4DR6M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr6M02
4GKJM 1XMQM 3GO8A 3GPUA 3SASA 1Q3CA 4G4NA 1XNRM 4GKKM 5IWAM 1N36M 2UXCM 4DV5M 3A45A 4MB7A 4DR2M 4DR1M 2UXDM 1HNWM 4PD2A 5ITUA 4X66M 3JR5A 2XZUA 5IT9S 2UXBM 4LF5M 1N33M 4NXMM 4LF9M 4JI1M 2UUAM 1XNQM 2F5SA 4DR7M 3W0FA 1HNZM 5FLXS 3GPXA 5ITTA 3GQ4A 5ITQA 4YHHM 3U6MA 3DOAA 2VQFM 4G4RA 4DV4M 3GQ3A 4DR6M 1Z5CA 5ITXE 2ZM6M 4CISA 3U6PA 4YY3M 1N32M 4DV0M 2F5QA 1FJGM 3VK8A 2XZFA 1KFVA 4JI7M 4DUYM 1J5EM 4LF6M 2F5OA 1TDHA 1PJIA 4K0KM 1L2DA 1MU5A 1MX0A 5ITXA 3JR4A 1IBKM 4JI8M 4B3SM 4DV1M 4DR3M 1N34M 4DV2M 3J81S 4KHPM 4ITQA 3TWLA 5LMUM 3U6LA 1L1ZA 3TWKA 3TWMA 3J80S 1K3WA 4X65M 3OTOM 3T1YM 1NNJA 4NRVA 3J7AS 4JI4M 1L1TA 4B3RM 1L2CA 4AQYM 4DV3M 3U6DA 2OPFA 3U6EA 3GP1A 1XMOM 4PCZA 1K82A 1IBLM 3A46A 4LFAM 1PM5A 4JI5M 3T1HM 3SATA 1HR0M 3A42A 4B3TM 1PJJA 3SARA 4DV6M 4LFBM 4PDIA 1Z5AA 1TDZA 3SBJA 3U6OA 3VK7A 4DR5M 4LF7M 5BR8M 5ITYA 4JI0M 4PDGA 2F5PA 4DR4M 3GPPA 2OQ4A 2UUBM 1R2ZA 2ZBKB 2Q2EB 3U6SA 3U6CA 1EE8A 2E5LM 4DUZM 4OX9M 3SAWA 1Z5BA 4G4OA 5A2QS 4LF8M 4X64M 3GQ5A 2HHHM 3C58A 4X62M 3SAUA 3U6QA 1XC8A 4NRWA 5LMNM 4DV7M 1R2YA 2UU9M 4LF4M 2VQEM 4G4QA 4JI6M 1Q3BA 3GPYA 1L2BA 2F4VM 4JV5M 4LFCM 1IBMM 2F5NA 4NXNM 2UUCM 3SAVA 4JI2M 1HNXM 1I94M 1Q39A 3JAMS 4JI3M 5ITRA 4JYAM 1Z59A 1K3XA 2HKJA 4B3MM 2EA0A
chains in the Genus database with same CATH superfamily
4GKJM 1E32A 2I7PA 1LV7A 1IY2A 1OFIA 4JXJA 5EP3A 2QP9X 2R45A 4LRTA 3SASA 4G4NA 1GKIA 2CHGA 1VDLA 2DVWB 2LNHC 2WSEF 3TPZA 4GKKM 1NHGC 2XH9A 1NVMA 4L4UA 2DNAA 5FSWA 3GLFA 3F92A 1NSFA 1IXZA 3SHGB 1GO5A 2DKLA 2LH0A 4DR1M 2YR0A 2G5GX 2OOAA 3B89A 3W0LB 3VDPA 1JR3E 3HHYA 3ZC7B 3HGIA 4IBKA 4JN6A 2CHQA 3RGPA 4KO8A 3GLIE 2X49A 2QBYB 2F5SA 1YE9A 2JWSA 1UM8A 4D82A 4MGIE 1NNUC 3B74A 3HZJA 3HU1A 3U6MA 3DOAA 1DGBA 2DWZB 2P5TA 3M0EA 2ZTDA 4AI6A 3KXEC 3CF0A 1Z5CA 1D0MA 4CISA 2LHCA 4YY3M 3AOGA 2J7OA 1J7KA 1FJGM 1DGHA 2R18A 2KNZA 1PJIA 5L8RF 5ITXA 3RE8A 3JR4A 5FTKA 5KPTA 4HEOA 5H37D 1G41A 2WZJA 3T15A 3J81S 3PFIA 2DWNA 3IG5A 4GMQA 5LMUM 3LCVB 4LGYA 3C3EA 2A5YB 3J80S 2WSFF 2KZUA 4B7FA 1G8PA 1TH3A 4L78A 1IN6A 3FTEA 4B3RM 3HJ8A 2QHOB 1L2CA 3SMSA 3U6DA 2XGNA 1SXJB 2OPFA 2VF8A 4PCZA 2QCUA 2D7GA 3CF6E 3I4YA 3U60B 3L28A 5EP2A 2M60A 2CV1A 4WURA 3K9PA 1NY6A 2MGWA 2R65A 4B3TM 4GEWA 4IBIA 4OU7A 4BLCA 1ZMVA 3SARA 2KA6B 3A98B 1OIPA 2Y0QA 1NO1A 3U6OA 3VK7A 3FUVA 3BOSA 2FNAA 3GLGA 3Q8GA 3FUUA 1XXHA 3GLIB 4A3VB 1Y8GA 1RU3A 2L4EA 3TQSA 5EXXA 2VIIA 3ZCBB 3FRIA 4NOOB 4B7HA 1R2ZA 3U61B 3AL0C 3U6SA 4KT0F 4MGKE 2LVNC 1Z5BA 4IBEA 4CJ6A 4FWGA 4X64M 1D0LA 2HHHM 1IXSA 1R4GA 4IIWA 4FD2A 2CFOA 2CE7A 2Z3XA 2N35A 1MJGM 2L2DA 3FE3A 3IG8A 4NL4H 1TGUA 2Y0TA 4IBDA 3HHZA 1OQYA 1XXHE 3VKGA 5KO3A 4GITA 3C3DA 4NXNM 2KDLA 4W5WA 1DGGA 2KRKA 5C18A 3SAVA 2DAGA 1I94M 4JI2M 1W5SA 3JAMS 2R62A 3HKPA 3FUWA 3VKHA 4B3MM 1JR3D 2EA0A 2L6OA 3PXGA 3K8ZA 1YSYA 1GL7A 2JY8A 3NWLA 3U5ZA 4ANRA 1Q3CA 1XNRM 2OOBA 3WHLA 1EIJA 3H4JA 1QANA 2DAMA 2L09A 2AHMA 3KP1E 4DV5M 3K9OA 1VEJA 2K47A 2KEBA 2O25A 4G6ZA 3SYKA 2UXDM 2FE8A 2G8LA 2L7IA 4GH9A 3KFUG 2HWJA 1GABA 2LVPC 4LY6A 4R7GA 2M5ZA 2RGHA 2Z7JA 4PD2A 4XK8F 1IN7A 3AOEC 4I4LA 1W5TA 4BBAA 1NY5A 1G3IA 4JI1M 4LF9M 1IM2A 1XNQM 1XHBA 2B3TA 2DHRA 2LBCA 2DAKA 3W0FA 1OIZA 3W67A 2DAEA 1HNZM 3T6PA 1V33A 1TH4A 3GQ4A 2CWBA 1DO2A 4YHHM 3IHPA 1HT1E 2G3QA 2LVAA 3HHWA 1AIPC 1IN8A 1QAOA 3J7BA 5JI2E 1QYRA 3J2PB 4OVZA 1XB2B 4F2LA 1OKSA 2J5YA 1ORYB 4IBCA 2XZFA 4FCWA 1KFVA 3KW6A 3GLHA 2XFTA 2Z8YM 3B9PA 1MU5A 2C9CA 4IBGA 4B3SM 4WP2A 3B7ZA 3J27B 5IREB 4LCBA 3FYCA 4LJ7A 4DV2M 1N75A 1MN3A 2J7NA 4ITQA 3GRUA 3GRYA 3Q8XA 4I81A 1L1ZA 3KOWE 4L16A 3TWKA 1K3WA 3T1YM 2L4FA 2FS1A 4IJEA 3TL4X 3J7AS 1TTEA 3KOXE 4JI4M 1N78A 2JXNA 1GL6A 4RF0A 2O5RA 2JY6B 2R4JA 4Y28F 3E9SA 4D80A 4DV3M 3FD9A 3T38A 2WSCF 1TF0B 2XFSA 3RGSA 4GHLA 2Y21A 1IBLM 3A46A 1QDRA 4GC5A 1HQYE 2C9OA 3HHXA 4QNRA 4LJ6A 1E9SA 4I8OA 2EKFA 4MGHA 1SXJC 4NRWA 