2OQ4A

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
262
structure length
252
Chain Sequence
PQGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGLFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrates and mutations of critical residues
rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords 5'-D(*G*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*GP*G)-3'
total genus 74
structure length 252
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2oq4A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2oq4A01
4LF8M 1XMQM 4JI5M 2UUAM 3T1HM 4LF6M 3JR5A 3SARA 2HKJA 2Q2EB 1IBLM 1HNZM 2UU9M 5ITXA 4JI7M 1NNJA 4LFBM 2F5SA 4PD2A 3A42A 4MB7A 5ITTA 4X62M 1K3XA 1K82A 3SBJA 3GO8A 3SAVA 2F4VM 2UXBM 4NRWA 4DV5M 3GPPA 1I94M 2F5QA 4DR1M 4ITQA 5ITXE 4JI6M 4LF4M 4JI2M 1HR0M 1TDHA 4DUZM 3T1YM 1J5EM 1L1TA 3TWKA 3SATA 4X65M 1K3WA 4YY3M 2OPFA 4DR3M 4KHPM 4PDGA 1FJGM 4DR2M 4PDIA 4DR5M 4B3RM 4JI1M 1HNWM 4G4OA 4B3SM 1L2DA 3U6EA 3J7AS 4LF7M 3GQ3A 5FLXS 4LFAM 3U6LA 5ITYA 4DV7M 4DV3M 3GPYA 2F5NA 2F5PA 2UXCM 4DUYM 1N34M 4LF9M 4K0KM 5IT9S 4B3MM 1XNRM 4G4RA 5ITUA 4DR7M 4JYAM 1N32M 3JR4A 3VK7A 1XMOM 1R2ZA 2XZFA 1MU5A 3GQ4A 3A46A 4GKJM 3U6OA 2ZM6M 4LF5M 4NXNM 2UUCM 3JAMS 1Q3BA 1Z5AA 4DV2M 3SAWA 4OX9M 4JI3M 4DV1M 3A45A 1XNQM 4X66M 4DR4M 3U6CA 5LMNM 1MX0A 4G4NA 1L2BA 1Z5CA 3OTOM 2F5OA 2XZUA 3GQ5A 4JI4M 3U6QA 3U6DA 1XC8A 1R2YA 1IBKM 1N33M 1TDZA 1IBMM 2VQEM 4YHHM 3U6SA 4LFCM 2UXDM 3DOAA 1KFVA 4NRVA 1Q39A 1L2CA 5ITQA 1PM5A 4GKKM 3GPXA 3SAUA 2E5LM 3U6PA 4JI0M 4DV4M 5BR8M 3TWMA 3J80S 4DV0M 2VQFM 4X64M 4JI8M 3J81S 4DR6M 3TWLA 1HNXM 2UUBM 2HHHM 1PJJA 5ITRA 5IWAM 4NXMM 1Z59A 3SASA 1PJIA 4JV5M 4G4QA 3GPUA 5LMUM 2OQ4A 4DV6M 3VK8A 1L1ZA 5A2QS 3W0FA 4CISA 4AQYM 1N36M 2ZBKB 4B3TM 3GP1A 1Z5BA 3C58A 1EE8A 4PCZA 3U6MA 2EA0A 1Q3CA
chains in the Genus database with same CATH superfamily
2R46A 3L26A 2OOBA 3CGWA 4JI5M 1A5TA 3I04M 4L78A 3K8ZA 3FD9A 2Q2EB 3PXGA 1HNZM 2KNZA 2LXEA 5ITXA 2UU9M 4WP2A 1NNJA 5FSWA 3H4MA 1ZMUA 4GHAA 5ITTA 4RF1A 2C99A 2R0IA 3GO8A 5E26A 4M9XA 2RKOA 3HKPA 1G71A 3HU1A 4DR1M 4AG5A 1DGFA 2I7PA 3FRIA 4KO8A 4JI2M 4IBFA 1JR3E 2R4EA 2LVQD 4BBAA 1TDHA 3L27A 2JY8A 3B74A 3J7BA 3TWKA 2FE8A 3T6PA 4P17A 4YY3M 3UZUA 4DBGB 2OPFA 3QYEA 3CF6E 2DXIA 1TTEA 1FJGM 2EJSA 3K2LA 2BJWA 1VEKA 1XHBA 2OOAA 4I4LA 3J7AS 1HJPA 2J7NA 4LF7M 1NY6A 5GKNA 4LJ4A 2JY5A 5FLXS 2LVPC 3HU2A 3PVSA 5FTNA 3U6LA 3V76A 2QBYA 3VKGA 2APLA 2JY7A 1T6OA 2KDLA 4BLCA 2JZ1A 3GPYA 3J2PB 2WSEF 4IBJA 4DUYM 2M5ZA 2L2DA 2QZ4A 3LCUA 4LF9M 4K0KM 5IT9S 4ANRA 3EIHA 5E6JA 3AOEC 1OAIA 1NSFA 1G41A 3JR4A 1DGBA 4FD2A 4R3DA 2Z4RA 3ILKA 1TGUA 4GITA 5JI3E 3U6OA 4GKJM 4LF5M 2Y21A 1AUAA 4AKIA 3JAMS 1E94E 1OQYA 4OX9M 3E4RA 3L28A 2HL7A 3BOSA 3LCVB 4DV1M 4MGHA 2ZAOA 4FCWA 1XNQM 4X66M 2LTUA 2VF7A 4B08A 3FTFA 4FVMA 3E21A 1I4WA 3AOEA 1TH3A 4FCTA 2F5OA 2XZUA 2KZSA 4L8RC 3IG5A 4IIWA 2RRUA 4XBOA 2DAKA 2DAEA 1R2YA 1N33M 1V92A 1OIPA 1WJ7A 2HWJA 4NL4H 3DOAA 3IECA 3QAUA 3KW6A 1GL7A 1ZMWA 3Q8GA 4NRVA 2QPAA 4LJ8A 1L2CA 1NNUC 1PM5A 4GKKM 2JWSA 2E5LM 2L4EA 4GEWA 1RU3A 3HY5A 4MGIE 4LJAA 4DV4M 4GIPA 1LV7A 1G3IA 1FNNA 3J80S 3J81S 4DR6M 3RFWA 3T38A 1VG5A 2WZJA 2K0BX 5ITRA 4NXMM 3I4YA 3VKHA 4M9SA 4NSOB 4AKGA 4JV5M 2VF8A 3ZQJA 4G4QA 5LMUM 4JN6A 3MJ5A 3VK8A 5EQTA 1IY0A 2DNAA 1V33A 1TH2A 4AQYM 3Q8XA 2ZBKB 4B3TM 1Z5BA 3C58A 3K9OA 2XLJA 1EE8A 1HT1E 3U6MA 1TR8A 4R71A 4Q7JA 1I94M 1XMQM 2K47A 2UUAM 4LF6M 1QYRA 3HJ8A 3THGA 1R6BX 1QZMA 3KP1E 2HKJA 4M9ZA 3FTCA 3B89A 4JI7M 2EKFA 3SHGB 3AKZA 4I8OA 1IM2A 3A42A 1G4AE 4IBCA 1E32A 3KP0E 5BPVA 2GQFA 2G3QA 3SBJA 2QENA 3KVWA 4HLQA 1OKSA 1WR1B 3SAVA 2P5TA 3KSXA 2FS1A 3IG8A 4LGMA 3GPPA 2UXBM 4LJ7A 4ITQA 1IN7A 2LHGA 2V1CA 3GLIE 4II7A 4LF4M 2MR9A 4RF0A 1DO2A 1QDRA 1JR3A 3T1YM 1J5EM 2WSFF 1PJQA 2DENA 3F92A 4D82A 4EIWA 2CEAA 3SATA 2XSZD 3DA1A 1G8PA 3SYLA 3C9PA 2DAIA 4DR2M 4QOSA 2X49A 1W5TA 1HQCA 3GLHB 4PDIA 2D7EA 4NC6A 3TL4X 5F3WA 1EFUB 2LVAA 3L29A 4B3SM 3U6EA 3FUUA 