2OQ4A

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
262
structure length
252
Chain Sequence
PQGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGLFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrates and mutations of critical residues
rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords 5'-D(*G*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*GP*G)-3'
total genus 74
structure length 252
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2oq4A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2oq4A01
1XMQM 2ZBKB 5FLXS 4LF4M 4DV5M 4LF7M 2HKJA 3JR4A 4MB7A 4DV4M 4GKKM 3GPUA 4CISA 4B3RM 3U6MA 5A2QS 1EE8A 5BR8M 4G4RA 5ITXA 3GPPA 5ITUA 2ZM6M 1L1TA 3U6EA 3T1HM 1L2CA 3W0FA 4NXNM 1Q39A 3A46A 1PM5A 4JI6M 1PJJA 2F5PA 4PDGA 4JI4M 4DUZM 3T1YM 4YHHM 3SAWA 4B3MM 1NNJA 4DV7M 3J81S 4NRVA 3SAUA 1XNRM 4X62M 1Q3BA 3J7AS 4DV1M 3J80S 4LFAM 4DV0M 1XC8A 4X65M 1Q3CA 3TWKA 1IBLM 4GKJM 4G4NA 4PD2A 3OTOM 1N36M 4LFCM 3U6CA 4K0KM 3U6SA 2EA0A 4DR2M 3GO8A 5IWAM 4JI7M 2UXDM 3VK8A 3GP1A 2VQFM 1FJGM 3U6DA 2VQEM 3A45A 4YY3M 4PDIA 1N34M 4LF5M 5IT9S 3SARA 3U6OA 2UUAM 4X64M 1HNWM 3TWMA 1N33M 4LF8M 4DR6M 4JV5M 3SAVA 1XNQM 1HNXM 1R2ZA 2OPFA 4OX9M 2UXBM 2F5NA 2XZFA 3JAMS 1Z59A 5ITTA 5LMNM 3SBJA 1HNZM 5ITYA 1R2YA 5ITRA 1KFVA 4LF6M 1K82A 4JI2M 4G4QA 4JI3M 2F5QA 2UU9M 1N32M 4NRWA 4JI1M 3U6LA 2Q2EB 3JR5A 1TDZA 1J5EM 4DR3M 4G4OA 4DV2M 2HHHM 4LFBM 3GPYA 4DR5M 3U6QA 4DR1M 1PJIA 3TWLA 1IBMM 5ITQA 4DV6M 2XZUA 1K3WA 4X66M 2F5SA 4DR7M 2F5OA 1K3XA 3VK7A 3GPXA 4B3SM 3GQ3A 4DR4M 3C58A 1I94M 4JI5M 2E5LM 4JYAM 1Z5AA 4B3TM 4DUYM 3GQ5A 1L2DA 4AQYM 4JI0M 1IBKM 2UUCM 1L1ZA 1L2BA 1MU5A 1MX0A 4KHPM 1XMOM 1TDHA 4DV3M 2UUBM 3SATA 1Z5BA 3DOAA 3SASA 2OQ4A 4ITQA 4NXMM 4PCZA 1HR0M 4LF9M 1Z5CA 4JI8M 2F4VM 5ITXE 2UXCM 3GQ4A 3U6PA 5LMUM 3A42A
chains in the Genus database with same CATH superfamily
2ZBKB 2QNJA 1OKSA 1DGGA 1A5TA 2WZJA 1WJ7A 3WHKA 3UJNA 3U60A 3JR4A 4LF7M 1EIJA 1I4WA 2O25A 3DZDA 3I04M 4M9ZA 4GKKM 2D7HA 4B3RM 5L8RF 3U6MA 1ZMUA 2ZANA 2R65A 1E32A 4MGYE 2ZTCA 1OIPA 2QBYB 1V92A 5EXXA 5H37D 1DV0A 4NXNM 1Q39A 5DFLA 4OU7A 2M5ZA 3HX3A 2WSFF 2ZAMA 2RRUA 3FKEA 3KFUG 4FVMA 4QOZC 3SYKA 1XWIA 2LNHC 3KXEC 4GC9A 3T1YM 4LY6A 3J81S 2XGNA 3PXGA 3SAUA 1Q3BA 1QQWA 2DAGA 2N35A 1ZAEA 2C98A 2V6ZM 1WIVA 2LBCA 4DV0M 1IQPA 4GH9A 4IBDA 1WGLA 4LJ5A 2DXIA 2JZ1A 2Z8YM 2QP9X 3L29A 2L7IA 5KQ8A 3U6SA 3E21A 3J7BA 3VFDA 1AIPC 2EJSA 4AW4A 2C96A 4DR2M 1G3IA 3GO8A 2DAEA 2J7NA 3VK8A 1MN3A 2KHHA 4R7GA 3T38A 8CATA 1N75A 3HHWA 3KP0E 1QVRA 2XFTA 4KO8A 4L78A 3KSXA 3SYLA 3W67A 2VQEM 2DAIA 5KPTA 2ERCA 3U6OA 4QOSA 1R5LA 4LJ9A 2C9CA 3SAVA 3AL0C 3AOEC 4FWGA 4B7HA 2XEPA 2UXBM 2QBYA 2R46A 2EKKA 4MM3B 2GNOA 2XZFA 4CIZA 3JAMS 2LH0A 4F1IA 1XXHB 2LVQD 3KW6A 2OOBA 3R9XB 3B7ZA 4JN6A 4BLCA 4I4LA 4GIPA 1P3QQ 4JI3M 2DZLA 5EXSA 3FTFA 4P17A 4GEWA 3HZJA 4JI1M 4NRWA 2ZAOA 1N78A 4HL4A 1CUKA 1QZEA 3Q8XA 1TDZA 4JXJA 3FE3A 4G4OA 3U61B 2NQ8C 3GPYA 4DR1M 2X4AA 4I5SA 1DGHB 3FUTA 4DV6M 4QHSA 2KRKA 2XZUA 4DR7M 1NNUC 1YLAA 3H4MA 3HKPA 4I8OA 5GKNA 3VK7A 3L26A 1JR3A 2DNAA 1UFZA 2KZUA 3IHPA 1R4GA 4LJ4A 3K8ZA 1PJSA 1NO1A 3W68A 4JI5M 1IXRC 2QZ4A 4LCBA 3QWLA 3TL4X 1IN8A 3WHLA 2DWLA 4LGMA 4ANRA 3K9OA 2V1UA 1UM8A 1R6BX 2EUCA 1V34A 1WXQA 4IBEA 1IBKM 5E6JA 3FTEA 3ZCBB 2CEAA 4KHPM 3I51A 3CGWA 3VDUA 1QYRA 2CV0A 1Z5BA 4F2LA 4D81A 1GABA 4PCZA 4LZJA 2CV2A 2R44A 2FFJA 3ILKA 3L25A 2F4VM 2DAMA 2UXCM 3W0LB 3GQ4A 3GLHA 1Q02A 4OVZB 2LXEA 5JI3E 2OOAA 3CF0A 1ORYB 2YFQA 1XXHA 4MB7A 4AKGA 3SHFA 3GPUA 1NHWC 4CISA 2D7GA 3BXWA 1TH4A 2LTUA 3LCUA 3SMPA 5F3WA 5A2QS 1TH2A 2K0BX 5FTMA 1OFIA 1QAQA 2DWNA 3U6EA 3T1HM 4IBIA 4IIWA 3ZH9B 3L28A 1J7KA 4NL4H 3W0FA 2K47A 2JY5A 1LV7A 1DGHA 1PM5A 2KNZA 4JI6M 3HHZA 3GRUA 4R71A 1C1KA 2FNAA 2HAKA 2QQ8A 4A3VB 4YHHM 4B3MM 3NBIA 5EXTA 3K92A 1SG9A 2Y21A 3AOGA 1XNRM 3NBXX 3J7AS 1SXJC 3GLFE 3M7GA 2G5GX 4LFAM 2H1RA 4XK8F 1XC8A 4X65M 3UZUA 2MGWA 1Q3CA 1ZV1A 4GKJM 4L16A 4LGYA 1NY6A 3AV0A 3IECA 