4ZPXA 1PRBA 1OFHA 1PJJA 1QQWA 3LCUA 5EQTA 5FTMA 1EFUB 4PDIA 4LFBM 3RFWA 2JP7A 4MGYE 4DR5M 1WGLA 5BR8M 3L27A 3MHVC 4QHSA 4JI0M 4PDGA 2F5PA 8CATA 4AZFA 3GPPA 2OQ4A 1N77A 2UUBM 1XWIA 4FVMA 3SMPA 1E94E 4AG6A 2Q2EB 1SG9A 3THGA 2HAKA 2CEAA 4M9SA 4IBBA 4IBFA 3M6AA 4DUZM 2JZ0A 4MM3B 4MGZE 3GQ5A 1J09A 4X62M 5DYIA 1T6OA 3K1JA 3SAUA 2CUZA 2EKKA 2YNMD 1X37A 5LMNM 1YLAA 2ZTCA 2X8AA 4NC6A 1R2YA 4L6V6 2BWEA 3E46A 5EP1A 1XC8A 4JV5M 2X4AA 3FKEA 2K6BA 4LFCM 3R8FA 2F5NA 3HU2A 3HWSA 2MJ5B 3HJQA 3L2AA 2UUCM 1G71A 2EO2A 5FTNA 1WIVA 4II7A 2FH0A 3B7NA 3AJIB 3ZH9B 3NBIA 4JI3M 1IN4A 2D7EA 2QNJA 4D81A 2LXEA 3QYBA 1I4WA 1ZQ9A 3FTDA 5C1BA 4CGYB 1XMQM 2BNKA 5EXTA 2LTUA 4XBOA 3GO8A 2JY5A 1SXJE 2RKOA 4PT5A 3SC3A 1NJGA 3PNYA 3KOZE 1HJPA 1UFZA 3SFZA 2UXCM 2H5XA 1PJSA 3LQRA 1HQCA 3UGJA 4AKIA 2OO9A 2ZAMA 3UK6A 2XLJA 2R0IA 2DXIA 2CV0A 4X66M 5IT9S 1WR1B 1VG5A 2UXBM 2FFJA 4NXMM 1N33M 5KPZA 3M7GA 1VEKA 2DENA 4JI6M 3AV0A 3KOYE 4DR7M 3W68A 3U60A 1V92A 2NQ8C 3D8LA 2HL7A 4B7GA 5E6JA 2LHGA 4LZJA 4LZZA 4R71A 5ITQA 3I01M 2O01F 2VQFM 3GLHE 4G4RA 2JA2A 3DA1A 4DR6M 1JR3A 1R6BX 2KHHA 3FTCA 3U6PA 2RRUA 4FCVA 1XXHB 2F5QA 3GLIA 2C98A 3VK8A 4L15A 4JI7M 1J5EM 2F5OA 4K0KM 4LRSA 4P17A 1L2DA 1T3TA 2DWMA 1VDDA 3DZDA 2MH8A 1IBKM 1PJTA 1OTRA 3L29A 1IXRC 2R46A 4DV1M 4P16A 4DR3M 2APLA 2R44A 1GJTA 1OAIA 4LJAA 3GLFB 3E4RA 4L8RC 3GRVA 3CF2A 5KQDA 3FRHA 4LGMA 2K9DA 1CUKA 3TWMA 3I04M 4DBGB 5E26A 4X65M 3OTOM 3LQQA 2V1UA 3QAUA 1PJQA 1NJFA 1L1TA 3LMMA 2ZANA 2XSZD 1KSFX 2GQFA 2KW0A 5DNYA 2CRUA 2EJSA 2LVOC 3BBZA 3SYLA 3U6EA 2RGOA 2QBYA 3I4VA 1E9RA 1GLNA 1K82A 4QOSA 3NBXX 1PM5A 4LFAM 4JI5M 1GVNA 3U5ZB 2VF7A 3EIHA 2BJWA 3T1HM 4EIWA 2DAIA 3CGWA 4DV6M 1TDZA 2LWXA 2Y20A 3PNVA 4Q7JA 5ITYA 4XGIA 2Z4SA 1DGHB 1WHCA 2I7NA 4TUWA 2BWBA 2DZLA 2JNHA 1BVSA 2JY7A 1QDTA 1TR8A 3ILKA 3KSXA 4M0DA 4RF1A 4OW0A 5EXPA 3U6CA 1G59A 4R3DA 2KRUA 1ZMUA 3SAWA 1QAQA 2GNOA 3UZUA 5A2QS 4G4OA 2R4EA 4BB9A 4LF8M 5F3WA 3LVWA 4QHTA 2V6ZM 2FOIC 1SXJD 3K2LA 1IN5A 1QZEA 2QPAA 3KS4A 1Q3BA 5KQ8A 3GPYA 4G4QA 1IFYA 1VQ1A 2R6FA 1L2BA 2F4VM 2Z4RA 3VLFB 3LW5F 3GRRA 2V1CA 4LJ9A 1D0KA 4FW9A 4LG2A 5DYGA 3CTWB 1HNXM 4AKHA 2EUCA 1ZMWA 1SXJA 5ITRA 4JYAM 1Z59A 3PVSA 2HKJA 3HY5A 2QZ4A 4GC9A 3FUXA 4G3OA 4KLNA 4REZA 3GLFE 2QSFX 3FTFA 3WHKA 3GPUA 4NSRA 2ERCA 4F1IA 3AOEA 3HU3A 5IWAM 3SHFA 1N36M 3A45A 4HL4A 4MB7A 3DFZA 1WJ7A 4GHAA 1F4IA 3GLGB 4DR2M 3VFDA 1JB0F 1OAOC 2KNAA 4AW4A 1HNWM 3L25A 1S3SA 1TH2A 2DWLA 3U61A 1DV0A 3H4MA 1IY1A 5ITUA 4UN2B 4CHTB 3K92A 3JR5A 2XZUA 1GJSA 1DO0A 1V34A 4LF5M 3FUTA 5JI3E 2DHYA 1IY0A 2UUAM 2XEPA 1IXSB 3KS8A 1QZMA 5FTJA 1WGNA 3R9XB 1T43A 5FLXS 3GPXA 5ITTA 1C1KA 1A5TA 2QQ8A 2XSZA 4MH0E 2VDBB 4AG5A 2CV2A 2C99A 1ZAEA 2LVQD 3TE6A 4RNAA 3UJNA 4DV4M 3MJ5A 3GQ3A 5GKNA 1NV9A 5ITXE 2ZM6M 2JZ1A 1AUAA 1N32M 1D2NA 4DV0M 4Z6YA 3MMPA 2D7HA 2XF3A 4LF6M 1Q02A 4DUYM 3C9PA 1TDHA 2W82A 1MX0A 4FCTA 4IBJA 4JI8M 4B08A 2DI0A 4GIPA 5KPRA 1G4AE 2C5RA 1N34M 4FWHA 3B7QA 1C7YA 2YQZA 4KHPM 3UMMA 4LJ8A 4GRIA 3TWLA 3KDSE 4S12A 3L26A 4I5SA 5EP4A 3U6LA 3QYEA 2YFQA 1QVRA 2L7HA 1NNJA 3MK6A 4NRVA 1NV8A 1DGFA 5FTLA 1HT2E 3IECA 7CATA 5BPVA 1YUBA 3LVVA 4M9XA 4AQYM 2CHVA 3QWLA 2JUJA 3D8BA 4Z8XA 5EXSA 3KVWA 3ZQJA 3GP1A 1IQPA 1XMOM 4M9ZA 4QOZC 1ZV1A 3KSJA 4AKGA 1VEGA 4FWDA 3GLGE 3SATA 1HR0M 3A42A 1NHWC 1L8QA 1KYIA 2MROB 4HLQA 5EJCA 1Z5AA 3AFHA 3E21A 3SBJA 4LF7M 1LTMA 4WW0A 4OVZB 2MR9A 2CP8A 2K0BX 1P3QQ 4DR4M 3GLHB 2ZBKB 2DZOB 4IJFA 4CIZA 2QENA 1EE8A 3HX3A 2E5LM 1QAMA 4OX9M 4LJ4A 5IZ7D 3C58A 3KP0E 3V76A 4QNMA 3EIEA 3U6QA 1Z6TA 4DV7M 1JQJC 4M0WA 4NSOB 2UU9M 4LF4M 1R7RA 2C96A 2VQEM 2ZAOA 3BXWA 1H6UA 5DFLA 1FNNA 1QUTA 1IBMM 2DZNB 1WXQA 2HCBA 2KZSA 3HJSA 2KXEA 4KODA 3VDUA 1Q39A 2H1RA 4RKUF 1OJLA 3AKZA 3FYDA 1PGYA 1K3XA 2BJVA 3I51A 1R5LA 4LJ5A 2KNVA 1QUSA
chains in the Genus database with same CATH topology