2O5RA 3GRUA 4B7GA 3GQ3A 1YE9A 2CHQA 3K9PA 5EXXA 2R65A 2XGNA 4MGZE 1L8QA 2LH0A 3HJQA 2UXCM 2CV2A 3WHLA 3H4JA 1YUBA 4B3MM 1XNRM 3WHKA 1IN5A 4QHSA 3GLIB 4KT0F 2KNAA 2V6ZM 3FYCA 5EJCA 3I4VA 1N32M 2VIIA 2KA6B 3HHWA 4LCBA 5IREB 2JNHA 3BBZA 4MM3B 1QVRA 3C3DA 2R45A 5DNYA 3VFDA 4IBGA 4AW4A 4XK8F 1J7KA 1SXJC 2L4FA 3E9SA 3AV0A 4OU7A 2MJ5B 3MMPA 4LRSA 1NVMA 2UUCM 4LZZA 4DV2M 4Y28F 4JI3M 4BB9A 3C3EA 4F2LA 4ZPXA 1OAOC 2CV0A 4WW0A 2R4JA 1PJSA 1J09A 4QHTA 3GRVA 2BWEA 2K9DA 1D0LA 1MX0A 2YNMD 1QAMA 1Z5CA 2XFSA 1ZMVA 1NJFA 3FUTA 2M60A 1IBKM 5DYIA 2XFTA 1JR3D 2VQEM 3U6SA 1UFZA 4LFCM 3GRYA 4M0DA 2UXDM 3GRRA 4HL4A 2LHCA 1Q39A 4GH9A 3SMSA 3NBIA 3FKEA 4CJ6A 2DHRA 3GLHA 5EXPA 3SAUA 2KZUA 4AZFA 2CUZA 3U6PA 4JI0M 1R7RA 4KODA 2G5GX 1Q02A 1IN4A 2I7NA 2R44A 3K1JA 2VQFM 5FTMA 2DAGA 1MN3A 1T43A 1WGLA 1P3QQ 3HWSA 5EXSA 5DYGA 1QDTA 4Z8XA 2HHHM 2JUJA 2LNHC 1D0KA 1PGYA 3LQRA 2FNAA 3B7NA 4AKHA 1D0MA 1X37A 2DWZB 4HEOA 4I5SA 5KQDA 1SXJA 3J27B 1ZQ9A 3EIEA 2OQ4A 4DV6M 1IXSB 5A2QS 1L1ZA 2FFJA 4CISA 1NJGA 1Z6TA 3FTDA 3FUWA 3AFHA 3KOYE 3PNYA 4PCZA 4IJEA 2CFOA 4LF8M 3HHXA 1JB0F 3GLGA 3T1HM 4D80A 3SARA 3HHYA 1Y8GA 3CF0A 4RNAA 1DV0A 4LFBM 2R6FA 2F5SA 1SG9A 1TF0B 1HT2E 4MB7A 2HAKA 4WURA 2ZANA 1K3XA 1K82A 2WSCF 2C96A 4XGIA 1N78A 2F4VM 3LMMA 3SFZA 4DV5M 2ZTDA 3AJIB 3DFZA 5ITXE 4JI6M 4OW0A 1SXJD 1GO5A 2CHVA 2JZ0A 2XSZA 3B7ZA 4DUZM 1L1TA 2C9OA 1E9SA 3RE8A 5H37D 4GC9A 1E9RA 1R4GA 2H5XA 4AG6A 4DR3M 3M7GA 3VDPA 2DWLA 4KHPM 3VDUA 2LWXA 1OFIA 4NSRA 1IBMM 2YQZA 4DR5M 4B3RM 2R18A 1QZEA 1XXHB 3GLHE 2VDBB 3D8LA 5L8RF 4G4OA 1CUKA 2DZNB 3KXEC 1HNWM 3MHVC 3HHZA 4MH0E 4B7FA 1VEJA 1HQYE 2DZLA 4D81A 4DV7M 4DV3M 3B9PA 2F5NA 2F5PA 1GKIA 2Z8YM 2CWBA 3KOZE 2Y20A 1WGNA 4UN2B 4LG2A 4JYAM 2O01F 3FE3A 5EXTA 3TQSA 4NOOB 1OTRA 1IY1A 3LQQA 5EP4A 3MK6A 1XMOM 2MGWA 2MH8A 3UMMA 4QNRA 1MU5A 3GLGB 3TE6A 2XZFA 3A46A 3FTEA 1IN6A 4LRTA 3A98B 3ZC7B 3SMPA 1NY5A 1Q3BA 3GLFE 1AIPC 4G6ZA 2LVOC 2Z7JA 2XF3A 3M0EA 4FW9A 4MGKE 4LGYA 1N75A 4M0WA 1NHGC 3U6CA 1PJTA 5LMNM 2C9CA 4FWHA 4G3OA 4G4NA 4LZJA 2N35A 3KOWE 2BJVA 3U60A 2JA2A 1IXRC 3OTOM 3GQ5A 4JI4M 3RGSA 3UGJA 3HX3A 2YFQA 2XH9A 3FUVA 5KPRA 3GLFB 3U6QA 2GNOA 1XC8A 1SXJB 2KHHA 3RGPA 1TDZA 2V1UA 2A5YB 4IBBA 4GMQA 3KS8A 1NV8A 1JQJC 3T15A 1EIJA 1NHWC 2L7IA 5ITQA 3QWLA 3SHFA 2CE7A 7CATA 3GLGE 1GLNA 1MJGM 2KXEA 2JP7A 5BR8M 1ZV1A 3NWLA 1ORYB 3TWMA 4IBKA 1IFYA 4DV0M 4FCVA 4X64M 4OVZB 2UUBM 3SC3A 1WHCA 2KRKA 4MGYE 4IBIA 5FTJA 1PJJA 3KFUG 2CRUA 2ZAMA 1KYIA 3CTWB 1YSYA 2KRUA 4REZA 4R7GA 5FTKA 1F4IA 1XWIA 4W5WA 2BWBA 4L4UA 4PT5A 3GPUA 5KPZA 1C1KA 1KSFX 3HZJA 5DFLA 3ZH9B 2D7HA 3TPZA 3HJSA 1GVNA 4GRIA 2MROB 2DWMA 1Q3CA 3PFIA 3KOXE 1QAQA 5JI2E 2R62A 3JR5A 1ZAEA 2LBCA 2B3TA 1IBLM 1GJSA 3DZDA 4CHTB 3U61B 4PD2A 4Z6YA 4X62M 3NBXX 4QNMA 1DGHB 2W82A 1VQ1A 2QQ8A 4NRWA 2AHMA 1OFHA 1XXHE 2F5QA 1PRBA 3FUXA 1IXSA 3K92A 3ZCBB 1HR0M 4P16A 4QOZC 2DKLA 2EO2A 3SYKA 1IXZA 1T3TA 2HCBA 3KS4A 5KQ8A 4X65M 2CP8A 2QNJA 1K3WA 3HGIA 3W0LB 2OO9A 2FH0A 3CF2A 3FRHA 4LJ9A 1YLAA 2G8LA 2NQ8C 4PDGA 1C7YA 2JXNA 2L7HA 1WIVA 2YR0A 4JI1M 4OVZA 1L2DA 2DI0A 3PNVA 2J5YA 4L15A 3IHPA 2KW0A 1G59A 1QUSA 2O25A 2H1RA 3FYDA 3LVVA 4LFAM 1IN8A 4CGYB 3AL0C 4LJ5A 5ITYA 2JY6B 4LJ6A 1VDLA 1QQWA 3AOGA 2J7OA 2QSFX 5IZ7D 1N34M 2DZOB 1OJLA 3KSJA 3GLFA 1D2NA 4FWDA 4G4RA 5FTLA 2ZTCA 4S12A 1R5LA 5ITUA 3GLIA 4DR7M 3U5ZA 1N77A 3U5ZB 2KNVA 5C18A 2CHGA 3VK7A 1R2ZA 2D7GA 2X4AA 2DWNA 3GQ4A 4B7HA 5C1BA 3LW5F 4GHLA 2ZM6M 8CATA 1WXQA 3R8FA 4NXNM 3VLFB 1Z5AA 3SAWA 1NV9A 1DGGA 1VEGA 2DHYA 2X8AA 2EKKA 2L09A 3A45A 3I51A 4IBDA 2Y0TA 2QBYB 2C98A 3B7QA 4DR4M 1V34A 2QP9X 4IBEA 2EUCA 1NO1A 3KDSE 4RKUF 1L2BA 3BXWA 2DVWB 1W5SA 2ERCA 3HU3A 2DAMA 3UJNA 3L2AA 2FOIC 3U6DA 5KPTA 3M6AA 5KO3A 5EP2A 2Y0QA 1SXJE 3UK6A 1QANA 1QUTA 4F1IA 3W67A 4YHHM 1XB2B 1KFVA 2CV1A 3R9XB 3L25A 1S3SA 3W68A 4LY6A 2QCUA 2LVNC 1QAOA 3I01M 3GPXA 1H6UA 3LVWA 2Z4SA 2QHOB 1VDDA 5EP3A 1IY2A 3E46A 4GC5A 4CIZA 2K6BA 1GABA 1OIZA 4JI8M 1XXHA 5EP1A 3TWLA 1HNXM 2RGOA 4TUWA 1UM8A 4L6V6 3U61A 2C5RA 1GJTA 4AI6A 5IWAM 3U60B 2L6OA 1DGHA 2XEPA 1Z59A 3SASA 1TH4A 1PJIA 1IQPA 4JXJA 2Z3XA 1DO0A 4L16A 3W0FA 1GL6A 2KEBA 2BNKA 3QYBA 3D8BA 2RGHA 4KLNA 4A3VB 1LTMA 1N36M 4I81A 3GP1A 1BVSA 4IJFA 2EA0A 4FWGA