4W5WA 4G4NA 5FTLA 2JY6B 4L15A 1GVNA 3MMPA 4GITA 3U60B 2YNMD 3KP1E 1G71A 5C1BA 3KOYE 2BWBA 1KSFX 1VDDA 3HGIA 4WP2A 2O01F 1N77A 4LRTA 2WSEF 2VQFM 1NV8A 2W82A 4FWDA 5EP1A 4LRSA 1HT1E 2HCBA 2BWEA 3B74A 2CHVA 4KODA 4PDIA 1N34M 1SXJB 2LWXA 1OIZA 4LF5M 1YUBA 3FYDA 4UN2B 4X64M 1HNWM 3KDSE 1OFHA 3GLIB 2DVWB 4LF8M 4JV5M 2OPFA 3LVVA 4LJ7A 3HU1A 2GQFA 2J7OA 3QYEA 2KA6B 1OAIA 2C9OA 3FUXA 4IBKA 1Z59A 1QZMA 1G4AE 1VEKA 2M60A 4FCTA 4M9SA 5EP2A 4BB9A 5LMNM 1GKIA 1X37A 4II7A 5ITRA 1KFVA 4JI2M 1NHGC 2JZ0A 5BPVA 4G4QA 3DFZA 3HHXA 3U6LA 2Q2EB 3GLGB 2Z4RA 4L8RC 2L6OA 1DO2A 3V76A 4DR3M 2Z7JA 2LVAA 2HWJA 2LVPC 1PJIA 3HWSA 1GL6A 1IN4A 1VEJA 2KRUA 5ITQA 2D7EA 2XFSA 5IZ7D 2KEBA 3J27B 2MH8A 5FTKA 1TH3A 1VEGA 3RGSA 1G59A 1K3XA 2KNAA 2F5OA 1JQJC 1F4IA 3KVWA 1HT2E 3C58A 2G8LA 4NOOB 2DWMA 5FTNA 3CF6E 2E5LM 2DKLA 4PT5A 1TGUA 4JYAM 3GQ5A 4IBFA 1L2DA 4AQYM 2P5TA 1MJGM 3GRYA 2UUCM 4L6V6 1HQCA 2K6BA 3L27A 1XMOM 3FRHA 1TDHA 4EIWA 3SATA 2VF8A 3DOAA 1WHCA 3TPZA 3SASA 4ITQA 2K9DA 2Y0QA 3QAUA 4NXMM 4LF9M 1TR8A 3E4RA 3FTDA 4LJ8A 4JI8M 3HHYA 2CV1A 4IJFA 2KXEA 5LMUM 3A42A 1IXSA 1EFUB 2RKOA 1XMQM 4L4UA 5FLXS 1ZQ9A 2APLA 1D0KA 2HKJA 2KNVA 1NSFA 2CE7A 1V33A 3LW5F 4G6ZA 5DNYA 5EQTA 5JI2E 4G4RA 2L7HA 3VKGA 3A98B 5IREB 3GPPA 4AG6A 2ZM6M 5DYGA 2O5RA 4FD2A 3B7QA 3ZC7B 3U61A 4AKIA 2JY7A 3A46A 1S3SA 3D8BA 1W5SA 1PJJA 3NWLA 4FW9A 3RFWA 3GLGE 1NNJA 1G8PA 3SMSA 4DBGB 2L09A 2OO9A 1T3TA 1NVMA 2DI0A 5FTJA 2DWZB 2DHYA 3K1JA 4MGKE 4P16A 1RU3A 3PVSA 3D8LA 4DV1M 4ZPXA 1T43A 1JR3E 2JA2A 4XBOA 3KS4A 3GRRA 4RF0A 3TWKA 3GLHB 3VKHA 1IBLM 2DENA 2RGHA 4GRIA 4RKUF 4TUWA 3OTOM 4RNAA 2JY8A 4RF1A 3GLIE 2EKFA 1H6UA 3LQRA 4WW0A 3SHGB 2VF7A 3U6CA 4K0KM 2J5YA 2QPAA 2LHCA 4NC6A 5KQDA 1JR3D 1IY0A 5IWAM 1HQYE 2MROB 4OVZA 1WGNA 4JI7M 2UXDM 3FRIA 2CWBA 2FH0A 2R0IA 2HL7A 5EJCA 3EIHA 3U6DA 3C3EA 3QYBA 4B7GA 2Y20A 3A45A 2I7PA 2LHGA 2H5XA 3UK6A 4IJEA 3SARA 1QDRA 2X8AA 1GO5A 3VDPA 4G3OA 2UUAM 1GLNA 2L2DA 1D0MA 3C3DA 2XSZD 3M6AA 2B3TA 3CTWB 1HNXM 1XNQM 4OX9M 1NJGA 3T15A 7CATA 2JP7A 4AKHA 2V1CA 3EIEA 2BNKA 1HNZM 5ITYA 4LF6M 1K82A 1L8QA 1PRBA 5DYIA 2JUJA 2F5QA 2CRUA 3L2AA 4LJ6A 2UU9M 1N32M 1GJTA 2YQZA 3K9PA 3JR5A 2YR0A 4QHTA 3FYCA 4DV2M 1WR1B 2HHHM 2CFOA 1KYIA 2DZNB 2RGOA 4IBGA 1IN7A 3TWLA 1K3WA 4X66M 2F5SA 2R45A 4XGIA 1GL7A 1QANA 2FE8A 2XH9A 3B7NA 2R4JA 4B3SM 3GQ3A 1VG5A 1XXHE 4DR4M 1I94M 3PNYA 3M0EA 3I4VA 1D2NA 3LQQA 2WSCF 3DA1A 1Z5AA 2CUZA 4B3TM 1GJSA 1FNNA 1SXJA 3GLHE 4JI0M 4NSRA 4D82A 5C18A 1L1ZA 2ZTDA 1L2BA 1MU5A 1LTMA 1E9SA 4IBBA 4DV3M 3MK6A 1XHBA 3ZQJA 1XB2B 3GLFB 2UUBM 1NJFA 3IG8A 3B9PA 1HR0M 2X49A 1QUTA 1IY1A 4QNMA 1OAOC 1VDLA 1TTEA 1C7YA 1ZMVA 4OW0A 3U6PA 1E94E 4LF4M 3KSJA 5EP3A 1OQYA 3KOZE 4DV5M 1ZMWA 2C99A 1IY2A 3HJSA 3KOWE 3U5ZA 3BBZA 4DV4M 1YE9A 3GRVA 2DZOB 2BJWA 4KT0F 4Y28F 2G3QA 1DO0A 1QAMA 1EE8A 5BR8M 2KDLA 5ITXA 3GLGA 5ITUA 1D0LA 4FWHA 1DGBA 2CHGA 1L1TA 1L2CA 3H4JA 3FUWA 1JB0F 1OJLA 1AUAA 2C5RA 2F5PA 2R4EA 4PDGA 4AI6A 4JI4M 4GC5A 4DUZM 4MGZE 3SAWA 4FCVA 2CHQA 4DV7M 4NRVA 3THGA 2VDBB 3AOEA 4X62M 4Z8XA 3TE6A 5KPRA 3J80S 3FUVA 4BBAA 2LVOC 4IBCA 4B7FA 1QAOA 3GLFA 4CJ6A 2BJVA 2CP8A 4PD2A 2R18A 4AZFA 2LVNC 1N36M 1PJQA 4NSOB 3CF2A 4LFCM 3AFHA 3R8FA 1PGYA 1SXJE 4M9XA 3T6PA 5KPZA 2EA0A 3RGPA 3LMMA 4MH0E 4Q7JA 1IXSB 3BOSA 1IN6A 4WURA 2EO2A 3LVWA 3SFZA 3GP1A 3FTCA 2QCUA 3HU2A 3PNVA 4CHTB 1J09A 2Z4SA 1IFYA 1FJGM 4LZZA 3RE8A 3U5ZB 4YY3M 1Z6TA 3AKZA 5IT9S 2R6FA 4I81A 1E9RA 2QENA 4S12A 4LG2A 4GHLA 2I7NA 1T6OA 2MJ5B 4FCWA 2R62A 3TWMA 3HY5A 1N33M 3J2PB 4DR6M 1TF0B 1R2ZA 3E46A 2KZSA 1YSYA 2F5NA 2FS1A 3MJ5A 2FOIC 4HLQA 5ITTA 3SBJA 5FSWA 2Z3XA 1R2YA 1IXZA 4MGHA 4REZA 3UGJA 3I4YA 1PJTA 1W5TA 4AG5A 2JNHA 4M0WA 1SXJD 1Y8GA 3VLFB 1VQ1A 3C9PA 3MHVC 2Y0TA 2QHOB 3KS8A 4HEOA 3B89A 3HJ8A 4MGIE 1J5EM 2L4EA 2AHMA 4LFBM 4DR5M 4M0DA 3U6QA 4Z6YA 2QSFX 1IBMM 1IM2A 4R3DA 3Q8GA 3HU3A 1QDTA 3FUUA 3IG5A 1DGFA 4GHAA 3GPXA 4QNRA 5KO3A 3F92A 1IN5A 2A5YB 2MR9A 4KLNA 1R7RA 3HJQA 2VIIA 2DAKA 3PFIA 4IBJA 5EXPA 3KOXE 1BVSA 3E9SA 4DUYM 3SC3A 3LCVB 1OTRA 2XLJA 1NY5A 3GLIA 1MX0A 2XF3A 4GMQA 3I01M 4LJAA 1HJPA 3FD9A 3AJIB 4CGYB 2OQ4A 2XSZA 2JWSA 5E26A 3UMMA 1Z5CA 2L4FA 4D80A 1G41A 3K2LA 3TQSA 5ITXE 1QUSA 2KW0A 2DHRA 5EP4A 1NV9A 2JXNA 4B08A
