4DR6M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr6M02
5BR8M 4LF4M 1TDHA 4NXNM 1IBKM 4X66M 2F5SA 3GQ4A 4CISA 4DV0M 3J7AS 1L1TA 1L2BA 4GKKM 5ITXA 1PJJA 4NXMM 3DOAA 3SBJA 3U6PA 3VK8A 4LF5M 4LF6M 4LFCM 5IT9S 4X65M 3TWMA 2XZFA 4JI8M 4DR4M 4LFBM 3TWLA 1PM5A 2F4VM 4DR7M 3U6QA 1N36M 4DR3M 4B3SM 2UXDM 1Z5AA 2XZUA 3U6SA 5A2QS 1PJIA 1Z5BA 1KFVA 3GP1A 3U6DA 1Q39A 4DV1M 5LMNM 4LFAM 5ITYA 2E5LM 1HR0M 1HNXM 4DR6M 5FLXS 1MU5A 4YHHM 1K3WA 3JAMS 4K0KM 4X62M 4X64M 4PD2A 1XMQM 2ZBKB 2F5NA 3GQ5A 4DV2M 4LF8M 1N33M 3A46A 3GQ3A 4JI6M 2UXCM 5ITRA 2UU9M 4LF7M 1IBMM 4JI3M 4G4QA 4DR2M 3U6LA 1FJGM 4DV4M 4JI1M 4G4NA 4DUYM 2ZM6M 3T1YM 3GPPA 2UXBM 1L2DA 1Z5CA 3J80S 3SARA 1XNQM 3T1HM 1N34M 3SAVA 3GPXA 3U6OA 5ITQA 3GPYA 3TWKA 3SATA 4B3MM 3A45A 2EA0A 3U6MA 3U6CA 2UUBM 1R2ZA 4GKJM 4DUZM 4NRWA 3SAWA 2F5OA 2VQFM 5ITTA 1NNJA 1L2CA 4DV6M 4YY3M 1HNZM 1Q3BA 4PCZA 4AQYM 1XNRM 4PDIA 2OPFA 1XMOM 2VQEM 2HKJA 5LMUM 4G4OA 1Z59A 3JR5A 1K3XA 1J5EM 3OTOM 2F5QA 2OQ4A 4DR1M 1EE8A 1R2YA 3SASA 2Q2EB 3J81S 4JYAM 1XC8A 4ITQA 1TDZA 4PDGA 2UUCM 4KHPM 4DV5M 4JI5M 3W0FA 4DV7M 1Q3CA 5ITXE 4DR5M 3VK7A 5ITUA 1K82A 4OX9M 1HNWM 4NRVA 2UUAM 1N32M 3U6EA 1L1ZA 4JI4M 1MX0A 2HHHM 4JI0M 4JI2M 3JR4A 4B3TM 5IWAM 3GO8A 3A42A 4JV5M 4G4RA 4JI7M 2F5PA 3C58A 1I94M 4DV3M 4MB7A 3GPUA 4LF9M 1IBLM 3SAUA 4B3RM
chains in the Genus database with same CATH superfamily
1TDHA 4NXNM 2BJWA 1NJFA 2H1RA 1IXSA 2DAMA 4FWGA 2H5XA 3GQ4A 4DV0M 5KO3A 4M0DA 3SMSA 4FD2A 4HEOA 4GKKM 1F4IA 3U61A 4RF0A 1VG5A 3HU3A 4IBKA 2CV1A 1QVRA 3FTFA 5FSWA 4LF5M 2XH9A 4EIWA 2XZFA 2MH8A 3QYBA 4KODA 4M9SA 4RKUF 2JY5A 3SFZA 4LJ7A 1G4AE 1ZAEA 4IBIA 2UXDM 3NBIA 1NY5A 1GL6A 1G71A 2DAEA 2LVQD 3GP1A 1LTMA 2EKFA 4GEWA 3LVVA 2FOIC 4DV1M 2Z4RA 1SXJB 3L25A 4IJFA 1HQYE 4L6V6 5FTJA 4A3VB 2E5LM 2DWMA 3SYLA 5BPVA 1DGHA 2FS1A 2HL7A 2R0IA 1OJLA 3EIEA 3HX3A 4JXJA 4I8OA 1XXHE 3T15A 4D82A 2CV2A 1TH2A 3KP1E 1N78A 2MJ5B 4X62M 1G3IA 3ILKA 1XMQM 2Y0TA 2Z7JA 2ZBKB 3EIHA 2F5NA 1YSYA 4MGZE 1R5LA 1TF0B 2CUZA 2K6BA 1D2NA 4GMQA 3A46A 1GKIA 2C9CA 4XK8F 4JI6M 3PFIA 4B08A 1WXQA 2L7IA 3QYEA 3HU2A 3FRIA 3FTDA 2LBCA 3A98B 5IREB 4DR2M 3U6LA 2MGWA 3MHVC 5EXSA 5DFLA 2X4AA 5L8RF 4NL4H 3GLHE 4GC5A 3RE8A 3SMPA 2CHGA 1WR1B 3U6OA 4Z6YA 5E6JA 5GKNA 1WHCA 2DENA 4S12A 3UK6A 2EA0A 2DI0A 3FRHA 3GRRA 4DUZM 4NRWA 1FNNA 3V76A 4MH0E 2LTUA 3KOWE 3VDPA 3KXEC 2KNZA 2EJSA 2GQFA 5DYIA 3J7AS 4AW4A 2DWZB 3BXWA 4KLNA 2WSFF 3K92A 1KSFX 1R7RA 4QNMA 2C99A 4L15A 1IY2A 1ZMVA 3KW6A 4QNRA 3FUXA 1NO1A 2FH0A 3MMPA 4LJ6A 3GRUA 3HHZA 2LVAA 1QAOA 4PDGA 1SXJD 1IFYA 3UZUA 4KHPM 3HHWA 2O5RA 3VK7A 1Q3CA 4OX9M 4AKIA 3GLIB 3IECA 4NRVA 1N32M 2R62A 1GLNA 4JI4M 2JY6B 2HHHM 3I04M 1V92A 2DAIA 2J5YA 4IIWA 3JR4A 5EJCA 1JR3E 4IBBA 4AG5A 2LHCA 2KNAA 3VKHA 2JWSA 3KVWA 4CIZA 7CATA 2DWLA 1IY0A 2I7PA 2KHHA 3WHKA 2G8LA 4KT0F 1OAIA 4JI7M 2QQ8A 4MGIE 1XXHB 4WW0A 4CJ6A 3AKZA 1IM2A 4DV3M 4LF9M 1HJPA 5EP1A 5KPTA 1QANA 3VLFB 2OOAA 3B7NA 3GLFA 3E4RA 4LF4M 1T3TA 2KNVA 4LZZA 4CISA 2B3TA 3AV0A 1L1TA 1L2BA 2DXIA 1R4GA 5ITXA 2VF8A 1WIVA 1N75A 5KPZA 4NXMM 3NWLA 2MR9A 3U60B 3D8BA 4IJEA 3U6PA 2DZLA 4LFCM 5IT9S 1VEGA 4IBCA 3L29A 3Q8GA 3HWSA 2K0BX 1QZEA 1T43A 3HJ8A 3U6QA 3GLHB 1V33A 4B3SM 2ZAOA 4OVZB 4HL4A 2LH0A 4LGMA 4W5WA 3BOSA 5DYGA 4IBFA 2JUJA 1OQYA 3ZQJA 3AJIB 5FTMA 3THGA 1ZQ9A 3NBXX 1WGLA 5LMNM 1J7KA 2R46A 2ZAMA 4I4LA 5ITYA 2VDBB 4RNAA 3VDUA 5KQDA 2JZ1A 1VEJA 3R9XB 3RFWA 3FUVA 4XGIA 1W5SA 2XF3A 1K3WA 4K0KM 2OO9A 2VIIA 1S3SA 4FWDA 2X8AA 4WP2A 3E21A 4DV2M 1PJQA 2L7HA 1DGHB 4AI6A 2WZJA 1NY6A 4CHTB 3KFUG 1RU3A 1C1KA 2UU9M 1YUBA 3L27A 4MGKE 1HT1E 3GLGE 3GLIE 4G4QA 3FKEA 2CE7A 3VFDA 5KPRA 3AOEA 3IG8A 3K9PA 2DNAA 2KA6B 2XFSA 2CP8A 3T1YM 1MJGM 3K8ZA 1Z5CA 2C9OA 3SARA 1XNQM 4R71A 2JZ0A 3E9SA 1TGUA 2XEPA 3U5ZB 1N34M 5ITQA 3GPYA 3PNVA 2Z3XA 3SATA 2R18A 1ORYB 2OOBA 3A45A 5EXXA 3C3EA 1R2ZA 3W67A 3SAWA 4I81A 3J27B 3W0LB 2F5OA 1QUSA 3DFZA 3CTWB 5ITTA 2YR0A 