY A;  3VKG A;  4OU7 A;  3SAR A;  1H6U A;  4BLC A;  3KSX A;  4AG6 A;  4S12 A;  1AUA A;  1Z5C A;  4ITQ A;  3FUW A;  4LJ5 A;  4FWH A;  3SHF A;  1EFU B;  4OW0 A;  2B3T A;  3DOA A;  4D81 A;  3KOZ E;  2KNV A;  1IXS A;  1HQC A;  1W5S A;  1L2C A;  2Z8Y M;  3B74 A;  3TQS A;  4CJ6 A;  3BOS A;  3L2A A;  4R3D A;  2KZS A;  2I7P A;  1E9R A;  3HU2 A;  2GNO A;  2LHC A;  4QHS A;  2JY6 B;  2MJ5 B;  3B7N A;  3KOY E;  1QYR A;  5H37 D;  3VK8 A;  1TH4 A;  1TH2 A;  3I04 M;  3MHV C;  2X8A A;  1N78 A;  3A46 A;  4PCZ A;  4LGM A;  5KQD A;  1NY5 A;  3BBZ A;  1VEK A;  5ITR A;  4JI7 M;  2MH8 A;  1T43 A;  2LXE A;  3FTC A;  3K2L A;  5JI3 E;  2EO2 A;  2KEB A;  1QDT A;  1GJT A;  2WSC F;  4AZF A;  3U6P A;  4LFB M;  2LVP C;  3GRU A;  4G4R A;  2QP9 X;  2H5X A;  3HU3 A;  2KXE A;  3GLF A;  5BR8 M;  1VEJ A;  2G5G X;  7CAT A;  2XFS A;  3W68 A;  5EXX A;  4DUZ M;  1ZMU A;  4GIP A;  3GLG A;  2FH0 A;  1OFI A;  2DZN B;  1G59 A;  2WZJ A;  2VF7 A;  3FYC A;  4LF5 M;  2DAK A;  4M9S A;  3L29 A;  5KO3 A;  5EQT A;  1JB0 F;  1GVN A;  2CHQ A;  3C3D A;  1A5T A;  2LTU A;  3SAV A;  3EIE A;  4M9X A;  3L26 A;  2UXB M;  2FS1 A;  4I8O A;  4AKG A;  1WJ7 A;  1KSF X;  2KA6 B;  1VEG A;  2QCU A;  4II7 A;  4DR7 M;  3U61 B;  1PM5 A;  1JQJ C;  5FSW A;  2F5Q A;  2C9C A;  4GEW A;  5KPR A;  1HT1 E;  3SHG B;  2Y0T A;  1TTE A;  1OFH A;  2L4F A;  2ZBK B;  3I4Y A;  5FTK A;  1IN7 A;  5ITU A;  5F3W A;  1LV7 A;  1FNN A;  1IN6 A;  5ITT A;  3T6P A;  1DGG A;  2JA2 A;  4DR3 M;  2Z3X A;  4WUR A;  4W5W A;  2LVO C;  2L4E A;  4I4L A;  2QEN A;  3AKZ A;  4LCB A;  4LF8 M;  5FTL A;  1JR3 E;  2CUZ A;  3KDS E;  3KP0 E;  3KW6 A;  4QOZ C;  2R45 A;  4NOO B;  5EXP A;  4DV2 M;  2HAK A;  3FE3 A;  2Z7J A;  4HL4 A;  2JUJ A;  4IBB A;  4NSR A;  3J2P B;  1R6B X;  3PVS A;  1XWI A;  4JYA M;  2DAG A;  4MH0 E;  5IZ7 D;  3UJN A;  3VK7 A;  4REZ A;  3PFI A;  2F5P A;  3A98 B;  3HJQ A;  1IXS B;  3R8F A;  2HKJ A;  3MMP A;  1G4A E;  4R71 A;  3GPU A;  4LF9 M;  2I7N A;  3DA1 A;  1G41 A;  4OX9 M;  4PDG A;  3FTE A;  1TR8 A;  4JI0 M;  1Z59 A;  1PJS A;  3SFZ A;  3U6Q A;  3UGJ A;  4NRV A;  2QBY A;  5DYI A;  5KPZ A;  3RGP A;  4G4Q