chains in the Genus database with same CATH topology
2ZBKB 1DGGA 3WHKA 3UJNA 3U60A 4LF7M 3JR4A 1I4WA 3DZDA 4M9ZA 4GKKM 2D7HA 4B3RM 3U6MA 2ZANA 2R65A 1E32A 4MGYE 2QBYB 5EXXA 5H37D 4NXNM 1Q39A 4OU7A 2M5ZA 2ZAMA 3FKEA 3KFUG 4FVMA 4QOZC 3SYKA 1XWIA 2LNHC 3KXEC 4GC9A 3T1YM 4LY6A 3J81S 2XGNA 3PXGA 3SAUA 1Q3BA 1QQWA 1ZAEA 2C98A 2V6ZM 4DV0M 1IQPA 4GH9A 4IBDA 2DXIA 4LJ5A 2QP9X 3L29A 2L7IA 5KQ8A 3U6SA 3J7BA 3VFDA 4DR2M 4AW4A 2C96A 1G3IA 3GO8A 2J7NA 3VK8A 4R7GA 3T38A 8CATA 1N75A 3HHWA 3KP0E 1QVRA 2XFTA 4KO8A 4L78A 3KSXA 3SYLA 2VQEM 5KPTA 2ERCA 3U6OA 4QOSA 4LJ9A 2C9CA 3SAVA 3AL0C 3AOEC 4FWGA 4B7HA 2XEPA 2UXBM 2QBYA 2R46A 4MM3B 2XZFA 3JAMS 2LH0A 1XXHB 3KW6A 3R9XB 4JN6A 4BLCA 4I4LA 4GIPA 4JI3M 5EXSA 3FTFA 4NRWA 4JI1M 2ZAOA 1N78A 4HL4A 1TDZA 3Q8XA 4JXJA 4G4OA 3U61B 2NQ8C 3GPYA 4DR1M 2X4AA 4I5SA 1DGHB 3FUTA 4DV6M 4QHSA 2KRKA 2XZUA 4DR7M 1NNUC 3HKPA 3H4MA 4I8OA 5GKNA 3VK7A 3L26A 1JR3A 2KZUA 4LJ4A 3K8ZA 4JI5M 1IXRC 2QZ4A 4LCBA 3QWLA 3TL4X 1IN8A 3WHLA 2DWLA 4LGMA 2V1UA 1UM8A 1R6BX 2EUCA 4IBEA 1WXQA 1IBKM 3FTEA 5E6JA 3ZCBB 2CEAA 4KHPM 3I51A 3VDUA 1QYRA 2CV0A 1Z5BA 4D81A 4PCZA 4LZJA 2CV2A 2FFJA 3ILKA 3L25A 2F4VM 2UXCM 3W0LB 3GQ4A 3GLHA 4OVZB 2LXEA 5JI3E 3CF0A 1ORYB 2YFQA 1XXHA 4MB7A 4AKGA 3SHFA 3GPUA 1NHWC 4CISA 2D7GA 5F3WA 1TH4A 3SMPA 5A2QS 1TH2A 5FTMA 1OFIA 1QAQA 2DWNA 3U6EA 3T1HM 4IBIA 4IIWA 3ZH9B 3L28A 1J7KA 4NL4H 3W0FA 2K47A 1LV7A 1DGHA 1PM5A 4JI6M 3HHZA 3GRUA 1C1KA 2FNAA 4A3VB 4YHHM 4B3MM 3NBIA 5EXTA 3K92A 3AOGA 2Y21A 1XNRM 3J7AS 1SXJC 3M7GA 2G5GX 4LFAM 2H1RA 1XC8A 4X65M 3UZUA 1Q3CA 4GKJM 4L16A 4LGYA 1NY6A 3AV0A 4G4NA 4W5WA 5FTLA 4L15A 1GVNA 4GITA 3U60B 2YNMD 3KP1E 5C1BA 3KOYE 1KSFX 1VDDA 3HGIA 1N77A 4LRTA 2VQFM 2W82A 4FWDA 5EP1A 4LRSA 1HT1E 2HCBA 4PDIA 4KODA 2CHVA 1N34M 4LF5M 1SXJB 2LWXA 1YUBA 3FYDA 4X64M 1HNWM 3KDSE 1OFHA 3GLIB 2DVWB 4LF8M 4JV5M 2OPFA 3LVVA 4LJ7A 3HU1A 2J7OA 2KA6B 2C9OA 3FUXA 4IBKA 1Z59A 1QZMA 1G4AE 2M60A 4M9SA 4FCTA 4BB9A 5EP2A 5LMNM 1GKIA 1X37A 4II7A 5ITRA 1KFVA 4JI2M 1NHGC 5BPVA 4G4QA 3DFZA 3HHXA 3U6LA 2Q2EB 3GLGB 2Z4RA 4L8RC 2L6OA 1DO2A 4DR3M 2Z7JA 1PJIA 3HWSA 1GL6A 1IN4A 2KRUA 5ITQA 2D7EA 2XFSA 5IZ7D 2KEBA 3J27B 5FTKA 3RGSA 1TH3A 1G59A 1K3XA 2F5OA 1JQJC 3KVWA 1HT2E 3C58A 2G8LA 4NOOB 2DWMA 5FTNA 3CF6E 2E5LM 4PT5A 4JYAM 1TGUA 3GQ5A 4IBFA 1L2DA 4AQYM 2P5TA 3GRYA 2UUCM 1HQCA 3L27A 1XMOM 1TDHA 4EIWA 3SATA 3DOAA 3SASA 3TPZA 4ITQA 2Y0QA 3QAUA 4NXMM 4LF9M 3E4RA 3FTDA 4LJ8A 4JI8M 3HHYA 2CV1A 4IJFA 2KXEA 5LMUM 3A42A 2RKOA 1XMQM 4L4UA 5FLXS 1ZQ9A 2HKJA 1NSFA 2CE7A 4G6ZA 5DNYA 5EQTA 5JI2E 4G4RA 2L7HA 3VKGA 3A98B 5IREB 3GPPA 4AG6A 2ZM6M 5DYGA 2O5RA 4FD2A 3ZC7B 3U61A 4AKIA 3A46A 1S3SA 3D8BA 1W5SA 1PJJA 3NWLA 4FW9A 3RFWA 1NNJA 1G8PA 3SMSA 2L09A 1T3TA 1NVMA 5FTJA 2DWZB 4MGKE 3K1JA 4P16A 3PVSA 3D8LA 4DV1M 4ZPXA 2JA2A 4XBOA 3KS4A 3GRRA 4RF0A 3TWKA 3GLHB 3VKHA 1IBLM 2RGHA 4GRIA 4TUWA 3OTOM 4RNAA 4RF1A 1H6UA 3LQRA 4WW0A 3SHGB 3U6CA 4K0KM 2QPAA 5KQDA 1JR3D 1IY0A 5IWAM 1HQYE 4OVZA 4JI7M 2UXDM 5EJCA 2HL7A 3EIHA 3U6DA 4B7GA 2Y20A 3A45A 2I7PA 3UK6A 4IJEA 3SARA 2X8AA 3VDPA 2UUAM 1GLNA 2XSZD 3M6AA 3CTWB 1HNXM 1XNQM 4OX9M 1NJGA 3T15A 7CATA 4AKHA 2V1CA 3EIEA 2BNKA 1HNZM 5ITYA 4LF6M 1K82A 1L8QA 5DYIA 2F5QA 3L2AA 4LJ6A 2UU9M 1N32M 2YQZA 3JR5A 2YR0A 4QHTA 3FYCA 4DV2M 2HHHM 2CFOA 1KYIA 2DZNB 2RGOA 4IBGA 1IN7A 3TWLA 1K3WA 4X66M 2F5SA 2R45A 4XGIA 1GL7A 1QANA 2FE8A 2XH9A 2R4JA 4B3SM 3GQ3A 4DR4M 1I94M 3PNYA 3M0EA 3I4VA 1D2NA 3LQQA 3DA1A 1Z5AA 2CUZA 4B3TM 1FNNA 1SXJA 4JI0M 4NSRA 4D82A 5C18A 1L1ZA 1L2BA 1MU5A 1E9SA 4IBBA 4DV3M 3MK6A 1XHBA 3GLFB 2UUBM 1NJFA 3IG8A 3B9PA 1HR0M 2X49A 1IY1A 4QNMA 4OW0A 3U6PA 1E94E 4LF4M 3KSJA 5EP3A 3KOZE 4DV5M 2C99A 3KOWE 1IY2A 3HJSA 3U5ZA 4DV4M 1YE9A 3GRVA 2DZOB 2BJWA 