4DR6M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr6M02
2E5LM 4LFCM 4NXMM 3SBJA 2UXBM 5ITTA 1IBLM 4LF7M 1XNRM 3JAMS 2UU9M 5IT9S 2UXCM 4NRWA 4DV7M 4JV5M 3U6PA 1K82A 1MX0A 4DR7M 1Q3CA 1XMOM 4NXNM 5ITXE 3U6DA 4ITQA 3GQ5A 2UUCM 3GO8A 3JR4A 4B3SM 3A42A 5ITUA 1L1TA 1L2DA 2HKJA 1FJGM 4DV5M 2XZFA 4X62M 3U6OA 3TWLA 2UUAM 4KHPM 5ITRA 3J7AS 3SARA 3VK8A 4DR4M 1Z5CA 1IBMM 2ZBKB 1N36M 4B3RM 5LMNM 3U6SA 4G4NA 3J81S 4CISA 1I94M 4PCZA 2XZUA 4GKKM 3SAVA 1KFVA 4DV0M 5ITXA 4LF4M 4JYAM 4JI4M 5BR8M 2F5OA 2F5QA 3C58A 1N34M 1EE8A 1N32M 3DOAA 4LFAM 4B3TM 4DR2M 4LF9M 4YHHM 4JI6M 1PJJA 4DR3M 3U6MA 4DV6M 3GPYA 3GQ3A 1R2ZA 4LF8M 2UUBM 4G4RA 1HNZM 4G4OA 3TWKA 4DV4M 3SAWA 4OX9M 4X66M 1PJIA 3GP1A 3U6EA 4JI7M 4DV2M 3VK7A 1K3WA 2HHHM 1XNQM 3GQ4A 1MU5A 3A45A 2F5PA 1TDZA 3GPPA 4YY3M 1HR0M 4LFBM 1Z5BA 3OTOM 4JI3M 4X64M 2EA0A 3W0FA 4PD2A 3U6LA 4JI8M 1Z59A 5FLXS 3GPUA 2OPFA 5A2QS 5ITYA 3TWMA 1PM5A 4MB7A 4PDGA 3SASA 3A46A 4X65M 4DUZM 1HNXM 1R2YA 4GKJM 5IWAM 3GPXA 2F5SA 5ITQA 4DV3M 4JI0M 5LMUM 4DV1M 2F5NA 1Q39A 2Q2EB 4B3MM 4DUYM 3U6CA 3JR5A 4AQYM 2ZM6M 1IBKM 1J5EM 1L2BA 1L1ZA 4JI2M 2OQ4A 1Z5AA 1TDHA 4PDIA 2VQFM 4LF5M 2VQEM 3U6QA 1N33M 3T1HM 1XMQM 4DR1M 4JI1M 1XC8A 4LF6M 3SATA 1L2CA 3T1YM 1NNJA 1Q3BA 4G4QA 4NRVA 4DR6M 3J80S 2F4VM 2UXDM 4JI5M 3SAUA 4DR5M 1HNWM 4K0KM 1K3XA
chains in the Genus database with same CATH superfamily
3E46A 4NXMM 1J7KA 3GLHA 2V1CA 5ITTA 1IBLM 2QBYA 1G8PA 1PRBA 1QUSA 2KW0A 4GHAA 1GVNA 2CHGA 3E9SA 2LNHC 4B08A 5IT9S 2JUJA 3A98B 3IG5A 3GRUA 5FTNA 2FFJA 3K9PA 4NC6A 3WHKA 2O01F 3CGWA 2JNHA 3VDUA 5C1BA 2DWMA 1GKIA 5ITXE 4XGIA 2EUCA 3NWLA 1L1TA 1DGGA 1YE9A 2DNAA 4GHLA 1C1KA 1YLAA 3RGSA 4DV5M 3HU1A 3TWLA 2QHOB 3SMSA 2UUAM 2JZ1A 5DYIA 1OFIA 3VK8A 3HGIA 1IBMM 3SARA 1N36M 1N77A 3KOYE 2DHYA 3CTWB 4G4NA 4PCZA 3B9PA 2LH0A 3B7ZA 3ZCBB 4AW4A 1ZMWA 2JZ0A 1AUAA 4LF4M 3Q8GA 3LMMA 2Y0TA 1G3IA 1NJFA 2AHMA 1N34M 1EE8A 1QUTA 1Q02A 3DOAA 2QPAA 1WIVA 1V34A 4DR2M 4LF9M 2R4EA 3PNVA 3GPYA 3GQ3A 1V92A 3LVWA 3B89A 3LVVA 1Z6TA 5IZ7D 1QDTA 2ZANA 3GLFA 7CATA 2VF8A 1XXHE 4Q7JA 3TWKA 2DAEA 1OIZA 3FUUA 1ZQ9A 4FWHA 3GP1A 1Y8GA 4JI7M 4DV2M 1ORYB 2L09A 3HU3A 4XBOA 2L4FA 1HT2E 3M6AA 4B7HA 3GQ4A 4IBDA 4EIWA 2WZJA 2CV0A 8CATA 4OVZB 4GC5A 2R45A 2KNVA 2XSZD 3CF6E 3GRYA 4JI3M 4LJ6A 3W0FA 1EIJA 5FLXS 1IFYA 2LVNC 1S3SA 4I8OA 1E94E 3KVWA 2L4EA 2HCBA 1QVRA 5EXTA 4MB7A 2RRUA 4AG5A 5GKNA 3VDPA 3KS8A 3A46A 4B7GA 2QNJA 2KZSA 4A3VB 4X65M 1DGBA 1R4GA 2GNOA 2GQFA 3HY5A 1TR8A 4LGMA 5DFLA 4GKJM 4D81A 2KDLA 4OU7A 5EXPA 4AKHA 3FD9A 1XXHB 3C3EA 5LMUM 2F5NA 3KOXE 2QCUA 5FSWA 4CHTB 1T43A 3FUXA 1ZAEA 3H4MA 4M9ZA 1WGNA 3R8FA 4GC9A 3HJQA 4JI2M 1OKSA 3L28A 1Z5AA 4IBGA 1F4IA 1MN3A 1TDHA 2D7HA 2P5TA 2X8AA 1OTRA 5JI3E 4F1IA 3TPZA 2C9OA 4GMQA 3FRHA 4QHSA 1HQYE 2JXNA 4LRSA 5JI2E 1L2CA 1VG5A 4HLQA 4AZFA 4NSOB 4BBAA 3HZJA 3M0EA 4IJFA 3JR4A 1D0MA 2F4VM 2BNKA 3SAUA 3UJNA 4GEWA 4LJ8A 3L26A 1IQPA 4K0KM 3B7NA 3VKHA 4LFCM 3SBJA 1ZMVA 4LJ4A 4LF7M 5H37D 2V6ZM 1W5TA 4L4UA 4RF1A 1XB2B 4MGYE 3JAMS 2HL7A 5C18A 2NQ8C 1VDLA 2X4AA 3TQSA 3SYKA 2DZLA 2I7PA 2XF3A 4DV7M 4JV5M 3U6PA 4HEOA 1MX0A 2QP9X 2R65A 5KO3A 3TE6A 1Q3CA 1V33A 4XK8F 3J7BA 4NXNM 4P17A 4WURA 1IXSB 1PJQA 1TF0B 3HJSA 2V1UA 1DV0A 4LJAA 2DWNA 4LG2A 4I4LA 1FJGM 2DZOB 2VDBB 1N75A 2Y0QA 3E4RA 2Z3XA 2ERCA 3L29A 5ITRA 1IY2A 1G4AE 2JY7A 5LMNM 4W5WA 2KXEA 2CEAA 3U6SA 2CWBA 1I94M 3T15A 1ZMUA 1VEJA 2BJVA 1DO2A 3SFZA 2KZUA 3NBXX 4RKUF 3SAVA 1KFVA 1PGYA 2YR0A 4JI4M 4P16A 5BR8M 4I5SA 2A5YB 2F5QA 2L2DA 1N32M 2CHVA 3FTFA 3LQRA 4IBKA 3GLGB 4B3TM 2VIIA 2J7NA 1J09A 2XLJA 4NSRA 4DR3M 3U6MA 1NNUC 2FS1A 4DV6M 3WHLA 1SXJE 4D82A 2CV2A 2L6OA 1DGHB 1KSFX 2EKFA 2DAIA 1TGUA 3D8LA 1YSYA 4FW9A 1PJIA 3KOWE 1NY6A 3GLIE 3U6EA 2QBYB 3Q8XA 3VK7A 1GABA 3GRVA 2HHHM 3UGJA 4WP2A 2C96A 3RFWA 3L27A 3A45A 4KT0F 1QAOA 2MH8A 2ZTCA 2R18A 1TDZA 2Y21A 1QZEA 4YY3M 1HR0M 4B3SM 2R62A 3U60A 3W0LB 2FE8A 2EA0A 4PD2A 1Z59A 