4DR6M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr6M02
3U6PA 3VK8A 3T1YM 4JI0M 5ITRA 3GQ3A 4B3SM 3U6QA 5A2QS 3TWLA 1PJJA 3J7AS 3DOAA 3W0FA 1L2BA 4DV6M 1N36M 4NXMM 2F5OA 3J80S 1J5EM 4DR5M 4LF9M 1Z59A 2UXDM 4JI5M 4LF5M 4ITQA 2UUAM 4GKKM 2UUCM 4KHPM 3U6MA 1Z5AA 3SBJA 4DV2M 5BR8M 4JI6M 4B3TM 4LF8M 1TDZA 3U6DA 1L2CA 4JI1M 1IBMM 3GPUA 2VQEM 1TDHA 4K0KM 2XZUA 4NRVA 1Z5BA 4DV0M 1PM5A 2UUBM 5IWAM 3JR5A 2F5PA 3SARA 4DV5M 4G4OA 3SATA 2ZM6M 1KFVA 3U6SA 3U6OA 2HKJA 3T1HM 1Q3CA 3VK7A 1N33M 4DR7M 4LFCM 4JI3M 4G4QA 1EE8A 4NRWA 1XNQM 4MB7A 3SAUA 2UXCM 3GQ4A 4LFBM 2E5LM 3A45A 3GP1A 1XMOM 4JI7M 4DV3M 3SASA 1NNJA 3OTOM 1L1TA 4CISA 3JR4A 3TWKA 3U6LA 4DUYM 5ITQA 5ITYA 4B3MM 4PDIA 2F5QA 1Q3BA 3JAMS 3GQ5A 1XMQM 4LF7M 4PD2A 4G4NA 4JYAM 3C58A 2OPFA 2F4VM 1N32M 2UU9M 5LMNM 1Q39A 4DV1M 1K82A 2VQFM 4LF4M 4X66M 4DR3M 4LF6M 4JI2M 1K3XA 4DR2M 1XNRM 1MX0A 1R2ZA 1L2DA 4AQYM 2EA0A 1IBKM 5LMUM 2F5NA 5ITXA 1N34M 4G4RA 3A42A 3GPXA 4JI8M 1PJIA 4B3RM 3SAVA 1HNZM 4OX9M 1I94M 5ITTA 3GO8A 3J81S 5FLXS 2F5SA 4DV7M 2ZBKB 5IT9S 4YHHM 2Q2EB 4DUZM 5ITXE 4LFAM 1HNWM 4NXNM 1MU5A 4PCZA 2HHHM 3A46A 3GPPA 4JV5M 1R2YA 2UXBM 3SAWA 4X65M 4GKJM 2XZFA 1IBLM 1HR0M 2OQ4A 4JI4M 4DR1M 1Z5CA 4DR4M 3TWMA 4DV4M 3U6CA 1L1ZA 4PDGA 1K3WA 3U6EA 1XC8A 1HNXM 5ITUA 4DR6M 3GPYA 4YY3M 4X64M 1FJGM 4X62M
chains in the Genus database with same CATH superfamily
3FE3A 3U6PA 1G71A 3VK8A 1LTMA 4JI0M 2R62A 1VG5A 3NBIA 3KS8A 1N78A 2JY6B 3Q8XA 2C9OA 3TWLA 2M60A 3VFDA 1ZMUA 1QVRA 3U5ZB 5F3WA 3U61A 1N36M 1QZEA 1NJFA 2CUZA 4IBEA 1XWIA 1G8PA 1Z59A 2A5YB 2DZOB 4M9XA 4JI5M 3K1JA 1HQCA 2EKFA 2UUAM 2JY8A 4ITQA 2Y0TA 3H4JA 1G59A 4GKKM 1IXSB 4AKIA 4JI6M 2L6OA 1N75A 2K6BA 1UM8A 4Q7JA 2JXNA 1DGGA 3PXGA 4D82A 4L8RC 3KP1E 2KHHA 2DVWB 1WHCA 3KOWE 4NC6A 1E32A 2XF3A 4DV0M 2W82A 4EIWA 3GLIA 2MR9A 1PM5A 2F5PA 3SARA 4DV5M 1D0KA 1GL7A 2ZM6M 4FCVA 4OVZA 2HKJA 4MM3B 1W5TA 4WP2A 4JI3M 2EO2A 4P17A 3GLFE 4I81A 4ZPXA 3E4RA 2LTUA 2BJWA 1XNQM 2QNJA 4LZJA 4MGHA 1XMOM 4JI7M 2ZTDA 5FTNA 4CHTB 1XXHA 2DHYA 4LRTA 1L1TA 4CISA 4M9SA 3U6LA 3TWKA 3KP0E 1SXJA 2F5QA 1XMQM 3GQ5A 1PGYA 2LHCA 3ZC7B 4FD2A 1JQJC 1CUKA 1VDLA 2DZLA 5DYIA 2VIIA 2CEAA 3M7GA 2VQFM 1GVNA 1R5LA 5EXTA 2FE8A 2YFQA 2DNAA 4W5WA 4FW9A 1K3XA 2DWMA 3HZJA 2WSCF 4QNMA 1MX0A 2NQ8C 2XEPA 2JZ0A 1IBKM 1YLAA 2EJSA 3FUTA 4B08A 5ITXA 1N34M 3GPXA 1NHGC 2N35A 1PJIA 4JI8M 3K9OA 4LJ5A 3KOYE 4JXJA 4M0WA 1HNZM 4B3RM 3BXWA 4D81A 2DAGA 3HKPA 1VQ1A 2BWEA 2QHOB 1OTRA 5FLXS 5DFLA 2F5SA 3E46A 4II7A 2R46A 4IBCA 3E21A 3HHWA 1TH2A 3RFWA 2MH8A 4NXNM 4PCZA 1IN6A 4XK8F 3ZQJA 1T6OA 2C98A 3SAWA 3GLHA 4GKJM 3RE8A 2L2DA 4OW0A 2OQ4A 4R7GA 1ORYB 4DR1M 3HU3A 2R44A 5EXXA 1NSFA 3HHZA 2CRUA 3B7NA 3LW5F 4Y28F 3PVSA 4GHAA 1K3WA 1E9SA 3SHGB 3U6EA 2R18A 2DXIA 1V92A 2HAKA 3UZUA 4X64M 3MJ5A 1FJGM 3U61B 1HJPA 4M9ZA 4X62M 3HGIA 5KPZA 2X8AA 3FYCA 3CGWA 2H5XA 2OOBA 2R65A 3AJIB 3T1YM 3VLFB 3GQ3A 3U6QA 4JN6A 5KPTA 1D2NA 5A2QS 1G4AE 3KS4A 1DGHA 2ZAOA 3W0FA 2MGWA 2RGOA 2F5OA 1J5EM 2FS1A 3GLIE 4GHLA 2X49A 1JR3E 1EIJA 3R8FA 1G41A 5IREB 4DBGB 1IFYA 3GLGE 3GLIB 1T3TA 4RF0A 4L78A 3K92A 3TL4X 3U6DA 4OVZB 1L2CA 1R6BX 1A5TA 2VQEM 3SYLA 1WIVA 2KNVA 3I01M 4K0KM 1YSYA 4LZZA 4NRVA 4AZFA 3AL0C 3FYDA 1IQPA 2KZUA 2Z8YM 4LJ9A 3W67A 1GJSA 1ZQ9A 2HWJA 2D7GA 1XXHE 4FWHA 4IJFA 5EP3A 1Q3CA 3U6OA 3VK7A 1N33M 4IBBA 2I7PA 3HU1A 3T15A 4LFCM 4DR7M 3KDSE 1OAOC 4MH0E 4G4QA 1QAMA 4GIPA 1QYRA 2XSZD 2DAMA 1XXHB 1DO2A 3I4YA 5E6JA 2CHQA 3LVWA 4F1IA 5FTLA 2KZSA 2MROB 5H37D 3SAUA 2C5RA 2UXCM 4LFBM 3A45A 4L16A 1ZMVA 2FH0A 1SXJB 3GRRA 4MGIE 1QUSA 3AOEC 4I4LA 5EXPA 2CFOA 4DV3M 1F4IA 2KNAA 1QDTA 3MMPA 4WURA 3NWLA 1NNJA 2V6ZM 2DHRA 3HJSA 1WR1B 3U60A 3IECA 5ITQA 4DUYM 2G5GX 1Q3BA 3ILKA 3HX3A 5KO3A 4G4NA 4JYAM 2HL7A 4FWDA 2OPFA 1N32M 4TUWA 1GL6A 2FFJA 2UU9M 3AFHA 1OFIA 4FWGA 4XBOA 1D0LA 2EUCA 2Y21A 2DAIA 2LH0A 4X66M 2VF7A 2R4JA 2ZAMA 4DR3M 2L7HA 2RKOA 2JY7A 1E9RA 4LRSA 3AKZA 