chains in the Genus database with same CATH topology
2R46A 3L26A 4JI5M 4L78A 3K8ZA 3FD9A 2Q2EB 3PXGA 1HNZM 2UU9M 2LXEA 5ITXA 1NNJA 5FSWA 3H4MA 4GHAA 5ITTA 4RF1A 2C99A 3GO8A 5E26A 4M9XA 2RKOA 3HKPA 3HU1A 4DR1M 4AG5A 1DGFA 2I7PA 4KO8A 4JI2M 4IBFA 2R4EA 4BBAA 1TDHA 3L27A 3J7BA 3TWKA 2FE8A 4YY3M 3UZUA 2OPFA 3CF6E 2DXIA 1FJGM 3K2LA 2BJWA 1XHBA 4I4LA 3J7AS 2J7NA 4LF7M 1NY6A 5GKNA 4LJ4A 5FLXS 3HU2A 3PVSA 5FTNA 3U6LA 2QBYA 3VKGA 4BLCA 3GPYA 3J2PB 4IBJA 4DUYM 2M5ZA 2QZ4A 4LF9M 4K0KM 5IT9S 3EIHA 5E6JA 3AOEC 1NSFA 1G41A 3JR4A 1DGBA 4FD2A 4R3DA 2Z4RA 3ILKA 1TGUA 4GITA 5JI3E 3U6OA 4GKJM 4LF5M 2Y21A 4AKIA 3JAMS 1E94E 4OX9M 3L28A 3E4RA 2HL7A 3BOSA 4DV1M 4MGHA 2ZAOA 4FCWA 1XNQM 4X66M 4B08A 3FTFA 4FVMA 1I4WA 3AOEA 1TH3A 4FCTA 2F5OA 2XZUA 2KZSA 4L8RC 3IG5A 4IIWA 4XBOA 1R2YA 1N33M 4NL4H 3DOAA 3QAUA 3KW6A 1GL7A 4NRVA 2QPAA 4LJ8A 1L2CA 1NNUC 1PM5A 4GKKM 2E5LM 4MGIE 4LJAA 4DV4M 4GIPA 1LV7A 1G3IA 1FNNA 3J80S 3J81S 4DR6M 3RFWA 3T38A 5ITRA 4NXMM 3I4YA 3VKHA 4M9SA 4NSOB 4AKGA 4JV5M 4G4QA 5LMUM 4JN6A 3MJ5A 3VK8A 5EQTA 1IY0A 1TH2A 4AQYM 3Q8XA 2ZBKB 4B3TM 1Z5BA 3C58A 2XLJA 1EE8A 1HT1E 3U6MA 1I94M 1XMQM 2K47A 2UUAM 4LF6M 1QYRA 3HJ8A 3THGA 1R6BX 1QZMA 3KP1E 2HKJA 4M9ZA 3FTCA 4JI7M 3SHGB 3AKZA 4I8OA 1IM2A 3A42A 1G4AE 4IBCA 1E32A 3KP0E 5BPVA 3SBJA 2QENA 3KVWA 4HLQA 3SAVA 2UXBM 2P5TA 3KSXA 4LGMA 3IG8A 3GPPA 4LJ7A 4ITQA 1IN7A 2V1CA 4II7A 4LF4M 4RF0A 1DO2A 1JR3A 3T1YM 1J5EM 3SATA 4D82A 4EIWA 2CEAA 2XSZD 3DA1A 1G8PA 3SYLA 4DR2M 4QOSA 2X49A 1W5TA 1HQCA 3GLHB 4PDIA 2D7EA 5F3WA 3TL4X 3L29A 4B3SM 3U6EA 3FUUA 2O5RA 3GRUA 4B7GA 3GQ3A 1YE9A 2CHQA 5EXXA 2R65A 2XGNA 4MGZE 1L8QA 2LH0A 3HJQA 2UXCM 2CV2A 3WHLA 1YUBA 4B3MM 1XNRM 3WHKA 1IN5A 4QHSA 3GLIB 2V6ZM 3FYCA 5EJCA 3I4VA 1N32M 2VIIA 2KA6B 3HHWA 4LCBA 5IREB 4MM3B 1QVRA 2R45A 5DNYA 3VFDA 4IBGA 4AW4A 1J7KA 1SXJC 3E9SA 3AV0A 4OU7A 2UUCM 4LRSA 1NVMA 4LZZA 4DV2M 4JI3M 4BB9A 4ZPXA 2CV0A 4WW0A 2R4JA 1J09A 4QHTA 3GRVA 1MX0A 2YNMD 1QAMA 1Z5CA 2XFSA 1NJFA 3FUTA 2M60A 1IBKM 5DYIA 2XFTA 1JR3D 2VQEM 3U6SA 4LFCM 2UXDM 3GRYA 4M0DA 3GRRA 4HL4A 1Q39A 4GH9A 3SMSA 3NBIA 3FKEA 2DHRA 3GLHA 5EXPA 3SAUA 2KZUA 4AZFA 2CUZA 3U6PA 4JI0M 1R7RA 4KODA 2G5GX 1IN4A 2I7NA 3K1JA 2VQFM 5FTMA 2HHHM 3HWSA 5EXSA 5DYGA 4Z8XA 2LNHC 3LQRA 2FNAA 4AKHA 1X37A 2DWZB 4I5SA 5KQDA 1SXJA 3J27B 1ZQ9A 3EIEA 2OQ4A 4DV6M 1IXSB 5A2QS 1L1ZA 2FFJA 4CISA 1NJGA 1Z6TA 3FTDA 3FUWA 3KOYE 3AFHA 3PNYA 4PCZA 4IJEA 2CFOA 4LF8M 3HHXA 3GLGA 3T1HM 4D80A 3SARA 3HHYA 3CF0A 4RNAA 4LFBM 2F5SA 4MB7A 1HT2E 4WURA 2ZANA 1K3XA 1K82A 2C96A 4XGIA 1N78A 2F4VM 3LMMA 3SFZA 4DV5M 3AJIB 3DFZA 5ITXE 4JI6M 4OW0A 1SXJD 2CHVA 2XSZA 4DUZM 1L1TA 2C9OA 1E9SA 3RE8A 5H37D 4GC9A 1E9RA 4AG6A 4DR3M 2DWLA 3M7GA 3VDPA 4KHPM 3VDUA 2LWXA 1OFIA 4NSRA 2YQZA 4DR5M 4B3RM 2R18A 1XXHB 3D8LA 4G4OA 1HNWM 2DZNB 3KXEC 3MHVC 3HHZA 4MH0E 4B7FA 1HQYE 4D81A 4DV7M 4DV3M 3B9PA 2F5NA 2F5PA 1GKIA 3KOZE 2Y20A 4LG2A 4JYAM 5EXTA 3TQSA 4NOOB 1IY1A 3LQQA 5EP4A 3MK6A 1XMOM 3UMMA 4QNRA 1MU5A 3GLGB 3TE6A 2XZFA 3A46A 3FTEA 1IN6A 4LRTA 3A98B 3ZC7B 3SMPA 1NY5A 1Q3BA 4G6ZA 2Z7JA 2XF3A 3M0EA 4FW9A 4MGKE 4LGYA 1N75A 4M0WA 1NHGC 3U6CA 5LMNM 2C9CA 4FWHA 4G4NA 4LZJA 3KOWE 3U60A 2BJVA 2JA2A 1IXRC 3OTOM 3GQ5A 4JI4M 3RGSA 3UGJA 3U6QA 2YFQA 2XH9A 3FUVA 5KPRA 3GLFB 1XC8A 1SXJB 3RGPA 2V1UA 1TDZA 2A5YB 4IBBA 4GMQA 3KS8A 1JQJC 3T15A 1NHWC 2L7IA 5ITQA 3QWLA 3SHFA 2CE7A 7CATA 1GLNA 2KXEA 5BR8M 3NWLA 1ORYB 3TWMA 4IBKA 4DV0M 4FCVA 4X64M 4OVZB 2UUBM 3SC3A 2KRKA 4MGYE 4IBIA 5FTJA 1PJJA 3KFUG 2ZAMA 1KYIA 3CTWB 1YSYA 2KRUA 4REZA 4R7GA 5FTKA 1XWIA 4W5WA 4L4UA 4PT5A 3GPUA 5KPZA 1C1KA 1KSFX 3ZH9B 2D7HA 3TPZA 3HJSA 1GVNA 4GRIA 2DWMA 1Q3CA 3PFIA 3KOXE 1QAQA 5JI2E 2R62A 3JR5A 1ZAEA 1IBLM 3DZDA 4CHTB 3U61B 4PD2A 4Z6YA 