1L2CA 1NJGA 1IN6A 2D7GA 1XNRM 4PDIA 2Z8YM 2OPFA 1G41A 4KO8A 2VQEM 5LMUM 1Z59A 4B7HA 4NC6A 4G4OA 1J5EM 4DR1M 1GO5A 3HU1A 1R2YA 4MGHA 3SASA 2QHOB 1T6OA 3DA1A 3Q8XA 1OAOC 4I5SA 4LJ9A 3HJQA 2QBYB 3KOXE 2RGOA 1PJSA 4DV5M 3AOGA 2JY7A 4JI5M 1K82A 1G8PA 1HNWM 4B7GA 5ITUA 2XGNA 4MGYE 1WJ7A 4D80A 1G59A 1L1ZA 5FTNA 2CHQA 1EFUB 2HWJA 4Y28F 4B3TM 1SXJA 2G5GX 1UM8A 4L4UA 4G4RA 4JV5M 1OIZA 4QOZC 2F5PA 3PVSA 4AKGA 3HGIA 3K9OA 1XHBA 4G6ZA 4M0WA 4F1IA 3C58A 2V1CA 2Y20A 4LRSA 1KYIA 2X49A 4MB7A 1IBLM 3C3DA 1LV7A 5BR8M 2JXNA 4B7FA 3HHXA 5IZ7D 3I4YA 1WGNA 1JR3D 1P3QQ 3B7ZA 3M7GA 3SHFA 1X37A 5F3WA 4LRTA 2Z4SA 1N77A 3LMMA 3KOYE 3LQQA 4FW9A 4IBJA 3GLGB 2KZUA 2DZNB 4IBEA 3SBJA 5EQTA 1VEKA 2DAKA 5C1BA 1E94E 3QWLA 3AL0C 1QQWA 3TWMA 3PNYA 4DR4M 2BNKA 1ZMWA 1DV0A 4QOSA 3TWLA 3RGSA 1PM5A 2F4VM 2CV0A 4JN6A 1XWIA 3WHLA 3B74A 5H37D 4FVMA 3UGJA 1HQCA 2XZUA 1GJSA 3FTEA 1H6UA 1Z5BA 2WSEF 3CF2A 2J7OA 4MM3B 1I4WA 1NV8A 1TTEA 3D8LA 4P16A 2R45A 1Q02A 1HNXM 5FLXS 1NSFA 4GHAA 3HJSA 2CRUA 2FNAA 4YHHM 2I7NA 3HY5A 2QNJA 1MN3A 4M9ZA 4FCTA 4X64M 2XLJA 4L8RC 3ZH9B 2XSZD 2YFQA 1ZV1A 2A5YB 3FYCA 3ZCBB 1IN7A 4AG6A 1D0MA 1IXSB 4LJ4A 1GABA 2FE8A 4LF8M 3FE3A 1N33M 3QAUA 3GQ3A 2UXCM 5ITRA 1W5TA 2C96A 4JI3M 4F2LA 1QZMA 4LY6A 3GLIA 1GVNA 3AOEC 3CF0A 3T38A 1IN5A 3U61B 4LG2A 5C18A 4TUWA 1FJGM 1XB2B 5EP2A 1VDLA 5EXPA 4DUYM 3ZC7B 5KQ8A 4G4NA 3GPPA 1UFZA 1L2DA 2UXBM 1JB0F 3FTCA 3FUTA 1OKSA 2CWBA 2O01F 5DNYA 3SAVA 3LQRA 1L8QA 4LGYA 3TQSA 1PJTA 3GPXA 2ZTCA 3L28A 4B3MM 4GIPA 1IN4A 1XXHA 4G3OA 2UUBM 4GKJM 1D0LA 2J7NA 3B9PA 4LZJA 3U6CA 2APLA 4FCWA 4AZFA 4QHSA 4M9XA 2QENA 3T6PA 2N35A 1IN8A 2K9DA 2P5TA 4AKHA 1NNJA 3CGWA 4DV6M 4YY3M 1Q3BA 4PCZA 4AQYM 2NQ8C 4GC9A 1XMOM 2Y21A 4ANRA 1PGYA 2F5QA 2DVWB 4ITQA 1TR8A 3SC3A 3JR5A 2DZOB 1CUKA 3OTOM 4GHLA 1EE8A 3UJNA 4P17A 3U60A 4WURA 2DKLA 4GH9A 5E26A 2BWEA 4FCVA 4UN2B 3GLFE 2V1UA 1Y8GA 3H4MA 3GLHA 4II7A 2L6OA 1TDZA 2HAKA 2BWBA 2M5ZA 2MROB 2CFOA 2RRUA 2VF7A 4OVZA 3L26A 4DV7M 2QP9X 2YQZA 5ITXE 1GJTA 4GITA 3PXGA 2UUAM 3U6EA 3IHPA 4R3DA 4OU7A 1SXJC 5FTLA 2KDLA 2QCUA 1YLAA 2D7EA 3FYDA 4JI2M 3I51A 2JNHA 3GO8A 3H4JA 2R6FA 1QUTA 2LHGA 3RGPA 1E9RA 1NV9A 2KXEA 3KP0E 3TL4X 1IQPA 4L16A 1OFIA 1NHGC 3IG5A 3GPUA 3SAUA 3K1JA 3TPZA 4XBOA 4PT5A 2R4JA 1Z6TA 2HCBA 2R44A 3C9PA 1IBKM 1QDTA 2ZANA 4X66M 4BBAA 2F5SA 2KW0A 4FWHA 3LCVB 3KOZE 3SHGB 1PRBA 1PJJA 4Q7JA 2G3QA 2K47A 3FUWA 3DOAA 4R7GA 1R6BX 4CGYB 3VKGA 2Y0QA 3VK8A 4LF6M 3J7BA 4D81A 1VQ1A 4X65M 4JI8M 1JR3A 4LFBM 4DR7M 3W68A 1N36M 1SG9A 3KDSE 4NSRA 4BLCA 3U5ZA 4LJ5A 1EIJA 2LNHC 1DO0A 4DR3M 1AUAA 3KSJA 4Z8XA 1Z5AA 1OFHA 3U6SA 2AHMA 5A2QS 3M0EA 3M6AA 1PJIA 1QDRA 4NOOB 1KFVA 2FFJA 3UMMA 3U6DA 1Q39A 2DHRA 4BB9A 2EKKA 4RF1A 4LFAM 3B89A 1DGFA 4QHTA 1HR0M 2LXEA 3B7QA 5EP4A 1NVMA 4DR6M 2YNMD 1DGGA 1MU5A 1ZMUA 3HHYA 3JAMS 2QSFX 5EP3A 1DGBA 2JP7A 4PD2A 3LVWA 3SYKA 2BJVA 2JA2A 1TH4A 3CF6E 3F92A 3GLFB 3GQ5A 2QBYA 3DZDA 3GRYA 3HKPA 4REZA 3MK6A 3K2LA 2CEAA 4LJ8A 1QAMA 1C7YA 4IBDA 3R8FA 4IBGA 4LF7M 1IBMM 1A5TA 2ZTDA 2DWNA 1AIPC 4LJAA 3KS4A 2ERCA 2XSZA 1V34A 2W82A 1QAQA 3L2AA 4DV4M 4JI1M 2LWXA 3I01M 4L78A 2ZM6M 1J09A 2JY8A 3J80S 3T1HM 2V6ZM 2R4EA 2DAGA 2KRUA 3MJ5A 4GRIA 3TWKA 2QZ4A 2L09A 3LCUA 2EUCA 3U6MA 4HLQA 3J2PB 4LCBA 1E32A 3I4VA 2KRKA 2VQFM 1SXJE 2RKOA 4DBGB 2L2DA 1IY1A 2D7HA 2KZSA 2R65A 8CATA 3HZJA 1HNZM 1YE9A 3TE6A 3E46A 1NNUC 1JQJC 2HKJA 1K3XA 3GRVA 1DO2A 4OW0A 3GLGA 2OQ4A 2Q2EB 1GL7A 1BVSA 2EO2A 2RGHA 3J81S 2LVNC 3KSXA 1D0KA 4JYAM 2XFTA 3LW5F 1XC8A 2QPAA 1IXRC 2LVPC 2KEBA 2UUCM 5JI2E 1VDDA 2L4FA 1OIPA 3KS8A 3FUUA 2WSCF 3W0FA 5JI3E 4DR5M 2DHYA 2LVOC 2O25A 5EXTA 1OTRA 3AFHA 1E9SA 1MX0A 3BBZA 1HT2E 4JI0M 4ZPXA 1IXZA 5IWAM 2C5RA 3A42A 2L4EA 5FTKA 2CHVA 1QYRA 4NSOB 2M60A 2C98A 1NHWC 1I94M 4B3RM 3FD9A 2GNOA 1TH3A
chains in the Genus database with same CATH topology