2KDLA 5EXSA 1XNRM 1IY0A 2K9DA 1PRBA 1WJ7A 2K0BX 1TH4A 3L27A 5LMUM 2KA6B 4QOSA 2F5NA 3SHFA 5L8RF 3SC3A 3A42A 3K8ZA 1PJSA 3EIHA 2R0IA 4LGMA 2QBYA 1I94M 3HJ8A 3C9PA 4A3VB 2V1CA 4BBAA 3GLHB 3AOGA 1ZMWA 2Q2EB 5KQ8A 2LVQD 1HNWM 1MN3A 2VF8A 2HHHM 2O5RA 4IBIA 3GPPA 2KEBA 1QZMA 1R2YA 2UXBM 3CF2A 3J27B 2DWZB 1ZAEA 5FTKA 1IBLM 3BBZA 4JI4M 3MHVC 3TWMA 3FUWA 3I51A 4Z6YA 2CP8A 1BVSA 1TF0B 2CHGA 3SYKA 2XFTA 3CF0A 5IZ7D 4DV4M 1VEJA 1NNUC 4M0DA 2QENA 4XGIA 1JR3D 3I4VA 5JI3E 3FTEA 1AUAA 1DGBA 3QYEA 1DGHB 2GQFA 3L26A 2JUJA 1HT1E 2HCBA 1OKSA 1WGNA 1UFZA 1YE9A 3SMPA 2DWLA 2CV0A 4B3SM 1V34A 3B9PA 3LQQA 3BOSA 2LBCA 4CJ6A 4NSOB 3UGJA 2R45A 1PJJA 1GJTA 3GRUA 2APLA 3J7AS 3DOAA 3LCUA 2MJ5B 2DAEA 4DV6M 3L29A 1QQWA 4KO8A 3J80S 2OO9A 1OIZA 4LF9M 2JZ1A 2UXDM 3RGSA 1NY6A 3GRYA 2UUCM 1QAQA 3SBJA 4DV2M 1N77A 3D8LA 5BR8M 1XHBA 4B3TM 4LF8M 1TDZA 3GLFA 1IBMM 3GPUA 4BB9A 1C7YA 3HY5A 2RGHA 1TDHA 1IN8A 1Z5BA 2UUBM 5IWAM 2XFSA 4LJ7A 1YUBA 5FSWA 4G4OA 4NSRA 4LJ4A 1KFVA 2LXEA 3U6SA 3T1HM 4RKUF 2LWXA 1NVMA 3PNVA 1Z6TA 5EP4A 5EP2A 1T43A 1AIPC 1EE8A 3LMMA 2CE7A 4NRWA 1NY5A 3TPZA 3SMSA 3I04M 1TTEA 2C99A 4Z8XA 5EQTA 4NL4H 3GP1A 3E9SA 3U60B 2DWNA 4IBGA 2XGNA 2JWSA 3DZDA 2L4FA 2LNHC 4HLQA 1OFHA 1QANA 4IBJA 3HHYA 3W0LB 4GITA 3MK6A 2D7HA 4CIZA 3FKEA 3UK6A 3QWLA 1IN5A 3DA1A 3WHKA 1GKIA 4GH9A 3L2AA 2QCUA 4REZA 5DNYA 4PDIA 4B3MM 2D7EA 3KFUG 3FTCA 4LF7M 1DGFA 2F4VM 4AKHA 4B7FA 5LMNM 4LJAA 3AOEA 2L09A 3DFZA 2C96A 4DV1M 1HT2E 3R9XB 5C1BA 3FRHA 1GABA 3C3EA 4GRIA 4JI2M 4IJEA 3B74A 1SXJE 2XH9A 3B7QA 3UJNA 1Y8GA 3KOXE 3IHPA 2QBYB 4L6V6 2EA0A 3KXEC 2RRUA 1W5SA 1E94E 4QHTA 3ZCBB 3KOZE 1XB2B 5EJCA 3F92A 2YR0A 2FNAA 3H4MA 1TR8A 2I7NA 4LJ8A 4R71A 2JNHA 4HL4A 2QQ8A 1R4GA 3IG8A 5ITTA 4FVMA 1H6UA 3J81S 2Z4RA 2H1RA 3GO8A 3VKHA 3W68A 2CV1A 4DV7M 2ZBKB 4HEOA 1S3SA 2LVNC 5IT9S 4YHHM 4DUZM 5ITXE 4IBKA 3EIEA 1GLNA 2R4EA 1JB0F 3KSJA 1MU5A 2ZTCA 2QP9X 1QAOA 3A46A 4JV5M 1PJTA 3M0EA 3TQSA 2WZJA 4X65M 3RGPA 2XZFA 1HQYE 2JP7A 1Z5CA 3L25A 1VEKA 4L4UA 3UMMA 4GC5A 5JI2E 1IY2A 2BWBA 1L1ZA 3M6AA 2KRKA 2AHMA 2DKLA 2QPAA 2LVPC 2KRUA 1QUTA 2QZ4A 3LVVA 1XC8A 5FTMA 3T38A 3FD9A 3GLHE 4GEWA 4YY3M 2C9CA 1EFUB 4OX9M 1ZV1A 1JR3A 2J7OA 1NHWC 3SFZA 1X37A 2BJVA 5ITRA 1IY1A 3J2PB 2CHVA 3GLGA 1GO5A 2DZNB 2KW0A 4QOZC 1OQYA 4I8OA 4WW0A 1L2BA 1NJGA 3PNYA 2M5ZA 2B3TA 4NXMM 3FRIA 3C3DA 3GLFB 4DR5M 1IN4A 1RU3A 3ZH9B 2XLJA 4RNAA 4IBFA 2J5YA 4KT0F 3PFIA 4CGYB 5E26A 4LF5M 4KHPM 3U6MA 1I4WA 1Z5AA 2LVOC 3U5ZA 1D0MA 2BNKA 2JA2A 4MGZE 4D80A 2DI0A 3KVWA 2Y0QA 2Z4SA 2P5TA 2KXEA 1IXRC 8CATA 4JI1M 3D8BA 3HHXA 3HJQA 4R3DA 2L7IA 2Z7JA 2XZUA 2DAKA 5KPRA 2YNMD 2LHGA 1IXSA 4L15A 4LGYA 3THGA 5KQDA 4FCTA 3WHLA 3JR5A 2V1UA 3SATA 1V33A 4NOOB 1QDRA 4B7HA 1WGLA 3QYBA 3B7ZA 2VDBB 1DV0A 2QSFX 1SXJC 1IXZA 1Q02A 1MJGM 4MB7A 3GQ4A 1J7KA 1OAIA 2E5LM 2O01F 2ZANA 1L8QA 4AW4A 1G3IA 3CTWB 3FTFA 2FOIC 3A98B 4KODA 3Q8GA 4P16A 1J09A 1PJQA 3CF6E 5DYGA 3SASA 4LY6A 3OTOM 1SXJD 5EP1A 5C18A 4GMQA 4AKGA 3J7BA 2OOAA 4AG5A 3JR4A 2Y20A 5ITYA 3JAMS 3KW6A 4PD2A 4OU7A 3C58A 2CWBA 3NBXX 4ANRA 1P3QQ 4I5SA 3AV0A 1Q39A 4BLCA 2LVAA 2O25A 3V76A 1K82A 4GC9A 3TE6A 4LF4M 5BPVA 2GNOA 3IG5A 4LCBA 4LF6M 3QAUA 2WSFF 5FTJA 2K47A 4FCWA 4MGKE 4DR2M 4IBDA 4RF1A 1SG9A 1R2ZA 1L2DA 4AQYM 2XSZA 4KLNA 3HU2A 1KSFX 2JY5A 1NV9A 1LV7A 2EKKA 4G4RA 1C1KA 3GRVA 2ERCA 3K2LA 3L28A 2YQZA 3SAVA 2DENA 1IM2A 1OIPA 1TGUA 1VDDA 4G6ZA 4MGYE 2L4EA 4AI6A 4PT5A 4G3OA 3KSXA 3B89A 2KNZA 1DO0A 4LFAM 2G3QA 3FUXA 3FUVA 4LG2A 3LCVB 1IN7A 4AG6A 3FTDA 1WXQA 4B7GA 2WSEF 1KYIA 1R7RA 3FUUA 3VDUA 1HR0M 4IIWA 1TH3A 4DR4M 7CATA 4S12A 1OJLA 3LQRA 4F2LA 4UN2B 3T6PA 1VEGA 3U6CA 4PDGA 2G8LA 3K9PA 3HWSA 4QHSA 2Z3XA 2R6FA 4LJ6A 4QNRA 3GLGB 5ITUA 1FNNA 1HNXM 5GKNA 4DR6M 3GPYA 2X4AA 2CV2A 3VDPA 1NV8A 3VKGA 1NO1A 2J7NA
chains in the Genus database with same CATH topology