1DO0A 1QAMA 1EE8A 5BR8M 5ITXA 3GLGA 5ITUA 4FWHA 1DGBA 2CHGA 1L1TA 1L2CA 3FUWA 1OJLA 2C5RA 2F5PA 2R4EA 4PDGA 4AI6A 4JI4M 4GC5A 4DUZM 4MGZE 3SAWA 4FCVA 2CHQA 4DV7M 4NRVA 3THGA 3AOEA 4X62M 4Z8XA 3TE6A 5KPRA 3J80S 3FUVA 4BBAA 4B7FA 4IBCA 1QAOA 3GLFA 2BJVA 4PD2A 2R18A 4AZFA 1N36M 4NSOB 3CF2A 4LFCM 3AFHA 3R8FA 1SXJE 4M9XA 2EA0A 5KPZA 3RGPA 3LMMA 4MH0E 1IXSB 3BOSA 1IN6A 4WURA 2EO2A 3LVWA 3SFZA 3GP1A 3FTCA 3PNVA 2QCUA 3HU2A 4CHTB 1J09A 2Z4SA 1FJGM 4LZZA 3RE8A 3U5ZB 4YY3M 1Z6TA 3AKZA 5IT9S 4I81A 1E9RA 2QENA 4S12A 4LG2A 4GHLA 2I7NA 4FCWA 3TWMA 2R62A 1N33M 3J2PB 4DR6M 1R2ZA 2KZSA 1YSYA 2F5NA 3MJ5A 2FOIC 4HLQA 5ITTA 3SBJA 5FSWA 2Z3XA 1R2YA 1IXZA 4MGHA 4REZA 3UGJA 3I4YA 1W5TA 4AG5A 4M0WA 1SXJD 3VLFB 3MHVC 2Y0TA 3KS8A 3HJ8A 1J5EM 4MGIE 2AHMA 4LFBM 4DR5M 4M0DA 3U6QA 4Z6YA 1IBMM 1IM2A 4R3DA 3HU3A 3FUUA 3IG5A 1DGFA 4GHAA 3GPXA 4QNRA 5KO3A 1IN5A 2A5YB 4KLNA 1R7RA 3HJQA 2VIIA 3PFIA 4IBJA 5EXPA 3KOXE 3E9SA 4DUYM 3SC3A 2XLJA 1NY5A 3GLIA 1MX0A 2XF3A 4GMQA 4LJAA 3FD9A 3AJIB 4CGYB 2OQ4A 2XSZA 5E26A 3UMMA 1Z5CA 4D80A 1G41A 3K2LA 3TQSA 5ITXE 2KW0A 2DHRA 5EP4A 4B08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ M;  2ZBK B;  5FLX S;  4LF4 M;  4DV5 M;  4LF7 M;  2HKJ A;  3JR4 A;  4MB7 A;  4DV4 M;  4GKK M;  3GPU A;  4CIS A;  4B3R M;  3U6M A;  5A2Q S;  1EE8 A;  5BR8 M;  4G4R A;  5ITX A;  3GPP A;  5ITU A;  2ZM6 M;  1L1T A;  3U6E A;  3T1H M;  1L2C A;  3W0F A;  4NXN M;  1Q39 A;  3A46 A;  1PM5 A;  4JI6 M;  1PJJ A;  2F5P A;  4PDG A;  4JI4 M;  4DUZ M;  3T1Y M;  4YHH M;  3SAW A;  4B3M M;  1NNJ A;  4DV7 M;  3J81 S;  4NRV A;  3SAU A;  1XNR M;  4X62 M;  1Q3B A;  3J7A S;  4DV1 M;  3J80 S;  4LFA M;  4DV0 M;  1XC8 A;  4X65 M;  1Q3C A;  3TWK A;  1IBL M;  4GKJ M;  4G4N A;  4PD2 A;  3OTO M;  1N36 M;  4LFC M;  3U6C A;  4K0K M;  3U6S A;  2EA0 A;  4DR2 M;  3GO8 A;  5IWA M;  4JI7 M;  2UXD M;  3VK8 A;  3GP1 A;  2VQF M;  1FJG M;  3U6D A;  2VQE M;  3A45 A;  4YY3 M;  4PDI A;  1N34 M;  4LF5 M;  5IT9 S;  3SAR A;  3U6O A;  2UUA M;  4X64 M;  1HNW M;  3TWM A;  1N33 M;  4LF8 M;  4DR6 M;  4JV5 M;  3SAV A;  1XNQ M;  1HNX M;  1R2Z A;  2OPF A;  4OX9 M;  2UXB M;  2F5N A;  2XZF A;  3JAM S;  1Z59 A;  5ITT A;  5LMN M;  3SBJ A;  1HNZ M;  5ITY A;  1R2Y A;  5ITR A;  1KFV A;  4LF6 M;  1K82 A;  4JI2 M;  4G4Q A;  4JI3 M;  2F5Q A;  2UU9 M;  1N32 M;  4NRW A;  4JI1 M;  3U6L A;  2Q2E B;  3JR5 A;  1TDZ A;  1J5E M;  4DR3 M;  4G4O A;  4DV2 M;  2HHH M;  4LFB M;  3GPY A;  4DR5 M;  3U6Q A;  4DR1 M;  1PJI A;  3TWL A;  1IBM M;  5ITQ A;  4DV6 M;  2XZU A;  1K3W A;  4X66 M;  2F5S A;  4DR7 M;  2F5O A;  1K3X A;  3VK7 A;  3GPX A;  4B3S M;  3GQ3 A;  4DR4 M;  3C58 A;  1I94 M;  4JI5 M;  2E5L M;  4JYA M;  1Z5A A;  4B3T M;  4DUY M;  3GQ5 A;  1L2D A;  4AQY M;  4JI0 M;  1IBK M;  2UUC M;  1L1Z A;  1L2B A;  1MU5 A;  1MX0 A;  4KHP M;  1XMO M;  1TDH A;  4DV3 M;  2UUB M;  3SAT A;  1Z5B A;  3DOA A;  3SAS A;  2OQ4 A;  4ITQ A;  4NXM M;  4PCZ A;  1HR0 M;  4LF9 M;  1Z5C A;  4JI8 M;  2F4V M;  5ITX E;  2UXC M;  3GQ4 A;  3U6P A;  5LMU M;  3A42 A; 
#chains in the Genus database with same CATH topology
 2ZBK B;  2QNJ A;  1OKS A;  1DGG A;  1A5T A;  2WZJ A;  1WJ7 A;  3WHK A;  3UJN A;  3U60 A;  3JR4 A;  4LF7 M;  1EIJ A;  1I4W A;  2O25 A;  3DZD A;  3I04 M;  4M9Z A;  4GKK M;  2D7H A;  4B3R M;  5L8R F;  3U6M A;  1ZMU A;  2ZAN A;  2R65 A;  1E32 A;  4MGY E;  2ZTC A;  1OIP A;  2QBY B;  1V92 A;  5EXX A;  5H37 D;  1DV0 A;  4NXN M;  1Q39 A;  5DFL A;  4OU7 A;  2M5Z A;  3HX3 A;  2WSF F;  2ZAM A;  2RRU A;  3FKE A;  3KFU G;  4FVM A;  4QOZ C;  3SYK A;  1XWI A;  2LNH C;  3KXE C;  4GC9 A;  3T1Y M;  4LY6 A;  3J81 S;  2XGN A;  3PXG A;  3SAU A;  1Q3B A;  1QQW A;  2DAG A;  2N35 A;  1ZAE A;  2C98 A;  2V6Z M;  1WIV A;  2LBC A;  4DV0 M;  1IQP A;  4GH9 A;  4IBD A;  1WGL A;  4LJ5 A;  2DXI A;  2JZ1 A;  2Z8Y M;  2QP9 X;  3L29 A;  2L7I A;  5KQ8 A;  3U6S A;  3E21 A;  3J7B A;  3VFD A;  1AIP C;  2EJS A;  4AW4 A;  2C96 A;  4DR2 M;  