1TTEA 3I4VA 2L7IA 1OFHA 3W68A 2MGWA 4REZA 3GPUA 2OPFA 3ZH9B 2LVPC 5ITYA 1OQYA 3ZQJA 3TWMA 3FYCA 1EFUB 4JN6A 1HJPA 3U61B 1OAOC 3SMPA 3I01M 2KA6B 3IHPA 3PXGA 4DUZM 1JR3D 1HNXM 2Z4RA 3SYLA 3QWLA 1R2YA 4MH0E 2LHGA 4KLNA 1HQCA 5L8RF 1G71A 1D0LA 1SXJB 3HX3A 5ITQA 2KNAA 5BPVA 4JI0M 1HT1E 1SXJD 1WJ7A 3ZC7B 4DV1M 4B3MM 2JY6B 4DUYM 4NL4H 3PVSA 3SHFA 3GLIB 4AQYM 3J2PB 3VFDA 1JB0F 1NHWC 1IN6A 1L2BA 1QAQA 3GLHE 3DFZA 1QDRA 2OQ4A 5FTJA 3KSXA 5IREB 4AI6A 3ILKA 2LXEA 4MGIE 4PDIA 2G5GX 2VQFM 4Y28F 5KPRA 2VQEM 2K6BA 2WSEF 2K9DA 2J7OA 3W67A 3U6QA 3F92A 1XMQM 2R4JA 4DR1M 2G8LA 4JI1M 4LF6M 5KPTA 3SATA 4G4QA 2H1RA 3HHYA 4DR6M 4CIZA 1JQJC 2CRUA 4JI5M 4GH9A 3L25A 1HNWM 1NY5A 1K3XA 1NHGC 1OAIA 2D7EA 3FTDA 2Z8YM 1NVMA 3VLFB 3FE3A 1XNRM 1VEGA 2XGNA 4GIPA 2JWSA 1P3QQ 4R7GA 2UU9M 4R3DA 1WGLA 2XFSA 4M0DA 3C3DA 1UFZA 2KHHA 1E32A 1K82A 3U5ZB 3K1JA 4KO8A 1XMOM 1GO5A 3K8ZA 4IJEA 2X49A 3U6DA 3T6PA 2LVQD 4M0WA 2FOIC 3HKPA 3A42A 3KOZE 3GLHB 3RE8A 2R0IA 2ZAMA 2HKJA 2XEPA 3J27B 4FD2A 5ITUA 1L2DA 3CF0A 3UZUA 3LCUA 2KEBA 4UN2B 3BBZA 4X62M 1PJTA 2XZFA 1E9SA 2C99A 4FWGA 3MJ5A 2OOAA 4ZPXA 3UMMA 2ZBKB 4B3RM 1DGFA 3J81S 4CISA 2BWEA 4QOSA 1X37A 3AOEC 3U61A 3GLFE 3T38A 3B74A 2HAKA 4IBIA 2XZUA 3SHGB 4GKKM 3GLGE 5ITXA 5KPZA 2R44A 4IBBA 1AIPC 2R46A 3AOEA 4L78A 2F5OA 3C58A 1NV8A 2LBCA 4LRTA 5DNYA 4LFAM 2APLA 1VDDA 3KXEC 5FTKA 4LZZA 3PFIA 4YHHM 1GJSA 1WHCA 5FTMA 1DO0A 1LTMA 4FWDA 4FCWA 4OVZA 1G59A 1IN4A 1R2ZA 3I4YA 3B7QA 1ZV1A 1IY0A 3IECA 3LQQA 4G4RA 4DV4M 1IM2A 3SAWA 4OX9M 3FTEA 4X66M 3AKZA 2J5YA 2JY8A 1C7YA 1LV7A 2DAKA 3FUVA 5EP1A 4JXJA 2WSFF 1XNQM 1OIPA 3DA1A 4NOOB 2BWBA 4QOZC 1YUBA 3FUTA 3HHXA 2CE7A 4QNRA 4IBCA 3GLFB 3BOSA 4HL4A 4Z8XA 1A5TA 3KP1E 3U6LA 4FVMA 4JI8M 1JR3E 4G6ZA 4LCBA 4M9XA 1XXHA 3IG8A 3M7GA 2K0BX 4MM3B 4MGZE 5EJCA 1PM5A 3KS4A 1SG9A 4PDGA 3SASA 3HHZA 3U5ZA 4LJ5A 3KSJA 3L2AA 2DWZB 5E26A 5KQ8A 4BB9A 2ZAOA 1R5LA 3GPXA 3C9PA 3HWSA 1T3TA 3QYBA 4G3OA 2C9CA 5DYGA 2YNMD 3DZDA 2RGOA 2Q2EB 1NJGA 1QQWA 3PNYA 3U6CA 2ZM6M 2MJ5B 1J5EM 2L7HA 2C5RA 1I4WA 2DAGA 1WXQA 2JY5A 1GLNA 3THGA 4IBEA 4FCTA 1N33M 4AG6A 2DI0A 1T6OA 4D80A 1RU3A 4IIWA 2K47A 1XC8A 1D2NA 4KODA 4QNMA 1XHBA 1Q3BA 2JP7A 4WW0A 4OW0A 4GRIA 4NRVA 1TH3A 4IBFA 4S12A 2DVWB 4I81A 3RGPA 1H6UA 4DR5M 1GL7A 3LW5F 5EP2A 1IXSA 4L15A 2E5LM 2DWLA 2UXBM 2JA2A 3TL4X 2LVOC 3HJ8A 1R7RA 2HWJA 3FUWA 4RF0A 2UXCM 5E6JA 4NRWA 2QENA 3FKEA 1GJTA 3K92A 3MK6A 1IXRC 4L8RC 4TUWA 1N78A 4DR7M 2FH0A 3EIEA 4BLCA 5EP4A 2XH9A 3GQ5A 1OJLA 2UUCM 4ITQA 5FTLA 3GO8A 4AKIA 3MHVC 2CFOA 1GL6A 4LZJA 1IN7A 2CV1A 3AJIB 3U6OA 2QQ8A 1L8QA 3GLGA 4KHPM 3J7AS 4DR4M 4RNAA 1Z5CA 3EIHA 3GRRA 2KRKA 1QYRA 5F3WA 3FYDA 1IY1A 1VQ1A 2EJSA 1IXZA 2CHQA 2QZ4A 2DXIA 2EKKA 4DV0M 1DGHA 4JYAM 3KP0E 5EQTA 4QHTA 2MROB 2M60A 2R6FA 1TH4A 2KNZA 1D0KA 2QSFX 4L6V6 3SC3A 2RKOA 2RGHA 4LJ7A 3K9OA 2DHRA 1PJSA 4JI6M 1PJJA 3KDSE 2OOBA 2CP8A 3D8BA 1G41A 4LJ9A 4PT5A 4LF8M 2N35A 2UUBM 4ANRA 1NO1A 1WR1B 1HNZM 4G4OA 3QAUA 1XWIA 3HHWA 3H4JA 2M5ZA 4R71A 2BJWA 2MR9A 3AV0A 4GITA 2DZNB 4F2LA 1UM8A 1K3WA 4AKGA 1JR3A 4II7A 1MU5A 2G3QA 1SXJC 2YQZA 4MGKE 2DENA 2F5PA 1QAMA 2Z4SA 3V76A 3GPPA 4LFBM 2EO2A 1SXJA 1Z5BA 3OTOM 2I7NA 4X64M 3R9XB 1IN5A 2DKLA 2O5RA 2KRUA 3KFUG 3I04M 4CJ6A 3BXWA 1R6BX 4Z6YA 3AL0C 2O25A 5A2QS 2XFTA 2LHCA 2XSZA 3GLIA 3NBIA 4MGHA 1MJGM 5EP3A 3HU2A 5KQDA 3FTCA 1FNNA 3I51A 4B7FA 4L16A 3VKGA 3LCVB 5IWAM 2F5SA 2LTUA 3U60B 2DAMA 2CUZA 2B3TA 4IBJA 2H5XA 5EXSA 4DV3M 4LY6A 1W5SA 2W82A 3K2LA 1IN8A 4M9SA 2Y20A 1CUKA 3CF2A 1Q39A 3MMPA 2ZTDA 3JR5A 1IBKM 1QANA 1KYIA 3E21A 1L1ZA 1VEKA 3KW6A 2OO9A 4FCVA 2WSCF 4LF5M 2FNAA 4LGYA 1BVSA 1E9RA 3T1HM 1TH2A 1NV9A 2C98A 5EXXA 3T1YM 2LWXA 1NNJA 3AFHA 1QZMA 3UK6A 4CGYB 3QYEA 2YFQA 2LVAA 3J80S 4DBGB 2UXDM 2D7GA 3FRIA 1NSFA 2VF7A 2Z7JA 3AOGA
chains in the Genus database with same CATH topology