4X62M 4QNMA 1DGHB 2W82A 4NRWA 2AHMA 1OFHA 2F5QA 3FUXA 3K92A 3ZCBB 1HR0M 4P16A 4QOZC 2EO2A 3SYKA 1IXZA 1T3TA 2HCBA 3KS4A 5KQ8A 4X65M 1K3WA 3HGIA 3W0LB 3CF2A 4LJ9A 2G8LA 4PDGA 2NQ8C 2L7HA 2YR0A 4JI1M 4OVZA 1L2DA 3PNVA 4L15A 2KW0A 1G59A 3FYDA 4LFAM 2H1RA 3LVVA 1IN8A 4CGYB 3AL0C 4LJ5A 5ITYA 4LJ6A 1QQWA 3AOGA 2J7OA 5IZ7D 1N34M 2DZOB 1OJLA 3KSJA 3GLFA 1D2NA 4FWDA 4G4RA 5FTLA 5ITUA 4S12A 3GLIA 4DR7M 3U5ZA 1N77A 3U5ZB 5C18A 2CHGA 3VK7A 1R2ZA 2D7GA 2X4AA 2DWNA 3GQ4A 4B7HA 5C1BA 4GHLA 2ZM6M 8CATA 1WXQA 3R8FA 4NXNM 3VLFB 1Z5AA 3SAWA 2X8AA 1DGGA 3I51A 2L09A 3A45A 4IBDA 2Y0TA 2QBYB 2C98A 4DR4M 2QP9X 4IBEA 2EUCA 3KDSE 1L2BA 2DVWB 1W5SA 2ERCA 3HU3A 3UJNA 3L2AA 2FOIC 3U6DA 5KPTA 3M6AA 5KO3A 5EP2A 2Y0QA 1SXJE 3UK6A 1QANA 4YHHM 1IBMM 2CV1A 3L25A 1KFVA 3R9XB 1S3SA 4LY6A 2QCUA 1QAOA 3GPXA 1H6UA 3LVWA 2Z4SA 1VDDA 5EP3A 1IY2A 4GC5A 4JI8M 1XXHA 5EP1A 3TWLA 1HNXM 2RGOA 4TUWA 1UM8A 3U61A 2C5RA 4AI6A 5IWAM 3U60B 2L6OA 1DGHA 2XEPA 1Z59A 3SASA 1TH4A 1PJIA 1IQPA 4JXJA 2Z3XA 1DO0A 4L16A 3W0FA 1GL6A 2KEBA 2BNKA 4KLNA 3D8BA 2RGHA 4A3VB 1N36M 4I81A 3GP1A 4IJFA 2EA0A 4FWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 M;  1XMQ M;  4JI5 M;  2UUA M;  3T1H M;  4LF6 M;  3JR5 A;  3SAR A;  2HKJ A;  2Q2E B;  1IBL M;  1HNZ M;  2UU9 M;  5ITX A;  4JI7 M;  1NNJ A;  4LFB M;  2F5S A;  4PD2 A;  3A42 A;  4MB7 A;  5ITT A;  4X62 M;  1K3X A;  1K82 A;  3SBJ A;  3GO8 A;  3SAV A;  2F4V M;  2UXB M;  4NRW A;  4DV5 M;  3GPP A;  1I94 M;  2F5Q A;  4DR1 M;  4ITQ A;  5ITX E;  4JI6 M;  4LF4 M;  4JI2 M;  1HR0 M;  1TDH A;  4DUZ M;  3T1Y M;  1J5E M;  1L1T A;  3TWK A;  3SAT A;  4X65 M;  1K3W A;  4YY3 M;  2OPF A;  4DR3 M;  4KHP M;  4PDG A;  1FJG M;  4DR2 M;  4PDI A;  4DR5 M;  4B3R M;  4JI1 M;  1HNW M;  4G4O A;  4B3S M;  1L2D A;  3U6E A;  3J7A S;  4LF7 M;  3GQ3 A;  5FLX S;  4LFA M;  3U6L A;  5ITY A;  4DV7 M;  4DV3 M;  3GPY A;  2F5N A;  2F5P A;  2UXC M;  4DUY M;  1N34 M;  4LF9 M;  4K0K M;  5IT9 S;  4B3M M;  1XNR M;  4G4R A;  5ITU A;  4DR7 M;  4JYA M;  1N32 M;  3JR4 A;  3VK7 A;  1XMO M;  1R2Z A;  2XZF A;  1MU5 A;  3GQ4 A;  3A46 A;  4GKJ M;  3U6O A;  2ZM6 M;  4LF5 M;  4NXN M;  2UUC M;  3JAM S;  1Q3B A;  1Z5A A;  4DV2 M;  3SAW A;  4OX9 M;  4JI3 M;  4DV1 M;  3A45 A;  1XNQ M;  4X66 M;  4DR4 M;  3U6C A;  5LMN M;  1MX0 A;  4G4N A;  1L2B A;  1Z5C A;  3OTO M;  2F5O A;  2XZU A;  3GQ5 A;  4JI4 M;  3U6Q A;  3U6D A;  1XC8 A;  1R2Y A;  1IBK M;  1N33 M;  1TDZ A;  1IBM M;  2VQE M;  4YHH M;  3U6S A;  4LFC M;  2UXD M;  3DOA A;  1KFV A;  4NRV A;  1Q39 A;  1L2C A;  5ITQ A;  1PM5 A;  4GKK M;  3GPX A;  3SAU A;  2E5L M;  3U6P A;  4JI0 M;  4DV4 M;  5BR8 M;  3TWM A;  3J80 S;  4DV0 M;  2VQF M;  4X64 M;  4JI8 M;  3J81 S;  4DR6 M;  3TWL A;  1HNX M;  2UUB M;  2HHH M;  1PJJ A;  5ITR A;  5IWA M;  4NXM M;  1Z59 A;  3SAS A;  1PJI A;  4JV5 M;  4G4Q A;  3GPU A;  5LMU M;  2OQ4 A;  4DV6 M;  3VK8 A;  1L1Z A;  5A2Q S;  3W0F A;  4CIS A;  4AQY M;  1N36 M;  2ZBK B;  4B3T M;  3GP1 A;  1Z5B A;  3C58 A;  1EE8 A;  4PCZ A;  3U6M A;  2EA0 A;  1Q3C A; 
#chains in the Genus database with same CATH topology
 2R46 A;  3L26 A;  2OOB A;  3CGW A;  4JI5 M;  1A5T A;  3I04 M;  4L78 A;  3K8Z A;  3FD9 A;  2Q2E B;  3PXG A;  1HNZ M;  2KNZ A;  2LXE A;  5ITX A;  2UU9 M;  4WP2 A;  1NNJ A;  5FSW A;  3H4M A;  1ZMU A;  4GHA A;  5ITT A;  4RF1 A;  2C99 A;  2R0I A;  3GO8 A;  5E26 A;  4M9X A;  2RKO A;  3HKP A;  1G71 A;  3HU1 A;  4DR1 M;  4AG5 A;  1DGF A;  2I7P A;  3FRI A;  4KO8 A;  4JI2 M;  4IBF A;  1JR3 E;  2R4E A;  2LVQ D;  4BBA A;  1TDH A;  3L27 A;  2JY8 A;  3B74 A;  3J7B A;  3TWK A;  2FE8 A;  3T6P A;  4P17 A;  4YY3 M;  3UZU A;  4DBG B;  2OPF A;  3QYE A;  3CF6 E;  2DXI A;  1TTE A;  1FJG M;  2EJS A;  3K2L A;  2BJW A;  1VEK A;  1XHB A;  2OOA A;  4I4L A;  3J7A S;  1HJP A;  2J7N A;  4LF7 M;  1NY6 A;  5GKN A;  4LJ4 A;  2JY5 A;  5FLX S;  2LVP C;  3HU2 A;  3PVS A;  5FTN A;  3U6L A;  3V76 A;  2QBY A;  3VKG A;  2APL A;  2JY7 A;  