1G3I A;  3GO8 A;  2DAE A;  2J7N A;  3VK8 A;  1MN3 A;  2KHH A;  4R7G A;  3T38 A;  8CAT A;  1N75 A;  3HHW A;  3KP0 E;  1QVR A;  2XFT A;  4KO8 A;  4L78 A;  3KSX A;  3SYL A;  3W67 A;  2VQE M;  2DAI A;  5KPT A;  2ERC A;  3U6O A;  4QOS A;  1R5L A;  4LJ9 A;  2C9C A;  3SAV A;  3AL0 C;  3AOE C;  4FWG A;  4B7H A;  2XEP A;  2UXB M;  2QBY A;  2R46 A;  2EKK A;  4MM3 B;  2GNO A;  2XZF A;  4CIZ A;  3JAM S;  2LH0 A;  4F1I A;  1XXH B;  2LVQ D;  3KW6 A;  2OOB A;  3R9X B;  3B7Z A;  4JN6 A;  4BLC A;  4I4L A;  4GIP A;  1P3Q Q;  4JI3 M;  2DZL A;  5EXS A;  3FTF A;  4P17 A;  4GEW A;  3HZJ A;  4JI1 M;  4NRW A;  2ZAO A;  1N78 A;  4HL4 A;  1CUK A;  1QZE A;  3Q8X A;  1TDZ A;  4JXJ A;  3FE3 A;  4G4O A;  3U61 B;  2NQ8 C;  3GPY A;  4DR1 M;  2X4A A;  4I5S A;  1DGH B;  3FUT A;  4DV6 M;  4QHS A;  2KRK A;  2XZU A;  4DR7 M;  1NNU C;  1YLA A;  3H4M A;  3HKP A;  4I8O A;  5GKN A;  3VK7 A;  3L26 A;  1JR3 A;  2DNA A;  1UFZ A;  2KZU A;  3IHP A;  1R4G A;  4LJ4 A;  3K8Z A;  1PJS A;  1NO1 A;  3W68 A;  4JI5 M;  1IXR C;  2QZ4 A;  4LCB A;  3QWL A;  3TL4 X;  1IN8 A;  3WHL A;  2DWL A;  4LGM A;  4ANR A;  3K9O A;  2V1U A;  1UM8 A;  1R6B X;  2EUC A;  1V34 A;  1WXQ A;  4IBE A;  1IBK M;  5E6J A;  3FTE A;  3ZCB B;  2CEA A;  4KHP M;  3I51 A;  3CGW A;  3VDU A;  1QYR A;  2CV0 A;  1Z5B A;  4F2L A;  4D81 A;  1GAB A;  4PCZ A;  4LZJ A;  2CV2 A;  2R44 A;  2FFJ A;  3ILK A;  3L25 A;  2F4V M;  2DAM A;  2UXC M;  3W0L B;  3GQ4 A;  3GLH A;  1Q02 A;  4OVZ B;  2LXE A;  5JI3 E;  2OOA A;  3CF0 A;  1ORY B;  2YFQ A;  1XXH A;  4MB7 A;  4AKG A;  3SHF A;  3GPU A;  1NHW C;  4CIS A;  2D7G A;  3BXW A;  1TH4 A;  2LTU A;  3LCU A;  3SMP A;  5F3W A;  5A2Q S;  1TH2 A;  2K0B X;  5FTM A;  1OFI A;  1QAQ A;  2DWN A;  3U6E A;  3T1H M;  4IBI A;  4IIW A;  3ZH9 B;  3L28 A;  1J7K A;  4NL4 H;  3W0F A;  2K47 A;  2JY5 A;  1LV7 A;  1DGH A;  1PM5 A;  2KNZ A;  4JI6 M;  3HHZ A;  3GRU A;  4R71 A;  1C1K A;  2FNA A;  2HAK A;  2QQ8 A;  4A3V B;  4YHH M;  4B3M M;  3NBI A;  5EXT A;  3K92 A;  1SG9 A;  2Y21 A;  3AOG A;  1XNR M;  3NBX X;  3J7A S;  1SXJ C;  3GLF E;  3M7G A;  2G5G X;  4LFA M;  2H1R A;  4XK8 F;  1XC8 A;  4X65 M;  3UZU A;  2MGW A;  1Q3C A;  1ZV1 A;  4GKJ M;  4L16 A;  4LGY A;  1NY6 A;  3AV0 A;  3IEC A;  4W5W A;  4G4N A;  5FTL A;  2JY6 B;  4L15 A;  1GVN A;  3MMP A;  4GIT A;  3U60 B;  2YNM D;  3KP1 E;  1G71 A;  5C1B A;  3KOY E;  2BWB A;  1KSF X;  1VDD A;  3HGI A;  4WP2 A;  2O01 F;  1N77 A;  4LRT A;  2WSE F;  2VQF M;  1NV8 A;  2W82 A;  4FWD A;  5EP1 A;  4LRS A;  1HT1 E;  2HCB A;  2BWE A;  3B74 A;  2CHV A;  4KOD A;  4PDI A;  1N34 M;  1SXJ B;  2LWX A;  1OIZ A;  4LF5 M;  1YUB A;  3FYD A;  4UN2 B;  4X64 M;  1HNW M;  3KDS E;  1OFH A;  3GLI B;  2DVW B;  4LF8 M;  4JV5 M;  2OPF A;  3LVV A;  4LJ7 A;  3HU1 A;  2GQF A;  2J7O A;  3QYE A;  2KA6 B;  1OAI A;  2C9O A;  3FUX A;  4IBK A;  1Z59 A;  1QZM A;  1G4A E;  1VEK A;  2M60 A;  4FCT A;  4M9S A;  5EP2 A;  4BB9 A;  5LMN M;  1GKI A;  1X37 A;  4II7 A;  5ITR A;  1KFV A;  4JI2 M;  1NHG C;  2JZ0 A;  5BPV A;  4G4Q A;  3DFZ A;  3HHX A;  3U6L A;  2Q2E B;  3GLG B;  2Z4R A;  4L8R C;  2L6O A;  1DO2 A;  3V76 A;  4DR3 M;  2Z7J A;  2LVA A;  2HWJ A;  2LVP C;  1PJI A;  3HWS A;  1GL6 A;  1IN4 A;  1VEJ A;  2KRU A;  5ITQ A;  2D7E A;  2XFS A;  5IZ7 D;  2KEB A;  3J27 B;  2MH8 A;  5FTK A;  1TH3 A;  1VEG A;  3RGS A;  1G59 A;  1K3X A;  2KNA A;  2F5O A;  1JQJ C;  1F4I A;  3KVW A;  1HT2 E;  3C58 A;  2G8L A;  4NOO B;  2DWM A;  5FTN A;  3CF6 E;  2E5L M;  2DKL A;  4PT5 A;  1TGU A;  4JYA M;  3GQ5 A;  4IBF A;  1L2D A;  4AQY M;  2P5T A;  1MJG M;  3GRY A;  2UUC M;  4L6V 6;  1HQC A;  2K6B A;  3L27 A;  1XMO M;  3FRH A;  1TDH A;  4EIW A;  3SAT A;  2VF8 A;  3DOA A;  1WHC A;  3TPZ A;  3SAS A;  4ITQ A;  2K9D A;  2Y0Q A;  3QAU A;  4NXM M;  4LF9 M;  1TR8 A;  3E4R A;  3FTD A;  4LJ8 A;  4JI8 M;  3HHY A;  2CV1 A;  4IJF A;  2KXE A;  5LMU M;  3A42 A;  1IXS A;  1EFU B;  2RKO A;  1XMQ M;  4L4U A;  5FLX