4GKJM 1E32A 2I7PA 1LV7A 1IY2A 1OFIA 4JXJA 5EP3A 2QP9X 2R45A 4LRTA 3SASA 4G4NA 1GKIA 2CHGA 2LNHC 2DVWB 3TPZA 4GKKM 1NHGC 2XH9A 1NVMA 4L4UA 5FSWA 3GLFA 1NSFA 1IXZA 3SHGB 2LH0A 4DR1M 2YR0A 2G5GX 3W0LB 3VDPA 3HHYA 3ZC7B 3HGIA 4IBKA 4JN6A 2CHQA 3RGPA 4KO8A 2X49A 2QBYB 2F5SA 1YE9A 1UM8A 4D82A 4MGIE 1NNUC 3HU1A 3U6MA 3DOAA 1DGBA 2DWZB 2P5TA 3M0EA 4AI6A 3KXEC 3CF0A 1Z5CA 4CISA 4YY3M 3AOGA 2J7OA 1J7KA 1FJGM 1DGHA 2R18A 1PJIA 5ITXA 3RE8A 3JR4A 5FTKA 5KPTA 5H37D 1G41A 3T15A 3J81S 3PFIA 2DWNA 3IG5A 4GMQA 5LMUM 4LGYA 2A5YB 3J80S 2KZUA 4B7FA 1G8PA 1TH3A 4L78A 1IN6A 3FTEA 4B3RM 3HJ8A 1L2CA 3SMSA 3U6DA 2XGNA 1SXJB 2OPFA 4PCZA 2QCUA 2D7GA 3CF6E 3I4YA 3U60B 3L28A 5EP2A 2M60A 2CV1A 4WURA 1NY6A 4B3TM 2R65A 4IBIA 4OU7A 4BLCA 3SARA 2KA6B 3A98B 2Y0QA 3U6OA 3VK7A 3FUVA 3BOSA 2FNAA 3GLGA 3FUUA 1XXHA 3GLIB 4A3VB 3TQSA 3ZCBB 5EXXA 2VIIA 1R2ZA 4NOOB 4B7HA 3U61B 3AL0C 3U6SA 4MGKE 1Z5BA 4IBEA 4FWGA 4X64M 2HHHM 4IIWA 4FD2A 2CFOA 2CE7A 2Z3XA 4JI6M 3IG8A 4NL4H 1TGUA 2Y0TA 4IBDA 3HHZA 3VKGA 5KO3A 4GITA 4NXNM 4W5WA 3SAVA 1DGGA 2KRKA 5C18A 4JI2M 1I94M 1W5SA 3JAMS 2R62A 3HKPA 3FUWA 3VKHA 4B3MM 1JR3D 2EA0A 2L6OA 3PXGA 3K8ZA 1YSYA 1GL7A 3NWLA 3U5ZA 1Q3CA 1XNRM 3WHLA 1QANA 2L09A 2AHMA 3KP1E 4DV5M 2K47A 2KEBA 4G6ZA 3SYKA 2UXDM 2FE8A 2G8LA 2L7IA 4GH9A 3KFUG 4LY6A 4R7GA 2M5ZA 2RGHA 2Z7JA 4PD2A 1IN7A 3AOEC 4I4LA 1W5TA 4BBAA 1NY5A 1G3IA 4JI1M 4LF9M 1IM2A 1XNQM 1XHBA 2DHRA 3W0FA 1HNZM 1TH4A 3GQ4A 1DO2A 4YHHM 1HT1E 3HHWA 1IN8A 1QAOA 3J7BA 5JI2E 1QYRA 3J2PB 4OVZA 1ORYB 4IBCA 2XZFA 4FCWA 1KFVA 3KW6A 3GLHA 2XFTA 3B9PA 1MU5A 2C9CA 4IBGA 4B3SM 3J27B 5IREB 4LCBA 3FYCA 4LJ7A 4DV2M 1N75A 2J7NA 4ITQA 3GRUA 3GRYA 3Q8XA 4I81A 1L1ZA 3KOWE 4L16A 3TWKA 1K3WA 3T1YM 4IJEA 3TL4X 3J7AS 1N78A 3KOXE 4JI4M 4RF0A 1GL6A 2O5RA 2R4JA 3E9SA 4D80A 4DV3M 3FD9A 3T38A 2XFSA 3RGSA 4GHLA 2Y21A 1IBLM 3A46A 4GC5A 1HQYE 2C9OA 3HHXA 4QNRA 4LJ6A 1E9SA 4I8OA 4MGHA 1SXJC 4ZPXA 1OFHA 1PJJA 1QQWA 5EQTA 5FTMA 4LFBM 4PDIA 3RFWA 4MGYE 4DR5M 5BR8M 3L27A 3MHVC 4QHSA 4JI0M 4PDGA 2F5PA 8CATA 4AZFA 3GPPA 2OQ4A 1N77A 2UUBM 4FVMA 1XWIA 3SMPA 1E94E 4AG6A 2Q2EB 3THGA 2CEAA 4M9SA 4IBBA 4IBFA 3M6AA 4DUZM 4MM3B 4MGZE 3GQ5A 1J09A 4X62M 5DYIA 3K1JA 3SAUA 1XC8A 2CUZA 2YNMD 5LMNM 1X37A 1R2YA 4NRWA 2X8AA 5EP1A 4JV5M 2X4AA 3FKEA 4LFCM 3R8FA 2F5NA 3HU2A 3HWSA 3L2AA 3HJQA 2UUCM 2EO2A 5FTNA 4II7A 3AJIB 3ZH9B 3NBIA 4JI3M 1IN4A 2D7EA 4D81A 2LXEA 5C1BA 1I4WA 1ZQ9A 3FTDA 1XMQM 4CGYB 2BNKA 5EXTA 4XBOA 3GO8A 1SXJE 2RKOA 4PT5A 3SC3A 1NJGA 3PNYA 3KOZE 3SFZA 2UXCM 3LQRA 1HQCA 3UGJA 4AKIA 2ZAMA 3UK6A 2XLJA 2DXIA 2CV0A 4X66M 5IT9S 2UXBM 2FFJA 4NXMM 1N33M 5KPZA 3M7GA 3AV0A 3KOYE 4DR7M 3U60A 2NQ8C 3D8LA 2HL7A 4B7GA 5E6JA 4LZJA 4LZZA 5ITQA 2VQFM 4G4RA 2JA2A 3DA1A 4DR6M 1JR3A 1R6BX 3FTCA 3U6PA 4FCVA 1XXHB 2F5QA 3GLIA 2C98A 3VK8A 4L15A 4JI7M 1J5EM 2F5OA 4K0KM 4LRSA 2DWMA 1L2DA 1T3TA 1VDDA 3DZDA 1IBKM 3L29A 1IXRC 2R46A 4DV1M 4P16A 4DR3M 4LJAA 3GLFB 3E4RA 4L8RC 3GRVA 3CF2A 5KQDA 4LGMA 3TWMA 4X65M 5E26A 3OTOM 2V1UA 3LQQA 3QAUA 1NJFA 1L1TA 3LMMA 2ZANA 2XSZD 1KSFX 2KW0A 5DNYA 3SYLA 3U6EA 2RGOA 2QBYA 3I4VA 1E9RA 1GLNA 1K82A 4QOSA 1PM5A 4LFAM 4JI5M 1GVNA 3U5ZB 3EIHA 2BJWA 3T1HM 4EIWA 4DV6M 1TDZA 2LWXA 2Y20A 3PNVA 5ITYA 4XGIA 2Z4SA 1DGHB 4TUWA 2I7NA 4QOZC 3KSXA 4RF1A 5EXPA 3ILKA 4M0DA 1G59A 4OW0A 3U6CA 4R3DA 2KRUA 3SAWA 1QAQA 3UZUA 5A2QS 4G4OA 2R4EA 4BB9A 4LF8M 5F3WA 3LVWA 4QHTA 2V6ZM 2FOIC 3KS4A 3K2LA 1SXJD 1IN5A 2QPAA 4G4QA 1Q3BA 5KQ8A 3GPYA 1L2BA 2F4VM 2Z4RA 3VLFB 4LG2A 3GRRA 2V1CA 4LJ9A 4FW9A 5DYGA 3CTWB 1HNXM 4AKHA 2EUCA 1SXJA 5ITRA 4JYAM 3PVSA 1Z59A 2HKJA 4GC9A 2QZ4A 3FUXA 4KLNA 4REZA 3FTFA 3WHKA 3GPUA 4NSRA 2ERCA 3AOEA 3HU3A 5IWAM 3SHFA 1N36M 3A45A 4HL4A 4MB7A 3DFZA 4GHAA 3GLGB 4DR2M 3VFDA 1HNWM 4AW4A 3L25A 1S3SA 1TH2A 2DWLA 3U61A 3H4MA 1IY1A 5ITUA 4CHTB 3JR5A 2XZUA 1DO0A 4LF5M 3FUTA 5JI3E 1IY0A 2UUAM 2XEPA 1IXSB 3KS8A 1QZMA 5FTJA 3R9XB 5FLXS 3GPXA 5ITTA 1C1KA 2XSZA 4MH0E 4AG5A 2CV2A 2C99A 1ZAEA 3TE6A 4RNAA 3UJNA 4DV4M 3MJ5A 3GQ3A 