3U6PA 3VK8A 4JI0M 2R62A 3NBIA 3KS8A 1N78A 3Q8XA 2C9OA 3TWLA 2M60A 3VFDA 3U5ZB 1QVRA 5F3WA 3U61A 1N36M 1NJFA 2CUZA 4IBEA 1XWIA 1G8PA 1Z59A 2A5YB 2DZOB 4M9XA 4JI5M 3K1JA 1HQCA 2UUAM 4ITQA 4GKKM 2Y0TA 1G59A 1IXSB 4AKIA 4JI6M 2L6OA 1N75A 1UM8A 1DGGA 3PXGA 4D82A 4L8RC 3KP1E 2DVWB 3KOWE 4DV0M 1E32A 2XF3A 1PM5A 2W82A 4EIWA 3GLIA 2F5PA 3SARA 4DV5M 1GL7A 2ZM6M 4FCVA 4OVZA 2HKJA 4MM3B 1W5TA 4JI3M 2EO2A 4I81A 4ZPXA 3E4RA 2BJWA 1XNQM 4LZJA 4MGHA 1XMOM 4JI7M 5FTNA 4CHTB 1XXHA 4LRTA 1L1TA 4CISA 4M9SA 3U6LA 3TWKA 3KP0E 1SXJA 2F5QA 1XMQM 3GQ5A 3ZC7B 4FD2A 1JQJC 5DYIA 2VIIA 2CEAA 3M7GA 2VQFM 1GVNA 5EXTA 2FE8A 2YFQA 4W5WA 4FW9A 1K3XA 2DWMA 4QNMA 1MX0A 2NQ8C 2XEPA 1IBKM 3FUTA 4B08A 5ITXA 1N34M 3GPXA 1NHGC 4JI8M 1PJIA 4B3RM 4M0WA 4LJ5A 3KOYE 4JXJA 1HNZM 4D81A 3HKPA 5FLXS 2F5SA 4II7A 2R46A 4IBCA 3HHWA 1TH2A 3RFWA 4NXNM 4PCZA 1IN6A 2C98A 3SAWA 3GLHA 4GKJM 3RE8A 4OW0A 2OQ4A 4R7GA 1ORYB 4DR1M 3HU3A 5EXXA 1NSFA 3HHZA 3PVSA 4GHAA 1K3WA 1E9SA 3SHGB 3U6EA 2R18A 2DXIA 3UZUA 4X64M 3MJ5A 1FJGM 3U61B 4M9ZA 4X62M 3HGIA 5KPZA 2X8AA 3FYCA 2R65A 3AJIB 3T1YM 3VLFB 3GQ3A 3U6QA 4JN6A 5KPTA 1D2NA 5A2QS 1G4AE 3KS4A 1DGHA 2ZAOA 3W0FA 2RGOA 2F5OA 1J5EM 4GHLA 2X49A 3R8FA 1G41A 5IREB 3GLIB 1T3TA 4RF0A 4L78A 3K92A 3TL4X 3U6DA 4OVZB 1L2CA 1R6BX 2VQEM 3SYLA 4K0KM 1YSYA 4LZZA 4NRVA 4AZFA 3AL0C 3FYDA 1IQPA 2KZUA 4LJ9A 1ZQ9A 2D7GA 4FWHA 4IJFA 5EP3A 3U6OA 1Q3CA 3VK7A 1N33M 4IBBA 2I7PA 3HU1A 3T15A 4LFCM 4DR7M 3KDSE 4MH0E 4G4QA 1QAMA 4GIPA 1QYRA 2XSZD 3I4YA 1XXHB 1DO2A 5E6JA 5H37D 2CHQA 3LVWA 2C5RA 5FTLA 2KZSA 3SAUA 2UXCM 4LFBM 3A45A 4L16A 4MGIE 1SXJB 3GRRA 3AOEC 4I4LA 5EXPA 4DV3M 2CFOA 1NNJA 4WURA 3NWLA 2V6ZM 2DHRA 3HJSA 3U60A 4DUYM 5ITQA 2G5GX 1Q3BA 3ILKA 5KO3A 4G4NA 4JYAM 2HL7A 4FWDA 2OPFA 1N32M 4TUWA 1GL6A 2FFJA 2UU9M 3AFHA 1OFIA 4FWGA 4XBOA 2EUCA 2Y21A 4X66M 2LH0A 4DR3M 2ZAMA 2R4JA 2L7HA 2RKOA 1E9RA 4LRSA 3AKZA 1XNRM 5EXSA 1IY0A 3L27A 1TH4A 5LMUM 2KA6B 4QOSA 2F5NA 3SHFA 3SC3A 3A42A 3K8ZA 3EIHA 4LGMA 2QBYA 1I94M 3HJ8A 4A3VB 2V1CA 4BBAA 3GLHB 3AOGA 2Q2EB 5KQ8A 1HNWM 2HHHM 2O5RA 4IBIA 3GPPA 2KEBA 1QZMA 1R2YA 2UXBM 3CF2A 3J27B 2DWZB 1ZAEA 5FTKA 1IBLM 4JI4M 3MHVC 3TWMA 3FUWA 3I51A 4Z6YA 2CHGA 4DV4M 3SYKA 2XFTA 3CF0A 5IZ7D 1NNUC 4M0DA 2QENA 4XGIA 1JR3D 3I4VA 5JI3E 3FTEA 1DGBA 1DGHB 3L26A 1HT1E 2HCBA 1YE9A 3SMPA 2DWLA 2CV0A 4B3SM 3B9PA 3LQQA 3BOSA 4NSOB 2R45A 1PJJA 3GRUA 3J7AS 3DOAA 4DV6M 3L29A 1QQWA 4KO8A 3J80S 4LF9M 2UXDM 3RGSA 1NY6A 3GRYA 2UUCM 1QAQA 3SBJA 4DV2M 1N77A 3D8LA 5BR8M 1XHBA 4B3TM 4LF8M 1TDZA 3GLFA 1IBMM 3GPUA 4BB9A 2RGHA 1TDHA 1IN8A 1Z5BA 2UUBM 5IWAM 2XFSA 4LJ7A 1YUBA 5FSWA 4G4OA 4NSRA 4LJ4A 1KFVA 2LXEA 3U6SA 3T1HM 2LWXA 1NVMA 3PNVA 1Z6TA 5EP4A 5EP2A 1EE8A 3LMMA 2CE7A 4NRWA 1NY5A 3TPZA 3SMSA 3U60B 2C99A 4Z8XA 5EQTA 4NL4H 3GP1A 3E9SA 2DWNA 4IBGA 2XGNA 3DZDA 3HHYA 2LNHC 4HLQA 1OFHA 1QANA 4IBJA 3W0LB 4GITA 3MK6A 2D7HA 3FKEA 3UK6A 3QWLA 1IN5A 3DA1A 3WHKA 1GKIA 4GH9A 3L2AA 2QCUA 4REZA 5DNYA 4PDIA 4B3MM 2D7EA 3KFUG 3FTCA 4LF7M 1DGFA 2F4VM 4AKHA 4B7FA 5LMNM 4LJAA 3AOEA 2L09A 3DFZA 2C96A 4DV1M 1HT2E 3R9XB 5C1BA 4JI2M 4GRIA 4IJEA 1SXJE 2XH9A 3UJNA 3KOXE 2QBYB 2EA0A 3KXEC 1W5SA 1E94E 4QHTA 3ZCBB 3KOZE 5EJCA 2YR0A 2FNAA 3H4MA 2I7NA 4LJ8A 4HL4A 3IG8A 5ITTA 4FVMA 1H6UA 3J81S 2Z4RA 2H1RA 3GO8A 3VKHA 2CV1A 4DV7M 2ZBKB 1S3SA 5IT9S 4YHHM 4DUZM 5ITXE 4IBKA 3EIEA 1GLNA 2R4EA 3KSJA 1MU5A 2QP9X 1QAOA 3A46A 4JV5M 3M0EA 3TQSA 4X65M 3RGPA 2XZFA 1HQYE 1Z5CA 3L25A 4L4UA 3UMMA 4GC5A 5JI2E 1IY2A 1L1ZA 3M6AA 2KRKA 2AHMA 2QPAA 2KRUA 2QZ4A 3LVVA 1XC8A 5FTMA 3T38A 3FD9A 4YY3M 2C9CA 4OX9M 1JR3A 2J7OA 1NHWC 3SFZA 1X37A 2BJVA 5ITRA 1IY1A 3J2PB 2CHVA 3GLGA 2DZNB 2KW0A 4QOZC 4I8OA 4WW0A 1L2BA 1NJGA 3PNYA 2M5ZA 4NXMM 3GLFB 4DR5M 1IN4A 3ZH9B 2XLJA 4RNAA 4IBFA 3PFIA 4CGYB 5E26A 4LF5M 4KHPM 3U6MA 1I4WA 1Z5AA 3U5ZA 2BNKA 2JA2A 4MGZE 4D80A 3KVWA 2Y0QA 2Z4SA 2P5TA 2KXEA 1IXRC 8CATA 4JI1M 3D8BA 3HHXA 3HJQA 4R3DA 2L7IA 2Z7JA 2XZUA 5KPRA 2YNMD 5KQDA 4L15A 4LGYA 3THGA 3JR5A 4FCTA 3WHLA 2V1UA 