4DR6M

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dr6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dr6M02
2ZM6M 4X66M 3U6LA 3U6QA 2HKJA 2OPFA 1XMOM 4NXNM 3TWLA 4ITQA 4NRWA 1N32M 1MX0A 4CISA 2UUCM 4DV4M 4LFCM 1FJGM 5IWAM 3U6CA 4MB7A 2UU9M 5LMUM 4G4RA 4NRVA 4DR4M 3C58A 3JR4A 3TWKA 4JI5M 1TDZA 2ZBKB 4JYAM 4X62M 3JAMS 2F5NA 4LFBM 4PCZA 1K3XA 1HNWM 4B3SM 4LFAM 1EE8A 4OX9M 1IBLM 3SAUA 1HNXM 4JI2M 3GO8A 4LF7M 1Q39A 4GKJM 5ITUA 4B3MM 1IBMM 1Z59A 3U6PA 1L2DA 1HR0M 1IBKM 1L2BA 4LF5M 2XZFA 1Q3CA 3GP1A 1HNZM 2UUAM 4K0KM 5IT9S 5BR8M 4JI0M 3A42A 4DR3M 3OTOM 2XZUA 1XC8A 5ITQA 1Z5BA 5LMNM 4AQYM 2EA0A 4DUZM 5A2QS 4LF9M 4G4OA 1PJJA 4B3TM 1PM5A 1K3WA 3U6OA 4KHPM 3GQ3A 1Z5CA 4X64M 4DV5M 4DV3M 3SARA 5ITRA 1TDHA 1N33M 2UXBM 5ITXA 1I94M 4GKKM 3VK7A 3U6MA 4NXMM 3A46A 2HHHM 1R2ZA 2VQEM 5ITYA 4LF8M 1NNJA 4DR7M 1R2YA 3TWMA 3U6SA 4DR2M 4LF6M 1MU5A 3SASA 3JR5A 4JI4M 3W0FA 4DV7M 3A45A 4DV6M 2OQ4A 3GPUA 3VK8A 3GPPA 4DR5M 4JI6M 3SAWA 4DR1M 5ITXE 4B3RM 4JI8M 3SATA 3J7AS 4X65M 4JV5M 3GQ5A 1L1ZA 4PD2A 2E5LM 1N34M 3GPXA 4DV0M 3T1HM 2F5OA 5ITTA 1PJIA 2F4VM 2UUBM 4PDGA 2VQFM 3U6EA 2UXCM 1KFVA 2F5QA 2UXDM 1L2CA 3DOAA 3U6DA 3GPYA 1Z5AA 3GQ4A 2F5SA 3J81S 3SAVA 4JI3M 1J5EM 1XNQM 4DR6M 1Q3BA 3SBJA 4JI1M 2F5PA 2Q2EB 1XNRM 1N36M 4PDIA 5FLXS 4DUYM 4YY3M 1XMQM 4JI7M 4G4NA 3J80S 4DV2M 1L1TA 4YHHM 4G4QA 4LF4M 4DV1M 3T1YM 1K82A
chains in the Genus database with same CATH superfamily
3MK6A 3B7NA 1L8QA 1V33A 3QYEA 2KHHA 5GKNA 5FSWA 1J09A 2WZJA 3TWLA 2KZSA 3LVVA 4CISA 1SXJA 2Z4SA 2UUCM 2LHCA 3AKZA 3MMPA 3UZUA 4IBEA 1NNUC 4G4RA 1UM8A 4IBDA 1IY0A 4FD2A 3KS8A 4PT5A 1GABA 2FFJA 4LJ4A 2X8AA 4LJAA 4I81A 3U5ZB 1IN4A 4X62M 4JYAM 5KPZA 1W5TA 2BJWA 2C9OA 2KA6B 2ZTCA 4MM3B 3GRUA 1WR1B 4FWHA 4LRTA 1EE8A 2NQ8C 2EO2A 4MH0E 3SAUA 1GVNA 1NY5A 4GIPA 3PXGA 3GO8A 4LJ6A 1HNXM 4LF7M 4GKJM 3HHZA 2CP8A 3GLFB 3F92A 5ITUA 4W5WA 2R44A 1TR8A 4B08A 2OOBA 3HWSA 3KSXA 4QNMA 3M0EA 5EXXA 2QBYB 4BBAA 2D7EA 4B7FA 4BB9A 1G4AE 3E46A 4JI0M 