4NXMM 1J7KA 3GLHA 2V1CA 5ITTA 1IBLM 2QBYA 1G8PA 2KW0A 4GHAA 1GVNA 2CHGA 3E9SA 2LNHC 4B08A 5IT9S 3A98B 3IG5A 3GRUA 5FTNA 2FFJA 3WHKA 3VDUA 5C1BA 2DWMA 1GKIA 5ITXE 4XGIA 2EUCA 3NWLA 1L1TA 1DGGA 1YE9A 1C1KA 4DV5M 3RGSA 3HU1A 3TWLA 3SMSA 2UUAM 5DYIA 1OFIA 3VK8A 3HGIA 1IBMM 3SARA 1N36M 1N77A 3KOYE 4G4NA 3CTWB 4PCZA 3B9PA 2LH0A 3ZCBB 4AW4A 4LF4M 3LMMA 2Y0TA 1G3IA 1NJFA 2AHMA 1N34M 1EE8A 3DOAA 2QPAA 4DR2M 4LF9M 2R4EA 3PNVA 3GPYA 3GQ3A 3LVWA 3LVVA 1Z6TA 5IZ7D 2ZANA 3GLFA 7CATA 3TWKA 3FUUA 1ZQ9A 4FWHA 3GP1A 4JI7M 4DV2M 1ORYB 2L09A 3HU3A 4XBOA 3GQ4A 1HT2E 3M6AA 4B7HA 4IBDA 4EIWA 2CV0A 8CATA 4OVZB 4GC5A 2R45A 2XSZD 3CF6E 3GRYA 4JI3M 4LJ6A 3W0FA 5FLXS 4I8OA 1S3SA 1E94E 3KVWA 2HCBA 1QVRA 5EXTA 4MB7A 4AG5A 5GKNA 3VDPA 3KS8A 3A46A 4B7GA 2KZSA 4A3VB 4X65M 1DGBA 4LGMA 4GKJM 4D81A 4OU7A 5EXPA 4AKHA 3FD9A 1XXHB 5LMUM 2F5NA 3KOXE 2QCUA 5FSWA 4CHTB 3FUXA 1ZAEA 3H4MA 4M9ZA 3R8FA 4GC9A 3HJQA 4JI2M 3L28A 1Z5AA 4IBGA 1TDHA 2D7HA 2P5TA 2X8AA 5JI3E 3TPZA 2C9OA 4GMQA 4QHSA 1HQYE 4LRSA 5JI2E 1L2CA 4HLQA 4AZFA 4NSOB 4BBAA 4IJFA 3M0EA 3JR4A 2F4VM 2BNKA 3SAUA 3UJNA 4LJ8A 3L26A 1IQPA 4K0KM 3VKHA 4LFCM 3SBJA 4LJ4A 4LF7M 5H37D 2V6ZM 1W5TA 4L4UA 4RF1A 4MGYE 3JAMS 2HL7A 5C18A 2NQ8C 2X4AA 3TQSA 3SYKA 2I7PA 4DV7M 2XF3A 4JV5M 3U6PA 1MX0A 2QP9X 2R65A 5KO3A 3TE6A 1Q3CA 3J7BA 4NXNM 4WURA 1IXSB 3HJSA 2V1UA 4LJAA 2DWNA 4LG2A 4I4LA 1FJGM 2DZOB 1N75A 2Y0QA 3E4RA 2Z3XA 2ERCA 3L29A 5ITRA 1IY2A 1G4AE 5LMNM 4W5WA 2KXEA 2CEAA 3U6SA 1I94M 3T15A 2BJVA 1DO2A 3SFZA 2KZUA 3SAVA 1KFVA 2YR0A 4JI4M 4P16A 5BR8M 4I5SA 2A5YB 2F5QA 1N32M 2CHVA 3FTFA 3LQRA 4IBKA 3GLGB 4B3TM 2VIIA 2J7NA 1J09A 2XLJA 4NSRA 4DR3M 3U6MA 1NNUC 4DV6M 3WHLA 1SXJE 4D82A 2CV2A 2L6OA 1DGHB 1KSFX 1TGUA 3D8LA 1YSYA 4FW9A 1PJIA 3KOWE 1NY6A 3U6EA 3Q8XA 3VK7A 3GRVA 2HHHM 3UGJA 2C96A 3RFWA 3L27A 3A45A 1QAOA 2R18A 1TDZA 2Y21A 4YY3M 1HR0M 4B3SM 2R62A 3U60A 3W0LB 2FE8A 2EA0A 4PD2A 1Z59A 3I4VA 2L7IA 1OFHA 3GPUA 2OPFA 4REZA 3ZH9B 5ITYA 3TWMA 3FYCA 4JN6A 3U61B 3SMPA 2KA6B 3PXGA 4DUZM 1JR3D 1HNXM 2Z4RA 3SYLA 3QWLA 1R2YA 4MH0E 4KLNA 1HQCA 5ITQA 1SXJB 5BPVA 4JI0M 1HT1E 1SXJD 3ZC7B 4DV1M 4B3MM 4DUYM 4NL4H 3PVSA 3SHFA 3GLIB 4AQYM 3J2PB 3VFDA 1NHWC 1IN6A 1L2BA 1QAQA 3DFZA 2OQ4A 4AI6A 5FTJA 3KSXA 5IREB 3ILKA 2LXEA 4MGIE 4PDIA 2G5GX 2VQFM 5KPRA 2VQEM 2J7OA 3U6QA 1XMQM 2R4JA 4DR1M 2G8LA 4JI1M 4LF6M 5KPTA 3SATA 4G4QA 2H1RA 3HHYA 4DR6M 1JQJC 4JI5M 4GH9A 3L25A 1HNWM 1NY5A 1K3XA 1NHGC 2D7EA 3FTDA 1NVMA 3VLFB 1XNRM 2XGNA 4GIPA 4R7GA 2UU9M 4R3DA 2XFSA 4M0DA 1E32A 1K82A 3U5ZB 3K1JA 4KO8A 1XMOM 3K8ZA 4IJEA 2X49A 3U6DA 4M0WA 2FOIC 3HKPA 3A42A 3KOZE 3GLHB 3RE8A 2ZAMA 5ITUA 2HKJA 2XEPA 3J27B 4FD2A 1L2DA 2QBYB 3CF0A 3UZUA 4X62M 2KEBA 2XZFA 1E9SA 2C99A 4FWGA 3MJ5A 4ZPXA 3UMMA 2ZBKB 4B3RM 1DGFA 3J81S 4CISA 4QOSA 1X37A 3AOEC 3U61A 3T38A 4IBIA 2XZUA 3SHGB 4GKKM 5ITXA 5KPZA 4IBBA 2R46A 3AOEA 4L78A 2F5OA 3C58A 4LRTA 5DNYA 4LFAM 1VDDA 3KXEC 5FTKA 4LZZA 3PFIA 4YHHM 5FTMA 1DO0A 4FWDA 4FCWA 4OVZA 1G59A 1IN4A 1R2ZA 3I4YA 1IY0A 3LQQA 4G4RA 4DV4M 1IM2A 3SAWA 4OX9M 3FTEA 4X66M 3AKZA 1LV7A 3FUVA 5EP1A 4JXJA 1XNQM 3DA1A 4NOOB 4QOZC 1YUBA 3FUTA 3HHXA 2CE7A 4QNRA 4IBCA 3GLFB 3BOSA 4HL4A 4Z8XA 3U6LA 3KP1E 4FVMA 4JI8M 4G6ZA 4LCBA 4M9XA 1XXHA 3IG8A 3M7GA 4MM3B 4MGZE 5EJCA 1PM5A 3KS4A 4PDGA 3SASA 3HHZA 3U5ZA 4LJ5A 3KSJA 3L2AA 2DWZB 5E26A 5KQ8A 4BB9A 2ZAOA 3GPXA 3HWSA 1T3TA 2C9CA 5DYGA 2YNMD 3DZDA 2RGOA 2Q2EB 1NJGA 1QQWA 3PNYA 3U6CA 2ZM6M 1J5EM 2L7HA 2C5RA 1I4WA 1WXQA 3THGA 1GLNA 4IBEA 4FCTA 1N33M 4AG6A 4D80A 4IIWA 2K47A 1XC8A 1D2NA 4KODA 4QNMA 1XHBA 1Q3BA 4WW0A 4OW0A 4GRIA 4NRVA 1TH3A 4IBFA 4S12A 2DVWB 4I81A 3RGPA 1H6UA 4DR5M 1GL7A 5EP2A 4L15A 2E5LM 2DWLA 2UXBM 2JA2A 3TL4X 3HJ8A 1R7RA 3FUWA 4RF0A 2UXCM 5E6JA 4NRWA 2QENA 3FKEA 3K92A 3MK6A 1IXRC 4L8RC 4TUWA 1N78A 4DR7M 3EIEA 4BLCA 5EP4A 2XH9A 3GQ5A 1OJLA 2UUCM 4ITQA 5FTLA 3GO8A 4AKIA 3MHVC 2CFOA 1GL6A 4LZJA 1IN7A 2CV1A 3AJIB 3U6OA 1L8QA 3GLGA 4KHPM 3J7AS 4DR4M 4RNAA 1Z5CA 3EIHA 3GRRA 2KRKA 1QYRA 5F3WA 