5GKNA 5ITXE 2ZM6M 1N32M 1D2NA 4DV0M 4Z6YA 2D7HA 2XF3A 4LF6M 4DUYM 1TDHA 2W82A 1MX0A 4FCTA 4IBJA 4JI8M 4B08A 4GIPA 5KPRA 1G4AE 2C5RA 1N34M 4FWHA 2YQZA 4KHPM 3UMMA 4LJ8A 4GRIA 3TWLA 3KDSE 4S12A 3L26A 4I5SA 5EP4A 3U6LA 2YFQA 1QVRA 2L7HA 1NNJA 3MK6A 4NRVA 1DGFA 5FTLA 1HT2E 7CATA 5BPVA 1YUBA 3LVVA 4M9XA 4AQYM 2CHVA 3QWLA 3D8BA 4Z8XA 5EXSA 3KVWA 3GP1A 1XMOM 1IQPA 4M9ZA 3KSJA 4AKGA 4FWDA 3SATA 1HR0M 3A42A 1NHWC 1L8QA 1KYIA 4HLQA 5EJCA 1Z5AA 3AFHA 3SBJA 4LF7M 4WW0A 4OVZB 4DR4M 3GLHB 2ZBKB 2DZOB 4IJFA 2QENA 1EE8A 2E5LM 1QAMA 4OX9M 4LJ4A 5IZ7D 3C58A 3KP0E 4QNMA 3EIEA 3U6QA 1Z6TA 4DV7M 1JQJC 4M0WA 4NSOB 2UU9M 4LF4M 1R7RA 2VQEM 2ZAOA 1H6UA 1FNNA 1IBMM 2DZNB 1WXQA 2HCBA 2KZSA 3HJSA 2KXEA 4KODA 3VDUA 1Q39A 2H1RA 1OJLA 3AKZA 3FYDA 1K3XA 2BJVA 3K92A 3I51A 4LJ5A 2C96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ M;  1XMQ M;  3GO8 A;  3GPU A;  3SAS A;  1Q3C A;  4G4N A;  1XNR M;  4GKK M;  5IWA M;  1N36 M;  2UXC M;  4DV5 M;  3A45 A;  4MB7 A;  4DR2 M;  4DR1 M;  2UXD M;  1HNW M;  4PD2 A;  5ITU A;  4X66 M;  3JR5 A;  2XZU A;  5IT9 S;  2UXB M;  4LF5 M;  1N33 M;  4NXM M;  4LF9 M;  4JI1 M;  2UUA M;  1XNQ M;  2F5S A;  4DR7 M;  3W0F A;  1HNZ M;  5FLX S;  3GPX A;  5ITT A;  3GQ4 A;  5ITQ A;  4YHH M;  3U6M A;  3DOA A;  2VQF M;  4G4R A;  4DV4 M;  3GQ3 A;  4DR6 M;  1Z5C A;  5ITX E;  2ZM6 M;  4CIS A;  3U6P A;  4YY3 M;  1N32 M;  4DV0 M;  2F5Q A;  1FJG M;  3VK8 A;  2XZF A;  1KFV A;  4JI7 M;  4DUY M;  1J5E M;  4LF6 M;  2F5O A;  1TDH A;  1PJI A;  4K0K M;  1L2D A;  1MU5 A;  1MX0 A;  5ITX A;  3JR4 A;  1IBK M;  4JI8 M;  4B3S M;  4DV1 M;  4DR3 M;  1N34 M;  4DV2 M;  3J81 S;  4KHP M;  4ITQ A;  3TWL A;  5LMU M;  3U6L A;  1L1Z A;  3TWK A;  3TWM A;  3J80 S;  1K3W A;  4X65 M;  3OTO M;  3T1Y M;  1NNJ A;  4NRV A;  3J7A S;  4JI4 M;  1L1T A;  4B3R M;  1L2C A;  4AQY M;  4DV3 M;  3U6D A;  2OPF A;  3U6E A;  3GP1 A;  1XMO M;  4PCZ A;  1K82 A;  1IBL M;  3A46 A;  4LFA M;  1PM5 A;  4JI5 M;  3T1H M;  3SAT A;  1HR0 M;  3A42 A;  4B3T M;  1PJJ A;  3SAR A;  4DV6 M;  4LFB M;  4PDI A;  1Z5A A;  1TDZ A;  3SBJ A;  3U6O A;  3VK7 A;  4DR5 M;  4LF7 M;  5BR8 M;  5ITY A;  4JI0 M;  4PDG A;  2F5P A;  4DR4 M;  3GPP A;  2OQ4 A;  2UUB M;  1R2Z A;  2ZBK B;  2Q2E B;  3U6S A;  3U6C A;  1EE8 A;  2E5L M;  4DUZ M;  4OX9 M;  3SAW A;  1Z5B A;  4G4O A;  5A2Q S;  4LF8 M;  4X64 M;  3GQ5 A;  2HHH M;  3C58 A;  4X62 M;  3SAU A;  3U6Q A;  1XC8 A;  4NRW A;  5LMN M;  4DV7 M;  1R2Y A;  2UU9 M;  4LF4 M;  2VQE M;  4G4Q A;  4JI6 M;  1Q3B A;  3GPY A;  1L2B A;  2F4V M;  4JV5 M;  4LFC M;  1IBM M;  2F5N A;  4NXN M;  2UUC M;  3SAV A;  4JI2 M;  1HNX M;  1I94 M;  1Q39 A;  3JAM S;  4JI3 M;  5ITR A;  4JYA M;  1Z59 A;  1K3X A;  2HKJ A;  4B3M M;  2EA0 A; 
#chains in the Genus database with same CATH topology
 4GKJ M;  1E32 A;  2I7P A;  1LV7 A;  1IY2 A;  1OFI A;  4JXJ A;  5EP3 A;  2QP9 X;  2R45 A;  4LRT A;  3SAS A;  4G4N A;  1GKI A;  2CHG A;  1VDL A;  2DVW B;  2LNH C;  2WSE F;  3TPZ A;  4GKK M;  1NHG C;  2XH9 A;  1NVM A;  4L4U A;  2DNA A;  5FSW A;  3GLF A;  3F92 A;  1NSF A;  1IXZ A;  3SHG B;  1GO5 A;  2DKL A;  2LH0 A;  4DR1 M;  2YR0 A;  2G5G X;  2OOA A;  3B89 A;  3W0L B;  3VDP A;  1JR3 E;  3HHY A;  3ZC7 B;  3HGI A;  4IBK A;  4JN6 A;  2CHQ A;  3RGP A;  4KO8 A;  3GLI E;  2X49 A;  2QBY B;  2F5S A;  1YE9 A;  2JWS A;  1UM8 A;  4D82 A;  4MGI E;  1NNU C;  3B74 A;  3HZJ A;  3HU1 A;  3U6M A;  3DOA A;  1DGB A;  2DWZ B;  2P5T A;  3M0E A;  2ZTD A;  4AI6 A;  3KXE C;  3CF0 A;  1Z5C A;  1D0M A;  4CIS A;  2LHC A;  4YY3 M;  3AOG A;  2J7O A;  1J7K A;  1FJG M;  1DGH A;  2R18 A;  2KNZ A;  1PJI A;  5L8R F;  5ITX A;  3RE8 A;  3JR4 A;  5FTK A;  5KPT A;  4HEO A;  5H37 D;  1G41 A;  2WZJ A;  3T15 A;  3J81 S;  3PFI A;  2DWN A;  3IG5 A;  4GMQ A;  5LMU M;  3LCV B;  4LGY A;  3C3E A;  2A5Y B;  3J80 S;  2WSF F;  2KZU A;  4B7F A;  1G8P A;  1TH3 A;  4L78 A;  1IN6 A;  