1TDHA 4NXNM 2BJWA 1NJFA 2H1RA 4FWGA 3GQ4A 4DV0M 5KO3A 4M0DA 3SMSA 4FD2A 4GKKM 3U61A 4RF0A 3HU3A 4IBKA 2CV1A 1QVRA 3FTFA 5FSWA 4LF5M 2XH9A 4EIWA 2XZFA 4M9SA 4KODA 3SFZA 4LJ7A 1G4AE 1ZAEA 4IBIA 2UXDM 3NBIA 1NY5A 1GL6A 3GP1A 3LVVA 2FOIC 4DV1M 2Z4RA 1SXJB 3L25A 4IJFA 1HQYE 5FTJA 4A3VB 2E5LM 2DWMA 3SYLA 5BPVA 1DGHA 2HL7A 1OJLA 3EIEA 2CV2A 4JXJA 4I8OA 3T15A 4D82A 1TH2A 3KP1E 1N78A 4X62M 1G3IA 3ILKA 1XMQM 2Y0TA 2Z7JA 2ZBKB 3EIHA 2F5NA 1YSYA 4MGZE 2CUZA 1D2NA 4GMQA 3A46A 1GKIA 2C9CA 4JI6M 3PFIA 4B08A 1WXQA 2L7IA 3HU2A 3FTDA 5IREB 4DR2M 3A98B 3U6LA 3MHVC 5EXSA 2X4AA 4NL4H 4GC5A 3RE8A 3SMPA 2CHGA 3U6OA 4Z6YA 5E6JA 5GKNA 4S12A 2EA0A 3UK6A 3GRRA 4DUZM 4NRWA 1FNNA 4MH0E 3KOWE 3VDPA 3KXEC 5DYIA 3J7AS 4AW4A 2DWZB 4KLNA 3K92A 1KSFX 1R7RA 4QNMA 2C99A 4L15A 1IY2A 4QNRA 3KW6A 3FUXA 4LJ6A 3GRUA 3HHZA 1QAOA 4PDGA 1SXJD 3UZUA 4KHPM 3HHWA 2O5RA 3VK7A 1Q3CA 4OX9M 4AKIA 3GLIB 4NRVA 1N32M 2R62A 1GLNA 4JI4M 2HHHM 4IIWA 3JR4A 5EJCA 4AG5A 4IBBA 3VKHA 3KVWA 7CATA 2DWLA 1IY0A 2I7PA 4JI7M 3WHKA 2G8LA 4MGIE 1XXHB 4WW0A 3AKZA 1IM2A 4DV3M 4LF9M 5EP1A 5KPTA 1QANA 3VLFB 3GLFA 4LF4M 3E4RA 1T3TA 4LZZA 4CISA 3AV0A 1L1TA 1L2BA 2DXIA 5ITXA 1N75A 5KPZA 4NXMM 3NWLA 3U60B 3D8BA 4IJEA 3U6PA 4LFCM 5IT9S 4IBCA 3L29A 3HWSA 3HJ8A 3U6QA 3GLHB 4B3SM 2ZAOA 4OVZB 4HL4A 2LH0A 4LGMA 4W5WA 3BOSA 5DYGA 4IBFA 3AJIB 5FTMA 3THGA 1ZQ9A 5LMNM 1J7KA 2R46A 2ZAMA 4I4LA 5ITYA 4RNAA 3VDUA 5KQDA 3R9XB 3RFWA 3FUVA 4XGIA 1W5SA 2XF3A 1K3WA 4K0KM 2VIIA 1S3SA 4FWDA 2X8AA 4DV2M 2L7HA 1DGHB 4AI6A 1NY6A 4CHTB 3KFUG 2UU9M 1C1KA 1YUBA 3L27A 4MGKE 1HT1E 4G4QA 3FKEA 2CE7A 3VFDA 5KPRA 3AOEA 3IG8A 2KA6B 2XFSA 3T1YM 3K8ZA 1Z5CA 2C9OA 3SARA 1XNQM 1N34M 3E9SA 1TGUA 2XEPA 3U5ZB 5ITQA 3GPYA 3PNVA 2Z3XA 3SATA 2R18A 1ORYB 3A45A 5EXXA 1R2ZA 3SAWA 4I81A 3J27B 3W0LB 2F5OA 3DFZA 3CTWB 5ITTA 2YR0A 1L2CA 1NJGA 1IN6A 2D7GA 1XNRM 4PDIA 2OPFA 1G41A 4KO8A 2VQEM 5LMUM 1Z59A 4B7HA 4G4OA 1J5EM 4DR1M 3HU1A 1R2YA 4MGHA 3SASA 3DA1A 3Q8XA 4I5SA 4LJ9A 3HJQA 2QBYB 3KOXE 2RGOA 4DV5M 3AOGA 4JI5M 1K82A 1G8PA 1HNWM 4B7GA 5ITUA 2XGNA 4MGYE 1G59A 4D80A 1L1ZA 5FTNA 2CHQA 4B3TM 1SXJA 2G5GX 1UM8A 4L4UA 4G4RA 4JV5M 4QOZC 2F5PA 3PVSA 4AKGA 3HGIA 4G6ZA 1XHBA 3C58A 4M0WA 2V1CA 2Y20A 4LRSA 1KYIA 2X49A 4MB7A 1IBLM 1LV7A 5BR8M 4B7FA 3HHXA 5IZ7D 3I4YA 1JR3D 3M7GA 3SHFA 1X37A 5F3WA 4LRTA 2Z4SA 1N77A 3LMMA 3KOYE 3LQQA 4FW9A 4IBJA 3GLGB 2KZUA 2DZNB 4IBEA 3SBJA 5EQTA 5C1BA 1E94E 3QWLA 3AL0C 1QQWA 3TWMA 3PNYA 4DR4M 2BNKA 4QOSA 3TWLA 3RGSA 1PM5A 2F4VM 2CV0A 4JN6A 1XWIA 3WHLA 5H37D 4FVMA 3UGJA 1HQCA 2XZUA 3FTEA 1H6UA 1Z5BA 3CF2A 2J7OA 4MM3B 1I4WA 3D8LA 4P16A 2R45A 1HNXM 5FLXS 1NSFA 4GHAA 3HJSA 2FNAA 4YHHM 2I7NA 4M9ZA 4FCTA 4X64M 2XLJA 4L8RC 3ZH9B 2XSZD 2YFQA 2A5YB 3FYCA 3ZCBB 1IN7A 4AG6A 1IXSB 4LJ4A 2FE8A 4LF8M 1N33M 3QAUA 3GQ3A 2UXCM 5ITRA 1W5TA 2C96A 4JI3M 3GLIA 1QZMA 4LY6A 3U61B 1GVNA 3AOEC 3CF0A 3T38A 1IN5A 4TUWA 4LG2A 5C18A 1FJGM 5EP2A 5EXPA 4DUYM 4G4NA 3ZC7B 5KQ8A 3GPPA 2UXBM 1L2DA 3FTCA 3FUTA 5DNYA 3SAVA 3LQRA 1L8QA 4LGYA 3TQSA 3GPXA 3L28A 4B3MM 4GIPA 1IN4A 1XXHA 2UUBM 4GKJM 3B9PA 2J7NA 4LZJA 3U6CA 4FCWA 4AZFA 4QHSA 4M9XA 2QENA 1IN8A 2P5TA 4AKHA 1NNJA 4DV6M 4YY3M 1Q3BA 4PCZA 4AQYM 2NQ8C 4GC9A 1XMOM 2Y21A 2F5QA 2DVWB 4ITQA 3SC3A 3JR5A 2DZOB 3OTOM 4GHLA 1EE8A 3UJNA 3U60A 4WURA 4GH9A 5E26A 4FCVA 2V1UA 3H4MA 3GLHA 4II7A 2L6OA 1TDZA 2M5ZA 3L26A 2CFOA 4OVZA 4DV7M 2QP9X 2YQZA 5ITXE 4GITA 3PXGA 2UUAM 3U6EA 4R3DA 4OU7A 1SXJC 5FTLA 2QCUA 2D7EA 3FYDA 4JI2M 3I51A 3GO8A 3RGPA 3KP0E 2KXEA 3TL4X 1IQPA 4L16A 1OFIA 1NHGC 3IG5A 3GPUA 3SAUA 3K1JA 3TPZA 4XBOA 4PT5A 2R4JA 1Z6TA 2HCBA 1IBKM 2ZANA 4X66M 4BBAA 2F5SA 2KW0A 4FWHA 3KOZE 3SHGB 1PJJA 2K47A 3FUWA 3DOAA 4R7GA 1R6BX 4CGYB 3VKGA 2Y0QA 3VK8A 4LF6M 3J7BA 4D81A 4X65M 4JI8M 1JR3A 4LFBM 4DR7M 1N36M 4NSRA 3KDSE 4BLCA 3U5ZA 4LJ5A 2LNHC 1DO0A 4DR3M 3KSJA 4Z8XA 1Z5AA 1OFHA 3U6SA 2AHMA 5A2QS 3M0EA 3M6AA 1PJIA 1KFVA 4NOOB 2FFJA 3UMMA 3U6DA 1Q39A 2DHRA 4BB9A 4RF1A 4LFAM 4QHTA 1DGFA 1HR0M 2LXEA 5EP4A 1NVMA 