3FYDA 1IY1A 1IXZA 2CHQA 2QZ4A 2DXIA 4DV0M 1DGHA 4JYAM 3KP0E 5EQTA 4QHTA 2M60A 1TH4A 3SC3A 2RKOA 2RGHA 4LJ7A 2DHRA 4JI6M 1PJJA 3KDSE 3D8BA 1G41A 4LJ9A 4PT5A 4LF8M 2UUBM 1HNZM 4G4OA 3QAUA 1XWIA 3HHWA 2M5ZA 2BJWA 3AV0A 4GITA 2DZNB 1UM8A 1K3WA 4AKGA 1JR3A 4II7A 1MU5A 1SXJC 2YQZA 4MGKE 2F5PA 1QAMA 2Z4SA 3GPPA 4LFBM 2EO2A 1SXJA 1Z5BA 3OTOM 2I7NA 4X64M 3R9XB 1IN5A 3KFUG 2O5RA 2KRUA 3AL0C 1R6BX 4Z6YA 5A2QS 2XFTA 2XSZA 3GLIA 3NBIA 4MGHA 5EP3A 3HU2A 5KQDA 3FTCA 1FNNA 3I51A 4B7FA 4L16A 3VKGA 5IWAM 2F5SA 3U60B 2CUZA 4IBJA 5EXSA 4DV3M 4LY6A 1W5SA 2W82A 3K2LA 1IN8A 4M9SA 2Y20A 3CF2A 1Q39A 3JR5A 1IBKM 1QANA 1KYIA 1L1ZA 3KW6A 4FCVA 4LF5M 2FNAA 4LGYA 1E9RA 3T1HM 1TH2A 2C98A 5EXXA 3T1YM 2LWXA 1NNJA 3AFHA 1QZMA 3UK6A 4CGYB 2YFQA 3J80S 2UXDM 2D7GA 4GHLA 1NSFA 2Z7JA 3AOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L M;  4LFC M;  4NXM M;  3SBJ A;  2UXB M;  5ITT A;  1IBL M;  4LF7 M;  1XNR M;  3JAM S;  2UU9 M;  5IT9 S;  2UXC M;  4NRW A;  4DV7 M;  4JV5 M;  3U6P A;  1K82 A;  1MX0 A;  4DR7 M;  1Q3C A;  1XMO M;  4NXN M;  5ITX E;  3U6D A;  4ITQ A;  3GQ5 A;  2UUC M;  3GO8 A;  3JR4 A;  4B3S M;  3A42 A;  5ITU A;  1L1T A;  1L2D A;  2HKJ A;  1FJG M;  4DV5 M;  2XZF A;  4X62 M;  3U6O A;  3TWL A;  2UUA M;  4KHP M;  5ITR A;  3J7A S;  3SAR A;  3VK8 A;  4DR4 M;  1Z5C A;  1IBM M;  2ZBK B;  1N36 M;  4B3R M;  5LMN M;  3U6S A;  4G4N A;  3J81 S;  4CIS A;  1I94 M;  4PCZ A;  2XZU A;  4GKK M;  3SAV A;  1KFV A;  4DV0 M;  5ITX A;  4LF4 M;  4JYA M;  4JI4 M;  5BR8 M;  2F5O A;  2F5Q A;  3C58 A;  1N34 M;  1EE8 A;  1N32 M;  3DOA A;  4LFA M;  4B3T M;  4DR2 M;  4LF9 M;  4YHH M;  4JI6 M;  1PJJ A;  4DR3 M;  3U6M A;  4DV6 M;  3GPY A;  3GQ3 A;  1R2Z A;  4LF8 M;  2UUB M;  4G4R A;  1HNZ M;  4G4O A;  3TWK A;  4DV4 M;  3SAW A;  4OX9 M;  4X66 M;  1PJI A;  3GP1 A;  3U6E A;  4JI7 M;  4DV2 M;  3VK7 A;  1K3W A;  2HHH M;  1XNQ M;  3GQ4 A;  1MU5 A;  3A45 A;  2F5P A;  1TDZ A;  3GPP A;  4YY3 M;  1HR0 M;  4LFB M;  1Z5B A;  3OTO M;  4JI3 M;  4X64 M;  2EA0 A;  3W0F A;  4PD2 A;  3U6L A;  4JI8 M;  1Z59 A;  5FLX S;  3GPU A;  2OPF A;  5A2Q S;  5ITY A;  3TWM A;  1PM5 A;  4MB7 A;  4PDG A;  3SAS A;  3A46 A;  4X65 M;  4DUZ M;  1HNX M;  1R2Y A;  4GKJ M;  5IWA M;  3GPX A;  2F5S A;  5ITQ A;  4DV3 M;  4JI0 M;  5LMU M;  4DV1 M;  2F5N A;  1Q39 A;  2Q2E B;  4B3M M;  4DUY M;  3U6C A;  3JR5 A;  4AQY M;  2ZM6 M;  1IBK M;  1J5E M;  1L2B A;  1L1Z A;  4JI2 M;  2OQ4 A;  1Z5A A;  1TDH A;  4PDI A;  2VQF M;  4LF5 M;  2VQE M;  3U6Q A;  1N33 M;  3T1H M;  1XMQ M;  4DR1 M;  4JI1 M;  1XC8 A;  4LF6 M;  3SAT A;  1L2C A;  3T1Y M;  1NNJ A;  1Q3B A;  4G4Q A;  4NRV A;  4DR6 M;  3J80 S;  2F4V M;  2UXD M;  4JI5 M;  3SAU A;  4DR5 M;  1HNW M;  4K0K M;  1K3X A; 
#chains in the Genus database with same CATH topology
 3E46 A;  4NXM M;  1J7K A;  3GLH A;  2V1C A;  5ITT A;  1IBL M;  2QBY A;  1G8P A;  1PRB A;  1QUS A;  2KW0 A;  4GHA A;  1GVN A;  2CHG A;  3E9S A;  2LNH C;  4B08 A;  5IT9 S;  2JUJ A;  3A98 B;  3IG5 A;  3GRU A;  5FTN A;  2FFJ A;  3K9P A;  4NC6 A;  3WHK A;  2O01 F;  3CGW A;  2JNH A;  3VDU A;  5C1B A;  2DWM A;  1GKI A;  5ITX E;  4XGI A;  2EUC A;  3NWL A;  1L1T A;  1DGG A;  1YE9 A;  2DNA A;  4GHL A;  1C1K A;  1YLA A;  3RGS A;  4DV5 M;  3HU1 A;  3TWL A;  2QHO B;  3SMS A;  2UUA M;  2JZ1 A;  5DYI A;  1OFI A;  3VK8 A;  3HGI A;  1IBM M;  3SAR A;  1N36 M;  1N77 A;  3KOY E;  2DHY A;  3CTW B;  4G4N A;  4PCZ A;  3B9P A;  2LH0 A;  3B7Z A;  3ZCB B;  4AW4 A;  1ZMW A;  2JZ0 A;  1AUA A;  4LF4 M;  3Q8G A;  3LMM A;  2Y0T A;  1G3I A;  1NJF A;  2AHM A;  1N34 M;  1EE8 A;  1QUT A;  1Q02 A;  3DOA A;  2QPA A;  1WIV A;  1V34 A;  4DR2 M;  4LF9 M;  2R4E A;  3PNV A;  3GPY A;  3GQ3 A;  1V92 A;  3LVW A;  3B89 A;  3LVV A;  1Z6T A;  5IZ7 D;  1QDT A;  2ZAN A;  3GLF A;  7CAT A;  2VF8 A;  1XXH E;  4Q7J A;  3TWK A;  2DAE A;  1OIZ A;  3FUU A;  1ZQ9 A;  4FWH A;  3GP1 A;  