A;  4LY6 A;  3M0E A;  5DNY A;  4X65 M;  5ITQ A;  3HHZ A;  2KRU A;  2XSZ A;  2KRK A;  5ITX A;  3OTO M;  4G4O A;  1N34 M;  1W5T A;  2FE8 A;  3MJ5 A;  3NBX X;  3GLF B;  4X64 M;  3GO8 A;  1HQY E;  3C9P A;  3LVW A;  3M7G A;  3GLG B;  4LF7 M;  4IBC A;  2JY5 A;  3U5Z A;  4JI2 M;  3GLH A;  2HL7 A;  3B7Z A;  1QZE A;  2M5Z A;  3VFD A;  3LW5 F;  3AOE A;  3FKE A;  5LMN M;  3U61 A;  1OIZ A;  4IIW A;  4B3R M;  2XSZ D;  3V76 A;  4JI8 M;  3J27 B;  2EKF A;  2V1C A;  4MB7 A;  2F5O A;  3B9P A;  5BPV A;  1WR1 B;  1S3S A;  2ERC A;  1Q3B A;  4DV5 M;  3ZCB B;  2R62 A;  3HX3 A;  1HR0 M;  1EIJ A;  5FLX S;  5DYG A;  3SAT A;  3U6L A;  3HZJ A;  2D7G A;  3FRI A;  4B08 A;  3AJI B;  4DV1 M;  1R2Y A;  3KOW E;  2AHM A;  1V34 A;  5ITY A;  2Y0Q A;  3I51 A;  2DXI A;  1HNZ M;  2DNA A;  3KOX E;  1XMQ M;  4LJ6 A;  1L2B A;  4CGY B;  1Q3C A;  2CP8 A;  1Z5B A;  2LH0 A;  3LMM A;  4AQY M;  1J7K A;  1TDH A;  1UM8 A;  4L15 A;  1DGH A;  1IM2 A;  1WGL A;  3ZH9 B;  1IN8 A;  4JXJ A;  4JI6 M;  1G3I A;  2VDB B;  2OO9 A;  1DGB A;  3E9S A;  2QNJ A;  2UUA M;  1IXZ A;  2EA0 A;  2QQ8 A;  4MGH A;  1KFV A;  2UUC M;  3K1J A;  1NNJ A;  2XF3 A;  1XC8 A;  1PJQ A;  2QZ4 A;  2Z4S A;  4FD2 A;  4G3O A;  5L8R F;  4IBK A;  4LFA M;  4YHH M;  1FJG M;  2LVN C;  4ZPX A;  3R9X B;  1ZMW A;  2QBY B;  1WXQ A;  3GPP A;  2DWM A;  3W67 A;  2LWX A;  3L27 A;  2APL A;  4GH9 A;  4Q7J A;  3WHK A;  3SAU A;  1NJG A;  1XXH E;  5C18 A;  5JI2 E;  2HCB A;  2OOA A;  3E21 A;  3LQR A;  2KDL A;  1L8Q A;  3D8L A;  2K9D A;  1HT2 E;  4G4N A;  2DZL A;  1N77 A;  3Q8X A;  3DFZ A;  1WIV A;  3UZU A;  5KQ8 A;  4UN2 B;  4NXM M;  4JV5 M;  4MGI E;  3J80 S;  1GO5 A;  4NXN M;  2E5L M;  1QZM A;  4PT5 A;  4L4U A;  2UUB M;  1MX0 A;  1NV8 A;  2XGN A;  3GRV A;  2OOB A;  1SXJ A;  4JN6 A;  4LJ7 A;  5E6J A;  5EP4 A;  4K0K M;  2CEA A;  1D2N A;  1K3W A;  4RF0 A;  4LF4 M;  3FRH A;  4R7G A;  2JXN A;  3GLH B;  4DV7 M;  3U5Z B;  3MK6 A;  2O25 A;  3WHL A;  5EXT A;  1I4W A;  4LZJ A;  1QAM A;  2DAI A;  2J7O A;  4A3V B;  1XNR M;  2P5T A;  3CF6 E;  1VDD A;  3I01 M;  4QOS A;  5EJC A;  2O01 F;  1R2Z A;  4DBG B;  2V1U A;  3PNY A;  1QUS