1T6O A;  2KDL A;  4BLC A;  2JZ1 A;  3GPY A;  3J2P B;  2WSE F;  4IBJ A;  4DUY M;  2M5Z A;  2L2D A;  2QZ4 A;  3LCU A;  4LF9 M;  4K0K M;  5IT9 S;  4ANR A;  3EIH A;  5E6J A;  3AOE C;  1OAI A;  1NSF A;  1G41 A;  3JR4 A;  1DGB A;  4FD2 A;  4R3D A;  2Z4R A;  3ILK A;  1TGU A;  4GIT A;  5JI3 E;  3U6O A;  4GKJ M;  4LF5 M;  2Y21 A;  1AUA A;  4AKI A;  3JAM S;  1E94 E;  1OQY A;  4OX9 M;  3E4R A;  3L28 A;  2HL7 A;  3BOS A;  3LCV B;  4DV1 M;  4MGH A;  2ZAO A;  4FCW A;  1XNQ M;  4X66 M;  2LTU A;  2VF7 A;  4B08 A;  3FTF A;  4FVM A;  3E21 A;  1I4W A;  3AOE A;  1TH3 A;  4FCT A;  2F5O A;  2XZU A;  2KZS A;  4L8R C;  3IG5 A;  4IIW A;  2RRU A;  4XBO A;  2DAK A;  2DAE A;  1R2Y A;  1N33 M;  1V92 A;  1OIP A;  1WJ7 A;  2HWJ A;  4NL4 H;  3DOA A;  3IEC A;  3QAU A;  3KW6 A;  1GL7 A;  1ZMW A;  3Q8G A;  4NRV A;  2QPA A;  4LJ8 A;  1L2C A;  1NNU C;  1PM5 A;  4GKK M;  2JWS A;  2E5L M;  2L4E A;  4GEW A;  1RU3 A;  3HY5 A;  4MGI E;  4LJA A;  4DV4 M;  4GIP A;  1LV7 A;  1G3I A;  1FNN A;  3J80 S;  3J81 S;  4DR6 M;  3RFW A;  3T38 A;  1VG5 A;  2WZJ A;  2K0B X;  5ITR A;  4NXM M;  3I4Y A;  3VKH A;  4M9S A;  4NSO B;  4AKG A;  4JV5 M;  2VF8 A;  3ZQJ A;  4G4Q A;  5LMU M;  4JN6 A;  3MJ5 A;  3VK8 A;  5EQT A;  1IY0 A;  2DNA A;  1V33 A;  1TH2 A;  4AQY M;  3Q8X A;  2ZBK B;  4B3T M;  1Z5B A;  3C58 A;  3K9O A;  2XLJ A;  1EE8 A;  1HT1 E;  3U6M A;  1TR8 A;  4R71 A;  4Q7J A;  1I94 M;  1XMQ M;  2K47 A;  2UUA M;  4LF6 M;  1QYR A;  3HJ8 A;  3THG A;  1R6B X;  1QZM A;  3KP1 E;  2HKJ A;  4M9Z A;  3FTC A;  3B89 A;  4JI7 M;  2EKF A;  3SHG B;  3AKZ A;  4I8O A;  1IM2 A;  3A42 A;  1G4A E;  4IBC A;  1E32 A;  3KP0 E;  5BPV A;  2GQF A;  2G3Q A;  3SBJ A;  2QEN A;  3KVW A;  4HLQ A;  1OKS A;  1WR1 B;  3SAV A;  2P5T A;  3KSX A;  2FS1 A;  3IG8 A;  4LGM A;  3GPP A;  2UXB M;  4LJ7 A;  4ITQ A;  1IN7 A;  2LHG A;  2V1C A;  3GLI E;  4II7 A;  4LF4 M;  2MR9 A;  4RF0 A;  1DO2 A;  1QDR A;  1JR3 A;  3T1Y M;  1J5E M;  2WSF F;  1PJQ A;  2DEN A;  3F92 A;  4D82 A;  4EIW A;  2CEA A;  3SAT A;  2XSZ D;  3DA1 A;  1G8P A;  3SYL A;  3C9P A;  2DAI A;  4DR2 M;  4QOS A;  2X49 A;  1W5T A;  1HQC A;  3GLH B;  4PDI A;  2D7E A;  4NC6 A;  3TL4 X;  5F3W A;  1EFU B;  2LVA A;  3L29 A;  4B3S M;  3U6E A;  3FUU A;  2O5R A;  3GRU A;  4B7G A;  3GQ3 A;  1YE9 A;  2CHQ A;  3K9P A;  5EXX A;  2R65 A;  2XGN A;  4MGZ E;  1L8Q A;  2LH0 A;  3HJQ A;  2UXC M;  2CV2 A;  3WHL A;  3H4J A;  1YUB A;  4B3M M;  1XNR M;  3WHK A;  1IN5 A;  4QHS A;  3GLI B;  4KT0 F;  2KNA A;  2V6Z M;  3FYC A;  5EJC A;  3I4V A;  1N32 M;  2VII A;  2KA6 B;  3HHW A;  4LCB A;  5IRE B;  2JNH A;  3BBZ A;  4MM3 B;  1QVR A;  3C3D A;  2R45 A;  5DNY A;  3VFD A;  4IBG A;  4AW4 A;  4XK8 F;  1J7K A;  1SXJ C;  2L4F A;  3E9S A;  3AV0 A;  4OU7 A;  2MJ5 B;  3MMP A;  4LRS A;  1NVM A;  2UUC M;  4LZZ A;  4DV2 M;  4Y28 F;  4JI3 M;  4BB9 A;  3C3E A;  4F2L A;  4ZPX A;  1OAO C;  2CV0 A;  4WW0 A;  2R4J A;  1PJS A;  1J09 A;  4QHT A;  3GRV A;  2BWE A;  2K9D A;  1D0L A;  1MX0 A;  2YNM D;  1QAM A;  1Z5C A;  2XFS A;  1ZMV A;  1NJF A;  3FUT A;  2M60 A;  1IBK M;  5DYI A;  2XFT A;  1JR3 D;  2VQE M;  3U6S A;  1UFZ A;  4LFC M;  3GRY A;  4M0D A;  2UXD M;  3GRR A;  4HL4 A;  2LHC A;  1Q39 A;  4GH9 A;  3SMS A;  3NBI A;  3FKE A;  4CJ6 A;  2DHR A;  3GLH A;  5EXP A;  3SAU A;  2KZU A;  4AZF A;  2CUZ A;  3U6P A;  4JI0 M;  1R7R A;  4KOD A;  2G5G X;  1Q02 A;  1IN4 A;  2I7N A;  2R44 A;  3K1J A;  2VQF M;  5FTM A;  2DAG A;  1MN3 A;  1T43 A;  1WGL A;  1P3Q Q;  3HWS A;  5EXS A;  5DYG A;  1QDT A;  4Z8X A;  2HHH M;  2JUJ A;  2LNH C;  1D0K A;  1PGY A;  3LQR A;  2FNA A;  3B7N A;  4AKH A;  1D0M A;  1X37 A;  2DWZ B;  4HEO A;  4I5S A;  5KQD A;  1SXJ A;  3J27 B;  1ZQ9 A;  3EIE A;  2OQ4 A;  4DV6 M;  1IXS B;  5A2Q S;  1L1Z A;  2FFJ A;  4CIS A;  1NJG A;  1Z6T A;  3FTD A;  3FUW A;  3AFH A;  3KOY E;  3PNY A;  4PCZ A;  4IJE A;  2CFO A;  4LF8 M;  3HHX A;  1JB0 F;  3GLG A;  3T1H M;  4D80 A;  3SAR A;  3HHY