3A42A 3TE6A 2HAKA 2L09A 1QANA 3GLFE 4IBIA 1T3TA 2MH8A 2EKFA 2CHVA 5C18A 1IQPA 4KLNA 5EXSA 3THGA 2R65A 1G41A 2DVWB 2V1UA 4AI6A 3FE3A 2KRUA 4DUZM 3C3EA 3L27A 3L29A 3UK6A 1RU3A 4G4OA 1R6BX 2JUJA 2C5RA 2CHQA 3GQ3A 4X64M 1TH4A 2DZLA 2YNMD 2CE7A 4QNRA 3IHPA 3QAUA 4S12A 5EP3A 3UGJA 2Z8YM 2JP7A 3CF2A 3U6MA 1EIJA 4CIZA 2MROB 5ITYA 4ZPXA 1XWIA 3U6SA 1IXSB 1H6UA 4KODA 4LF6M 3FUVA 1QAMA 1MU5A 3JR5A 3W0FA 1GJTA 3J7BA 2HL7A 1DGHA 2M60A 2VF8A 1EFUB 4DV7M 3H4JA 3KOYE 3LCUA 3NWLA 3K1JA 2JZ0A 4FWDA 1DO2A 2CV2A 2R6FA 1SG9A 3ZC7B 3NBXX 2YQZA 3SATA 3HX3A 5L8RF 1UFZA 5EJCA 3J7AS 1PRBA 2P5TA 2WSEF 3GQ5A 4PD2A 4D80A 4GMQA 4GHAA 1QAOA 3VFDA 2JY8A 1JR3E 1QYRA 1TH2A 3BXWA 2JA2A 4AG6A 1OFHA 2KXEA 5FTJA 3U60A 3R8FA 1SXJB 1VG5A 3M7GA 3RGPA 3U6DA 4IBCA 4D82A 3GLIA 1P3QQ 3A98B 1HJPA 2AHMA 4IIWA 4L15A 3SC3A 2LVPC 2XFTA 4JI3M 3SAVA 3KFUG 2R4JA 4JI1M 1GKIA 2CUZA 4FCTA 1N36M 2LVQD 2FE8A 3VLFB 1XMQM 1SXJE 4YY3M 4JI7M 4LZZA 4DV2M 1C1KA 3HJSA 3T1YM 2CV0A 2O25A 3I01M 3KP1E 3J27B 3I04M 2B3TA 2QENA 1DGGA 2DAKA 3U6QA 1QUSA 2DNAA 3ILKA 2OPFA 1XMOM 4NXNM 4ITQA 4NRWA 2L2DA 4IBJA 1OTRA 2CFOA 2XSZA 4LJ7A 1VQ1A 4LFCM 2APLA 1ORYB 5IZ7D 5IREB 2C99A 2CWBA 3K9PA 4M0WA 2DWZB 3C58A 3K8ZA 4QOZC 2FNAA 3AJIB 4JI5M 2YFQA 3JAMS 2F5NA 4PCZA 4IBGA 1HNWM 1OJLA 1OQYA 2KNAA 3KOZE 5EP2A 2DWNA 4B3SM 2LH0A 1R5LA 4OX9M 4DBGB 2RGOA 4MGZE 3TQSA 3EIHA 2DWLA 3L28A 3HU3A 3U6PA 1N75A 2DAGA 2DAIA 3FYCA 3GLHA 1JQJC 1IBKM 2XZFA 1QUTA 3GP1A 1HNZM 2LVNC 2KNZA 1Q02A 2L4EA 2QSFX 4NSRA 3PVSA 1GL6A 1E32A 5ITQA 1XXHA 2LXEA 2V1CA 3KOXE 5LMNM 4B7HA 1PJQA 3KVWA 4QOSA 2JY7A 5A2QS 1KYIA 2X4AA 5KPRA 2DKLA 2OO9A 1NO1A 2K9DA 4M9SA 4DV5M 3SARA 1C7YA 1IM2A 4LY6A 3SMPA 3B7QA 2DZNB 3VK7A 3W0LB 4NXMM 2HHHM 2VQEM 1LV7A 3TL4X 5H37D 5KPTA 3TWMA 3U60B 1R2YA 3K2LA 5KQDA 3B9PA 2QHOB 2R62A 4IJEA 4JI4M 4EIWA 2XFSA 2OQ4A 3GPUA 2EJSA 2K0BX 1R7RA 3GLGB 2VIIA 3SAWA 1IY2A 1T43A 2BJVA 2I7NA 5ITXE 2KDLA 2C96A 4JI8M 2LTUA 2W82A 3FTCA 3L2AA 4BLCA 5EP4A 4JV5M 3EIEA 2R4EA 2E5LM 