A;  3CF2 A;  2QPA A;  3W0L B;  1SXJ D;  2DEN A;  2J5Y A;  3GQ4 A;  2KNZ A;  4KHP M;  4WW0 A;  1V33 A;  1OJL A;  2C5R A;  2QSF X;  1CUK A;  2CWB A;  3RFW A;  4AG5 A;  3AV0 A;  3M6A A;  1NSF A;  2CHG A;  2XH9 A;  2ZAN A;  3GLI A;  1NHW C;  3HJS A;  3PNV A;  3K9O A;  1OTR A;  4FCT A;  4B7F A;  1VQ1 A;  1TGU A;  4RKU F;  4D82 A;  2XEP A;  3AOE C;  3QYB A;  1NO1 A;  1DGH B;  2XZU A;  4FWG A;  3KXE C;  1QDR A;  5FTJ A;  2L7H A;  2YNM D;  5C1B A;  1T6O A;  4M0D A;  3FUV A;  4F1I A;  3B89 A;  5EP2 A;  4CIS A;  1PJT A;  5EXS A;  3AL0 C;  3UMM A;  2VQE M;  1IBM M;  4DV0 M;  2KW0 A;  2JZ0 A;  4IBD A;  1WHC A;  3ZQJ A;  3K92 A;  1IY2 A;  1BVS A;  1C1K A;  3FYD A;  1GLN A;  5E26 A;  2L6O A;  3U6C A;  3GLF E;  3TWM A;  2UXD M;  1DV0 A;  1DO2 A;  4HEO A;  3HWS A;  1IN5 A;  4FCW A;  2JZ1 A;  4L16 A;  1GKI A;  4CIZ A;  3CF0 A;  1T3T A;  3W0F A;  3GLG E;  1IN4 A;  4NRW A;  3AFH A;  4BBA A;  2Z4R A;  1R5L A;  2VF8 A;  2R4E A;  3GP1 A;  3U6O A;  1E94 E;  4L6V 6;  1NVM A;  1YLA A;  4AI6 A;  2R18 A;  1N75 A;  2JY7 A;  4NL4 H;  3SC3 A;  3TWK A;  3VLF B;  1ZAE A;  2JNH A;  4D80 A;  1MU5 A;  4IJF A;  1SXJ B;  2FNA A;  1L2D A;  1IBK M;  1YE9 A;  1PGY A;  1XXH A;  4PDI A;  4M9Z A;  4IBE A;  4QHT A;  1VDL A;  2WSE F;  1V92 A;  4I81 A;  1RU3 A;  1OIP A;  1YSY A;  2DVW B;  2H1R A;  2HWJ A;  2LBC A;  2YR0 A;  4KT0 F;  4F2L A;  4KOD A;  4B3T M;  3BXW A;  2C98 A;  1L1T A;  4GHA A;  2R46 A;  1GJS A;  4BB9 A;  1NJF A;  4DV4 M;  5IWA M;  1L1Z A;  4GKJ M;  2XFT A;  4LJA A;  1R4G A;  2FOI C;  3KS4 A;  4LRS A;  3KS8 A;  4TUW A;  3ILK A;  2L2D A;  3A42 A;  3JR5 A;  1LTM A;  1I94 M;  2C96 A;  3D8B A;  4KO8 A;  4G6Z A;  4DR5 M;  4JI5 M;  2RGH A;  1DGF A;  4P17 A;  4L78 A;  4FCV A;  2KZU A;  4RNA A;  2L09 A;  2G3Q A;  5DFL A;  4L8R C;  1QAO A;  2G8L A;  1AIP C;  3QYE A;  1GL7 A;  2QHO B;  2W82 A;  2M60 A;  4I5S A;  1SXJ C;  2EKK A;  3RGS A;  1TDZ A;  2HHH M;  3AOG A;  3FUX A;  2LVA A;  3GLI B;  4AKH A;  2UXC M;  3CTW B;  1K82 A;  4LRT A;  1HJP A;  2BWE A;  4OVZ B;  4B3M M;  3CGW A;  4B3S M;  5KPT A;  2OQ4 A;  2F4V M;  1Z6T A;  3KP1 E;  1JR3 A;  3TWL A;  