A;  1Y8G A;  3CF0 A;  4RNA A;  1DV0 A;  4LFB M;  2R6F A;  2F5S A;  1SG9 A;  1TF0 B;  1HT2 E;  4MB7 A;  2HAK A;  4WUR A;  2ZAN A;  1K3X A;  1K82 A;  2WSC F;  2C96 A;  4XGI A;  1N78 A;  2F4V M;  3LMM A;  3SFZ A;  4DV5 M;  2ZTD A;  3AJI B;  3DFZ A;  5ITX E;  4JI6 M;  4OW0 A;  1SXJ D;  1GO5 A;  2CHV A;  2JZ0 A;  2XSZ A;  3B7Z A;  4DUZ M;  1L1T A;  2C9O A;  1E9S A;  3RE8 A;  5H37 D;  4GC9 A;  1E9R A;  1R4G A;  2H5X A;  4AG6 A;  4DR3 M;  3M7G A;  3VDP A;  2DWL A;  4KHP M;  3VDU A;  2LWX A;  1OFI A;  4NSR A;  1IBM M;  2YQZ A;  4DR5 M;  4B3R M;  2R18 A;  1QZE A;  1XXH B;  3GLH E;  2VDB B;  3D8L A;  5L8R F;  4G4O A;  1CUK A;  2DZN B;  3KXE C;  1HNW M;  3MHV C;  3HHZ A;  4MH0 E;  4B7F A;  1VEJ A;  1HQY E;  2DZL A;  4D81 A;  4DV7 M;  4DV3 M;  3B9P A;  2F5N A;  2F5P A;  1GKI A;  2Z8Y M;  2CWB A;  3KOZ E;  2Y20 A;  1WGN A;  4UN2 B;  4LG2 A;  4JYA M;  2O01 F;  3FE3 A;  5EXT A;  3TQS A;  4NOO B;  1OTR A;  1IY1 A;  3LQQ A;  5EP4 A;  3MK6 A;  1XMO M;  2MGW A;  2MH8 A;  3UMM A;  4QNR A;  1MU5 A;  3GLG B;  3TE6 A;  2XZF A;  3A46 A;  3FTE A;  1IN6 A;  4LRT A;  3A98 B;  3ZC7 B;  3SMP A;  1NY5 A;  1Q3B A;  3GLF E;  1AIP C;  4G6Z A;  2LVO C;  2Z7J A;  2XF3 A;  3M0E A;  4FW9 A;  4MGK E;  4LGY A;  1N75 A;  4M0W A;  1NHG C;  3U6C A;  1PJT A;  5LMN M;  2C9C A;  4FWH A;  4G3O A;  4G4N A;  4LZJ A;  2N35 A;  3KOW E;  2BJV A;  3U60 A;  2JA2 A;  1IXR C;  3OTO M;  3GQ5 A;  4JI4 M;  3RGS A;  3UGJ A;  3HX3 A;  2YFQ A;  2XH9 A;  3FUV A;  5KPR A;  3GLF B;  3U6Q A;  2GNO A;  1XC8 A;  1SXJ B;  2KHH A;  3RGP A;  1TDZ A;  2V1U A;  2A5Y B;  4IBB A;  4GMQ A;  3KS8 A;  1NV8 A;  1JQJ C;  3T15 A;  1EIJ A;  1NHW C;  2L7I A;  5ITQ A;  3QWL A;  3SHF A;  2CE7 A;  7CAT A;  3GLG E;  1GLN A;  1MJG M;  2KXE A;  2JP7 A;  5BR8 M;  1ZV1 A;  3NWL A;  1ORY B;  3TWM A;  4IBK A;  1IFY A;  4DV0 M;  4FCV A;  4X64 M;  4OVZ B;  2UUB M;  3SC3 A;  1WHC A;  2KRK A;  4MGY E;  4IBI A;  5FTJ A;  1PJJ A;  3KFU G;  2CRU A;  2ZAM A;  1KYI A;  3CTW B;  1YSY A;  2KRU A;  4REZ A;  4R7G A;  5FTK A;  1F4I A;  1XWI A;  4W5W A;  2BWB A;  4L4U A;  4PT5 A;  3GPU A;  5KPZ A;  1C1K A;  1KSF X;  3HZJ A;  5DFL A;  3ZH9 B;  2D7H A;  3TPZ A;  3HJS A;  1GVN A;  4GRI A;  2MRO B;  2DWM A;  1Q3C A;  3PFI A;  3KOX E;  1QAQ A;  5JI2 E;  2R62 A;  3JR5 A;  1ZAE A;  2LBC A;  2B3T A;  1IBL M;  1GJS A;  3DZD A;  4CHT B;  3U61 B;  4PD2 A;  4Z6Y A;  4X62 M;  3NBX X;  4QNM A;  1DGH B;  2W82 A;  1VQ1 A;  2QQ8 A;  4NRW A;  2AHM A;  1OFH A;  1XXH E;  2F5Q A;  1PRB A;  3FUX A;  1IXS A;  3K92 A;  3ZCB B;  1HR0 M;  4P16 A;  4QOZ C;  2DKL A;  2EO2 A;  3SYK A;  1IXZ A;  1T3T A;  2HCB A;  3KS4 A;  5KQ8 A;  4X65 M;  2CP8 A;  2QNJ A;  1K3W A;  3HGI A;  3W0L B;  2OO9 A;  2FH0 A;  3CF2 A;  3FRH A;  4LJ9 A;  1YLA A;  2G8L A;  2NQ8 C;  4PDG A;  1C7Y A;  2JXN A;  2L7H A;  1WIV A;  2YR0 A;  4JI1 M;  4OVZ A;  1L2D A;  2DI0 A;  3PNV A;  2J5Y A;  4L15 A;  3IHP A;  2KW0 A;  1G59 A;  1QUS A;  2O25 A;  2H1R A;  3FYD A;  3LVV A;  4LFA M;  1IN8 A;  4CGY B;  3AL0 C;  4LJ5 A;  5ITY A;  2JY6 B;  4LJ6 A;  1VDL A;  1QQW A;  3AOG A;  2J7O A;  2QSF X;  5IZ7 D;  1N34 M;  2DZO B;  1OJL A;  3KSJ A;  3GLF A;  1D2N A;  4FWD A;  4G4R A;  5FTL A;  2ZTC A;  4S12 A;  1R5L A;  5ITU A;  3GLI A;  4DR7 M;  3U5Z A;  1N77 A;  3U5Z B;  2KNV A;  5C18 A;  2CHG A;  3VK7 A;  1R2Z A;  2D7G A;  2X4A A;  2DWN A;  3GQ4 A;  4B7H A;  5C1B A;  3LW5 F;  4GHL A;  2ZM6 M;  8CAT A;  1WXQ A;  3R8F A;  4NXN M;  3VLF B;  1Z5A A;  3SAW A;  1NV9 A;  1DGG A;  1VEG A;  2DHY A;  2X8A A;  2EKK A;  2L09 A;  3A45 A;  3I51 A;  4IBD A;  2Y0T A;  2QBY B;  2C98 A;  3B7Q A;  4DR4 M;  1V34 A;  2QP9 X;  4IBE A;  2EUC A;  1NO1 A;  3KDS E;  4RKU F;  1L2B A;  3BXW A;  2DVW B;  1W5S A;  2ERC A;  3HU3 A;  2DAM A;  3UJN A;  3L2A A;  2FOI C;  3U6D A;  5KPT A;  3M6A A;  5KO3 A;  5EP2 A;  2Y0Q A;  1SXJ E;  3UK6 A;  1QAN A;  1QUT A;  4F1I A;  3W67 A;  4YHH M;  1XB2 B;  1KFV A;  