4DR6M 2YNMD 1DGGA 1MU5A 3HHYA 3JAMS 5EP3A 1DGBA 4PD2A 3LVWA 3SYKA 2BJVA 2JA2A 1TH4A 3CF6E 3GLFB 3GQ5A 2QBYA 3DZDA 3GRYA 3HKPA 4REZA 3MK6A 3K2LA 2CEAA 4LJ8A 1QAMA 4IBDA 3R8FA 4IBGA 4LF7M 1IBMM 2DWNA 4LJAA 3KS4A 2ERCA 2XSZA 2W82A 3L2AA 1QAQA 4DV4M 4JI1M 2LWXA 4L78A 2ZM6M 1J09A 3J80S 3T1HM 2V6ZM 2R4EA 2KRUA 3MJ5A 4GRIA 3TWKA 2QZ4A 2L09A 2EUCA 3U6MA 4HLQA 3J2PB 4LCBA 1E32A 3I4VA 2KRKA 2VQFM 1SXJE 2RKOA 1IY1A 2D7HA 2KZSA 2R65A 8CATA 1HNZM 1YE9A 3TE6A 1NNUC 1JQJC 2HKJA 1K3XA 3GRVA 1DO2A 4OW0A 3GLGA 2OQ4A 2Q2EB 1GL7A 2EO2A 2RGHA 3J81S 3KSXA 4JYAM 2XFTA 1XC8A 2QPAA 1IXRC 2KEBA 2UUCM 5JI2E 1VDDA 3KS8A 3FUUA 5JI3E 3W0FA 4DR5M 5EXTA 3AFHA 1E9SA 1MX0A 1HT2E 4JI0M 4ZPXA 1IXZA 5IWAM 2C5RA 3A42A 5FTKA 2CHVA 1QYRA 4NSOB 2M60A 2C98A 1NHWC 1I94M 4B3RM 3FD9A 1E9RA 1TH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 M;  4LF4 M;  1TDH A;  4NXN M;  1IBK M;  4X66 M;  2F5S A;  3GQ4 A;  4CIS A;  4DV0 M;  3J7A S;  1L1T A;  1L2B A;  4GKK M;  5ITX A;  1PJJ A;  4NXM M;  3DOA A;  3SBJ A;  3U6P A;  3VK8 A;  4LF5 M;  4LF6 M;  4LFC M;  5IT9 S;  4X65 M;  3TWM A;  2XZF A;  4JI8 M;  4DR4 M;  4LFB M;  3TWL A;  1PM5 A;  2F4V M;  4DR7 M;  3U6Q A;  1N36 M;  4DR3 M;  4B3S M;  2UXD M;  1Z5A A;  2XZU A;  3U6S A;  5A2Q S;  1PJI A;  1Z5B A;  1KFV A;  3GP1 A;  3U6D A;  1Q39 A;  4DV1 M;  5LMN M;  4LFA M;  5ITY A;  2E5L M;  1HR0 M;  1HNX M;  4DR6 M;  5FLX S;  1MU5 A;  4YHH M;  1K3W A;  3JAM S;  4K0K M;  4X62 M;  4X64 M;  4PD2 A;  1XMQ M;  2ZBK B;  2F5N A;  3GQ5 A;  4DV2 M;  4LF8 M;  1N33 M;  3A46 A;  3GQ3 A;  4JI6 M;  2UXC M;  5ITR A;  2UU9 M;  4LF7 M;  1IBM M;  4JI3 M;  4G4Q A;  4DR2 M;  3U6L A;  1FJG M;  4DV4 M;  4JI1 M;  4G4N A;  4DUY M;  2ZM6 M;  3T1Y M;  3GPP A;  2UXB M;  1L2D A;  1Z5C A;  3J80 S;  3SAR A;  1XNQ M;  3T1H M;  1N34 M;  3SAV A;  3GPX A;  3U6O A;  5ITQ A;  3GPY A;  3TWK A;  3SAT A;  4B3M M;  3A45 A;  2EA0 A;  3U6M A;  3U6C A;  2UUB M;  1R2Z A;  4GKJ M;  4DUZ M;  4NRW A;  3SAW A;  2F5O A;  2VQF M;  5ITT A;  1NNJ A;  1L2C A;  4DV6 M;  4YY3 M;  1HNZ M;  1Q3B A;  4PCZ A;  4AQY M;  1XNR M;  4PDI A;  2OPF A;  1XMO M;  2VQE M;  2HKJ A;  5LMU M;  4G4O A;  1Z59 A;  3JR5 A;  1K3X A;  1J5E M;  3OTO M;  2F5Q A;  2OQ4 A;  4DR1 M;  1EE8 A;  1R2Y A;  3SAS A;  2Q2E B;  3J81 S;  4JYA M;  1XC8 A;  4ITQ A;  1TDZ A;  4PDG A;  2UUC M;  4KHP M;  4DV5 M;  4JI5 M;  3W0F A;  4DV7 M;  1Q3C A;  5ITX E;  4DR5 M;  3VK7 A;  5ITU A;  1K82 A;  4OX9 M;  1HNW M;  4NRV A;  2UUA M;  1N32 M;  3U6E A;  1L1Z A;  4JI4 M;  1MX0 A;  2HHH M;  4JI0 M;  4JI2 M;  3JR4 A;  4B3T M;  5IWA M;  3GO8 A;  3A42 A;  4JV5 M;  4G4R A;  4JI7 M;  2F5P A;  3C58 A;  1I94 M;  4DV3 M;  4MB7 A;  3GPU A;  4LF9 M;  1IBL M;  3SAU A;  4B3R M; 
#chains in the Genus database with same CATH topology
 1TDH A;  4NXN M;  2BJW A;  1NJF A;  2H1R A;  1IXS A;  2DAM A;  4FWG A;  2H5X A;  3GQ4 A;  4DV0 M;  5KO3 A;  4M0D A;  3SMS A;  4FD2 A;  4HEO A;  4GKK M;  1F4I A;  3U61 A;  4RF0 A;  1VG5 A;  3HU3 A;  4IBK A;  2CV1 A;  1QVR A;  3FTF A;  5FSW A;  4LF5 M;  2XH9 A;  4EIW A;  2XZF A;  2MH8 A;  3QYB A;  4KOD A;  4M9S A;  4RKU F;  2JY5 A;  3SFZ A;  4LJ7 A;  1G4A E;  1ZAE A;  4IBI A;  2UXD M;  3NBI A;  1NY5 A;  1GL6 A;  1G71 A;  2DAE A;  2LVQ D;  3GP1 A;  1LTM A;  2EKF A;  4GEW A;  3LVV A;  2FOI C;  4DV1 M;  2Z4R A;  1SXJ B;  3L25 A;  4IJF A;  1HQY E;  4L6V 6;  5FTJ A;  4A3V B;  2E5L M;  2DWM A;  3SYL A;  5BPV A;  1DGH A;  2FS1 A;  2HL7 A;  2R0I A;  1OJL A;  3EIE A;  3HX3 A;  4JXJ A;  4I8O A;  1XXH E;  3T15 A;  4D82 A;  2CV2 A;  1TH2 A;  3KP1 E;  1N78 A;  2MJ5 B;  4X62 M;  1G3I A;  3ILK A;  1XMQ M;  2Y0T A;  2Z7J A;  2ZBK B;  3EIH A;  2F5N A;  1YSY A;  4MGZ E;  1R5L A;  1TF0 B;  2CUZ A;  2K6B A;  1D2N A;  4GMQ A;  3A46 A;  1GKI A;  2C9C A;  4XK8 F;  4JI6 M;  3PFI A;  4B08 A;  1WXQ A;  2L7I A;  3QYE A;  3HU2 A;  3FRI A;  3FTD A;  2LBC A;  