4Z8X A;  3SMS A;  4DR4 M;  4RF1 A;  4IBF A;  4X62 M;  2ZTD A;  1QUT A;  1QAN A;  4LJ8 A;  2DWZ B;  3KFU G;  2CFO A;  2Q2E B;  4GKK M;  2CV1 A;  1IY0 A;  3NWL A;  2R6F A;  3HGI A;  1HNX M;  2KHH A;  2J7N A;  3HY5 A;  1XNQ M;  5IT9 S;  3T15 A;  5ITX E;  4JI3 M;  1KYI A;  2GQF A;  2JWS A;  3IG8 A;  3LCU A;  1WGN A;  4QNM A;  2OPF A;  2DI0 A;  3GQ5 A;  4AKI A;  4LF6 M;  3GRR A;  3DZD A;  3JR4 A;  3THG A;  1DO0 A;  2JP7 A;  1JR3 D;  3K9P A;  4DR2 M;  2MR9 A;  3U6E A;  3Q8G A;  4LG2 A;  5FTM A;  3GLH E;  3FTD A;  2Y21 A;  2ZTC A;  1HNW M;  4FVM A;  1NY6 A;  1EE8 A;  1SG9 A;  2LVQ D;  1ZV1 A;  3T1H M;  2LNH C;  1YUB A;  3J81 S;  3IEC A;  2C99 A;  4XGI A;  4JI1 M;  3SBJ A;  2CRU A;  3L25 A;  1QVR A;  5EP3 A;  1XB2 B;  2CHV A;  4GC5 A;  4PD2 A;  3EIH A;  1XMO M;  2V6Z M;  3LVV A;  3NBI A;  4GC9 A;  2RRU A;  4DR1 M;  1XXH B;  4MM3 B;  3TE6 A;  2YQZ A;  4DV3 M;  1PJJ A;  1OAI A;  1G8P A;  1ORY B;  2O5R A;  3U6M A;  1J09 A;  1R7R A;  2FFJ A;  4M0W A;  3E46 A;  1UFZ A;  2K6B A;  3E4R A;  3TL4 X;  2WSF F;  2LHG A;  3B7Q A;  2UU9 M;  1NV9 A;  3L28 A;  3U6S A;  3SMP A;  2R4J A;  3C58 A;  2K0B X;  3I4V A;  5IRE B;  2DHY A;  3U60 A;  1OQY A;  4IJE A;  2K47 A;  3HHW A;  1PRB A;  1D0M A;  3QWL A;  3SAS A;  2XZF A;  4DUY M;  5LMU M;  1J5E M;  2JY8 A;  1XHB A;  4B7G A; 
#chains in the Genus database with same CATH homology
 4OVZ A;  2ZM6 M;  4JI4 M;  4DV6 M;  2CV2 A;  1GL6 A;  2D7H A;  2D7E A;  4NSO B;  4Z6Y A;  4LJ9 A;  3HHY A;  3SYK A;  2ZAM A;  1IY1 A;  1N33 M;  4B7H A;  4KLN A;  3ZC7 B;  3FTF A;  1N32 M;  3VDU A;  3FUU A;  3GRY A;  2DWL A;  1NNU C;  3FUT A;  2DZO B;  5EP1 A;  3PXG A;  2ZAO A;  4HLQ A;  3UK6 A;  3GPX A;  3HHX A;  3LQQ A;  4YY3 M;  2L7I A;  3IG5 A;  3TPZ A;  3HJ8 A;  2XLJ A;  1IXR C;  2VQF M;  8CAT A;  3KVW A;  4X66 M;  1Q39 A;  1ZQ9 A;  1Z5A A;  3KSJ A;  4FWD A;  3T1Y M;  3U6D A;  3RE8 A;  1K3X A;  1TH3 A;  2Y20 A;  4IBI A;  4GRI A;  1SXJ E;  2RKO A;  3A45 A;  4XBO A;  2CV0 A;  4MGZ E;  2BJV A;  3QAU A;  4CHT B;  3J7A S;  2C9O A;  4QNR A;  3SYL A;  2CE7 A;  4MGK E;  1X37 A;  1IQP A;  2EUC A;  2NQ8 C;  2X49 A;  