3FTE A;  4B3R M;  3HJ8 A;  2QHO B;  1L2C A;  3SMS A;  3U6D A;  2XGN A;  1SXJ B;  2OPF A;  2VF8 A;  4PCZ A;  2QCU A;  2D7G A;  3CF6 E;  3I4Y A;  3U60 B;  3L28 A;  5EP2 A;  2M60 A;  2CV1 A;  4WUR A;  3K9P A;  1NY6 A;  2MGW A;  2R65 A;  4B3T M;  4GEW A;  4IBI A;  4OU7 A;  4BLC A;  1ZMV A;  3SAR A;  2KA6 B;  3A98 B;  1OIP A;  2Y0Q A;  1NO1 A;  3U6O A;  3VK7 A;  3FUV A;  3BOS A;  2FNA A;  3GLG A;  3Q8G A;  3FUU A;  1XXH A;  3GLI B;  4A3V B;  1Y8G A;  1RU3 A;  2L4E A;  3TQS A;  5EXX A;  2VII A;  3ZCB B;  3FRI A;  4NOO B;  4B7H A;  1R2Z A;  3U61 B;  3AL0 C;  3U6S A;  4KT0 F;  4MGK E;  2LVN C;  1Z5B A;  4IBE A;  4CJ6 A;  4FWG A;  4X64 M;  1D0L A;  2HHH M;  1IXS A;  1R4G A;  4IIW A;  4FD2 A;  2CFO A;  2CE7 A;  2Z3X A;  2N35 A;  1MJG M;  2L2D A;  3FE3 A;  3IG8 A;  4NL4 H;  1TGU A;  2Y0T A;  4IBD A;  3HHZ A;  1OQY A;  1XXH E;  3VKG A;  5KO3 A;  4GIT A;  3C3D A;  4NXN M;  2KDL A;  4W5W A;  1DGG A;  2KRK A;  5C18 A;  3SAV A;  2DAG A;  1I94 M;  4JI2 M;  1W5S A;  3JAM S;  2R62 A;  3HKP A;  3FUW A;  3VKH A;  4B3M M;  1JR3 D;  2EA0 A;  2L6O A;  3PXG A;  3K8Z A;  1YSY A;  1GL7 A;  2JY8 A;  3NWL A;  3U5Z A;  4ANR A;  1Q3C A;  1XNR M;  2OOB A;  3WHL A;  1EIJ A;  3H4J A;  1QAN A;  2DAM A;  2L09 A;  2AHM A;  3KP1 E;  4DV5 M;  3K9O A;  1VEJ A;  2K47 A;  2KEB A;  2O25 A;  4G6Z A;  3SYK A;  2UXD M;  2FE8 A;  2G8L A;  2L7I A;  4GH9 A;  3KFU G;  2HWJ A;  1GAB A;  2LVP C;  4LY6 A;  4R7G A;  2M5Z A;  2RGH A;  2Z7J A;  4PD2 A;  4XK8 F;  1IN7 A;  3AOE C;  4I4L A;  1W5T A;  4BBA A;  1NY5 A;  1G3I A;  4JI1 M;  4LF9 M;  1IM2 A;  1XNQ M;  1XHB A;  2B3T A;  2DHR A;  2LBC A;  2DAK A;  3W0F A;  1OIZ A;  3W67 A;  2DAE A;  1HNZ M;  3T6P A;  1V33 A;  1TH4 A;  3GQ4 A;  2CWB A;  1DO2 A;  4YHH M;  3IHP A;  1HT1 E;  2G3Q A;  2LVA A;  3HHW A;  1AIP C;  1IN8 A;  1QAO A;  3J7B A;  5JI2 E;  1QYR A;  3J2P B;  4OVZ A;  1XB2 B;  4F2L A;  1OKS A;  2J5Y A;  1ORY B;  4IBC A;  2XZF A;  4FCW A;  1KFV A;  3KW6 A;  3GLH A;  2XFT A;  2Z8Y M;  3B9P A;  1MU5 A;  2C9C A;  4IBG A;  4B3S M;  4WP2 A;  3B7Z A;  3J27 B;  5IRE B;  4LCB A;  3FYC A;  4LJ7 A;  4DV2 M;  1N75 A;  1MN3 A;  2J7N A;  4ITQ A;  3GRU A;  3GRY A;  3Q8X A;  4I81 A;  1L1Z A;  3KOW E;  4L16 A;  3TWK A;  1K3W A;  3T1Y M;  2L4F A;  2FS1 A;  4IJE A;  3TL4 X;  3J7A S;  1TTE A;  3KOX E;  4JI4 M;  1N78 A;  2JXN A;  1GL6 A;  4RF0 A;  2O5R A;  2JY6 B;  2R4J A;  4Y28 F;  3E9S A;  4D80 A;  4DV3 M;  3FD9 A;  3T38 A;  2WSC F;  1TF0 B;  2XFS A;  3RGS A;  4GHL A;  2Y21 A;  1IBL M;  3A46 A;  1QDR A;  4GC5 A;  1HQY E;  2C9O A;  3HHX A;  4QNR A;  4LJ6 A;  1E9S A;  4I8O A;  2EKF A;  4MGH A;  1SXJ C;  4NRW A;  4ZPX A;  1PRB A;  1OFH A;  1PJJ A;  1QQW A;  3LCU A;  5EQT A;  5FTM A;  1EFU B;  4PDI A;  4LFB M;  3RFW A;  2JP7 A;  4MGY E;  4DR5 M;  1WGL A;  5BR8 M;  3L27 A;  3MHV C;  4QHS A;  4JI0 M;  4PDG A;  2F5P A;  8CAT A;  4AZF A;  3GPP A;  2OQ4 A;  1N77 A;  2UUB M;  1XWI A;  4FVM A;  3SMP A;  1E94 E;  4AG6 A;  2Q2E B;  1SG9 A;  3THG A;  2HAK A;  2CEA A;  4M9S A;  4IBB A;  4IBF A;  3M6A A;  4DUZ M;  2JZ0 A;  4MM3 B;  4MGZ E;  3GQ5 A;  1J09 A;  4X62 M;  5DYI A;  1T6O A;  3K1J A;  3SAU A;  2CUZ A;  2EKK A;  2YNM D;  1X37 A;  5LMN M;  1YLA A;  2ZTC A;  2X8A A;  4NC6 A;  1R2Y A;  4L6V 6;  2BWE A;  3E46 A;  5EP1 A;  1XC8 A;  4JV5 M;  2X4A A;  3FKE A;  2K6B A;  4LFC M;  3R8F A;  2F5N A;  3HU2 A;  3HWS A;  2MJ5 B;  3HJQ A;  3L2A A;  2UUC M;  1G71 A;  2EO2 A;  5FTN A;  1WIV A;  4II7 A;  2FH0 A;  3B7N A;  3AJI B;  3ZH9 B;  3NBI A;  4JI3 M;  1IN4 A;  2D7E A;  2QNJ A;  4D81 A;  2LXE A;  3QYB A;  1I4W A;  1ZQ9 A;  3FTD A;  5C1B A;  4CGY B;  1XMQ M;  2BNK A;  5EXT A;  2LTU A;  4XBO A;  3GO8 A;  2JY5 A;  1SXJ E;  2RKO A;  4PT5 A;  3SC3 A;  1NJG A;  3PNY A;  3KOZ E;  1HJP A;  1UFZ A;  3SFZ A;  2UXC M;  2H5X A;  1PJS A;  3LQR A;  1HQC A;  3UGJ A;  4AKI A;  2OO9 A;  2ZAM