2CV1 A;  3R9X B;  3L25 A;  1S3S A;  3W68 A;  4LY6 A;  2QCU A;  2LVN C;  1QAO A;  3I01 M;  3GPX A;  1H6U A;  3LVW A;  2Z4S A;  2QHO B;  1VDD A;  5EP3 A;  1IY2 A;  3E46 A;  4GC5 A;  4CIZ A;  2K6B A;  1GAB A;  1OIZ A;  4JI8 M;  1XXH A;  5EP1 A;  3TWL A;  1HNX M;  2RGO A;  4TUW A;  1UM8 A;  4L6V 6;  3U61 A;  2C5R A;  1GJT A;  4AI6 A;  5IWA M;  3U60 B;  2L6O A;  1DGH A;  2XEP A;  1Z59 A;  3SAS A;  1TH4 A;  1PJI A;  1IQP A;  4JXJ A;  2Z3X A;  1DO0 A;  4L16 A;  3W0F A;  1GL6 A;  2KEB A;  2BNK A;  3QYB A;  3D8B A;  2RGH A;  4KLN A;  4A3V B;  1LTM A;  1N36 M;  4I81 A;  3GP1 A;  1BVS A;  4IJF A;  2EA0 A;  4FWG A; 
#chains in the Genus database with same CATH homology
 2R46 A;  3L26 A;  4JI5 M;  4L78 A;  3K8Z A;  3FD9 A;  2Q2E B;  3PXG A;  1HNZ M;  2UU9 M;  2LXE A;  5ITX A;  1NNJ A;  5FSW A;  3H4M A;  4GHA A;  5ITT A;  4RF1 A;  2C99 A;  3GO8 A;  5E26 A;  4M9X A;  2RKO A;  3HKP A;  3HU1 A;  4DR1 M;  4AG5 A;  1DGF A;  2I7P A;  4KO8 A;  4JI2 M;  4IBF A;  2R4E A;  4BBA A;  1TDH A;  3L27 A;  3J7B A;  3TWK A;  2FE8 A;  4YY3 M;  3UZU A;  2OPF A;  3CF6 E;  2DXI A;  1FJG M;  3K2L A;  2BJW A;  1XHB A;  4I4L A;  3J7A S;  2J7N A;  4LF7 M;  1NY6 A;  5GKN A;  4LJ4 A;  5FLX S;  3HU2 A;  3PVS A;  5FTN A;  3U6L A;  2QBY A;  3VKG A;  4BLC A;  3GPY A;  3J2P B;  4IBJ A;  4DUY M;  2M5Z A;  2QZ4 A;  4LF9 M;  4K0K M;  5IT9 S;  3EIH A;  5E6J A;  3AOE C;  1NSF A;  1G41 A;  3JR4 A;  1DGB A;  4FD2 A;  4R3D A;  2Z4R A;  3ILK A;  1TGU A;  4GIT A;  5JI3 E;  3U6O A;  4GKJ M;  4LF5 M;  2Y21 A;  4AKI A;  3JAM S;  1E94 E;  4OX9 M;  3L28 A;  3E4R A;  2HL7 A;  3BOS A;  4DV1 M;  4MGH A;  2ZAO A;  4FCW A;  1XNQ M;  4X66 M;  4B08 A;  3FTF A;  4FVM A;  1I4W A;  3AOE A;  1TH3 A;  4FCT A;  2F5O A;  2XZU A;  2KZS A;  4L8R C;  3IG5 A;  4IIW A;  4XBO A;  1R2Y A;  1N33 M;  4NL4 H;  3DOA A;  3QAU A;  3KW6 A;  1GL7 A;  4NRV A;  2QPA A;  4LJ8 A;  1L2C A;  1NNU C;  1PM5 A;  4GKK M;  2E5L M;  4MGI E;  4LJA A;  4DV4 M;  4GIP A;  1LV7 A;  1G3I A;  1FNN A;  3J80 S;  3J81 S;  4DR6 M;  3RFW A;  3T38 A;  5ITR A;  4NXM M;  3I4Y A;  3VKH A;  4M9S A;  4NSO B;  4AKG A;  4JV5 M;  4G4Q A;  5LMU M;  4JN6 A;  3MJ5 A;  3VK8 A;  5EQT A;  1IY0 A;  1TH2 A;  4AQY M;  3Q8X A;  2ZBK B;  4B3T M;  1Z5B A;  3C58 A;  2XLJ A;  1EE8 A;  1HT1 E;  3U6M A;  1I94 M;  1XMQ M;  2K47 A;  2UUA M;  4LF6 M;  1QYR A;  3HJ8 A;  3THG A;  1R6B X;  1QZM A;  3KP1 E;  2HKJ A;  4M9Z A;  3FTC A;  4JI7 M;  3SHG B;  3AKZ A;  4I8O A;  1IM2 A;  3A42 A;  1G4A E;  4IBC A;  1E32 A;  3KP0 E;  5BPV A;  3SBJ A;  2QEN A;  3KVW A;  4HLQ A;  3SAV A;  2UXB M;  2P5T A;  3KSX A;  4LGM A;  3IG8 A;  3GPP A;  4LJ7 A;  4ITQ A;  1IN7 A;  2V1C A;  4II7 A;  4LF4 M;  4RF0 A;  1DO2 A;  1JR3 A;  3T1Y M;  1J5E M;  3SAT A;  4D82 A;  4EIW A;  2CEA A;  2XSZ D;  3DA1 A;  1G8P A;  3SYL A;  4DR2 M;  4QOS A;  2X49 A;  1W5T A;  1HQC A;  3GLH B;  4PDI A;  2D7E A;  5F3W A;  3TL4 X;  3L29 A;  4B3S M;  3U6E A;  3FUU A;  2O5R A;  3GRU A;  4B7G A;  3GQ3 A;  1YE9 A;  2CHQ A;  5EXX A;  2R65 A;  2XGN A;  4MGZ E;  1L8Q A;  2LH0 A;  3HJQ A;  2UXC M;  2CV2 A;  3WHL A;  1YUB A;  4B3M M;  1XNR M;  3WHK A;  1IN5 A;  4QHS A;  3GLI B;  2V6Z M;  3FYC A;  5EJC A;  3I4V A;  1N32 M;  2VII A;  2KA6 B;  3HHW A;  4LCB A;  5IRE B;  4MM3 B;  1QVR A;  2R45 A;  5DNY A;  3VFD A;  4IBG A;  4AW4 A;  1J7K A;  1SXJ C;  3E9S A;  3AV0 A;  4OU7 A;  2UUC M;  4LRS A;  1NVM A;  4LZZ A;  4DV2 M;  4JI3 M;  4BB9 A;  4ZPX A;  2CV0 A;  4WW0 A;  2R4J A;  1J09 A;  4QHT A;  3GRV A;  1MX0 A;  2YNM D;  1QAM A;  1Z5C A;  2XFS A;  1NJF A;  3FUT A;  2M60 A;  1IBK M;  5DYI A;  2XFT A;  1JR3 D;  2VQE M;  3U6S A;  4LFC M;  2UXD M;  3GRY A;  4M0D A;  3GRR A;  4HL4 A;  1Q39 A;  4GH9 A;  3SMS A;  3NBI A;  3FKE A;  2DHR A;  3GLH A;  5EXP A;  3SAU A;  2KZU A;  4AZF A;  2CUZ A;  3U6P A;  4JI0 M;  1R7R A;  4KOD A;  2G5G X;  1IN4 A;  2I7N A;  3K1J A;  2VQF M;  5FTM A;  2HHH M;  3HWS A;  5EXS A;  