3A98 B;  5IRE B;  4DR2 M;  3U6L A;  2MGW A;  3MHV C;  5EXS A;  5DFL A;  2X4A A;  5L8R F;  4NL4 H;  3GLH E;  4GC5 A;  3RE8 A;  3SMP A;  2CHG A;  1WR1 B;  3U6O A;  4Z6Y A;  5E6J A;  5GKN A;  1WHC A;  2DEN A;  4S12 A;  3UK6 A;  2EA0 A;  2DI0 A;  3FRH A;  3GRR A;  4DUZ M;  4NRW A;  1FNN A;  3V76 A;  4MH0 E;  2LTU A;  3KOW E;  3VDP A;  3KXE C;  2KNZ A;  2EJS A;  2GQF A;  5DYI A;  3J7A S;  4AW4 A;  2DWZ B;  3BXW A;  4KLN A;  2WSF F;  3K92 A;  1KSF X;  1R7R A;  4QNM A;  2C99 A;  4L15 A;  1IY2 A;  1ZMV A;  3KW6 A;  4QNR A;  3FUX A;  1NO1 A;  2FH0 A;  3MMP A;  4LJ6 A;  3GRU A;  3HHZ A;  2LVA A;  1QAO A;  4PDG A;  1SXJ D;  1IFY A;  3UZU A;  4KHP M;  3HHW A;  2O5R A;  3VK7 A;  1Q3C A;  4OX9 M;  4AKI A;  3GLI B;  3IEC A;  4NRV A;  1N32 M;  2R62 A;  1GLN A;  4JI4 M;  2JY6 B;  2HHH M;  3I04 M;  1V92 A;  2DAI A;  2J5Y A;  4IIW A;  3JR4 A;  5EJC A;  1JR3 E;  4IBB A;  4AG5 A;  2LHC A;  2KNA A;  3VKH A;  2JWS A;  3KVW A;  4CIZ A;  7CAT A;  2DWL A;  1IY0 A;  2I7P A;  2KHH A;  3WHK A;  2G8L A;  4KT0 F;  1OAI A;  4JI7 M;  2QQ8 A;  4MGI E;  1XXH B;  4WW0 A;  4CJ6 A;  3AKZ A;  1IM2 A;  4DV3 M;  4LF9 M;  1HJP A;  5EP1 A;  5KPT A;  1QAN A;  3VLF B;  2OOA A;  3B7N A;  3GLF A;  3E4R A;  4LF4 M;  1T3T A;  2KNV A;  4LZZ A;  4CIS A;  2B3T A;  3AV0 A;  1L1T A;  1L2B A;  2DXI A;  1R4G A;  5ITX A;  2VF8 A;  1WIV A;  1N75 A;  5KPZ A;  4NXM M;  3NWL A;  2MR9 A;  3U60 B;  3D8B A;  4IJE A;  3U6P A;  2DZL A;  4LFC M;  5IT9 S;  1VEG A;  4IBC A;  3L29 A;  3Q8G A;  3HWS A;  2K0B X;  1QZE A;  1T43 A;  3HJ8 A;  3U6Q A;  3GLH B;  1V33 A;  4B3S M;  2ZAO A;  4OVZ B;  4HL4 A;  2LH0 A;  4LGM A;  4W5W A;  3BOS A;  5DYG A;  4IBF A;  2JUJ A;  1OQY A;  3ZQJ A;  3AJI B;  5FTM A;  3THG A;  1ZQ9 A;  3NBX X;  1WGL A;  5LMN M;  1J7K A;  2R46 A;  2ZAM A;  4I4L A;  5ITY A;  2VDB B;  4RNA A;  3VDU A;  5KQD A;  2JZ1 A;  1VEJ A;  3R9X B;  3RFW A;  3FUV A;  4XGI A;  1W5S A;  2XF3 A;  1K3W A;  4K0K M;  2OO9 A;  2VII A;  1S3S A;  4FWD A;  2X8A A;  4WP2 A;  3E21 A;  4DV2 M;  1PJQ A;  2L7H A;  1DGH B;  4AI6 A;  2WZJ A;  1NY6 A;  4CHT B;  3KFU G;  1RU3 A;  1C1K A;  2UU9 M;  1YUB A;  3L27 A;  4MGK E;  1HT1 E;  3GLG E;  3GLI E;  4G4Q A;  3FKE A;  2CE7 A;  3VFD A;  5KPR A;  3AOE A;  3IG8 A;  3K9P A;  2DNA A;  2KA6 B;  2XFS A;  2CP8 A;  3T1Y M;  1MJG M;  3K8Z A;  1Z5C A;  2C9O A;  3SAR A;  1XNQ M;  4R71 A;  2JZ0 A;  3E9S A;  1TGU A;  2XEP A;  3U5Z B;  1N34 M;  5ITQ A;  3GPY A;  3PNV A;  2Z3X A;  3SAT A;  2R18 A;  1ORY B;  2OOB A;  3A45 A;  5EXX A;  3C3E A;  1R2Z A;  3W67 A;  3SAW A;  4I81 A;  3J27 B;  3W0L B;  2F5O A;  1QUS A;  3DFZ A;  3CTW B;  5ITT A;  2YR0 A;  1L2C A;  1NJG A;  1IN6 A;  2D7G A;  1XNR M;  4PDI A;  2Z8Y M;  2OPF A;  1G41 A;  4KO8 A;  2VQE M;  5LMU M;  1Z59 A;  4B7H A;  4NC6 A;  4G4O A;  1J5E M;  4DR1 M;  1GO5 A;  3HU1 A;  1R2Y A;  4MGH A;  3SAS A;  2QHO B;  1T6O A;  3DA1 A;  3Q8X A;  1OAO C;  4I5S A;  4LJ9 A;  3HJQ A;  2QBY B;  3KOX E;  2RGO A;  1PJS A;  4DV5 M;  3AOG A;  2JY7 A;  4JI5 M;  1K82 A;  1G8P A;  1HNW M;  4B7G A;  5ITU A;  2XGN A;  4MGY E;  1WJ7 A;  4D80 A;  1G59 A;  1L1Z A;  5FTN A;  2CHQ A;  1EFU B;  2HWJ A;  4Y28 F;  4B3T M;  1SXJ A;  2G5G X;  1UM8 A;  4L4U A;  4G4R A;  4JV5 M;  1OIZ A;  4QOZ C;  2F5P A;  3PVS A;  4AKG A;  3HGI A;  3K9O A;  1XHB A;  4G6Z A;  4M0W A;  4F1I A;  3C58 A;  2V1C A;  2Y20 A;  4LRS A;  1KYI A;  2X49 A;  4MB7 A;  1IBL M;  3C3D A;  1LV7 A;  5BR8 M;  2JXN A;  4B7F A;  3HHX A;  5IZ7 D;  3I4Y A;  1WGN A;  1JR3 D;  1P3Q Q;  3B7Z A;  3M7G A;  3SHF A;  1X37 A;  5F3W A;  4LRT A;  2Z4S A;  1N77 A;  3LMM A;  3KOY E;  3LQQ A;  4FW9 A;  4IBJ A;  3GLG B;  2KZU A;  2DZN B;  4IBE A;  3SBJ A;  5EQT A;  1VEK A;  2DAK A;  5C1B A;  1E94 E;  3QWL A;  3AL0 C;  1QQW A;  3TWM A;  3PNY A;  4DR4 M;  2BNK A;  1ZMW A;  1DV0 A;  4QOS A;  3TWL A;  3RGS A;  1PM5 A;  2F4V M;  2CV0 