S;  1ZQ9 A;  2APL A;  1D0K A;  2HKJ A;  2KNV A;  1NSF A;  2CE7 A;  1V33 A;  3LW5 F;  4G6Z A;  5DNY A;  5EQT A;  5JI2 E;  4G4R A;  2L7H A;  3VKG A;  3A98 B;  5IRE B;  3GPP A;  4AG6 A;  2ZM6 M;  5DYG A;  2O5R A;  4FD2 A;  3B7Q A;  3ZC7 B;  3U61 A;  4AKI A;  2JY7 A;  3A46 A;  1S3S A;  3D8B A;  1W5S A;  1PJJ A;  3NWL A;  4FW9 A;  3RFW A;  3GLG E;  1NNJ A;  1G8P A;  3SMS A;  4DBG B;  2L09 A;  2OO9 A;  1T3T A;  1NVM A;  2DI0 A;  5FTJ A;  2DWZ B;  2DHY A;  3K1J A;  4MGK E;  4P16 A;  1RU3 A;  3PVS A;  3D8L A;  4DV1 M;  4ZPX A;  1T43 A;  1JR3 E;  2JA2 A;  4XBO A;  3KS4 A;  3GRR A;  4RF0 A;  3TWK A;  3GLH B;  3VKH A;  1IBL M;  2DEN A;  2RGH A;  4GRI A;  4RKU F;  4TUW A;  3OTO M;  4RNA A;  2JY8 A;  4RF1 A;  3GLI E;  2EKF A;  1H6U A;  3LQR A;  4WW0 A;  3SHG B;  2VF7 A;  3U6C A;  4K0K M;  2J5Y A;  2QPA A;  2LHC A;  4NC6 A;  5KQD A;  1JR3 D;  1IY0 A;  5IWA M;  1HQY E;  2MRO B;  4OVZ A;  1WGN A;  4JI7 M;  2UXD M;  3FRI A;  2CWB A;  2FH0 A;  2R0I A;  2HL7 A;  5EJC A;  3EIH A;  3U6D A;  3C3E A;  3QYB A;  4B7G A;  2Y20 A;  3A45 A;  2I7P A;  2LHG A;  2H5X A;  3UK6 A;  4IJE A;  3SAR A;  1QDR A;  2X8A A;  1GO5 A;  3VDP A;  4G3O A;  2UUA M;  1GLN A;  2L2D A;  1D0M A;  3C3D A;  2XSZ D;  3M6A A;  2B3T A;  3CTW B;  1HNX M;  1XNQ M;  4OX9 M;  1NJG A;  3T15 A;  7CAT A;  2JP7 A;  4AKH A;  2V1C A;  3EIE A;  2BNK A;  1HNZ M;  5ITY A;  4LF6 M;  1K82 A;  1L8Q A;  1PRB A;  5DYI A;  2JUJ A;  2F5Q A;  2CRU A;  3L2A A;  4LJ6 A;  2UU9 M;  1N32 M;  1GJT A;  2YQZ A;  3K9P A;  3JR5 A;  2YR0 A;  4QHT A;  3FYC A;  4DV2 M;  1WR1 B;  2HHH M;  2CFO A;  1KYI A;  2DZN B;  2RGO A;  4IBG A;  1IN7 A;  3TWL A;  1K3W A;  4X66 M;  2F5S A;  2R45 A;  4XGI A;  1GL7 A;  1QAN A;  2FE8 A;  2XH9 A;  3B7N A;  2R4J A;  4B3S M;  3GQ3 A;  1VG5 A;  1XXH E;  4DR4 M;  1I94 M;  3PNY A;  3M0E A;  3I4V A;  1D2N A;  3LQQ A;  2WSC F;  3DA1 A;  1Z5A A;  2CUZ A;  4B3T M;  1GJS A;  1FNN A;  1SXJ A;  3GLH E;  4JI0 M;  4NSR A;  4D82 A;  5C18 A;  1L1Z A;  2ZTD A;  1L2B A;  1MU5 A;  1LTM A;  1E9S A;  4IBB A;  4DV3 M;  3MK6 A;  1XHB A;  3ZQJ A;  1XB2 B;  3GLF B;  2UUB M;  1NJF A;  3IG8 A;  3B9P A;  1HR0 M;  2X49 A;  1QUT A;  1IY1 A;  4QNM A;  1OAO C;  1VDL A;  1TTE A;  1C7Y A;  1ZMV A;  4OW0 A;  3U6P A;  1E94 E;  4LF4 M;  3KSJ A;  5EP3 A;  1OQY A;  3KOZ E;  4DV5 M;  1ZMW A;  2C99 A;  1IY2 A;  3HJS A;  3KOW E;  3U5Z A;  3BBZ A;  4DV4 M;  1YE9 A;  3GRV A;  2DZO B;  2BJW A;  4KT0 F;  4Y28 F;  2G3Q A;  1DO0 A;  1QAM A;  1EE8 A;  5BR8 M;  2KDL A;  5ITX A;  3GLG A;  5ITU A;  1D0L A;  4FWH A;  1DGB A;  2CHG A;  1L1T A;  1L2C A;  3H4J A;  3FUW A;  1JB0 F;  1OJL A;  1AUA A;  2C5R A;  2F5P A;  2R4E A;  4PDG A;  4AI6 A;  4JI4 M;  4GC5 A;  4DUZ M;  4MGZ E;  3SAW A;  4FCV A;  2CHQ A;  4DV7 M;  4NRV A;  3THG A;  2VDB B;  3AOE A;  4X62 M;  4Z8X A;  3TE6 A;  5KPR A;  3J80 S;  3FUV A;  4BBA A;  2LVO C;  4IBC A;  4B7F A;  1QAO A;  3GLF A;  4CJ6 A;  2BJV A;  2CP8 A;  4PD2 A;  2R18 A;  4AZF A;  2LVN C;  1N36 M;  1PJQ A;  4NSO B;  3CF2 A;  4LFC M;  3AFH A;  3R8F A;  1PGY A;  1SXJ E;  4M9X A;  3T6P A;  5KPZ A;  2EA0 A;  3RGP A;  3LMM A;  4MH0 E;  4Q7J A;  1IXS B;  3BOS A;  1IN6 A;  4WUR A;  2EO2 A;  3LVW A;  3SFZ A;  3GP1 A;  3FTC A;  2QCU A;  3HU2 A;  3PNV A;  4CHT B;  1J09 A;  2Z4S A;  1IFY A;  1FJG M;  4LZZ A;  3RE8 A;  3U5Z B;  4YY3 M;  1Z6T A;  3AKZ A;  5IT9 S;  2R6F A;  4I81 A;  1E9R A;  2QEN A;  4S12 A;  4LG2 A;  4GHL A;  2I7N A;  1T6O A;  2MJ5 B;  4FCW A;  2R62 A;  3TWM A;  3HY5 A;  1N33 M;  3J2P B;  4DR6 M;  1TF0 B;  1R2Z A;  3E46 A;  2KZS A;  1YSY A;  2F5N A;  2FS1 A;  3MJ5 A;  2FOI C;  4HLQ A;  5ITT A;  3SBJ A;  5FSW A;  2Z3X A;  1R2Y A;  1IXZ A;  4MGH A;  4REZ A;  3UGJ A;  3I4Y A;  1PJT A;  1W5T A;  4AG5 A;  2JNH A;  4M0W A;  1SXJ D;  1Y8G A;  3VLF B;  1VQ1 A;  3C9P A;  3MHV C;  2Y0T A;  2QHO B;  3KS8 A;  4HEO A;  3B89 A;  3HJ8 A;  4MGI E;  1J5E M;  2L4E A;  2AHM A;  4LFB M;  4DR5 