2YFQ A;  1E9S A;  3JAM S;  3H4M A;  4GHL A;  4LFC M;  4EIW A;  1QAQ A;  3SAW A;  5A2Q S;  3GPY A;  2DHR A;  2R65 A;  4MGY E;  2BJW A;  3J7B A;  3FD9 A;  5GKN A;  4LZZ A;  4GMQ A;  4AW4 A;  2A5Y B;  2F5N A;  2F5S A;  1PJI A;  1N36 M;  1QQW A;  3HKP A;  3HU1 A;  2VII A;  3VKH A;  4IBG A;  4IBJ A;  2RGO A;  4FW9 A;  3U60 B;  1NHG C;  3K8Z A;  1E32 A;  2BNK A;  2X4A A;  4P16 A;  4GIT A;  3GQ3 A;  4DR6 M;  4LJ4 A;  3VDP A;  3T38 A;  5FTN A;  2DWN A;  4LGY A;  3VKG A;  4OU7 A;  3SAR A;  1H6U A;  4BLC A;  3KSX A;  4AG6 A;  4S12 A;  1Z5C A;  4ITQ A;  3FUW A;  4LJ5 A;  4FWH A;  3SHF A;  4OW0 A;  3DOA A;  4D81 A;  3KOZ E;  1HQC A;  1W5S A;  1L2C A;  3TQS A;  3BOS A;  3L2A A;  4R3D A;  2KZS A;  2I7P A;  1E9R A;  3HU2 A;  4QHS A;  3KOY E;  5H37 D;  1QYR A;  3VK8 A;  1TH4 A;  1TH2 A;  3MHV C;  2X8A A;  1N78 A;  3A46 A;  4PCZ A;  4LGM A;  5KQD A;  1NY5 A;  5ITR A;  4JI7 M;  2LXE A;  3FTC A;  3K2L A;  5JI3 E;  2EO2 A;  2KEB A;  4AZF A;  3U6P A;  4LFB M;  3GRU A;  4G4R A;  2QP9 X;  3HU3 A;  2KXE A;  3GLF A;  5BR8 M;  2G5G X;  7CAT A;  2XFS A;  5EXX A;  4DUZ M;  4GIP A;  3GLG A;  1G59 A;  1OFI A;  2DZN B;  3FYC A;  4LF5 M;  4M9S A;  3L29 A;  5KO3 A;  5EQT A;  1GVN A;  2CHQ A;  3SAV A;  3EIE A;  4M9X A;  3L26 A;  2UXB M;  4I8O A;  4AKG A;  1KSF X;  2KA6 B;  2QCU A;  4II7 A;  4DR7 M;  3U61 B;  1PM5 A;  1JQJ C;  5FSW A;  2F5Q A;  2C9C A;  5KPR A;  1HT1 E;  3SHG B;  2Y0T A;  1OFH A;  3I4Y A;  2ZBK B;  5FTK A;  1IN7 A;  5F3W A;  1LV7 A;  1FNN A;  1IN6 A;  5ITT A;  1DGG A;  2JA2 A;  4DR3 M;  2Z3X A;  4WUR A;  4W5W A;  4I4L A;  2QEN A;  3AKZ A;  4LCB A;  4LF8 M;  5FTL A;  2CUZ A;  3KDS E;  3KW6 A;  3KP0 E;  4QOZ C;  2R45 A;  4NOO B;  5EXP A;  4DV2 M;  2Z7J A;  4HL4 A;  4IBB A;  4NSR A;  3J2P B;  1R6B X;  3PVS A;  1XWI A;  4JYA M;  4MH0 E;  5IZ7 D;  3UJN A;  3VK7 A;  4REZ A;  3PFI A;  2F5P A;  3A98 B;  3HJQ A;  1IXS B;  3R8F A;  2HKJ A;  1G4A E;  3GPU A;  4LF9 M;  2I7N A;  3DA1 A;  1G41 A;  4OX9 M;  4PDG A;  3FTE A;  4JI0 M;  1Z59 A;  3U6Q A;  3SFZ A;  3UGJ A;  4NRV A;  2QBY A;  5DYI A;  5KPZ A;  3RGP A;  4G4Q A;  4LY6 A;  3M0E A;  