A;  4JN6 A;  1XWI A;  3WHL A;  3B74 A;  5H37 D;  4FVM A;  3UGJ A;  1HQC A;  2XZU A;  1GJS A;  3FTE A;  1H6U A;  1Z5B A;  2WSE F;  3CF2 A;  2J7O A;  4MM3 B;  1I4W A;  1NV8 A;  1TTE A;  3D8L A;  4P16 A;  2R45 A;  1Q02 A;  1HNX M;  5FLX S;  1NSF A;  4GHA A;  3HJS A;  2CRU A;  2FNA A;  4YHH M;  2I7N A;  3HY5 A;  2QNJ A;  1MN3 A;  4M9Z A;  4FCT A;  4X64 M;  2XLJ A;  4L8R C;  3ZH9 B;  2XSZ D;  2YFQ A;  1ZV1 A;  2A5Y B;  3FYC A;  3ZCB B;  1IN7 A;  4AG6 A;  1D0M A;  1IXS B;  4LJ4 A;  1GAB A;  2FE8 A;  4LF8 M;  3FE3 A;  1N33 M;  3QAU A;  3GQ3 A;  2UXC M;  5ITR A;  1W5T A;  2C96 A;  4JI3 M;  4F2L A;  1QZM A;  4LY6 A;  3GLI A;  1GVN A;  3AOE C;  3CF0 A;  3T38 A;  1IN5 A;  3U61 B;  4LG2 A;  5C18 A;  4TUW A;  1FJG M;  1XB2 B;  5EP2 A;  1VDL A;  5EXP A;  4DUY M;  3ZC7 B;  5KQ8 A;  4G4N A;  3GPP A;  1UFZ A;  1L2D A;  2UXB M;  1JB0 F;  3FTC A;  3FUT A;  1OKS A;  2CWB A;  2O01 F;  5DNY A;  3SAV A;  3LQR A;  1L8Q A;  4LGY A;  3TQS A;  1PJT A;  3GPX A;  2ZTC A;  3L28 A;  4B3M M;  4GIP A;  1IN4 A;  1XXH A;  4G3O A;  2UUB M;  4GKJ M;  1D0L A;  2J7N A;  3B9P A;  4LZJ A;  3U6C A;  2APL A;  4FCW A;  4AZF A;  4QHS A;  4M9X A;  2QEN A;  3T6P A;  2N35 A;  1IN8 A;  2K9D A;  2P5T A;  4AKH A;  1NNJ A;  3CGW A;  4DV6 M;  4YY3 M;  1Q3B A;  4PCZ A;  4AQY M;  2NQ8 C;  4GC9 A;  1XMO M;  2Y21 A;  4ANR A;  1PGY A;  2F5Q A;  2DVW B;  4ITQ A;  1TR8 A;  3SC3 A;  3JR5 A;  2DZO B;  1CUK A;  3OTO M;  4GHL A;  1EE8 A;  3UJN A;  4P17 A;  3U60 A;  4WUR A;  2DKL A;  4GH9 A;  5E26 A;  2BWE A;  4FCV A;  4UN2 B;  3GLF E;  2V1U A;  1Y8G A;  3H4M A;  3GLH A;  4II7 A;  2L6O A;  1TDZ A;  2HAK A;  2BWB A;  2M5Z A;  2MRO B;  2CFO A;  2RRU A;  2VF7 A;  4OVZ A;  3L26 A;  4DV7 M;  2QP9 X;  2YQZ A;  5ITX E;  1GJT A;  4GIT A;  3PXG A;  2UUA M;  3U6E A;  3IHP A;  4R3D A;  4OU7 A;  1SXJ C;  5FTL A;  2KDL A;  2QCU A;  1YLA A;  2D7E A;  3FYD A;  4JI2 M;  3I51 A;  2JNH A;  3GO8 A;  3H4J A;  2R6F A;  1QUT A;  2LHG A;  3RGP A;  1E9R A;  1NV9 A;  2KXE A;  3KP0 E;  3TL4 X;  1IQP A;  4L16 A;  1OFI A;  1NHG C;  3IG5 A;  3GPU A;  3SAU A;  3K1J A;  3TPZ A;  4XBO A;  4PT5 A;  2R4J A;  1Z6T A;  2HCB A;  2R44 A;  3C9P A;  1IBK M;  1QDT A;  2ZAN A;  4X66 M;  4BBA A;  2F5S A;  2KW0 A;  4FWH A;  3LCV B;  3KOZ E;  3SHG B;  1PRB A;  1PJJ A;  4Q7J A;  2G3Q A;  2K47 A;  3FUW A;  3DOA A;  4R7G A;  1R6B X;  4CGY B;  3VKG A;  2Y0Q A;  3VK8 A;  4LF6 M;  3J7B A;  4D81 A;  1VQ1 A;  4X65 M;  4JI8 M;  1JR3 A;  4LFB M;  4DR7 M;  3W68 A;  1N36 M;  1SG9 A;  3KDS E;  4NSR A;  4BLC A;  3U5Z A;  4LJ5 A;  1EIJ A;  2LNH C;  1DO0 A;  4DR3 M;  1AUA A;  3KSJ A;  4Z8X A;  1Z5A A;  1OFH A;  3U6S A;  2AHM A;  5A2Q S;  3M0E A;  3M6A A;  1PJI A;  1QDR A;  4NOO B;  1KFV A;  2FFJ A;  3UMM A;  3U6D A;  1Q39 A;  2DHR A;  4BB9 A;  2EKK A;  4RF1 A;  4LFA M;  3B89 A;  1DGF A;  4QHT A;  1HR0 M;  2LXE A;  3B7Q A;  5EP4 A;  1NVM A;  4DR6 M;  2YNM D;  1DGG A;  1MU5 A;  1ZMU A;  3HHY A;  3JAM S;  2QSF X;  5EP3 A;  1DGB A;  2JP7 A;  4PD2 A;  3LVW A;  3SYK A;  2BJV A;  2JA2 A;  1TH4 A;  3CF6 E;  3F92 A;  3GLF B;  3GQ5 A;  2QBY A;  3DZD A;  3GRY A;  3HKP A;  4REZ A;  3MK6 A;  3K2L A;  2CEA A;  4LJ8 A;  1QAM A;  1C7Y A;  4IBD A;  3R8F A;  4IBG A;  4LF7 M;  1IBM M;  1A5T A;  2ZTD A;  2DWN A;  1AIP C;  4LJA A;  3KS4 A;  2ERC A;  2XSZ A;  1V34 A;  2W82 A;  1QAQ A;  3L2A A;  4DV4 M;  4JI1 M;  2LWX A;  3I01 M;  4L78 A;  2ZM6 M;  1J09 A;  2JY8 A;  3J80 S;  3T1H M;  2V6Z M;  2R4E A;  2DAG A;  2KRU A;  3MJ5 A;  4GRI A;  3TWK A;  2QZ4 A;  2L09 A;  3LCU A;  2EUC A;  3U6M A;  4HLQ A;  3J2P B;  4LCB A;  1E32 A;  3I4V A;  2KRK A;  2VQF M;  1SXJ E;  2RKO A;  4DBG B;  2L2D A;  1IY1 A;  2D7H A;  2KZS A;  2R65 A;  8CAT A;  3HZJ A;  1HNZ M;  1YE9 A;  3TE6 A;  3E46 A;  1NNU C;  1JQJ C;  2HKJ A;  1K3X A;  3GRV A;  1DO2 A;  4OW0 A;  3GLG A;  2OQ4 A;  2Q2E B;  1GL7 A;  1BVS A;  2EO2 A;  2RGH A;  3J81 S;  2LVN C;  3KSX A;  1D0K A;  4JYA M;  2XFT A;  3LW5 F;  1XC8 A;  2QPA A;  1IXR C;  2LVP C;  2KEB A;  2UUC M;  5JI2 E;  1VDD A;  2L4F A;  1OIP A;  3KS8 A;  3FUU A;  2WSC F;  3W0F A;  5JI3 E;  4DR5 M;  2DHY A;  2LVO C;  2O25 A;  5EXT A;  1OTR A;  3AFH A;  1E9S A;  1MX0 A;  3BBZ A;  1HT2 E;  4JI0 M;  4ZPX A;  1IXZ A;  5IWA M;  2C5R A;  3A42 A;  2L4E A;  5FTK A;  2CHV A;  1QYR A;  4NSO B;  2M60 A;  2C98 A;  1NHW C;  1I94 M;  4B3R M;  3FD9 A;  2GNO A;  1TH3 A; 