1Y8G A;  4JI7 M;  4DV2 M;  1ORY B;  2L09 A;  3HU3 A;  4XBO A;  2L4F A;  1HT2 E;  3M6A A;  4B7H A;  3GQ4 A;  4IBD A;  4EIW A;  2WZJ A;  2CV0 A;  8CAT A;  4OVZ B;  4GC5 A;  2R45 A;  2KNV A;  2XSZ D;  3CF6 E;  3GRY A;  4JI3 M;  4LJ6 A;  3W0F A;  1EIJ A;  5FLX S;  1IFY A;  2LVN C;  1S3S A;  4I8O A;  1E94 E;  3KVW A;  2L4E A;  2HCB A;  1QVR A;  5EXT A;  4MB7 A;  2RRU A;  4AG5 A;  5GKN A;  3VDP A;  3KS8 A;  3A46 A;  4B7G A;  2QNJ A;  2KZS A;  4A3V B;  4X65 M;  1DGB A;  1R4G A;  2GNO A;  2GQF A;  3HY5 A;  1TR8 A;  4LGM A;  5DFL A;  4GKJ M;  4D81 A;  2KDL A;  4OU7 A;  5EXP A;  4AKH A;  3FD9 A;  1XXH B;  3C3E A;  5LMU M;  2F5N A;  3KOX E;  2QCU A;  5FSW A;  4CHT B;  1T43 A;  3FUX A;  1ZAE A;  3H4M A;  4M9Z A;  1WGN A;  3R8F A;  4GC9 A;  3HJQ A;  4JI2 M;  1OKS A;  3L28 A;  1Z5A A;  4IBG A;  1F4I A;  1MN3 A;  1TDH A;  2D7H A;  2P5T A;  2X8A A;  1OTR A;  5JI3 E;  4F1I A;  3TPZ A;  2C9O A;  4GMQ A;  3FRH A;  4QHS A;  1HQY E;  2JXN A;  4LRS A;  5JI2 E;  1L2C A;  1VG5 A;  4HLQ A;  4AZF A;  4NSO B;  4BBA A;  3HZJ A;  3M0E A;  4IJF A;  3JR4 A;  1D0M A;  2F4V M;  2BNK A;  3SAU A;  3UJN A;  4GEW A;  4LJ8 A;  3L26 A;  1IQP A;  4K0K M;  3B7N A;  3VKH A;  4LFC M;  3SBJ A;  1ZMV A;  4LJ4 A;  4LF7 M;  5H37 D;  2V6Z M;  1W5T A;  4L4U A;  4RF1 A;  1XB2 B;  4MGY E;  3JAM S;  2HL7 A;  5C18 A;  2NQ8 C;  1VDL A;  2X4A A;  3TQS A;  3SYK A;  2DZL A;  2I7P A;  2XF3 A;  4DV7 M;  4JV5 M;  3U6P A;  4HEO A;  1MX0 A;  2QP9 X;  2R65 A;  5KO3 A;  3TE6 A;  1Q3C A;  1V33 A;  4XK8 F;  3J7B A;  4NXN M;  4P17 A;  4WUR A;  1IXS B;  1PJQ A;  1TF0 B;  3HJS A;  2V1U A;  1DV0 A;  4LJA A;  2DWN A;  4LG2 A;  4I4L A;  1FJG M;  2DZO B;  2VDB B;  1N75 A;  2Y0Q A;  3E4R A;  2Z3X A;  2ERC A;  3L29 A;  5ITR A;  1IY2 A;  1G4A E;  2JY7 A;  5LMN M;  4W5W A;  2KXE A;  2CEA A;  3U6S A;  2CWB A;  1I94 M;  3T15 A;  1ZMU A;  1VEJ A;  2BJV A;  1DO2 A;  3SFZ A;  2KZU A;  3NBX X;  4RKU F;  3SAV A;  1KFV A;  1PGY A;  2YR0 A;  4JI4 M;  4P16 A;  5BR8 M;  4I5S A;  2A5Y B;  2F5Q A;  2L2D A;  1N32 M;  2CHV A;  3FTF A;  3LQR A;  4IBK A;  3GLG B;  4B3T M;  2VII A;  2J7N A;  1J09 A;  2XLJ A;  4NSR A;  4DR3 M;  3U6M A;  1NNU C;  2FS1 A;  4DV6 M;  3WHL A;  1SXJ E;  4D82 A;  2CV2 A;  2L6O A;  1DGH B;  1KSF X;  2EKF A;  2DAI A;  1TGU A;  3D8L A;  1YSY A;  4FW9 A;  1PJI A;  3KOW E;  1NY6 A;  3GLI E;  3U6E A;  2QBY B;  3Q8X A;  3VK7 A;  1GAB A;  3GRV A;  2HHH M;  3UGJ A;  4WP2 A;  2C96 A;  3RFW A;  3L27 A;  3A45 A;  4KT0 F;  1QAO A;  2MH8 A;  2ZTC A;  2R18 A;  1TDZ A;  2Y21 A;  1QZE A;  4YY3 M;  1HR0 M;  4B3S M;  2R62 A;  3U60 A;  3W0L B;  2FE8 A;  2EA0 A;  4PD2 A;  1Z59 A;  1TTE A;  3I4V A;  2L7I A;  1OFH A;  3W68 A;  2MGW A;  4REZ A;  3GPU A;  2OPF A;  3ZH9 B;  2LVP C;  5ITY A;  1OQY A;  3ZQJ A;  3TWM A;  3FYC A;  1EFU B;  4JN6 A;  1HJP A;  3U61 B;  1OAO C;  3SMP A;  3I01 M;  2KA6 B;  3IHP A;  3PXG A;  4DUZ M;  1JR3 D;  1HNX M;  2Z4R A;  3SYL A;  3QWL A;  1R2Y A;  4MH0 E;  2LHG A;  4KLN A;  1HQC A;  5L8R F;  1G71 A;  1D0L A;  1SXJ B;  3HX3 A;  5ITQ A;  2KNA A;  5BPV A;  4JI0 M;  1HT1 E;  1SXJ D;  1WJ7 A;  3ZC7 B;  4DV1 M;  4B3M M;  2JY6 B;  4DUY M;  4NL4 H;  3PVS A;  3SHF A;  3GLI B;  4AQY M;  3J2P B;  3VFD A;  1JB0 F;  1NHW C;  1IN6 A;  1L2B A;  1QAQ A;  3GLH E;  3DFZ A;  1QDR A;  2OQ4 A;  5FTJ A;  3KSX A;  5IRE B;  4AI6 A;  3ILK A;  2LXE A;  4MGI E;  4PDI A;  2G5G X;  2VQF M;  4Y28 F;  5KPR A;  2VQE M;  2K6B A;  2WSE F;  2K9D A;  2J7O A;  3W67 A;  3U6Q A;  3F92 A;  1XMQ M;  2R4J A;  4DR1 M;  2G8L A;  4JI1 M;  4LF6 M;  5KPT A;  3SAT A;  4G4Q A;  2H1R A;  3HHY A;  4DR6 M;  4CIZ A;  1JQJ C;  2CRU A;  4JI5 M;  4GH9 A;  3L25 A;  1HNW M;  1NY5 A;  1K3X A;  1NHG C;  1OAI A;  2D7E A;  3FTD A;  2Z8Y M;  1NVM A;  3VLF B;  3FE3 A;  1XNR M;  1VEG A;  2XGN A;  4GIP A;  2JWS A;  1P3Q Q;  4R7G A;  2UU9 M;  4R3D A;  1WGL A;  2XFS