M;  4M0D A;  3U6Q A;  4Z6Y A;  2QSF X;  1IBM M;  1IM2 A;  4R3D A;  3Q8G A;  3HU3 A;  1QDT A;  3FUU A;  3IG5 A;  1DGF A;  4GHA A;  3GPX A;  4QNR A;  5KO3 A;  3F92 A;  1IN5 A;  2A5Y B;  2MR9 A;  4KLN A;  1R7R A;  3HJQ A;  2VII A;  2DAK A;  3PFI A;  4IBJ A;  5EXP A;  3KOX E;  1BVS A;  3E9S A;  4DUY M;  3SC3 A;  3LCV B;  1OTR A;  2XLJ A;  1NY5 A;  3GLI A;  1MX0 A;  2XF3 A;  4GMQ A;  3I01 M;  4LJA A;  1HJP A;  3FD9 A;  3AJI B;  4CGY B;  2OQ4 A;  2XSZ A;  2JWS A;  5E26 A;  3UMM A;  1Z5C A;  2L4F A;  4D80 A;  1G41 A;  3K2L A;  3TQS A;  5ITX E;  1QUS A;  2KW0 A;  2DHR A;  5EP4 A;  1NV9 A;  2JXN A;  4B08 A; 
#chains in the Genus database with same CATH homology
 2ZBK B;  1DGG A;  3WHK A;  3UJN A;  3U60 A;  4LF7 M;  3JR4 A;  1I4W A;  3DZD A;  4M9Z A;  4GKK M;  2D7H A;  4B3R M;  3U6M A;  2ZAN A;  2R65 A;  1E32 A;  4MGY E;  2QBY B;  5EXX A;  5H37 D;  4NXN M;  1Q39 A;  4OU7 A;  2M5Z A;  2ZAM A;  3FKE A;  3KFU G;  4FVM A;  4QOZ C;  3SYK A;  1XWI A;  2LNH C;  3KXE C;  4GC9 A;  3T1Y M;  4LY6 A;  3J81 S;  2XGN A;  3PXG A;  3SAU A;  1Q3B A;  1QQW A;  1ZAE A;  2C98 A;  2V6Z M;  4DV0 M;  1IQP A;  4GH9 A;  4IBD A;  2DXI A;  4LJ5 A;  2QP9 X;  3L29 A;  2L7I A;  5KQ8 A;  3U6S A;  3J7B A;  3VFD A;  4DR2 M;  4AW4 A;  2C96 A;  1G3I A;  3GO8 A;  2J7N A;  3VK8 A;  4R7G A;  3T38 A;  8CAT A;  1N75 A;  3HHW A;  3KP0 E;  1QVR A;  2XFT A;  4KO8 A;  4L78 A;  3KSX A;  3SYL A;  2VQE M;  5KPT A;  2ERC A;  3U6O A;  4QOS A;  4LJ9 A;  2C9C A;  3SAV A;  3AL0 C;  3AOE C;  4FWG A;  4B7H A;  2XEP A;  2UXB M;  2QBY A;  2R46 A;  4MM3 B;  2XZF A;  3JAM S;  2LH0 A;  1XXH B;  3KW6 A;  3R9X B;  4JN6 A;  4BLC A;  4I4L A;  4GIP A;  4JI3 M;  5EXS A;  3FTF A;  4NRW A;  4JI1 M;  2ZAO A;  1N78 A;  4HL4 A;  1TDZ A;  3Q8X A;  4JXJ A;  4G4O A;  3U61 B;  2NQ8 C;  3GPY A;  4DR1 M;  2X4A A;  4I5S A;  1DGH B;  3FUT A;  4DV6 M;  4QHS A;  2KRK A;  2XZU A;  4DR7 M;  1NNU C;  3HKP A;  3H4M A;  4I8O A;  5GKN A;  3VK7 A;  3L26 A;  1JR3 A;  2KZU A;  4LJ4 A;  3K8Z A;  4JI5 M;  1IXR C;  2QZ4 A;  4LCB A;  3QWL A;  3TL4 X;  1IN8 A;  3WHL A;  2DWL A;  4LGM A;  2V1U A;  1UM8 A;  1R6B X;  2EUC A;  4IBE A;  1WXQ A;  1IBK M;  3FTE A;  5E6J A;  3ZCB B;  2CEA A;  4KHP M;  3I51 A;  3VDU A;  1QYR A;  2CV0 A;  1Z5B A;  4D81 A;  4PCZ A;  4LZJ A;  2CV2 A;  2FFJ A;  3ILK A;  3L25 A;  2F4V M;  2UXC M;  3W0L B;  3GQ4 A;  3GLH A;  4OVZ B;  2LXE A;  5JI3 E;  3CF0 A;  1ORY B;  2YFQ A;  1XXH A;  4MB7 A;  4AKG A;  3SHF A;  3GPU A;  1NHW C;  4CIS A;  2D7G A;  5F3W A;  1TH4 A;  3SMP A;  5A2Q S;  1TH2 A;  5FTM A;  1OFI A;  1QAQ A;  2DWN A;  3U6E A;  3T1H M;  4IBI A;  4IIW A;  3ZH9 B;  3L28 A;  1J7K A;  4NL4 H;  3W0F A;  2K47 A;  1LV7 A;  1DGH A;  1PM5 A;  4JI6 M;  3HHZ A;  3GRU A;  1C1K A;  2FNA A;  4A3V B;  4YHH M;  4B3M M;  3NBI A;  5EXT A;  3K92 A;  3AOG A;  2Y21 A;  1XNR M;  3J7A S;  1SXJ C;  3M7G A;  2G5G X;  4LFA M;  2H1R A;  1XC8 A;  4X65 M;  3UZU A;  1Q3C A;  4GKJ M;  4L16 A;  4LGY A;  1NY6 A;  3AV0 A;  4G4N A;  4W5W A;  5FTL A;  4L15 A;  1GVN A;  4GIT A;  3U60 B;  2YNM D;  3KP1 E;  5C1B A;  3KOY E;  1KSF X;  1VDD A;  3HGI A;  1N77 A;  4LRT A;  2VQF M;  2W82 A;  4FWD A;  5EP1 A;  4LRS A;  1HT1 E;  2HCB A;  4PDI A;  4KOD A;  2CHV A;  1N34 M;  4LF5 M;  1SXJ B;  2LWX A;  1YUB A;  3FYD A;  4X64 M;  1HNW M;  3KDS E;  1OFH A;  3GLI B;  2DVW B;  4LF8 M;  4JV5 M;  2OPF A;  3LVV A;  4LJ7 A;  3HU1 A;  2J7O A;  2KA6 B;  2C9O A;  3FUX A;  4IBK A;  1Z59 A;  1QZM A;  1G4A E;  2M60 A;  4M9S A;  4FCT A;  4BB9 A;  5EP2 A;  5LMN M;  1GKI A;  1X37 A;  4II7 A;  5ITR A;  1KFV A;  4JI2 M;  1NHG C;  5BPV A;  4G4Q A;  3DFZ A;  3HHX A;  3U6L A;  2Q2E B;  3GLG B;  2Z4R A;  4L8R C;  2L6O A;  1DO2 A;  4DR3 M;  2Z7J A;  1PJI A;  3HWS A;  1GL6 A;  1IN4 A;  2KRU A;  5ITQ A;  2D7E A;  2XFS A;  5IZ7 D;  2KEB A;  3J27 B;  5FTK A;  3RGS A;  1TH3 A;  1G59 A;  1K3X A;  2F5O A;  1JQJ C;  3KVW A;  1HT2 E;  3C58 A;  