#chains in the Genus database with same CATH homology
 1TDH A;  4NXN M;  2BJW A;  1NJF A;  2H1R A;  4FWG A;  3GQ4 A;  4DV0 M;  5KO3 A;  4M0D A;  3SMS A;  4FD2 A;  4GKK M;  3U61 A;  4RF0 A;  3HU3 A;  4IBK A;  2CV1 A;  1QVR A;  3FTF A;  5FSW A;  4LF5 M;  2XH9 A;  4EIW A;  2XZF A;  4M9S A;  4KOD A;  3SFZ A;  4LJ7 A;  1G4A E;  1ZAE A;  4IBI A;  2UXD M;  3NBI A;  1NY5 A;  1GL6 A;  3GP1 A;  3LVV A;  2FOI C;  4DV1 M;  2Z4R A;  1SXJ B;  3L25 A;  4IJF A;  1HQY E;  5FTJ A;  4A3V B;  2E5L M;  2DWM A;  3SYL A;  5BPV A;  1DGH A;  2HL7 A;  1OJL A;  3EIE A;  2CV2 A;  4JXJ A;  4I8O A;  3T15 A;  4D82 A;  1TH2 A;  3KP1 E;  1N78 A;  4X62 M;  1G3I A;  3ILK A;  1XMQ M;  2Y0T A;  2Z7J A;  2ZBK B;  3EIH A;  2F5N A;  1YSY A;  4MGZ E;  2CUZ A;  1D2N A;  4GMQ A;  3A46 A;  1GKI A;  2C9C A;  4JI6 M;  3PFI A;  4B08 A;  1WXQ A;  2L7I A;  3HU2 A;  3FTD A;  5IRE B;  4DR2 M;  3A98 B;  3U6L A;  3MHV C;  5EXS A;  2X4A A;  4NL4 H;  4GC5 A;  3RE8 A;  3SMP A;  2CHG A;  3U6O A;  4Z6Y A;  5E6J A;  5GKN A;  4S12 A;  2EA0 A;  3UK6 A;  3GRR A;  4DUZ M;  4NRW A;  1FNN A;  4MH0 E;  3KOW E;  3VDP A;  3KXE C;  5DYI A;  3J7A S;  4AW4 A;  2DWZ B;  4KLN A;  3K92 A;  1KSF X;  1R7R A;  4QNM A;  2C99 A;  4L15 A;  1IY2 A;  4QNR A;  3KW6 A;  3FUX A;  4LJ6 A;  3GRU A;  3HHZ A;  1QAO A;  4PDG A;  1SXJ D;  3UZU A;  4KHP M;  3HHW A;  2O5R A;  3VK7 A;  1Q3C A;  4OX9 M;  4AKI A;  3GLI B;  4NRV A;  1N32 M;  2R62 A;  1GLN A;  4JI4 M;  2HHH M;  4IIW A;  3JR4 A;  5EJC A;  4AG5 A;  4IBB A;  3VKH A;  3KVW A;  7CAT A;  2DWL A;  1IY0 A;  2I7P A;  4JI7 M;  3WHK A;  2G8L A;  4MGI E;  1XXH B;  4WW0 A;  3AKZ A;  1IM2 A;  4DV3 M;  4LF9 M;  5EP1 A;  5KPT A;  1QAN A;  3VLF B;  3GLF A;  4LF4 M;  3E4R A;  1T3T A;  4LZZ A;  4CIS A;  3AV0 A;  1L1T A;  1L2B A;  2DXI A;  5ITX A;  1N75 A;  5KPZ A;  4NXM M;  3NWL A;  3U60 B;  3D8B A;  4IJE A;  3U6P A;  4LFC M;  5IT9 S;  4IBC A;  3L29 A;  3HWS A;  3HJ8 A;  3U6Q A;  3GLH B;  4B3S M;  2ZAO A;  4OVZ B;  4HL4 A;  2LH0 A;  4LGM A;  4W5W A;  3BOS A;  5DYG A;  4IBF A;  3AJI B;  5FTM A;  3THG A;  1ZQ9 A;  5LMN M;  1J7K A;  2R46 A;  2ZAM A;  4I4L A;  5ITY A;  4RNA A;  3VDU A;  5KQD A;  3R9X B;  3RFW A;  3FUV A;  4XGI A;  1W5S A;  2XF3 A;  1K3W A;  4K0K M;  2VII A;  1S3S A;  4FWD A;  2X8A A;  4DV2 M;  2L7H A;  1DGH B;  4AI6 A;  1NY6 A;  4CHT B;  3KFU G;  2UU9 M;  1C1K A;  1YUB A;  3L27 A;  4MGK E;  1HT1 E;  4G4Q A;  3FKE A;  2CE7 A;  3VFD A;  5KPR A;  3AOE A;  3IG8 A;  2KA6 B;  2XFS A;  3T1Y M;  3K8Z A;  1Z5C A;  2C9O A;  3SAR A;  1XNQ M;  1N34 M;  3E9S A;  1TGU A;  2XEP A;  3U5Z B;  5ITQ A;  3GPY A;  3PNV A;  2Z3X A;  3SAT A;  2R18 A;  1ORY B;  3A45 A;  5EXX A;  1R2Z A;  3SAW A;  4I81 A;  3J27 B;  3W0L B;  2F5O A;  3DFZ A;  3CTW B;  5ITT A;  2YR0 A;  1L2C A;  1NJG A;  1IN6 A;  2D7G A;  1XNR M;  4PDI A;  2OPF A;  1G41 A;  4KO8 A;  2VQE M;  5LMU M;  1Z59 A;  4B7H A;  4G4O A;  1J5E M;  4DR1 M;  3HU1 A;  1R2Y A;  4MGH A;  3SAS A;  3DA1 A;  3Q8X A;  4I5S A;  4LJ9 A;  3HJQ A;  2QBY B;  3KOX E;  2RGO A;  4DV5 M;  3AOG A;  4JI5 M;  1K82 A;  1G8P A;  1HNW M;  4B7G A;  5ITU A;  2XGN A;  4MGY E;  1G59 A;  4D80 A;  1L1Z A;  5FTN A;  2CHQ A;  4B3T M;  1SXJ A;  2G5G X;  1UM8 A;  4L4U A;  4G4R A;  4JV5 M;  4QOZ C;  2F5P A;  3PVS A;  4AKG A;  3HGI A;  4G6Z A;  1XHB A;  3C58 A;  4M0W A;  2V1C A;  2Y20 A;  4LRS