3KDSE 3GPXA 5EP1A 2MJ5B 1AIPC 1NJGA 1NHGC 2EUCA 3HKPA 3GLGE 3LW5F 2F4VM 4D81A 2DENA 5C1BA 4UN2B 1Y8GA 4PDGA 2Z7JA 3U6EA 5DYIA 3KW6A 4NSOB 3RFWA 4M9XA 3QYBA 1IXRC 2KRKA 1DGBA 1Z5AA 1NV9A 3DA1A 3GPYA 2VDBB 2F5SA 1NV8A 3J81S 3W67A 2QNJA 3LMMA 3FUTA 5FTMA 2Y0TA 2Q2EB 2F5PA 1MJGM 3FKEA 4AKHA 3SYLA 1X37A 2CEAA 3VKHA 2C9CA 2XEPA 3AV0A 3D8BA 4GC9A 4DV1M 1K82A 5IT9S 4CHTB 2BWEA 1QAQA 3HU1A 5DFLA 3SHGB 4TUWA 3PFIA 1NVMA 2HKJA 2J7OA 1D2NA 2LNHC 3FRIA 2ZTDA 1MX0A 3RGSA 3C3DA 4DV4M 2QCUA 1IN6A 2XSZD 1PGYA 3FTDA 1FJGM 3E9SA 3GLHB 2UU9M 2D7HA 3HGIA 4DR4M 1T6OA 2DXIA 3JR4A 3TWKA 1HT2E 4ANRA 2QQ8A 2G8LA 3C9PA 1HQYE 3HJ8A 2ZBKB 4QHTA 1GLNA 4L4UA 5E26A 1TDZA 4M0DA 3Q8GA 1JR3D 2QP9X 1XXHB 4GITA 5FTNA 2Y21A 4QHSA 3B89A 1ZV1A 4MGKE 4Z8XA 1K3XA 1ZAEA 3GLHE 2H1RA 1QZMA 3Q8XA 3R9XB 4LFAM 2KZUA 1IBLM 4P17A 1FNNA 4JI2M 1Q39A 1OIZA 3HHXA 4AKIA 2LVAA 1IN7A 3FUWA 3KS4A 2M5ZA 3L26A 3LVWA 4LG2A 3ZH9B 3NBIA 4B3MM 3I4YA 1XXHE 1G3IA 1Z59A 2G5GX 1L2DA 5DYGA 2X49A 3B7ZA 4IJFA 1L2BA 4LF5M 1SXJD 2C98A 2V6ZM 2UUAM 4K0KM 2G3QA 2L7IA 4KO8A 5BR8M 1ZQ9A 3OTOM 2XZUA 2DZOB 2ZAMA 1IN8A 1TH3A 1Z5BA 1E94E 4M9ZA 1IY1A 4AQYM 1IN5A 4REZA 2EA0A 2K6BA 2O01F 1QDRA 2BNKA 2R45A 1PJJA 1OAOC 4B3TM 1PM5A 1K3WA 1NY6A 1OKSA 3AOEC 1Z5CA 4DV3M 3MJ5A 2JWSA 4OVZA 3K9OA 1TDHA 1N33M 2UXBM 4MGIE 1PJTA 5JI2E 1VDDA 2N35A 3A46A 1J7KA 1R2ZA 1VEGA 3AOGA 2LHGA 2MGWA 3LQQA 4DR2M 1IXZA 1WHCA 3AFHA 2R0IA 1NJFA 8CATA 2JZ1A 4G3OA 4XK8F 3WHLA 1N78A 2BWBA 4LZJA 2RGHA 3A45A 1I4WA 3CGWA 4R3DA 3SHFA 4DV6M 3U61A 2A5YB 3LQRA 4NL4H 4DR5M 1DGHB 1TGUA 1XHBA 3ZCBB 2L6OA 4AW4A 2KNVA 1TF0B 4DR1M 4B3RM 2KW0A 3DFZA 2WSCF 3DZDA 3SYKA 5JI3E 4X65M 2RKOA 4Y28F 1E9SA 3WHKA 1L1ZA 1G59A 1N34M 1DO0A 2R18A 5FTLA 2QPAA 1PJIA 3CF6E 2XF3A 3RE8A 2UUBM 4FCWA 4HLQA 4I8OA 4AZFA 1KFVA 4L8RC 2UXDM 1L2CA 4MGYE 3DOAA 3FUUA 3T38A 4A3VB 3UJNA 1BVSA 2XLJA 1CUKA 3FD9A 2ZANA 4XGIA 3KSJA 1J5EM 3GLIB 1Q3BA 3SBJA 4R7GA 3J2PB 1XNRM 4RNAA 4LGMA 4GC5A 4CJ6A 2H5XA 2J5YA 4I4LA 3D8LA 4PDIA 5DNYA 