A;  4M0D A;  3C3D A;  1UFZ A;  2KHH A;  1E32 A;  1K82 A;  3U5Z B;  3K1J A;  4KO8 A;  1XMO M;  1GO5 A;  3K8Z A;  4IJE A;  2X49 A;  3U6D A;  3T6P A;  2LVQ D;  4M0W A;  2FOI C;  3HKP A;  3A42 A;  3KOZ E;  3GLH B;  3RE8 A;  2R0I A;  2ZAM A;  2HKJ A;  2XEP A;  3J27 B;  4FD2 A;  5ITU A;  1L2D A;  3CF0 A;  3UZU A;  3LCU A;  2KEB A;  4UN2 B;  3BBZ A;  4X62 M;  1PJT A;  2XZF A;  1E9S A;  2C99 A;  4FWG A;  3MJ5 A;  2OOA A;  4ZPX A;  3UMM A;  2ZBK B;  4B3R M;  1DGF A;  3J81 S;  4CIS A;  2BWE A;  4QOS A;  1X37 A;  3AOE C;  3U61 A;  3GLF E;  3T38 A;  3B74 A;  2HAK A;  4IBI A;  2XZU A;  3SHG B;  4GKK M;  3GLG E;  5ITX A;  5KPZ A;  2R44 A;  4IBB A;  1AIP C;  2R46 A;  3AOE A;  4L78 A;  2F5O A;  3C58 A;  1NV8 A;  2LBC A;  4LRT A;  5DNY A;  4LFA M;  2APL A;  1VDD A;  3KXE C;  5FTK A;  4LZZ A;  3PFI A;  4YHH M;  1GJS A;  1WHC A;  5FTM A;  1DO0 A;  1LTM A;  4FWD A;  4FCW A;  4OVZ A;  1G59 A;  1IN4 A;  1R2Z A;  3I4Y A;  3B7Q A;  1ZV1 A;  1IY0 A;  3IEC A;  3LQQ A;  4G4R A;  4DV4 M;  1IM2 A;  3SAW A;  4OX9 M;  3FTE A;  4X66 M;  3AKZ A;  2J5Y A;  2JY8 A;  1C7Y A;  1LV7 A;  2DAK A;  3FUV A;  5EP1 A;  4JXJ A;  2WSF F;  1XNQ M;  1OIP A;  3DA1 A;  4NOO B;  2BWB A;  4QOZ C;  1YUB A;  3FUT A;  3HHX A;  2CE7 A;  4QNR A;  4IBC A;  3GLF B;  3BOS A;  4HL4 A;  4Z8X A;  1A5T A;  3KP1 E;  3U6L A;  4FVM A;  4JI8 M;  1JR3 E;  4G6Z A;  4LCB A;  4M9X A;  1XXH A;  3IG8 A;  3M7G A;  2K0B X;  4MM3 B;  4MGZ E;  5EJC A;  1PM5 A;  3KS4 A;  1SG9 A;  4PDG A;  3SAS A;  3HHZ A;  3U5Z A;  4LJ5 A;  3KSJ A;  3L2A A;  2DWZ B;  5E26 A;  5KQ8 A;  4BB9 A;  2ZAO A;  1R5L A;  3GPX A;  3C9P A;  3HWS A;  1T3T A;  3QYB A;  4G3O A;  2C9C A;  5DYG A;  2YNM D;  3DZD A;  2RGO A;  2Q2E B;  1NJG A;  1QQW A;  3PNY A;  3U6C A;  2ZM6 M;  2MJ5 B;  1J5E M;  2L7H A;  2C5R A;  1I4W A;  2DAG A;  1WXQ A;  2JY5 A;  1GLN A;  3THG A;  4IBE A;  4FCT A;  1N33 M;  4AG6 A;  2DI0 A;  1T6O A;  4D80 A;  1RU3 A;  4IIW A;  2K47 A;  1XC8 A;  1D2N A;  4KOD A;  4QNM A;  1XHB A;  1Q3B A;  2JP7 A;  4WW0 A;  4OW0 A;  4GRI A;  4NRV A;  1TH3 A;  4IBF A;  4S12 A;  2DVW B;  4I81 A;  3RGP A;  1H6U A;  4DR5 M;  1GL7 A;  3LW5 F;  5EP2 A;  1IXS A;  4L15 A;  2E5L M;  2DWL A;  2UXB M;  2JA2 A;  3TL4 X;  2LVO C;  3HJ8 A;  1R7R A;  2HWJ A;  3FUW A;  4RF0 A;  2UXC M;  5E6J A;  4NRW A;  2QEN A;  3FKE A;  1GJT A;  3K92 A;  3MK6 A;  1IXR C;  4L8R C;  4TUW A;  1N78 A;  4DR7 M;  2FH0 A;  3EIE A;  4BLC A;  5EP4 A;  2XH9 A;  3GQ5 A;  1OJL A;  2UUC M;  4ITQ A;  5FTL A;  3GO8 A;  4AKI A;  3MHV C;  2CFO A;  1GL6 A;  4LZJ A;  1IN7 A;  2CV1 A;  3AJI B;  3U6O A;  2QQ8 A;  1L8Q A;  3GLG A;  4KHP M;  3J7A S;  4DR4 M;  4RNA A;  1Z5C A;  3EIH A;  3GRR A;  2KRK A;  1QYR A;  5F3W A;  3FYD A;  1IY1 A;  1VQ1 A;  2EJS A;  1IXZ A;  2CHQ A;  2QZ4 A;  2DXI A;  2EKK A;  4DV0 M;  1DGH A;  4JYA M;  3KP0 E;  5EQT A;  4QHT A;  2MRO B;  2M60 A;  2R6F A;  1TH4 A;  2KNZ A;  1D0K A;  2QSF X;  4L6V 6;  3SC3 A;  2RKO A;  2RGH A;  4LJ7 A;  3K9O A;  2DHR A;  1PJS A;  4JI6 M;  1PJJ A;  3KDS E;  2OOB A;  2CP8 A;  3D8B A;  1G41 A;  4LJ9 A;  4PT5 A;  4LF8 M;  2N35 A;  2UUB M;  4ANR A;  1NO1 A;  1WR1 B;  1HNZ M;  4G4O A;  3QAU A;  1XWI A;  3HHW A;  3H4J A;  2M5Z A;  4R71 A;  2BJW A;  2MR9 A;  3AV0 A;  4GIT A;  2DZN B;  4F2L A;  1UM8 A;  1K3W A;  4AKG A;  1JR3 A;  4II7 A;  1MU5 A;  2G3Q A;  1SXJ C;  2YQZ A;  4MGK E;  2DEN A;  2F5P A;  1QAM A;  2Z4S A;  3V76 A;  3GPP A;  4LFB M;  2EO2 A;  1SXJ A;  1Z5B A;  3OTO M;  2I7N A;  4X64 M;  3R9X B;  1IN5 A;  2DKL A;  2O5R A;  2KRU A;  3KFU G;  3I04 M;  4CJ6 A;  3BXW A;  1R6B X;  4Z6Y A;  3AL0 C;  2O25 A;  5A2Q S;  2XFT A;  2LHC A;  2XSZ A;  3GLI A;  3NBI A;  4MGH A;  1MJG M;  5EP3 A;  3HU2 A;  5KQD A;  3FTC A;  1FNN A;  3I51 A;  4B7F A;  4L16 A;  3VKG A;  3LCV B;  5IWA M;  2F5S A;  2LTU A;  3U60 B;  2DAM A;  2CUZ A;  2B3T A;  4IBJ A;  2H5X A;  5EXS A;  4DV3 M;  4LY6 A;  1W5S A;  2W82 A;  3K2L A;  1IN8 A;  4M9S A;  2Y20 A;  1CUK A;  3CF2 A;  1Q39 A;  3MMP A;  2ZTD A;  3JR5 A;  1IBK M;  1QAN A;  1KYI A;  3E21 A;  1L1Z A;  1VEK A;  3KW6 A;  2OO9 A;  4FCV A;  2WSC F;  4LF5 M;  2FNA A;  4LGY A;  1BVS A;  1E9R A;  3T1H M;  1TH2 A;  1NV9 A;  2C98 A;  5EXX A;  3T1Y M;  2LWX A;  1NNJ A;  3AFH A;  1QZM A;  3UK6 A;  4CGY B;  3QYE A;  2YFQ A;  2LVA A;  3J80 S;  4DBG B;  2UXD M;  2D7G A;  3FRI A;  1NSF A;  2VF7 A;  2Z7J A;  3AOG A; 