A;  3UK6 A;  2XLJ A;  2R0I A;  2DXI A;  2CV0 A;  4X66 M;  5IT9 S;  1WR1 B;  1VG5 A;  2UXB M;  2FFJ A;  4NXM M;  1N33 M;  5KPZ A;  3M7G A;  1VEK A;  2DEN A;  4JI6 M;  3AV0 A;  3KOY E;  4DR7 M;  3W68 A;  3U60 A;  1V92 A;  2NQ8 C;  3D8L A;  2HL7 A;  4B7G A;  5E6J A;  2LHG A;  4LZJ A;  4LZZ A;  4R71 A;  5ITQ A;  3I01 M;  2O01 F;  2VQF M;  3GLH E;  4G4R A;  2JA2 A;  3DA1 A;  4DR6 M;  1JR3 A;  1R6B X;  2KHH A;  3FTC A;  3U6P A;  2RRU A;  4FCV A;  1XXH B;  2F5Q A;  3GLI A;  2C98 A;  3VK8 A;  4L15 A;  4JI7 M;  1J5E M;  2F5O A;  4K0K M;  4LRS A;  4P17 A;  1L2D A;  1T3T A;  2DWM A;  1VDD A;  3DZD A;  2MH8 A;  1IBK M;  1PJT A;  1OTR A;  3L29 A;  1IXR C;  2R46 A;  4DV1 M;  4P16 A;  4DR3 M;  2APL A;  2R44 A;  1GJT A;  1OAI A;  4LJA A;  3GLF B;  3E4R A;  4L8R C;  3GRV A;  3CF2 A;  5KQD A;  3FRH A;  4LGM A;  2K9D A;  1CUK A;  3TWM A;  3I04 M;  4DBG B;  5E26 A;  4X65 M;  3OTO M;  3LQQ A;  2V1U A;  3QAU A;  1PJQ A;  1NJF A;  1L1T A;  3LMM A;  2ZAN A;  2XSZ D;  1KSF X;  2GQF A;  2KW0 A;  5DNY A;  2CRU A;  2EJS A;  2LVO C;  3BBZ A;  3SYL A;  3U6E A;  2RGO A;  2QBY A;  3I4V A;  1E9R A;  1GLN A;  1K82 A;  4QOS A;  3NBX X;  1PM5 A;  4LFA M;  4JI5 M;  1GVN A;  3U5Z B;  2VF7 A;  3EIH A;  2BJW A;  3T1H M;  4EIW A;  2DAI A;  3CGW A;  4DV6 M;  1TDZ A;  2LWX A;  2Y20 A;  3PNV A;  4Q7J A;  5ITY A;  4XGI A;  2Z4S A;  1DGH B;  1WHC A;  2I7N A;  4TUW A;  2BWB A;  2DZL A;  2JNH A;  1BVS A;  2JY7 A;  1QDT A;  1TR8 A;  3ILK A;  3KSX A;  4M0D A;  4RF1 A;  4OW0 A;  5EXP A;  3U6C A;  1G59 A;  4R3D A;  2KRU A;  1ZMU A;  3SAW A;  1QAQ A;  2GNO A;  3UZU A;  5A2Q S;  4G4O A;  2R4E A;  4BB9 A;  4LF8 M;  5F3W A;  3LVW A;  4QHT A;  2V6Z M;  2FOI C;  1SXJ D;  3K2L A;  1IN5 A;  1QZE A;  2QPA A;  3KS4 A;  1Q3B A;  5KQ8 A;  3GPY A;  4G4Q A;  1IFY A;  1VQ1 A;  2R6F A;  1L2B A;  2F4V M;  2Z4R A;  3VLF B;  3LW5 F;  3GRR A;  2V1C A;  4LJ9 A;  1D0K A;  4FW9 A;  4LG2 A;  5DYG A;  3CTW B;  1HNX M;  4AKH A;  2EUC A;  1ZMW A;  1SXJ A;  5ITR A;  4JYA M;  1Z59 A;  3PVS A;  2HKJ A;  3HY5 A;  2QZ4 A;  4GC9 A;  3FUX A;  4G3O A;  4KLN A;  4REZ A;  3GLF E;  2QSF X;  3FTF A;  3WHK A;  3GPU A;  4NSR A;  2ERC A;  4F1I A;  3AOE A;  3HU3 A;  5IWA M;  3SHF A;  1N36 M;  3A45 A;  4HL4 A;  4MB7 A;  3DFZ A;  1WJ7 A;  4GHA A;  1F4I A;  3GLG B;  4DR2 M;  3VFD A;  1JB0 F;  1OAO C;  2KNA A;  4AW4 A;  1HNW M;  3L25 A;  1S3S A;  1TH2 A;  2DWL A;  3U61 A;  1DV0 A;  3H4M A;  1IY1 A;  5ITU A;  4UN2 B;  4CHT B;  3K92 A;  3JR5 A;  2XZU A;  1GJS A;  1DO0 A;  1V34 A;  4LF5 M;  3FUT A;  5JI3 E;  2DHY A;  1IY0 A;  2UUA M;  2XEP A;  1IXS B;  3KS8 A;  1QZM A;  5FTJ A;  1WGN A;  3R9X B;  1T43 A;  5FLX S;  3GPX A;  5ITT A;  1C1K A;  1A5T A;  2QQ8 A;  2XSZ A;  4MH0 E;  2VDB B;  4AG5 A;  2CV2 A;  2C99 A;  1ZAE A;  2LVQ D;  3TE6 A;  4RNA A;  3UJN A;  4DV4 M;  3MJ5 A;  3GQ3 A;  5GKN A;  1NV9 A;  5ITX E;  2ZM6 M;  2JZ1 A;  1AUA A;  1N32 M;  1D2N A;  4DV0 M;  4Z6Y A;  3MMP A;  2D7H A;  2XF3 A;  4LF6 M;  1Q02 A;  4DUY M;  3C9P A;  1TDH A;  2W82 A;  1MX0 A;  4FCT A;  4IBJ A;  4JI8 M;  4B08 A;  2DI0 A;  4GIP A;  5KPR A;  1G4A E;  2C5R A;  1N34 M;  4FWH A;  3B7Q A;  1C7Y A;  2YQZ A;  4KHP M;  3UMM A;  4LJ8 A;  4GRI A;  3TWL A;  3KDS E;  4S12 A;  3L26 A;  4I5S A;  5EP4 A;  3U6L A;  3QYE A;  2YFQ A;  1QVR A;  2L7H A;  1NNJ A;  3MK6 A;  4NRV A;  1NV8 A;  1DGF A;  5FTL A;  1HT2 E;  3IEC A;  7CAT A;  5BPV A;  1YUB A;  3LVV A;  4M9X A;  4AQY M;  2CHV A;  3QWL A;  2JUJ A;  3D8B A;  4Z8X A;  5EXS A;  3KVW A;  3ZQJ A;  3GP1 A;  1IQP A;  1XMO M;  4M9Z A;  4QOZ C;  1ZV1 A;  3KSJ A;  4AKG A;  1VEG A;  4FWD A;  3GLG E;  3SAT A;  1HR0 M;  3A42 A;  1NHW C;  1L8Q A;  1KYI A;  2MRO B;  4HLQ A;  5EJC A;  1Z5A A;  3AFH A;  3E21 A;  3SBJ A;  4LF7 M;  1LTM A;  4WW0 A;  4OVZ B;  2MR9 A;  2CP8 A;  2K0B X;  1P3Q Q;  4DR4 M;  3GLH B;  2ZBK B;  2DZO B;  4IJF A;  4CIZ A;  2QEN A;  1EE8 A;  3HX3 A;  2E5L M;  1QAM A;  4OX9 M;  4LJ4 A;  5IZ7 D;  3C58 A;  3KP0 E;  3V76 A;  4QNM A;  3EIE A;  3U6Q A;  1Z6T A;  4DV7 M;  1JQJ C;  4M0W A;  4NSO B;  2UU9 M;  4LF4 M;  1R7R A;  2C96 A;  2VQE M;  2ZAO A;  3BXW A;  1H6U A;  5DFL A;  1FNN A;  1QUT A;  1IBM M;  2DZN B;  1WXQ A;  2HCB A;  2KZS A;  3HJS A;  2KXE A;  4KOD A;  3VDU A;  1Q39 A;  2H1R A;  4RKU F;  1OJL A;  3AKZ A;  3FYD A;  1PGY A;  1K3X A;  2BJV A;  3I51 A;  1R5L A;  4LJ5 A;  2KNV A;  1QUS A; 