A;  1KYI A;  2X49 A;  4MB7 A;  1IBL M;  1LV7 A;  5BR8 M;  4B7F A;  3HHX A;  5IZ7 D;  3I4Y A;  1JR3 D;  3M7G A;  3SHF A;  1X37 A;  5F3W A;  4LRT A;  2Z4S A;  1N77 A;  3LMM A;  3KOY E;  3LQQ A;  4FW9 A;  4IBJ A;  3GLG B;  2KZU A;  2DZN B;  4IBE A;  3SBJ A;  5EQT A;  5C1B A;  1E94 E;  3QWL A;  3AL0 C;  1QQW A;  3TWM A;  3PNY A;  4DR4 M;  2BNK A;  4QOS A;  3TWL A;  3RGS A;  1PM5 A;  2F4V M;  2CV0 A;  4JN6 A;  1XWI A;  3WHL A;  5H37 D;  4FVM A;  3UGJ A;  1HQC A;  2XZU A;  3FTE A;  1H6U A;  1Z5B A;  3CF2 A;  2J7O A;  4MM3 B;  1I4W A;  3D8L A;  4P16 A;  2R45 A;  1HNX M;  5FLX S;  1NSF A;  4GHA A;  3HJS A;  2FNA A;  4YHH M;  2I7N A;  4M9Z A;  4FCT A;  4X64 M;  2XLJ A;  4L8R C;  3ZH9 B;  2XSZ D;  2YFQ A;  2A5Y B;  3FYC A;  3ZCB B;  1IN7 A;  4AG6 A;  1IXS B;  4LJ4 A;  2FE8 A;  4LF8 M;  1N33 M;  3QAU A;  3GQ3 A;  2UXC M;  5ITR A;  1W5T A;  2C96 A;  4JI3 M;  3GLI A;  1QZM A;  4LY6 A;  3U61 B;  1GVN A;  3AOE C;  3CF0 A;  3T38 A;  1IN5 A;  4TUW A;  4LG2 A;  5C18 A;  1FJG M;  5EP2 A;  5EXP A;  4DUY M;  4G4N A;  3ZC7 B;  5KQ8 A;  3GPP A;  2UXB M;  1L2D A;  3FTC A;  3FUT A;  5DNY A;  3SAV A;  3LQR A;  1L8Q A;  4LGY A;  3TQS A;  3GPX A;  3L28 A;  4B3M M;  4GIP A;  1IN4 A;  1XXH A;  2UUB M;  4GKJ M;  3B9P A;  2J7N A;  4LZJ A;  3U6C A;  4FCW A;  4AZF A;  4QHS A;  4M9X A;  2QEN A;  1IN8 A;  2P5T A;  4AKH A;  1NNJ A;  4DV6 M;  4YY3 M;  1Q3B A;  4PCZ A;  4AQY M;  2NQ8 C;  4GC9 A;  1XMO M;  2Y21 A;  2F5Q A;  2DVW B;  4ITQ A;  3SC3 A;  3JR5 A;  2DZO B;  3OTO M;  4GHL A;  1EE8 A;  3UJN A;  3U60 A;  4WUR A;  4GH9 A;  5E26 A;  4FCV A;  2V1U A;  3H4M A;  3GLH A;  4II7 A;  2L6O A;  1TDZ A;  2M5Z A;  3L26 A;  2CFO A;  4OVZ A;  4DV7 M;  2QP9 X;  2YQZ A;  5ITX E;  4GIT A;  3PXG A;  2UUA M;  3U6E A;  4R3D A;  4OU7 A;  1SXJ C;  5FTL A;  2QCU A;  2D7E A;  3FYD A;  4JI2 M;  3I51 A;  3GO8 A;  3RGP A;  3KP0 E;  2KXE A;  3TL4 X;  1IQP A;  4L16 A;  1OFI A;  1NHG C;  3IG5 A;  3GPU A;  3SAU A;  3K1J A;  3TPZ A;  4XBO A;  4PT5 A;  2R4J A;  1Z6T A;  2HCB A;  1IBK M;  2ZAN A;  4X66 M;  4BBA A;  2F5S A;  2KW0 A;  4FWH A;  3KOZ E;  3SHG B;  1PJJ A;  2K47 A;  3FUW A;  3DOA A;  4R7G A;  1R6B X;  4CGY B;  3VKG A;  2Y0Q A;  3VK8 A;  4LF6 M;  3J7B A;  4D81 A;  4X65 M;  4JI8 M;  1JR3 A;  4LFB M;  4DR7 M;  1N36 M;  4NSR A;  3KDS E;  4BLC A;  3U5Z A;  4LJ5 A;  2LNH C;  1DO0 A;  4DR3 M;  3KSJ A;  4Z8X A;  1Z5A A;  1OFH A;  3U6S A;  2AHM A;  5A2Q S;  3M0E A;  3M6A A;  1PJI A;  1KFV A;  4NOO B;  2FFJ A;  3UMM A;  3U6D A;  1Q39 A;  2DHR A;  4BB9 A;  4RF1 A;  4LFA M;  4QHT A;  1DGF A;  1HR0 M;  2LXE A;  5EP4 A;  1NVM A;  4DR6 M;  2YNM D;  1DGG A;  1MU5 A;  3HHY A;  3JAM S;  5EP3 A;  1DGB A;  4PD2 A;  3LVW A;  3SYK A;  2BJV A;  2JA2 A;  1TH4 A;  3CF6 E;  3GLF B;  3GQ5 A;  2QBY A;  3DZD A;  3GRY A;  3HKP A;  4REZ A;  3MK6 A;  3K2L A;  2CEA A;  4LJ8 A;  1QAM A;  4IBD A;  3R8F A;  4IBG A;  4LF7 M;  1IBM M;  2DWN A;  4LJA A;  3KS4 A;  2ERC A;  2XSZ A;  2W82 A;  3L2A A;  1QAQ A;  4DV4 M;  4JI1 M;  2LWX A;  4L78 A;  2ZM6 M;  1J09 A;  3J80 S;  3T1H M;  2V6Z M;  2R4E A;  2KRU A;  3MJ5 A;  4GRI A;  3TWK A;  2QZ4 A;  2L09 A;  2EUC A;  3U6M A;  4HLQ A;  3J2P B;  4LCB A;  1E32 A;  3I4V A;  2KRK A;  2VQF M;  1SXJ E;  2RKO A;  1IY1 A;  2D7H A;  2KZS A;  2R65 A;  8CAT A;  1HNZ M;  1YE9 A;  3TE6 A;  1NNU C;  1JQJ C;  2HKJ A;  1K3X A;  3GRV A;  1DO2 A;  4OW0 A;  3GLG A;  2OQ4 A;  2Q2E B;  1GL7 A;  2EO2 A;  2RGH A;  3J81 S;  3KSX A;  4JYA M;  2XFT A;  1XC8 A;  2QPA A;  1IXR C;  2KEB A;  2UUC M;  5JI2 E;  1VDD A;  3KS8 A;  3FUU A;  5JI3 E;  3W0F A;  4DR5 M;  5EXT A;  3AFH A;  1E9S A;  1MX0 A;  1HT2 E;  4JI0 M;  4ZPX A;  1IXZ A;  5IWA M;  2C5R A;  3A42 A;  5FTK A;  2CHV A;  1QYR A;  4NSO B;  2M60 A;  2C98 A;  1NHW C;  1I94 M;  4B3R M;  3FD9 A;  1E9R A;  1TH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...