3SATA 4NOOB 4B7HA 1SXJC 1IXZA 4MB7A 3GQ4A 1J7KA 2E5LM 2ZANA 1L8QA 4AW4A 1G3IA 3CTWB 3FTFA 2FOIC 3A98B 4KODA 4P16A 1J09A 3CF6E 5DYGA 3SASA 4LY6A 3OTOM 1SXJD 5EP1A 5C18A 4GMQA 4AKGA 3J7BA 4AG5A 3JR4A 2Y20A 5ITYA 3JAMS 3KW6A 4PD2A 4OU7A 3C58A 4I5SA 3AV0A 1Q39A 4BLCA 1K82A 4GC9A 3TE6A 4LF4M 5BPVA 4LCBA 3IG5A 4LF6M 3QAUA 5FTJA 2K47A 4FCWA 4MGKE 4DR2M 4IBDA 4RF1A 1R2ZA 1L2DA 4AQYM 2XSZA 4KLNA 3HU2A 1KSFX 1LV7A 4G4RA 1C1KA 3K2LA 2ERCA 3L28A 3GRVA 2YQZA 3SAVA 1IM2A 1TGUA 1VDDA 4G6ZA 4MGYE 4AI6A 4PT5A 3KSXA 1DO0A 4LFAM 3FUXA 3FUVA 4LG2A 4AG6A 1IN7A 3FTDA 1WXQA 4B7GA 1KYIA 1R7RA 3FUUA 3VDUA 1HR0M 4IIWA 1TH3A 4DR4M 7CATA 4S12A 1OJLA 3LQRA 3U6CA 4PDGA 2G8LA 3HWSA 4QHSA 2Z3XA 4LJ6A 4QNRA 3GLGB 1HNXM 5ITUA 1FNNA 5GKNA 4DR6M 3GPYA 2X4AA 2CV2A 3VDPA 3VKGA 3UGJA 2J7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6P A;  3VK8 A;  3T1Y M;  4JI0 M;  5ITR A;  3GQ3 A;  4B3S M;  3U6Q A;  5A2Q S;  3TWL A;  1PJJ A;  3J7A S;  3DOA A;  3W0F A;  1L2B A;  4DV6 M;  1N36 M;  4NXM M;  2F5O A;  3J80 S;  1J5E M;  4DR5 M;  4LF9 M;  1Z59 A;  2UXD M;  4JI5 M;  4LF5 M;  4ITQ A;  2UUA M;  4GKK M;  2UUC M;  4KHP M;  3U6M A;  1Z5A A;  3SBJ A;  4DV2 M;  5BR8 M;  4JI6 M;  4B3T M;  4LF8 M;  1TDZ A;  3U6D A;  1L2C A;  4JI1 M;  1IBM M;  3GPU A;  2VQE M;  1TDH A;  4K0K M;  2XZU A;  4NRV A;  1Z5B A;  4DV0 M;  1PM5 A;  2UUB M;  5IWA M;  3JR5 A;  2F5P A;  3SAR A;  4DV5 M;  4G4O A;  3SAT A;  2ZM6 M;  1KFV A;  3U6S A;  3U6O A;  2HKJ A;  3T1H M;  1Q3C A;  3VK7 A;  1N33 M;  4DR7 M;  4LFC M;  4JI3 M;  4G4Q A;  1EE8 A;  4NRW A;  1XNQ M;  4MB7 A;  3SAU A;  2UXC M;  3GQ4 A;  4LFB M;  2E5L M;  3A45 A;  3GP1 A;  1XMO M;  4JI7 M;  4DV3 M;  3SAS A;  1NNJ A;  3OTO M;  1L1T A;  4CIS A;  3JR4 A;  3TWK A;  3U6L A;  4DUY M;  5ITQ A;  5ITY A;  4B3M M;  4PDI A;  2F5Q A;  1Q3B A;  3JAM S;  3GQ5 A;  1XMQ M;  4LF7 M;  4PD2 A;  4G4N A;  4JYA M;  3C58 A;  2OPF A;  2F4V M;  1N32 M;  2UU9 M;  5LMN M;  1Q39 A;  4DV1 M;  1K82 A;  2VQF M;  4LF4 M;  4X66 M;  4DR3 M;  4LF6 M;  4JI2 M;  1K3X A;  4DR2 M;  1XNR M;  1MX0 A;  1R2Z A;  1L2D A;  4AQY M;  2EA0 A;  1IBK M;  5LMU M;  2F5N A;  5ITX A;  1N34 M;  4G4R A;  3A42 A;  3GPX A;  4JI8 M;  1PJI A;  4B3R M;  3SAV A;  1HNZ M;  4OX9 M;  1I94 M;  5ITT A;  3GO8 A;  3J81 S;  5FLX S;  2F5S A;  4DV7 M;  2ZBK B;  5IT9 S;  4YHH M;  2Q2E B;  4DUZ M;  5ITX E;  4LFA M;  1HNW M;  4NXN M;  1MU5 A;  4PCZ A;  2HHH M;  3A46 A;  3GPP A;  4JV5 M;  1R2Y A;  2UXB M;  3SAW A;  4X65 M;  4GKJ M;  2XZF A;  1IBL M;  1HR0 M;  2OQ4 A;  4JI4 M;  4DR1 M;  1Z5C A;  4DR4 M;  3TWM A;  4DV4 M;  3U6C A;  1L1Z A;  4PDG A;  1K3W A;  3U6E A;  1XC8 A;  1HNX M;  5ITU A;  4DR6 M;  3GPY A;  4YY3 M;  4X64 M;  1FJG M;  4X62 M; 
#chains in the Genus database with same CATH topology
 3FE3 A;  3U6P A;  1G71 A;  3VK8 A;  1LTM A;  4JI0 M;  2R62 A;  1VG5 A;  3NBI A;  3KS8 A;  1N78 A;  2JY6 B;  3Q8X A;  2C9O A;  3TWL A;  2M60 A;  3VFD A;  1ZMU A;  1QVR A;  3U5Z B;  5F3W A;  3U61 A;  1N36 M;  1QZE A;  1NJF A;  2CUZ A;  4IBE A;  1XWI A;  1G8P A;  1Z59 A;  2A5Y B;  2DZO B;  4M9X A;  4JI5 M;  3K1J A;  1HQC A;  2EKF A;  2UUA M;  2JY8 A;  4ITQ A;  2Y0T A;  3H4J A;  1G59 A;  4GKK M;  1IXS B;  4AKI A;  4JI6 M;  2L6O A;  1N75 A;  2K6B A;  1UM8 A;  4Q7J A;  2JXN A;  1DGG A;  3PXG A;  4D82 A;  4L8R C;  3KP1 E;  2KHH A;  2DVW B;  1WHC A;  3KOW E;  4NC6 A;  1E32 A;  2XF3 A;  4DV0 M;  2W82 A;  4EIW A;  3GLI A;  2MR9 A;  1PM5 A;  2F5P A;  3SAR A;  4DV5 M;  1D0K A;  1GL7 A;  2ZM6 M;  4FCV A;  4OVZ A;  2HKJ A;  4MM3 B;  1W5T A;  4WP2 A;  4JI3 M;  2EO2 A;  4P17 A;  3GLF E;  4I81 A;  4ZPX A;  3E4R A;  2LTU A;  2BJW A;  1XNQ M;  2QNJ A;  4LZJ A;  4MGH A;  1XMO M;  4JI7 M;  2ZTD A;  5FTN A;  4CHT B;  1XXH A;  2DHY A;  4LRT A;  1L1T A;  4CIS A;  4M9S A;  3U6L A;  3TWK A;  3KP0 E;  1SXJ A;  2F5Q A;  1XMQ M;  3GQ5 A;  1PGY A;  2LHC A;  