#chains in the Genus database with same CATH homology
 4NXM M;  1J7K A;  3GLH A;  2V1C A;  5ITT A;  1IBL M;  2QBY A;  1G8P A;  2KW0 A;  4GHA A;  1GVN A;  2CHG A;  3E9S A;  2LNH C;  4B08 A;  5IT9 S;  3A98 B;  3IG5 A;  3GRU A;  5FTN A;  2FFJ A;  3WHK A;  3VDU A;  5C1B A;  2DWM A;  1GKI A;  5ITX E;  4XGI A;  2EUC A;  3NWL A;  1L1T A;  1DGG A;  1YE9 A;  1C1K A;  4DV5 M;  3RGS A;  3HU1 A;  3TWL A;  3SMS A;  2UUA M;  5DYI A;  1OFI A;  3VK8 A;  3HGI A;  1IBM M;  3SAR A;  1N36 M;  1N77 A;  3KOY E;  4G4N A;  3CTW B;  4PCZ A;  3B9P A;  2LH0 A;  3ZCB B;  4AW4 A;  4LF4 M;  3LMM A;  2Y0T A;  1G3I A;  1NJF A;  2AHM A;  1N34 M;  1EE8 A;  3DOA A;  2QPA A;  4DR2 M;  4LF9 M;  2R4E A;  3PNV A;  3GPY A;  3GQ3 A;  3LVW A;  3LVV A;  1Z6T A;  5IZ7 D;  2ZAN A;  3GLF A;  7CAT A;  3TWK A;  3FUU A;  1ZQ9 A;  4FWH A;  3GP1 A;  4JI7 M;  4DV2 M;  1ORY B;  2L09 A;  3HU3 A;  4XBO A;  3GQ4 A;  1HT2 E;  3M6A A;  4B7H A;  4IBD A;  4EIW A;  2CV0 A;  8CAT A;  4OVZ B;  4GC5 A;  2R45 A;  2XSZ D;  3CF6 E;  3GRY A;  4JI3 M;  4LJ6 A;  3W0F A;  5FLX S;  4I8O A;  1S3S A;  1E94 E;  3KVW A;  2HCB A;  1QVR A;  5EXT A;  4MB7 A;  4AG5 A;  5GKN A;  3VDP A;  3KS8 A;  3A46 A;  4B7G A;  2KZS A;  4A3V B;  4X65 M;  1DGB A;  4LGM A;  4GKJ M;  4D81 A;  4OU7 A;  5EXP A;  4AKH A;  3FD9 A;  1XXH B;  5LMU M;  2F5N A;  3KOX E;  2QCU A;  5FSW A;  4CHT B;  3FUX A;  1ZAE A;  3H4M A;  4M9Z A;  3R8F A;  4GC9 A;  3HJQ A;  4JI2 M;  3L28 A;  1Z5A A;  4IBG A;  1TDH A;  2D7H A;  2P5T A;  2X8A A;  5JI3 E;  3TPZ A;  2C9O A;  4GMQ A;  4QHS A;  1HQY E;  4LRS A;  5JI2 E;  1L2C A;  4HLQ A;  4AZF A;  4NSO B;  4BBA A;  4IJF A;  3M0E A;  3JR4 A;  2F4V M;  2BNK A;  3SAU A;  3UJN A;  4LJ8 A;  3L26 A;  1IQP A;  4K0K M;  3VKH A;  4LFC M;  3SBJ A;  4LJ4 A;  4LF7 M;  5H37 D;  2V6Z M;  1W5T A;  4L4U A;  4RF1 A;  4MGY E;  3JAM S;  2HL7 A;  5C18 A;  2NQ8 C;  2X4A A;  3TQS A;  3SYK A;  2I7P A;  4DV7 M;  2XF3 A;  4JV5 M;  3U6P A;  1MX0 A;  2QP9 X;  2R65 A;  5KO3 A;  3TE6 A;  1Q3C A;  3J7B A;  4NXN M;  4WUR A;  1IXS B;  3HJS A;  2V1U A;  4LJA A;  2DWN A;  4LG2 A;  4I4L A;  1FJG M;  2DZO B;  1N75 A;  2Y0Q A;  3E4R A;  2Z3X A;  2ERC A;  3L29 A;  5ITR A;  1IY2 A;  1G4A E;  5LMN M;  4W5W A;  2KXE A;  2CEA A;  3U6S A;  1I94 M;  3T15 A;  2BJV A;  1DO2 A;  3SFZ A;  2KZU A;  3SAV A;  1KFV A;  2YR0 A;  4JI4 M;  4P16 A;  5BR8 M;  4I5S A;  2A5Y B;  2F5Q A;  1N32 M;  2CHV A;  3FTF A;  3LQR A;  4IBK A;  3GLG B;  4B3T M;  2VII A;  2J7N A;  1J09 A;  2XLJ A;  4NSR A;  4DR3 M;  3U6M A;  1NNU C;  4DV6 M;  3WHL A;  1SXJ E;  4D82 A;  2CV2 A;  2L6O A;  1DGH B;  1KSF X;  1TGU A;  3D8L A;  1YSY A;  4FW9 A;  1PJI A;  3KOW E;  1NY6 A;  3U6E A;  3Q8X A;  3VK7 A;  3GRV A;  2HHH M;  3UGJ A;  2C96 A;  3RFW A;  3L27 A;  3A45 A;  1QAO A;  2R18 A;  1TDZ A;  2Y21 A;  4YY3 M;  1HR0 M;  4B3S M;  2R62 A;  3U60 A;  3W0L B;  2FE8 A;  2EA0 A;  4PD2 A;  1Z59 A;  3I4V A;  2L7I A;  1OFH A;  3GPU A;  2OPF A;  4REZ A;  3ZH9 B;  5ITY A;  3TWM A;  3FYC A;  4JN6 A;  3U61 B;  3SMP A;  2KA6 B;  3PXG A;  4DUZ M;  1JR3 D;  1HNX M;  2Z4R A;  3SYL A;  3QWL A;  1R2Y A;  4MH0 E;  4KLN A;  1HQC A;  5ITQ A;  1SXJ B;  5BPV A;  4JI0 M;  1HT1 E;  1SXJ D;  3ZC7 B;  4DV1 M;  4B3M M;  4DUY M;  4NL4 H;  3PVS A;  3SHF A;  3GLI B;  4AQY M;  3J2P B;  3VFD A;  1NHW C;  1IN6 A;  1L2B A;  1QAQ A;  3DFZ A;  2OQ4 