5DYG A;  4Z8X A;  2LNH C;  3LQR A;  2FNA A;  4AKH A;  1X37 A;  2DWZ B;  4I5S A;  5KQD A;  1SXJ A;  3J27 B;  1ZQ9 A;  3EIE A;  2OQ4 A;  4DV6 M;  1IXS B;  5A2Q S;  1L1Z A;  2FFJ A;  4CIS A;  1NJG A;  1Z6T A;  3FTD A;  3FUW A;  3KOY E;  3AFH A;  3PNY A;  4PCZ A;  4IJE A;  2CFO A;  4LF8 M;  3HHX A;  3GLG A;  3T1H M;  4D80 A;  3SAR A;  3HHY A;  3CF0 A;  4RNA A;  4LFB M;  2F5S A;  4MB7 A;  1HT2 E;  4WUR A;  2ZAN A;  1K3X A;  1K82 A;  2C96 A;  4XGI A;  1N78 A;  2F4V M;  3LMM A;  3SFZ A;  4DV5 M;  3AJI B;  3DFZ A;  5ITX E;  4JI6 M;  4OW0 A;  1SXJ D;  2CHV A;  2XSZ A;  4DUZ M;  1L1T A;  2C9O A;  1E9S A;  3RE8 A;  5H37 D;  4GC9 A;  1E9R A;  4AG6 A;  4DR3 M;  2DWL A;  3M7G A;  3VDP A;  4KHP M;  3VDU A;  2LWX A;  1OFI A;  4NSR A;  2YQZ A;  4DR5 M;  4B3R M;  2R18 A;  1XXH B;  3D8L A;  4G4O A;  1HNW M;  2DZN B;  3KXE C;  3MHV C;  3HHZ A;  4MH0 E;  4B7F A;  1HQY E;  4D81 A;  4DV7 M;  4DV3 M;  3B9P A;  2F5N A;  2F5P A;  1GKI A;  3KOZ E;  2Y20 A;  4LG2 A;  4JYA M;  5EXT A;  3TQS A;  4NOO B;  1IY1 A;  3LQQ A;  5EP4 A;  3MK6 A;  1XMO M;  3UMM A;  4QNR A;  1MU5 A;  3GLG B;  3TE6 A;  2XZF A;  3A46 A;  3FTE A;  1IN6 A;  4LRT A;  3A98 B;  3ZC7 B;  3SMP A;  1NY5 A;  1Q3B A;  4G6Z A;  2Z7J A;  2XF3 A;  3M0E A;  4FW9 A;  4MGK E;  4LGY A;  1N75 A;  4M0W A;  1NHG C;  3U6C A;  5LMN M;  2C9C A;  4FWH A;  4G4N A;  4LZJ A;  3KOW E;  3U60 A;  2BJV A;  2JA2 A;  1IXR C;  3OTO M;  3GQ5 A;  4JI4 M;  3RGS A;  3UGJ A;  3U6Q A;  2YFQ A;  2XH9 A;  3FUV A;  5KPR A;  3GLF B;  1XC8 A;  1SXJ B;  3RGP A;  2V1U A;  1TDZ A;  2A5Y B;  4IBB A;  4GMQ A;  3KS8 A;  1JQJ C;  3T15 A;  1NHW C;  2L7I A;  5ITQ A;  3QWL A;  3SHF A;  2CE7 A;  7CAT A;  1GLN A;  2KXE A;  5BR8 M;  3NWL A;  1ORY B;  3TWM A;  4IBK A;  4DV0 M;  4FCV A;  4X64 M;  4OVZ B;  2UUB M;  3SC3 A;  2KRK A;  4MGY E;  4IBI A;  5FTJ A;  1PJJ A;  3KFU G;  2ZAM A;  1KYI A;  3CTW B;  1YSY A;  2KRU A;  4REZ A;  4R7G A;  5FTK A;  1XWI A;  4W5W A;  4L4U A;  4PT5 A;  3GPU A;  5KPZ A;  1C1K A;  1KSF X;  3ZH9 B;  2D7H A;  3TPZ A;  3HJS A;  1GVN A;  4GRI A;  2DWM A;  1Q3C A;  3PFI A;  3KOX E;  1QAQ A;  5JI2 E;  2R62 A;  3JR5 A;  1ZAE A;  1IBL M;  3DZD A;  4CHT B;  3U61 B;  4PD2 A;  4Z6Y A;  4X62 M;  4QNM A;  1DGH B;  2W82 A;  4NRW A;  2AHM A;  1OFH A;  2F5Q A;  3FUX A;  3K92 A;  3ZCB B;  1HR0 M;  4P16 A;  4QOZ C;  2EO2 A;  3SYK A;  1IXZ A;  1T3T A;  2HCB A;  3KS4 A;  5KQ8 A;  4X65 M;  1K3W A;  3HGI A;  3W0L B;  3CF2 A;  4LJ9 A;  2G8L A;  4PDG A;  2NQ8 C;  2L7H A;  2YR0 A;  4JI1 M;  4OVZ A;  1L2D A;  3PNV A;  4L15 A;  2KW0 A;  1G59 A;  3FYD A;  4LFA M;  2H1R A;  3LVV A;  1IN8 A;  4CGY B;  3AL0 C;  4LJ5 A;  5ITY A;  4LJ6 A;  1QQW A;  3AOG A;  2J7O A;  5IZ7 D;  1N34 M;  2DZO B;  1OJL A;  3KSJ A;  3GLF A;  1D2N A;  4FWD A;  4G4R A;  5FTL A;  5ITU A;  4S12 A;  3GLI A;  4DR7 M;  3U5Z A;  1N77 A;  3U5Z B;  5C18 A;  2CHG A;  3VK7 A;  1R2Z A;  2D7G A;  2X4A A;  2DWN A;  3GQ4 A;  4B7H A;  5C1B A;  4GHL A;  2ZM6 M;  8CAT A;  1WXQ A;  3R8F A;  4NXN M;  3VLF B;  1Z5A A;  3SAW A;  2X8A A;  1DGG A;  3I51 A;  2L09 A;  3A45 A;  4IBD A;  2Y0T A;  2QBY B;  2C98 A;  4DR4 M;  2QP9 X;  4IBE A;  2EUC A;  3KDS E;  1L2B A;  2DVW B;  1W5S A;  2ERC A;  3HU3 A;  3UJN A;  3L2A A;  2FOI C;  3U6D A;  5KPT A;  3M6A A;  5KO3 A;  5EP2 A;  2Y0Q A;  1SXJ E;  3UK6 A;  1QAN A;  4YHH M;  1IBM M;  2CV1 A;  3L25 A;  1KFV A;  3R9X B;  1S3S A;  4LY6 A;  2QCU A;  1QAO A;  3GPX A;  1H6U A;  3LVW A;  2Z4S A;  1VDD A;  5EP3 A;  1IY2 A;  4GC5 A;  4JI8 M;  1XXH A;  5EP1 A;  3TWL A;  1HNX M;  2RGO A;  4TUW A;  1UM8 A;  3U61 A;  2C5R A;  4AI6 A;  5IWA M;  3U60 B;  2L6O A;  1DGH A;  2XEP A;  1Z59 A;  3SAS A;  1TH4 A;  1PJI A;  1IQP A;  4JXJ A;  2Z3X A;  1DO0 A;  4L16 A;  3W0F A;  1GL6 A;  2KEB A;  2BNK A;  4KLN A;  3D8B A;  2RGH A;  4A3V B;  1N36 M;  4I81 A;  3GP1 A;  4IJF A;  2EA0 A;  4FWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...