3ZC7 B;  4FD2 A;  1JQJ C;  1CUK A;  1VDL A;  2DZL A;  5DYI A;  2VII A;  2CEA A;  3M7G A;  2VQF M;  1GVN A;  1R5L A;  5EXT A;  2FE8 A;  2YFQ A;  2DNA A;  4W5W A;  4FW9 A;  1K3X A;  2DWM A;  3HZJ A;  2WSC F;  4QNM A;  1MX0 A;  2NQ8 C;  2XEP A;  2JZ0 A;  1IBK M;  1YLA A;  2EJS A;  3FUT A;  4B08 A;  5ITX A;  1N34 M;  3GPX A;  1NHG C;  2N35 A;  1PJI A;  4JI8 M;  3K9O A;  4LJ5 A;  3KOY E;  4JXJ A;  4M0W A;  1HNZ M;  4B3R M;  3BXW A;  4D81 A;  2DAG A;  3HKP A;  1VQ1 A;  2BWE A;  2QHO B;  1OTR A;  5FLX S;  5DFL A;  2F5S A;  3E46 A;  4II7 A;  2R46 A;  4IBC A;  3E21 A;  3HHW A;  1TH2 A;  3RFW A;  2MH8 A;  4NXN M;  4PCZ A;  1IN6 A;  4XK8 F;  3ZQJ A;  1T6O A;  2C98 A;  3SAW A;  3GLH A;  4GKJ M;  3RE8 A;  2L2D A;  4OW0 A;  2OQ4 A;  4R7G A;  1ORY B;  4DR1 M;  3HU3 A;  2R44 A;  5EXX A;  1NSF A;  3HHZ A;  2CRU A;  3B7N A;  3LW5 F;  4Y28 F;  3PVS A;  4GHA A;  1K3W A;  1E9S A;  3SHG B;  3U6E A;  2R18 A;  2DXI A;  1V92 A;  2HAK A;  3UZU A;  4X64 M;  3MJ5 A;  1FJG M;  3U61 B;  1HJP A;  4M9Z A;  4X62 M;  3HGI A;  5KPZ A;  2X8A A;  3FYC A;  3CGW A;  2H5X A;  2OOB A;  2R65 A;  3AJI B;  3T1Y M;  3VLF B;  3GQ3 A;  3U6Q A;  4JN6 A;  5KPT A;  1D2N A;  5A2Q S;  1G4A E;  3KS4 A;  1DGH A;  2ZAO A;  3W0F A;  2MGW A;  2RGO A;  2F5O A;  1J5E M;  2FS1 A;  3GLI E;  4GHL A;  2X49 A;  1JR3 E;  1EIJ A;  3R8F A;  1G41 A;  5IRE B;  4DBG B;  1IFY A;  3GLG E;  3GLI B;  1T3T A;  4RF0 A;  4L78 A;  3K92 A;  3TL4 X;  3U6D A;  4OVZ B;  1L2C A;  1R6B X;  1A5T A;  2VQE M;  3SYL A;  1WIV A;  2KNV A;  3I01 M;  4K0K M;  1YSY A;  4LZZ A;  4NRV A;  4AZF A;  3AL0 C;  3FYD A;  1IQP A;  2KZU A;  2Z8Y M;  4LJ9 A;  3W67 A;  1GJS A;  1ZQ9 A;  2HWJ A;  2D7G A;  1XXH E;  4FWH A;  4IJF A;  5EP3 A;  1Q3C A;  3U6O A;  3VK7 A;  1N33 M;  4IBB A;  2I7P A;  3HU1 A;  3T15 A;  4LFC M;  4DR7 M;  3KDS E;  1OAO C;  4MH0 E;  4G4Q A;  1QAM A;  4GIP A;  1QYR A;  2XSZ D;  2DAM A;  1XXH B;  1DO2 A;  3I4Y A;  5E6J A;  2CHQ A;  3LVW A;  4F1I A;  5FTL A;  2KZS A;  2MRO B;  5H37 D;  3SAU A;  2C5R A;  2UXC M;  4LFB M;  3A45 A;  4L16 A;  1ZMV A;  2FH0 A;  1SXJ B;  3GRR A;  4MGI E;  1QUS A;  3AOE C;  4I4L A;  5EXP A;  2CFO A;  4DV3 M;  1F4I A;  2KNA A;  1QDT A;  3MMP A;  4WUR A;  3NWL A;  1NNJ A;  2V6Z M;  2DHR A;  3HJS A;  1WR1 B;  3U60 A;  3IEC A;  5ITQ A;  4DUY M;  2G5G X;  1Q3B A;  3ILK A;  3HX3 A;  5KO3 A;  4G4N A;  4JYA M;  2HL7 A;  4FWD A;  2OPF A;  1N32 M;  4TUW A;  1GL6 A;  2FFJ A;  2UU9 M;  3AFH A;  1OFI A;  4FWG A;  4XBO A;  1D0L A;  2EUC A;  2Y21 A;  2DAI A;  2LH0 A;  4X66 M;  2VF7 A;  2R4J A;  2ZAM A;  4DR3 M;  2L7H A;  2RKO A;  2JY7 A;  1E9R A;  4LRS A;  3AKZ A;  2KDL A;  5EXS A;  1XNR M;  1IY0 A;  2K9D A;  1PRB A;  1WJ7 A;  2K0B X;  1TH4 A;  3L27 A;  5LMU M;  2KA6 B;  4QOS A;  2F5N A;  3SHF A;  5L8R F;  3SC3 A;  3A42 A;  3K8Z A;  1PJS A;  3EIH A;  2R0I A;  4LGM A;  2QBY A;  1I94 M;  3HJ8 A;  3C9P A;  4A3V B;  2V1C A;  4BBA A;  3GLH B;  3AOG A;  1ZMW A;  2Q2E B;  5KQ8 A;  2LVQ D;  1HNW M;  1MN3 A;  2VF8 A;  2HHH M;  2O5R A;  4IBI A;  3GPP A;  2KEB A;  1QZM A;  1R2Y A;  2UXB M;  3CF2 A;  3J27 B;  2DWZ B;  1ZAE A;  5FTK A;  1IBL M;  3BBZ A;  4JI4 M;  3MHV C;  3TWM A;  3FUW A;  3I51 A;  4Z6Y A;  2CP8 A;  1BVS A;  1TF0 B;  2CHG A;  3SYK A;  2XFT A;  3CF0 A;  5IZ7 D;  4DV4 M;  1VEJ A;  1NNU C;  4M0D A;  2QEN A;  4XGI A;  1JR3 D;  3I4V A;  5JI3 E;  3FTE A;  1AUA A;  1DGB A;  3QYE A;  1DGH B;  2GQF A;  3L26 A;  2JUJ A;  1HT1 E;  2HCB A;  1OKS A;  1WGN A;  1UFZ A;  1YE9 A;  3SMP A;  2DWL A;  2CV0 A;  4B3S M;  1V34 A;  3B9P A;  3LQQ A;  3BOS A;  2LBC A;  4CJ6 A;  4NSO B;  3UGJ A;  2R45 A;  1PJJ A;  1GJT A;  3GRU A;  2APL A;  3J7A S;  3DOA A;  3LCU A;  2MJ5 B;  2DAE A;  4DV6 M;  3L29 A;  1QQW A;  4KO8 A;  3J80 S;  2OO9 A;  1OIZ A;  4LF9 M;  2JZ1 A;  2UXD M;  3RGS A;  1NY6 A;  3GRY A;  2UUC M;  1QAQ A;  3SBJ A;  4DV2 