5DNY A;  4X65 M;  5ITQ A;  3HHZ A;  2KRU A;  2XSZ A;  2KRK A;  5ITX A;  3OTO M;  4G4O A;  1N34 M;  1W5T A;  2FE8 A;  3MJ5 A;  3GLF B;  4X64 M;  3GO8 A;  1HQY E;  3LVW A;  3M7G A;  3GLG B;  4LF7 M;  4IBC A;  3U5Z A;  4JI2 M;  3GLH A;  2HL7 A;  2M5Z A;  3VFD A;  5LMN M;  3AOE A;  3FKE A;  3U61 A;  4B3R M;  4IIW A;  2XSZ D;  4JI8 M;  3J27 B;  2V1C A;  4MB7 A;  2F5O A;  3B9P A;  5BPV A;  1S3S A;  2ERC A;  1Q3B A;  3ZCB B;  2R62 A;  1HR0 M;  5FLX S;  5DYG A;  3SAT A;  3U6L A;  2D7G A;  4B08 A;  3AJI B;  4DV1 M;  1R2Y A;  3KOW E;  2AHM A;  5ITY A;  2Y0Q A;  3I51 A;  2DXI A;  1HNZ M;  3KOX E;  1XMQ M;  4LJ6 A;  1L2B A;  4CGY B;  1Q3C A;  2LH0 A;  1Z5B A;  3LMM A;  4AQY M;  1J7K A;  1TDH A;  1UM8 A;  4L15 A;  1DGH A;  1IM2 A;  3ZH9 B;  1IN8 A;  4JXJ A;  4JI6 M;  1G3I A;  1DGB A;  3E9S A;  2UUA M;  1IXZ A;  2EA0 A;  4MGH A;  1KFV A;  2UUC M;  3K1J A;  1NNJ A;  2XF3 A;  1XC8 A;  2QZ4 A;  2Z4S A;  4FD2 A;  1FJG M;  4IBK A;  4LFA M;  4YHH M;  4ZPX A;  3R9X B;  2QBY B;  1WXQ A;  3GPP A;  2DWM A;  2LWX A;  3L27 A;  4GH9 A;  3WHK A;  3SAU A;  1NJG A;  5C18 A;  5JI2 E;  2HCB A;  3LQR A;  1L8Q A;  3D8L A;  4G4N A;  1HT2 E;  1N77 A;  3Q8X A;  3DFZ A;  3UZU A;  5KQ8 A;  4NXM M;  4JV5 M;  4MGI E;  3J80 S;  4NXN M;  2E5L M;  1QZM A;  4PT5 A;  4L4U A;  2UUB M;  1MX0 A;  3GRV A;  2XGN A;  4JN6 A;  4LJ7 A;  1SXJ A;  5E6J A;  5EP4 A;  5ITU A;  4DV5 M;  4K0K M;  2CEA A;  1D2N A;  1K3W A;  4RF0 A;  4LF4 M;  4R7G A;  3U5Z B;  3GLH B;  4DV7 M;  3MK6 A;  3WHL A;  5EXT A;  1I4W A;  4LZJ A;  1QAM A;  2J7O A;  4A3V B;  1XNR M;  2P5T A;  3CF6 E;  1VDD A;  4QOS A;  5EJC A;  1R2Z A;  2V1U A;  3PNY A;  3CF2 A;  2QPA A;  3W0L B;  1SXJ D;  3GQ4 A;  4KHP M;  4WW0 A;  1OJL A;  2C5R A;  3RFW A;  4AG5 A;  3AV0 A;  3M6A A;  1NSF A;  2CHG A;  2XH9 A;  2ZAN A;  3GLI A;  1NHW C;  3HJS A;  3PNV A;  4FCT A;  4B7F A;  4D82 A;  1TGU A;  2XEP A;  3AOE C;  2XZU A;  1DGH B;  4FWG A;  3KXE C;  5FTJ A;  2L7H A;  2YNM D;  5C1B A;  4M0D A;  3FUV A;  5EP2 A;  4CIS A;  5EXS A;  3AL0 C;  3UMM A;  2VQE M;  1IBM M;  4DV0 M;  2KW0 A;  4IBD A;  3K92 A;  1IY2 A;  1C1K A;  3FYD