#chains in the Genus database with same CATH homology
 4GKJ M;  1E32 A;  2I7P A;  1LV7 A;  1IY2 A;  1OFI A;  4JXJ A;  5EP3 A;  2QP9 X;  2R45 A;  4LRT A;  3SAS A;  4G4N A;  1GKI A;  2CHG A;  2LNH C;  2DVW B;  3TPZ A;  4GKK M;  1NHG C;  2XH9 A;  1NVM A;  4L4U A;  5FSW A;  3GLF A;  1NSF A;  1IXZ A;  3SHG B;  2LH0 A;  4DR1 M;  2YR0 A;  2G5G X;  3W0L B;  3VDP A;  3HHY A;  3ZC7 B;  3HGI A;  4IBK A;  4JN6 A;  2CHQ A;  3RGP A;  4KO8 A;  2X49 A;  2QBY B;  2F5S A;  1YE9 A;  1UM8 A;  4D82 A;  4MGI E;  1NNU C;  3HU1 A;  3U6M A;  3DOA A;  1DGB A;  2DWZ B;  2P5T A;  3M0E A;  4AI6 A;  3KXE C;  3CF0 A;  1Z5C A;  4CIS A;  4YY3 M;  3AOG A;  2J7O A;  1J7K A;  1FJG M;  1DGH A;  2R18 A;  1PJI A;  5ITX A;  3RE8 A;  3JR4 A;  5FTK A;  5KPT A;  5H37 D;  1G41 A;  3T15 A;  3J81 S;  3PFI A;  2DWN A;  3IG5 A;  4GMQ A;  5LMU M;  4LGY A;  2A5Y B;  3J80 S;  2KZU A;  4B7F A;  1G8P A;  1TH3 A;  4L78 A;  1IN6 A;  3FTE A;  4B3R M;  3HJ8 A;  1L2C A;  3SMS A;  3U6D A;  2XGN A;  1SXJ B;  2OPF A;  4PCZ A;  2QCU A;  2D7G A;  3CF6 E;  3I4Y A;  3U60 B;  3L28 A;  5EP2 A;  2M60 A;  2CV1 A;  4WUR A;  1NY6 A;  4B3T M;  2R65 A;  4IBI A;  4OU7 A;  4BLC A;  3SAR A;  2KA6 B;  3A98 B;  2Y0Q A;  3U6O A;  3VK7 A;  3FUV A;  3BOS A;  2FNA A;  3GLG A;  3FUU A;  1XXH A;  3GLI B;  4A3V B;  3TQS A;  3ZCB B;  5EXX A;  2VII A;  1R2Z A;  4NOO B;  4B7H A;  3U61 B;  3AL0 C;  3U6S A;  4MGK E;  1Z5B A;  4IBE A;  4FWG A;  4X64 M;  2HHH M;  4IIW A;  4FD2 A;  2CFO A;  2CE7 A;  2Z3X A;  4JI6 M;  3IG8 A;  4NL4 H;  1TGU A;  2Y0T A;  4IBD A;  3HHZ A;  3VKG A;  5KO3 A;  4GIT A;  4NXN M;  4W5W A;  3SAV A;  1DGG A;  2KRK A;  5C18 A;  4JI2 M;  1I94 M;  1W5S A;  3JAM S;  2R62 A;  3HKP A;  3FUW A;  3VKH A;  4B3M M;  1JR3 D;  2EA0 A;  2L6O A;  3PXG A;  3K8Z A;  1YSY A;  1GL7 A;  3NWL A;  3U5Z A;  1Q3C A;  1XNR M;  3WHL A;  1QAN A;  2L09 A;  2AHM A;  3KP1 E;  4DV5 M;  2K47 A;  2KEB A;  4G6Z A;  3SYK A;  2UXD M;  2FE8 A;  2G8L A;  2L7I A;  4GH9 A;  3KFU G;  4LY6 A;  4R7G A;  2M5Z A;  2RGH A;  2Z7J A;  4PD2 A;  1IN7 A;  3AOE C;  4I4L A;  1W5T A;  4BBA A;  1NY5 A;  1G3I A;  4JI1 M;  4LF9 M;  1IM2 A;  1XNQ M;  1XHB A;  2DHR A;  3W0F A;  1HNZ M;  1TH4 A;  3GQ4 A;  1DO2 A;  4YHH M;  1HT1 E;  3HHW A;  1IN8 A;  1QAO A;  3J7B A;  5JI2 E;  1QYR A;  3J2P B;  4OVZ A;  1ORY B;  4IBC A;  2XZF A;  4FCW A;  1KFV A;  3KW6 A;  3GLH A;  2XFT A;  3B9P A;  1MU5 A;  2C9C A;  4IBG A;  4B3S M;  3J27 B;  5IRE B;  4LCB A;  3FYC A;  4LJ7 A;  4DV2 M;  1N75 A;  2J7N A;  4ITQ A;  3GRU A;  3GRY A;  3Q8X A;  4I81 A;  1L1Z A;  3KOW E;  4L16 A;  3TWK A;  1K3W A;  3T1Y M;  4IJE A;  3TL4 X;  3J7A S;  1N78 A;  3KOX E;  4JI4 M;  4RF0 A;  1GL6 A;  2O5R A;  2R4J A;  3E9S A;  4D80 A;  4DV3 M;  3FD9 A;  3T38 A;  2XFS A;  3RGS A;  4GHL A;  2Y21 A;  1IBL M;  3A46 A;  4GC5 A;  1HQY E;  2C9O A;  3HHX A;  4QNR A;  4LJ6 A;  1E9S A;  4I8O A;  4MGH A;  1SXJ C;  4ZPX A;  1OFH A;  1PJJ A;  1QQW A;  5EQT A;  5FTM A;  4LFB M;  4PDI A;  3RFW A;  4MGY E;  4DR5 M;  5BR8 M;  3L27 A;  3MHV C;  4QHS A;  4JI0 M;  4PDG A;  2F5P A;  8CAT A;  4AZF A;  3GPP A;  2OQ4 A;  1N77 A;  2UUB M;  4FVM A;  1XWI A;  3SMP A;  1E94 E;  4AG6 A;  2Q2E B;  3THG A;  2CEA A;  4M9S A;  4IBB A;  4IBF A;  3M6A A;  4DUZ M;  4MM3 B;  4MGZ E;  3GQ5 A;  1J09 A;  4X62 M;  5DYI A;  3K1J A;  3SAU A;  1XC8 A;  2CUZ A;  2YNM