M;  1N77 A;  3D8L A;  5BR8 M;  1XHB A;  4B3T M;  4LF8 M;  1TDZ A;  3GLF A;  1IBM M;  3GPU A;  4BB9 A;  1C7Y A;  3HY5 A;  2RGH A;  1TDH A;  1IN8 A;  1Z5B A;  2UUB M;  5IWA M;  2XFS A;  4LJ7 A;  1YUB A;  5FSW A;  4G4O A;  4NSR A;  4LJ4 A;  1KFV A;  2LXE A;  3U6S A;  3T1H M;  4RKU F;  2LWX A;  1NVM A;  3PNV A;  1Z6T A;  5EP4 A;  5EP2 A;  1T43 A;  1AIP C;  1EE8 A;  3LMM A;  2CE7 A;  4NRW A;  1NY5 A;  3TPZ A;  3SMS A;  3I04 M;  1TTE A;  2C99 A;  4Z8X A;  5EQT A;  4NL4 H;  3GP1 A;  3E9S A;  3U60 B;  2DWN A;  4IBG A;  2XGN A;  2JWS A;  3DZD A;  2L4F A;  2LNH C;  4HLQ A;  1OFH A;  1QAN A;  4IBJ A;  3HHY A;  3W0L B;  4GIT A;  3MK6 A;  2D7H A;  4CIZ A;  3FKE A;  3UK6 A;  3QWL A;  1IN5 A;  3DA1 A;  3WHK A;  1GKI A;  4GH9 A;  3L2A A;  2QCU A;  4REZ A;  5DNY A;  4PDI A;  4B3M M;  2D7E A;  3KFU G;  3FTC A;  4LF7 M;  1DGF A;  2F4V M;  4AKH A;  4B7F A;  5LMN M;  4LJA A;  3AOE A;  2L09 A;  3DFZ A;  2C96 A;  4DV1 M;  1HT2 E;  3R9X B;  5C1B A;  3FRH A;  1GAB A;  3C3E A;  4GRI A;  4JI2 M;  4IJE A;  3B74 A;  1SXJ E;  2XH9 A;  3B7Q A;  3UJN A;  1Y8G A;  3KOX E;  3IHP A;  2QBY B;  4L6V 6;  2EA0 A;  3KXE C;  2RRU A;  1W5S A;  1E94 E;  4QHT A;  3ZCB B;  3KOZ E;  1XB2 B;  5EJC A;  3F92 A;  2YR0 A;  2FNA A;  3H4M A;  1TR8 A;  2I7N A;  4LJ8 A;  4R71 A;  2JNH A;  4HL4 A;  2QQ8 A;  1R4G A;  3IG8 A;  5ITT A;  4FVM A;  1H6U A;  3J81 S;  2Z4R A;  2H1R A;  3GO8 A;  3VKH A;  3W68 A;  2CV1 A;  4DV7 M;  2ZBK B;  4HEO A;  1S3S A;  2LVN C;  5IT9 S;  4YHH M;  4DUZ M;  5ITX E;  4IBK A;  3EIE A;  1GLN A;  2R4E A;  1JB0 F;  3KSJ A;  1MU5 A;  2ZTC A;  2QP9 X;  1QAO A;  3A46 A;  4JV5 M;  1PJT A;  3M0E A;  3TQS A;  2WZJ A;  4X65 M;  3RGP A;  2XZF A;  1HQY E;  2JP7 A;  1Z5C A;  3L25 A;  1VEK A;  4L4U A;  3UMM A;  4GC5 A;  5JI2 E;  1IY2 A;  2BWB A;  1L1Z A;  3M6A A;  2KRK A;  2AHM A;  2DKL A;  2QPA A;  2LVP C;  2KRU A;  1QUT A;  2QZ4 A;  3LVV A;  1XC8 A;  5FTM A;  3T38 A;  3FD9 A;  3GLH E;  4GEW A;  4YY3 M;  2C9C A;  1EFU B;  4OX9 M;  1ZV1 A;  1JR3 A;  2J7O A;  1NHW C;  3SFZ A;  1X37 A;  2BJV A;  5ITR A;  1IY1 A;  3J2P B;  2CHV A;  3GLG A;  1GO5 A;  2DZN B;  2KW0 A;  4QOZ C;  1OQY A;  4I8O A;  4WW0 A;  1L2B A;  1NJG A;  3PNY A;  2M5Z A;  2B3T A;  4NXM M;  3FRI A;  3C3D A;  3GLF B;  4DR5 M;  1IN4 A;  1RU3 A;  3ZH9 B;  2XLJ A;  4RNA A;  4IBF A;  2J5Y A;  4KT0 F;  3PFI A;  4CGY B;  5E26 A;  4LF5 M;  4KHP M;  3U6M A;  1I4W A;  1Z5A A;  2LVO C;  3U5Z A;  1D0M A;  2BNK A;  2JA2 A;  4MGZ E;  4D80 A;  2DI0 A;  3KVW A;  2Y0Q A;  2Z4S A;  2P5T A;  2KXE A;  1IXR C;  8CAT A;  4JI1 M;  3D8B A;  3HHX A;  3HJQ A;  4R3D A;  2L7I A;  2Z7J A;  2XZU A;  2DAK A;  5KPR A;  2YNM D;  2LHG A;  1IXS A;  4L15 A;  4LGY A;  3THG A;  5KQD A;  4FCT A;  3WHL A;  3JR5 A;  2V1U A;  3SAT A;  1V33 A;  4NOO B;  1QDR A;  4B7H A;  1WGL A;  3QYB A;  3B7Z A;  2VDB B;  1DV0 A;  2QSF X;  1SXJ C;  1IXZ A;  1Q02 A;  1MJG M;  4MB7 A;  3GQ4 A;  1J7K A;  1OAI A;  2E5L M;  2O01 F;  2ZAN A;  1L8Q A;  4AW4 A;  1G3I A;  3CTW B;  3FTF A;  2FOI C;  3A98 B;  4KOD A;  3Q8G A;  4P16 A;  1J09 A;  1PJQ A;  3CF6 E;  5DYG A;  3SAS A;  4LY6 A;  3OTO M;  1SXJ D;  5EP1 A;  5C18 A;  4GMQ A;  4AKG A;  3J7B A;  2OOA A;  4AG5 A;  3JR4 A;  2Y20 A;  5ITY A;  3JAM S;  3KW6 A;  4PD2 A;  4OU7 A;  3C58 A;  2CWB A;  3NBX X;  4ANR A;  1P3Q Q;  4I5S A;  3AV0 A;  1Q39 A;  4BLC A;  2LVA A;  2O25 A;  3V76 A;  1K82 A;  4GC9 A;  3TE6 A;  4LF4 M;  5BPV A;  2GNO A;  3IG5 A;  4LCB A;  4LF6 M;  3QAU A;  2WSF F;  5FTJ A;  2K47 A;  4FCW A;  4MGK E;  4DR2 M;  4IBD A;  4RF1 A;  1SG9 A;  1R2Z A;  1L2D A;  4AQY M;  2XSZ A;  4KLN A;  3HU2 A;  1KSF X;  2JY5 A;  1NV9 A;  1LV7 A;  2EKK A;  4G4R A;  1C1K A;  3GRV A;  2ERC A;  3K2L A;  3L28 A;  2YQZ A;  3SAV A;  2DEN A;  1IM2 A;  1OIP A;  1TGU A;  1VDD A;  4G6Z A;  4MGY E;  2L4E A;  4AI6 A;  4PT5 A;  4G3O A;  3KSX A;  3B89 A;  2KNZ A;  1DO0 A;  4LFA M;  2G3Q A;  3FUX A;  3FUV A;  4LG2 A;  3LCV B;  1IN7 A;  4AG6 A;  3FTD A;  1WXQ A;  4B7G A;  2WSE F;  1KYI A;  1R7R A;  3FUU A;  3VDU A;  1HR0 M;  4IIW A;  1TH3 A;  4DR4 M;  7CAT A;  4S12 A;  1OJL A;  3LQR A;  4F2L A;  4UN2 B;  3T6P A;  1VEG A;  3U6C A;  4PDG A;  2G8L A;  3K9P A;  3HWS A;  4QHS A;  2Z3X A;  2R6F A;  4LJ6 A;  4QNR A;  3GLG B;  5ITU A;  1FNN A;  1HNX M;  5GKN A;  4DR6 M;  3GPY A;  2X4A A;  2CV2 A;  3VDP A;  1NV8 A;  3VKG A;  1NO1 A;  2J7N A; 