A;  4AI6 A;  5FTJ A;  3KSX A;  5IRE B;  3ILK A;  2LXE A;  4MGI E;  4PDI A;  2G5G X;  2VQF M;  5KPR A;  2VQE M;  2J7O A;  3U6Q A;  1XMQ M;  2R4J A;  4DR1 M;  2G8L A;  4JI1 M;  4LF6 M;  5KPT A;  3SAT A;  4G4Q A;  2H1R A;  3HHY A;  4DR6 M;  1JQJ C;  4JI5 M;  4GH9 A;  3L25 A;  1HNW M;  1NY5 A;  1K3X A;  1NHG C;  2D7E A;  3FTD A;  1NVM A;  3VLF B;  1XNR M;  2XGN A;  4GIP A;  4R7G A;  2UU9 M;  4R3D A;  2XFS A;  4M0D A;  1E32 A;  1K82 A;  3U5Z B;  3K1J A;  4KO8 A;  1XMO M;  3K8Z A;  4IJE A;  2X49 A;  3U6D A;  4M0W A;  2FOI C;  3HKP A;  3A42 A;  3KOZ E;  3GLH B;  3RE8 A;  2ZAM A;  5ITU A;  2HKJ A;  2XEP A;  3J27 B;  4FD2 A;  1L2D A;  2QBY B;  3CF0 A;  3UZU A;  4X62 M;  2KEB A;  2XZF A;  1E9S A;  2C99 A;  4FWG A;  3MJ5 A;  4ZPX A;  3UMM A;  2ZBK B;  4B3R M;  1DGF A;  3J81 S;  4CIS A;  4QOS A;  1X37 A;  3AOE C;  3U61 A;  3T38 A;  4IBI A;  2XZU A;  3SHG B;  4GKK M;  5ITX A;  5KPZ A;  4IBB A;  2R46 A;  3AOE A;  4L78 A;  2F5O A;  3C58 A;  4LRT A;  5DNY A;  4LFA M;  1VDD A;  3KXE C;  5FTK A;  4LZZ A;  3PFI A;  4YHH M;  5FTM A;  1DO0 A;  4FWD A;  4FCW A;  4OVZ A;  1G59 A;  1IN4 A;  1R2Z A;  3I4Y A;  1IY0 A;  3LQQ A;  4G4R A;  4DV4 M;  1IM2 A;  3SAW A;  4OX9 M;  3FTE A;  4X66 M;  3AKZ A;  1LV7 A;  3FUV A;  5EP1 A;  4JXJ A;  1XNQ M;  3DA1 A;  4NOO B;  4QOZ C;  1YUB A;  3FUT A;  3HHX A;  2CE7 A;  4QNR A;  4IBC A;  3GLF B;  3BOS A;  4HL4 A;  4Z8X A;  3U6L A;  3KP1 E;  4FVM A;  4JI8 M;  4G6Z A;  4LCB A;  4M9X A;  1XXH A;  3IG8 A;  3M7G A;  4MM3 B;  4MGZ E;  5EJC A;  1PM5 A;  3KS4 A;  4PDG A;  3SAS A;  3HHZ A;  3U5Z A;  4LJ5 A;  3KSJ A;  3L2A A;  2DWZ B;  5E26 A;  5KQ8 A;  4BB9 A;  2ZAO A;  3GPX A;  3HWS A;  1T3T A;  2C9C A;  5DYG A;  2YNM D;  3DZD A;  2RGO A;  2Q2E B;  1NJG A;  1QQW A;  3PNY A;  3U6C A;  2ZM6 M;  1J5E M;  2L7H A;  2C5R A;  1I4W A;  1WXQ A;  3THG A;  1GLN A;  4IBE A;  4FCT A;  1N33 M;  4AG6 A;  4D80 A;  4IIW A;  2K47 A;  1XC8 A;  1D2N A;  4KOD A;  4QNM A;  1XHB A;  1Q3B A;  4WW0 A;  4OW0 A;  4GRI A;  4NRV A;  1TH3 A;  4IBF A;  4S12 A;  2DVW B;  4I81 A;  3RGP A;  1H6U A;  4DR5 M;  1GL7 A;  5EP2 A;  4L15 A;  2E5L M;  2DWL A;  2UXB M;  2JA2 A;  3TL4 X;  3HJ8 A;  1R7R A;  3FUW A;  4RF0 A;  2UXC M;  5E6J A;  4NRW A;  2QEN A;  3FKE A;  3K92 A;  3MK6 A;  1IXR C;  4L8R C;  4TUW A;  1N78 A;  4DR7 M;  3EIE A;  4BLC A;  5EP4 A;  2XH9 A;  3GQ5 A;  1OJL A;  2UUC M;  4ITQ A;  5FTL A;  3GO8 A;  4AKI A;  3MHV C;  2CFO A;  1GL6 A;  4LZJ A;  1IN7 A;  2CV1 A;  3AJI B;  3U6O A;  1L8Q A;  3GLG A;  4KHP M;  3J7A S;  4DR4 M;  4RNA A;  1Z5C A;  3EIH A;  3GRR A;  2KRK A;  1QYR A;  5F3W A;  3FYD A;  1IY1 A;  1IXZ A;  2CHQ A;  2QZ4 A;  2DXI A;  4DV0 M;  1DGH A;  4JYA M;  3KP0 E;  5EQT A;  4QHT A;  2M60 A;  1TH4 A;  3SC3 A;  2RKO A;  2RGH A;  4LJ7 A;  2DHR A;  4JI6 M;  1PJJ A;  3KDS E;  3D8B A;  1G41 A;  4LJ9 A;  4PT5 A;  4LF8 M;  2UUB M;  1HNZ M;  4G4O A;  3QAU A;  1XWI A;  3HHW A;  2M5Z A;  2BJW A;  3AV0 A;  4GIT A;  2DZN B;  1UM8 A;  1K3W A;  4AKG A;  1JR3 A;  4II7 A;  1MU5 A;  1SXJ C;  2YQZ A;  4MGK E;  2F5P A;  1QAM A;  2Z4S A;  3GPP A;  4LFB M;  2EO2 A;  1SXJ A;  1Z5B A;  3OTO M;  2I7N A;  4X64 M;  3R9X B;  1IN5 A;  3KFU G;  2O5R A;  2KRU A;  3AL0 C;  1R6B X;  4Z6Y A;  5A2Q S;  2XFT A;  2XSZ A;  3GLI A;  3NBI A;  4MGH A;  5EP3 A;  3HU2 A;  5KQD A;  3FTC A;  1FNN A;  3I51 A;  4B7F A;  4L16 A;  3VKG A;  5IWA M;  2F5S A;  3U60 B;  2CUZ A;  4IBJ A;  5EXS A;  4DV3 M;  4LY6 A;  1W5S A;  2W82 A;  3K2L A;  1IN8 A;  4M9S A;  2Y20 A;  3CF2 A;  1Q39 A;  3JR5 A;  1IBK M;  1QAN A;  1KYI A;  1L1Z A;  3KW6 A;  4FCV A;  4LF5 M;  2FNA A;  4LGY A;  1E9R A;  3T1H M;  1TH2 A;  2C98 A;  5EXX A;  3T1Y M;  2LWX A;  1NNJ A;  3AFH A;  1QZM A;  3UK6 A;  4CGY B;  2YFQ A;  3J80 S;  2UXD M;  2D7G A;  4GHL A;  1NSF A;  2Z7J A;  3AOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...