D;  5LMN M;  1X37 A;  1R2Y A;  4NRW A;  2X8A A;  5EP1 A;  4JV5 M;  2X4A A;  3FKE A;  4LFC M;  3R8F A;  2F5N A;  3HU2 A;  3HWS A;  3L2A A;  3HJQ A;  2UUC M;  2EO2 A;  5FTN A;  4II7 A;  3AJI B;  3ZH9 B;  3NBI A;  4JI3 M;  1IN4 A;  2D7E A;  4D81 A;  2LXE A;  5C1B A;  1I4W A;  1ZQ9 A;  3FTD A;  1XMQ M;  4CGY B;  2BNK A;  5EXT A;  4XBO A;  3GO8 A;  1SXJ E;  2RKO A;  4PT5 A;  3SC3 A;  1NJG A;  3PNY A;  3KOZ E;  3SFZ A;  2UXC M;  3LQR A;  1HQC A;  3UGJ A;  4AKI A;  2ZAM A;  3UK6 A;  2XLJ A;  2DXI A;  2CV0 A;  4X66 M;  5IT9 S;  2UXB M;  2FFJ A;  4NXM M;  1N33 M;  5KPZ A;  3M7G A;  3AV0 A;  3KOY E;  4DR7 M;  3U60 A;  2NQ8 C;  3D8L A;  2HL7 A;  4B7G A;  5E6J A;  4LZJ A;  4LZZ A;  5ITQ A;  2VQF M;  4G4R A;  2JA2 A;  3DA1 A;  4DR6 M;  1JR3 A;  1R6B X;  3FTC A;  3U6P A;  4FCV A;  1XXH B;  2F5Q A;  3GLI A;  2C98 A;  3VK8 A;  4L15 A;  4JI7 M;  1J5E M;  2F5O A;  4K0K M;  4LRS A;  2DWM A;  1L2D A;  1T3T A;  1VDD A;  3DZD A;  1IBK M;  3L29 A;  1IXR C;  2R46 A;  4DV1 M;  4P16 A;  4DR3 M;  4LJA A;  3GLF B;  3E4R A;  4L8R C;  3GRV A;  3CF2 A;  5KQD A;  4LGM A;  3TWM A;  4X65 M;  5E26 A;  3OTO M;  2V1U A;  3LQQ A;  3QAU A;  1NJF A;  1L1T A;  3LMM A;  2ZAN A;  2XSZ D;  1KSF X;  2KW0 A;  5DNY A;  3SYL A;  3U6E A;  2RGO A;  2QBY A;  3I4V A;  1E9R A;  1GLN A;  1K82 A;  4QOS A;  1PM5 A;  4LFA M;  4JI5 M;  1GVN A;  3U5Z B;  3EIH A;  2BJW A;  3T1H M;  4EIW A;  4DV6 M;  1TDZ A;  2LWX A;  2Y20 A;  3PNV A;  5ITY A;  4XGI A;  2Z4S A;  1DGH B;  4TUW A;  2I7N A;  4QOZ C;  3KSX A;  4RF1 A;  5EXP A;  3ILK A;  4M0D A;  1G59 A;  4OW0 A;  3U6C A;  4R3D A;  2KRU A;  3SAW A;  1QAQ A;  3UZU A;  5A2Q S;  4G4O A;  2R4E A;  4BB9 A;  4LF8 M;  5F3W A;  3LVW A;  4QHT A;  2V6Z M;  2FOI C;  3KS4 A;  3K2L A;  1SXJ D;  1IN5 A;  2QPA A;  4G4Q A;  1Q3B A;  5KQ8 A;  3GPY A;  1L2B A;  2F4V M;  2Z4R A;  3VLF B;  4LG2 A;  3GRR A;  2V1C A;  4LJ9 A;  4FW9 A;  5DYG A;  3CTW B;  1HNX M;  4AKH A;  2EUC A;  1SXJ A;  5ITR A;  4JYA M;  3PVS A;  1Z59 A;  2HKJ A;  4GC9 A;  2QZ4 A;  3FUX A;  4KLN A;  4REZ A;  3FTF A;  3WHK A;  3GPU A;  4NSR A;  2ERC A;  3AOE A;  3HU3 A;  5IWA M;  3SHF A;  1N36 M;  3A45 A;  4HL4 A;  4MB7 A;  3DFZ A;  4GHA A;  3GLG B;  4DR2 M;  3VFD A;  1HNW M;  4AW4 A;  3L25 A;  1S3S A;  1TH2 A;  2DWL A;  3U61 A;  3H4M A;  1IY1 A;  5ITU A;  4CHT B;  3JR5 A;  2XZU A;  1DO0 A;  4LF5 M;  3FUT A;  5JI3 E;  1IY0 A;  2UUA M;  2XEP A;  1IXS B;  3KS8 A;  1QZM A;  5FTJ A;  3R9X B;  5FLX S;  3GPX A;  5ITT A;  1C1K A;  2XSZ A;  4MH0 E;  4AG5 A;  2CV2 A;  2C99 A;  1ZAE A;  3TE6 A;  4RNA A;  3UJN A;  4DV4 M;  3MJ5 A;  3GQ3 A;  5GKN A;  5ITX E;  2ZM6 M;  1N32 M;  1D2N A;  4DV0 M;  4Z6Y A;  2D7H A;  2XF3 A;  4LF6 M;  4DUY M;  1TDH A;  2W82 A;  1MX0 A;  4FCT A;  4IBJ A;  4JI8 M;  4B08 A;  4GIP A;  5KPR A;  1G4A E;  2C5R A;  1N34 M;  4FWH A;  2YQZ A;  4KHP M;  3UMM A;  4LJ8 A;  4GRI A;  3TWL A;  3KDS E;  4S12 A;  3L26 A;  4I5S A;  5EP4 A;  3U6L A;  2YFQ A;  1QVR A;  2L7H A;  1NNJ A;  3MK6 A;  4NRV A;  1DGF A;  5FTL A;  1HT2 E;  7CAT A;  5BPV A;  1YUB A;  3LVV A;  4M9X A;  4AQY M;  2CHV A;  3QWL A;  3D8B A;  4Z8X A;  5EXS A;  3KVW A;  3GP1 A;  1XMO M;  1IQP A;  4M9Z A;  3KSJ A;  4AKG A;  4FWD A;  3SAT A;  1HR0 M;  3A42 A;  1NHW C;  1L8Q A;  1KYI A;  4HLQ A;  5EJC A;  1Z5A A;  3AFH A;  3SBJ A;  4LF7 M;  4WW0 A;  4OVZ B;  4DR4 M;  3GLH B;  2ZBK B;  2DZO B;  4IJF A;  2QEN A;  1EE8 A;  2E5L M;  1QAM A;  4OX9 M;  4LJ4 A;  5IZ7 D;  3C58 A;  3KP0 E;  4QNM A;  3EIE A;  3U6Q A;  1Z6T A;  4DV7 M;  1JQJ C;  4M0W A;  4NSO B;  2UU9 M;  4LF4 M;  1R7R A;  2VQE M;  2ZAO A;  1H6U A;  1FNN A;  1IBM M;  2DZN B;  1WXQ A;  2HCB A;  2KZS A;  3HJS A;  2KXE A;  4KOD A;  3VDU A;  1Q39 A;  2H1R A;  1OJL A;  3AKZ A;  3FYD A;  1K3X A;  2BJV A;  3K92 A;  3I51 A;  4LJ5 A;  2C96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...