#chains in the Genus database with same CATH homology
 3U6P A;  3VK8 A;  4JI0 M;  2R62 A;  3NBI A;  3KS8 A;  1N78 A;  3Q8X A;  2C9O A;  3TWL A;  2M60 A;  3VFD A;  3U5Z B;  1QVR A;  5F3W A;  3U61 A;  1N36 M;  1NJF A;  2CUZ A;  4IBE A;  1XWI A;  1G8P A;  1Z59 A;  2A5Y B;  2DZO B;  4M9X A;  4JI5 M;  3K1J A;  1HQC A;  2UUA M;  4ITQ A;  4GKK M;  2Y0T A;  1G59 A;  1IXS B;  4AKI A;  4JI6 M;  2L6O A;  1N75 A;  1UM8 A;  1DGG A;  3PXG A;  4D82 A;  4L8R C;  3KP1 E;  2DVW B;  3KOW E;  4DV0 M;  1E32 A;  2XF3 A;  1PM5 A;  2W82 A;  4EIW A;  3GLI A;  2F5P A;  3SAR A;  4DV5 M;  1GL7 A;  2ZM6 M;  4FCV A;  4OVZ A;  2HKJ A;  4MM3 B;  1W5T A;  4JI3 M;  2EO2 A;  4I81 A;  4ZPX A;  3E4R A;  2BJW A;  1XNQ M;  4LZJ A;  4MGH A;  1XMO M;  4JI7 M;  5FTN A;  4CHT B;  1XXH A;  4LRT A;  1L1T A;  4CIS A;  4M9S A;  3U6L A;  3TWK A;  3KP0 E;  1SXJ A;  2F5Q A;  1XMQ M;  3GQ5 A;  3ZC7 B;  4FD2 A;  1JQJ C;  5DYI A;  2VII A;  2CEA A;  3M7G A;  2VQF M;  1GVN A;  5EXT A;  2FE8 A;  2YFQ A;  4W5W A;  4FW9 A;  1K3X A;  2DWM A;  4QNM A;  1MX0 A;  2NQ8 C;  2XEP A;  1IBK M;  3FUT A;  4B08 A;  5ITX A;  1N34 M;  3GPX A;  1NHG C;  4JI8 M;  1PJI A;  4B3R M;  4M0W A;  4LJ5 A;  3KOY E;  4JXJ A;  1HNZ M;  4D81 A;  3HKP A;  5FLX S;  2F5S A;  4II7 A;  2R46 A;  4IBC A;  3HHW A;  1TH2 A;  3RFW A;  4NXN M;  4PCZ A;  1IN6 A;  2C98 A;  3SAW A;  3GLH A;  4GKJ M;  3RE8 A;  4OW0 A;  2OQ4 A;  4R7G A;  1ORY B;  4DR1 M;  3HU3 A;  5EXX A;  1NSF A;  3HHZ A;  3PVS A;  4GHA A;  1K3W A;  1E9S A;  3SHG B;  3U6E A;  2R18 A;  2DXI A;  3UZU A;  4X64 M;  3MJ5 A;  1FJG M;  3U61 B;  4M9Z A;  4X62 M;  3HGI A;  5KPZ A;  2X8A A;  3FYC A;  2R65 A;  3AJI B;  3T1Y M;  3VLF B;  3GQ3 A;  3U6Q A;  4JN6 A;  5KPT A;  1D2N A;  5A2Q S;  1G4A E;  3KS4 A;  1DGH A;  2ZAO A;  3W0F A;  2RGO A;  2F5O A;  1J5E M;  4GHL A;  2X49 A;  3R8F A;  1G41 A;  5IRE B;  3GLI B;  1T3T A;  4RF0 A;  4L78 A;  3K92 A;  3TL4 X;  3U6D A;  4OVZ B;  1L2C A;  1R6B X;  2VQE M;  3SYL A;  4K0K M;  1YSY A;  4LZZ A;  4NRV A;  4AZF A;  3AL0 C;  3FYD A;  1IQP A;  2KZU A;  4LJ9 A;  1ZQ9 A;  2D7G A;  4FWH A;  4IJF A;  5EP3 A;  3U6O A;  1Q3C A;  3VK7 A;  1N33 M;  4IBB A;  2I7P A;  3HU1 A;  3T15 A;  4LFC M;  4DR7 M;  3KDS E;  4MH0 E;  4G4Q A;  1QAM A;  4GIP A;  1QYR A;  2XSZ D;  3I4Y A;  1XXH B;  1DO2 A;  5E6J A;  5H37 D;  2CHQ A;  3LVW A;  2C5R A;  5FTL A;  2KZS A;  3SAU A;  2UXC M;  4LFB M;  3A45 A;  4L16 A;  4MGI E;  1SXJ B;  3GRR A;  3AOE C;  4I4L A;  5EXP A;  4DV3 M;  2CFO A;  1NNJ A;  4WUR A;  3NWL A;  2V6Z M;  2DHR A;  3HJS A;  3U60 A;  4DUY M;  5ITQ A;  2G5G X;  1Q3B A;  3ILK A;  5KO3 A;  4G4N A;  4JYA M;  2HL7 A;  4FWD A;  2OPF A;  1N32 M;  4TUW A;  1GL6 A;  2FFJ A;  2UU9 M;  3AFH A;  1OFI A;  4FWG A;  4XBO A;  2EUC A;  2Y21 A;  4X66 M;  2LH0 A;  4DR3 M;  2ZAM A;  2R4J A;  2L7H A;  2RKO A;  1E9R A;  4LRS A;  3AKZ A;  1XNR M;  5EXS A;  1IY0 A;  3L27 A;  1TH4 A;  5LMU M;  2KA6 B;  4QOS A;  2F5N A;  3SHF A;  3SC3 A;  3A42 A;  3K8Z A;  3EIH A;  4LGM A;  2QBY A;  1I94 M;  3HJ8 A;  4A3V B;  2V1C A;  4BBA A;  3GLH B;  3AOG A;  2Q2E B;  5KQ8 A;  1HNW M;  2HHH M;  2O5R A;  4IBI A;  3GPP A;  2KEB A;  1QZM A;  1R2Y A;  2UXB M;  3CF2 A;  3J27 B;  2DWZ B;  1ZAE A;  5FTK A;  1IBL M;  4JI4 M;  3MHV C;  3TWM A;  3FUW A;  3I51 A;  4Z6Y A;  2CHG A;  4DV4 M;  3SYK A;  2XFT A;  3CF0 A;  5IZ7 