2G8L A;  4NOO B;  2DWM A;  5FTN A;  3CF6 E;  2E5L M;  4PT5 A;  4JYA M;  1TGU A;  3GQ5 A;  4IBF A;  1L2D A;  4AQY M;  2P5T A;  3GRY A;  2UUC M;  1HQC A;  3L27 A;  1XMO M;  1TDH A;  4EIW A;  3SAT A;  3DOA A;  3SAS A;  3TPZ A;  4ITQ A;  2Y0Q A;  3QAU A;  4NXM M;  4LF9 M;  3E4R A;  3FTD A;  4LJ8 A;  4JI8 M;  3HHY A;  2CV1 A;  4IJF A;  2KXE A;  5LMU M;  3A42 A;  2RKO A;  1XMQ M;  4L4U A;  5FLX S;  1ZQ9 A;  2HKJ A;  1NSF A;  2CE7 A;  4G6Z A;  5DNY A;  5EQT A;  5JI2 E;  4G4R A;  2L7H A;  3VKG A;  3A98 B;  5IRE B;  3GPP A;  4AG6 A;  2ZM6 M;  5DYG A;  2O5R A;  4FD2 A;  3ZC7 B;  3U61 A;  4AKI A;  3A46 A;  1S3S A;  3D8B A;  1W5S A;  1PJJ A;  3NWL A;  4FW9 A;  3RFW A;  1NNJ A;  1G8P A;  3SMS A;  2L09 A;  1T3T A;  1NVM A;  5FTJ A;  2DWZ B;  4MGK E;  3K1J A;  4P16 A;  3PVS A;  3D8L A;  4DV1 M;  4ZPX A;  2JA2 A;  4XBO A;  3KS4 A;  3GRR A;  4RF0 A;  3TWK A;  3GLH B;  3VKH A;  1IBL M;  2RGH A;  4GRI A;  4TUW A;  3OTO M;  4RNA A;  4RF1 A;  1H6U A;  3LQR A;  4WW0 A;  3SHG B;  3U6C A;  4K0K M;  2QPA A;  5KQD A;  1JR3 D;  1IY0 A;  5IWA M;  1HQY E;  4OVZ A;  4JI7 M;  2UXD M;  5EJC A;  2HL7 A;  3EIH A;  3U6D A;  4B7G A;  2Y20 A;  3A45 A;  2I7P A;  3UK6 A;  4IJE A;  3SAR A;  2X8A A;  3VDP A;  2UUA M;  1GLN A;  2XSZ D;  3M6A A;  3CTW B;  1HNX M;  1XNQ M;  4OX9 M;  1NJG A;  3T15 A;  7CAT A;  4AKH A;  2V1C A;  3EIE A;  2BNK A;  1HNZ M;  5ITY A;  4LF6 M;  1K82 A;  1L8Q A;  5DYI A;  2F5Q A;  3L2A A;  4LJ6 A;  2UU9 M;  1N32 M;  2YQZ A;  3JR5 A;  2YR0 A;  4QHT A;  3FYC A;  4DV2 M;  2HHH M;  2CFO A;  1KYI A;  2DZN B;  2RGO A;  4IBG A;  1IN7 A;  3TWL A;  1K3W A;  4X66 M;  2F5S A;  2R45 A;  4XGI A;  1GL7 A;  1QAN A;  2FE8 A;  2XH9 A;  2R4J A;  4B3S M;  3GQ3 A;  4DR4 M;  1I94 M;  3PNY A;  3M0E A;  3I4V A;  1D2N A;  3LQQ A;  3DA1 A;  1Z5A A;  2CUZ A;  4B3T M;  1FNN A;  1SXJ A;  4JI0 M;  4NSR A;  4D82 A;  5C18 A;  1L1Z A;  1L2B A;  1MU5 A;  1E9S A;  4IBB A;  4DV3 M;  3MK6 A;  1XHB A;  3GLF B;  2UUB M;  1NJF A;  3IG8 A;  3B9P A;  1HR0 M;  2X49 A;  1IY1 A;  4QNM A;  4OW0 A;  3U6P A;  1E94 E;  4LF4 M;  3KSJ A;  5EP3 A;  3KOZ E;  4DV5 M;  2C99 A;  3KOW E;  1IY2 A;  3HJS A;  3U5Z A;  4DV4 M;  1YE9 A;  3GRV A;  2DZO B;  2BJW A;  1DO0 A;  1QAM A;  1EE8 A;  5BR8 M;  5ITX A;  3GLG A;  5ITU A;  4FWH A;  1DGB A;  2CHG A;  1L1T A;  1L2C A;  3FUW A;  1OJL A;  2C5R A;  2F5P A;  2R4E A;  4PDG A;  4AI6 A;  4JI4 M;  4GC5 A;  4DUZ M;  4MGZ E;  3SAW A;  4FCV A;  2CHQ A;  4DV7 M;  4NRV A;  3THG A;  3AOE A;  4X62 M;  4Z8X A;  3TE6 A;  5KPR A;  3J80 S;  3FUV A;  4BBA A;  4B7F A;  4IBC A;  1QAO A;  3GLF A;  2BJV A;  4PD2 A;  2R18 A;  4AZF A;  1N36 M;  4NSO B;  3CF2 A;  4LFC M;  3AFH A;  3R8F A;  1SXJ E;  4M9X A;  2EA0 A;  5KPZ A;  3RGP A;  3LMM A;  4MH0 E;  1IXS B;  3BOS A;  1IN6 A;  4WUR A;  2EO2 A;  3LVW A;  3SFZ A;  3GP1 A;  3FTC A;  3PNV A;  2QCU A;  3HU2 A;  4CHT B;  1J09 A;  2Z4S A;  1FJG M;  4LZZ A;  3RE8 A;  3U5Z B;  4YY3 M;  1Z6T A;  3AKZ A;  5IT9 S;  4I81 A;  1E9R A;  2QEN A;  4S12 A;  4LG2 A;  4GHL A;  2I7N A;  4FCW A;  3TWM A;  2R62 A;  1N33 M;  3J2P B;  4DR6 M;  1R2Z A;  2KZS A;  1YSY A;  2F5N A;  3MJ5 A;  2FOI C;  4HLQ A;  5ITT A;  3SBJ A;  5FSW A;  2Z3X A;  1R2Y A;  1IXZ A;  4MGH A;  4REZ A;  3UGJ A;  3I4Y A;  1W5T A;  4AG5 A;  4M0W A;  1SXJ D;  3VLF B;  3MHV C;  2Y0T A;  3KS8 A;  3HJ8 A;  1J5E M;  4MGI E;  2AHM A;  4LFB M;  4DR5 M;  4M0D A;  3U6Q A;  4Z6Y A;  1IBM M;  1IM2 A;  4R3D A;  3HU3 A;  3FUU A;  3IG5 A;  1DGF A;  4GHA A;  3GPX A;  4QNR A;  5KO3 A;  1IN5 A;  2A5Y B;  4KLN A;  1R7R A;  3HJQ A;  2VII A;  3PFI A;  4IBJ A;  5EXP A;  3KOX E;  3E9S A;  4DUY M;  3SC3 A;  2XLJ A;  1NY5 A;  3GLI A;  1MX0 A;  2XF3 A;  4GMQ A;  4LJA A;  3FD9 A;  3AJI B;  4CGY B;  2OQ4 A;  2XSZ A;  5E26 A;  3UMM A;  1Z5C A;  4D80 A;  1G41 A;  3K2L A;  3TQS A;  5ITX E;  2KW0 A;  2DHR A;  5EP4 A;  4B08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...