A;  1GLN A;  5E26 A;  2L6O A;  3U6C A;  3TWM A;  2UXD M;  1DO2 A;  3HWS A;  1IN5 A;  4FCW A;  4L16 A;  1GKI A;  4NRW A;  3CF0 A;  1T3T A;  3W0F A;  1IN4 A;  3AFH A;  4BBA A;  2Z4R A;  3GP1 A;  2R4E A;  3U6O A;  1E94 E;  1NVM A;  4AI6 A;  2R18 A;  1N75 A;  4NL4 H;  4D80 A;  3SC3 A;  3TWK A;  3VLF B;  1ZAE A;  4PD2 A;  3JR5 A;  1MU5 A;  4IJF A;  1SXJ B;  2FNA A;  1L2D A;  1IBK M;  1YE9 A;  1XXH A;  4PDI A;  4M9Z A;  4IBE A;  4QHT A;  4I81 A;  2YR0 A;  1YSY A;  2DVW B;  2H1R A;  4B3T M;  4KOD A;  2C98 A;  1L1T A;  4GHA A;  2R46 A;  4BB9 A;  1NJF A;  4DV4 M;  5IWA M;  1L1Z A;  4GKJ M;  2XFT A;  4LJA A;  2FOI C;  3KS4 A;  4LRS A;  3KS8 A;  4TUW A;  3ILK A;  3A42 A;  1I94 M;  2C96 A;  3D8B A;  4KO8 A;  4G6Z A;  4DR5 M;  4JI5 M;  2RGH A;  1DGF A;  4L78 A;  4FCV A;  2KZU A;  4RNA A;  2L09 A;  4L8R C;  1QAO A;  2G8L A;  1GL7 A;  2W82 A;  2M60 A;  4I5S A;  1SXJ C;  3RGS A;  1TDZ A;  2HHH M;  3AOG A;  3FUX A;  3GLI B;  4AKH A;  2UXC M;  3CTW B;  1K82 A;  4LRT A;  4OVZ B;  4B3M M;  4B3S M;  5KPT A;  2OQ4 A;  2F4V M;  1Z6T A;  3KP1 E;  1JR3 A;  3TWL A;  4Z8X A;  3SMS A;  4DR4 M;  4RF1 A;  4IBF A;  4X62 M;  1QAN A;  4LJ8 A;  2DWZ B;  3KFU G;  2CFO A;  2Q2E B;  4GKK M;  2CV1 A;  1IY0 A;  3NWL A;  3HGI A;  1HNX M;  2J7N A;  1XNQ M;  5IT9 S;  3T15 A;  5ITX E;  4JI3 M;  1KYI A;  3IG8 A;  4QNM A;  2OPF A;  3GQ5 A;  4AKI A;  4LF6 M;  3GRR A;  3DZD A;  3JR4 A;  3THG A;  1DO0 A;  1JR3 D;  4DR2 M;  3U6E A;  4LG2 A;  5FTM A;  3FTD A;  2Y21 A;  1HNW M;  4FVM A;  1NY6 A;  1EE8 A;  3T1H M;  2LNH C;  1YUB A;  3J81 S;  2C99 A;  4XGI A;  4JI1 M;  3SBJ A;  3L25 A;  1QVR A;  5EP3 A;  2CHV A;  4GC5 A;  3EIH A;  1XMO M;  2V6Z M;  3LVV A;  3NBI A;  4GC9 A;  4DR1 M;  1IBL M;  1XXH B;  4MM3 B;  3TE6 A;  2YQZ A;  4DV3 M;  1PJJ A;  1G8P A;  1ORY B;  2O5R A;  3U6M A;  1J09 A;  1R7R A;  2FFJ A;  4M0W A;  3E4R A;  3TL4 X;  2UU9 M;  3L28 A;  3U6S A;  3SMP A;  2R4J A;  3C58 A;  3I4V A;  5IRE B;  3U60 A;  4IJE A;  2K47 A;  3HHW A;  3QWL A;  3SAS A;  2XZF A;  4DUY M;  5LMU M;  1J5E M;  1XHB A;  4B7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...