D;  1NNU C;  4M0D A;  2QEN A;  4XGI A;  1JR3 D;  3I4V A;  5JI3 E;  3FTE A;  1DGB A;  1DGH B;  3L26 A;  1HT1 E;  2HCB A;  1YE9 A;  3SMP A;  2DWL A;  2CV0 A;  4B3S M;  3B9P A;  3LQQ A;  3BOS A;  4NSO B;  2R45 A;  1PJJ A;  3GRU A;  3J7A S;  3DOA A;  4DV6 M;  3L29 A;  1QQW A;  4KO8 A;  3J80 S;  4LF9 M;  2UXD M;  3RGS A;  1NY6 A;  3GRY A;  2UUC M;  1QAQ A;  3SBJ A;  4DV2 M;  1N77 A;  3D8L A;  5BR8 M;  1XHB A;  4B3T M;  4LF8 M;  1TDZ A;  3GLF A;  1IBM M;  3GPU A;  4BB9 A;  2RGH A;  1TDH A;  1IN8 A;  1Z5B A;  2UUB M;  5IWA M;  2XFS A;  4LJ7 A;  1YUB A;  5FSW A;  4G4O A;  4NSR A;  4LJ4 A;  1KFV A;  2LXE A;  3U6S A;  3T1H M;  2LWX A;  1NVM A;  3PNV A;  1Z6T A;  5EP4 A;  5EP2 A;  1EE8 A;  3LMM A;  2CE7 A;  4NRW A;  1NY5 A;  3TPZ A;  3SMS A;  3U60 B;  2C99 A;  4Z8X A;  5EQT A;  4NL4 H;  3GP1 A;  3E9S A;  2DWN A;  4IBG A;  2XGN A;  3DZD A;  3HHY A;  2LNH C;  4HLQ A;  1OFH A;  1QAN A;  4IBJ A;  3W0L B;  4GIT A;  3MK6 A;  2D7H A;  3FKE A;  3UK6 A;  3QWL A;  1IN5 A;  3DA1 A;  3WHK A;  1GKI A;  4GH9 A;  3L2A A;  2QCU A;  4REZ A;  5DNY A;  4PDI A;  4B3M M;  2D7E A;  3KFU G;  3FTC A;  4LF7 M;  1DGF A;  2F4V M;  4AKH A;  4B7F A;  5LMN M;  4LJA A;  3AOE A;  2L09 A;  3DFZ A;  2C96 A;  4DV1 M;  1HT2 E;  3R9X B;  5C1B A;  4JI2 M;  4GRI A;  4IJE A;  1SXJ E;  2XH9 A;  3UJN A;  3KOX E;  2QBY B;  2EA0 A;  3KXE C;  1W5S A;  1E94 E;  4QHT A;  3ZCB B;  3KOZ E;  5EJC A;  2YR0 A;  2FNA A;  3H4M A;  2I7N A;  4LJ8 A;  4HL4 A;  3IG8 A;  5ITT A;  4FVM A;  1H6U A;  3J81 S;  2Z4R A;  2H1R A;  3GO8 A;  3VKH A;  2CV1 A;  4DV7 M;  2ZBK B;  1S3S A;  5IT9 S;  4YHH M;  4DUZ M;  5ITX E;  4IBK A;  3EIE A;  1GLN A;  2R4E A;  3KSJ A;  1MU5 A;  2QP9 X;  1QAO A;  3A46 A;  4JV5 M;  3M0E A;  3TQS A;  4X65 M;  3RGP A;  2XZF A;  1HQY E;  1Z5C A;  3L25 A;  4L4U A;  3UMM A;  4GC5 A;  5JI2 E;  1IY2 A;  1L1Z A;  3M6A A;  2KRK A;  2AHM A;  2QPA A;  2KRU A;  2QZ4 A;  3LVV A;  1XC8 A;  5FTM A;  3T38 A;  3FD9 A;  4YY3 M;  2C9C A;  4OX9 M;  1JR3 A;  2J7O A;  1NHW C;  3SFZ A;  1X37 A;  2BJV A;  5ITR A;  1IY1 A;  3J2P B;  2CHV A;  3GLG A;  2DZN B;  2KW0 A;  4QOZ C;  4I8O A;  4WW0 A;  1L2B A;  1NJG A;  3PNY A;  2M5Z A;  4NXM M;  3GLF B;  4DR5 M;  1IN4 A;  3ZH9 B;  2XLJ A;  4RNA A;  4IBF A;  3PFI A;  4CGY B;  5E26 A;  4LF5 M;  4KHP M;  3U6M A;  1I4W A;  1Z5A A;  3U5Z A;  2BNK A;  2JA2 A;  4MGZ E;  4D80 A;  3KVW A;  2Y0Q A;  2Z4S A;  2P5T A;  2KXE A;  1IXR C;  8CAT A;  4JI1 M;  3D8B A;  3HHX A;  3HJQ A;  4R3D A;  2L7I A;  2Z7J A;  2XZU A;  5KPR A;  2YNM D;  5KQD A;  4L15 A;  4LGY A;  3THG A;  3JR5 A;  4FCT A;  3WHL A;  2V1U A;  3SAT A;  4NOO B;  4B7H A;  1SXJ C;  1IXZ A;  4MB7 A;  3GQ4 A;  1J7K A;  2E5L M;  2ZAN A;  1L8Q A;  4AW4 A;  1G3I A;  3CTW B;  3FTF A;  2FOI C;  3A98 B;  4KOD A;  4P16 A;  1J09 A;  3CF6 E;  5DYG A;  3SAS A;  4LY6 A;  3OTO M;  1SXJ D;  5EP1 A;  5C18 A;  4GMQ A;  4AKG A;  3J7B A;  4AG5 A;  3JR4 A;  2Y20 A;  5ITY A;  3JAM S;  3KW6 A;  4PD2 A;  4OU7 A;  3C58 A;  4I5S A;  3AV0 A;  1Q39 A;  4BLC A;  1K82 A;  4GC9 A;  3TE6 A;  4LF4 M;  5BPV A;  4LCB A;  3IG5 A;  4LF6 M;  3QAU A;  5FTJ A;  2K47 A;  4FCW A;  4MGK E;  4DR2 M;  4IBD A;  4RF1 A;  1R2Z A;  1L2D A;  4AQY M;  2XSZ A;  4KLN A;  3HU2 A;  1KSF X;  1LV7 A;  4G4R A;  1C1K A;  3K2L A;  2ERC A;  3L28 A;  3GRV A;  2YQZ A;  3SAV A;  1IM2 A;  1TGU A;  1VDD A;  4G6Z A;  4MGY E;  4AI6 A;  4PT5 A;  3KSX A;  1DO0 A;  4LFA M;  3FUX A;  3FUV A;  4LG2 A;  4AG6 A;  1IN7 A;  3FTD A;  1WXQ A;  4B7G A;  1KYI A;  1R7R A;  3FUU A;  3VDU A;  1HR0 M;  4IIW A;  1TH3 A;  4DR4 M;  7CAT A;  4S12 A;  1OJL A;  3LQR A;  3U6C A;  4PDG A;  2G8L A;  3HWS A;  4QHS A;  2Z3X A;  4LJ6 A;  4QNR A;  3GLG B;  1HNX M;  5ITU A;  1FNN A;  5GKN A;  4DR6 M;  3GPY A;  2X4A A;  2CV2 A;  3VDP A;  3VKG A;  3UGJ A;  2J7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...