5FLXS 4G4NA 1MN3A 3I4VA 3SFZA 1NHWC 4YHHM 2LWXA 3FTEA 4AKGA 2OOAA 2D7GA 1VEKA 2KEBA 3KP0E 2ZM6M 4AG5A 1F4IA 1TTEA 2XH9A 4HEOA 4WP2A 3HHYA 1A5TA 1KSFX 2FOIC 4X66M 4Z6YA 3GLIE 3U6LA 1Z6TA 2VF7A 1N32M 2Z3XA 2QZ4A 3E21A 4IBBA 1GJSA 3CTWB 4LJ9A 5IWAM 3U6CA 4MB7A 3UMMA 3FTFA 5LMUM 3FYDA 4NRVA 1QDTA 5EXTA 2JY6B 4HL4A 2FS1A 4II7A 4RKUF 5BPVA 2GQFA 2HCBA 1ZMWA 3GRRA 3AOEA 4LFBM 2DWMA 4LJ8A 3GRYA 4F2LA 1G8PA 2DHRA 2LVOC 3T6PA 3QWLA 4GEWA 4XBOA 2L4FA 2DAMA 1WGNA 2ERCA 1S3SA 4B7GA 1V34A 3FUXA 3T15A 3MHVC 4OVZB 1IBMM 1VDLA 3VKGA 2Z4RA 3BBZA 3PNYA 1QVRA 1HR0M 1DGFA 4GRIA 4L78A 1Q3CA 1W5SA 3B74A 1D0MA 3KXEC 4IBKA 1QQWA 3HY5A 1HQCA 4Q7JA 3IG8A 5E6JA 3W68A 5F3WA 1SXJC 2EKKA 3K92A 2O5RA 4DR3M 2DAEA 2CV1A 3HHWA 1GL7A 4OU7A 3IECA 4FW9A 3U5ZA 4LGYA 2YR0A 3ZQJA 3HJQA 1XC8A 4P16A 3U61B 2WSFF 4L6V6 3HU2A 1DV0A 3V76A 1YE9A 2CRUA 5EXPA 4LF9M 1QZEA 4F1IA 1N77A 1OAIA 3KOWE 4KT0F 3HZJA 4JXJA 3GLFA 5KO3A 3U6OA 4KHPM 1ZMVA 2DHYA 2R46A 4WURA 5ITRA 3LCVB 1V92A 2FH0A 1D0KA 1OIPA 5ITXA 1I94M 3AL0C 4GKKM 4LJ5A 2QBYA 4LRSA 2J7NA 4IBFA 1ZMUA 4LF8M 2Y0QA 2JNHA 1NNJA 4DR7M 3FRHA 1JB0F 4WW0A 5FTKA 4CGYB 3I51A 2LBCA 2RRUA 3TPZA 3SASA 3GLGA 4RF1A 3H4MA 4G6ZA 3GRVA 4GH9A 3CF0A 4L16A 2ZAOA 3GPPA 3PNVA 3VK8A 2JY5A 4JI6M 4FVMA 2XGNA 1HT1E 1NSFA 2DI0A 2K47A 4JN6A 1WGLA 2JXNA 4R71A 2GNOA 4MGHA 1LTMA 1YUBA 2HWJA 2Y20A 4FWGA 4OW0A 4DV0M 1G71A 4LCBA 5ITTA 5EQTA 3BOSA 3M6AA 3T1HM 2F5OA 1R4GA 2MR9A 1D0LA 2VQFM 1GO5A 1IXSA 1YSYA 2UXCM 1OFIA 2F5QA 1WJ7A 1IFYA 4FCVA 4NOOB 1PJSA 3E4RA 2I7PA 3L25A 3GQ4A 3SMSA 1VEJA 1JR3A 2CHGA 1XNQM 1XB2B 4DR6M 1AUAA 1WXQA 3VDUA 4GHLA 4RF0A 3VDPA 4NC6A 4DUYM 1WIVA 4I5SA 3J80S 1L1TA 5KQ8A 4G4QA 4LF4M 2L7HA 1E9RA 1YLAA 7CATA 3IG5A
chains in the Genus database with same CATH topology
3MK6A 1L8QA 5GKNA 5FSWA 1J09A 3TWLA 2KZSA 3LVVA 4CISA 1SXJA 2Z4SA 2UUCM 3AKZA 3UZUA 4IBEA 1NNUC 4G4RA 1UM8A 4IBDA 1IY0A 4FD2A 3KS8A 4PT5A 2FFJA 4LJ4A 2X8AA 4LJAA 4I81A 3U5ZB 1IN4A 4X62M 4JYAM 5KPZA 1W5TA 2BJWA 2C9OA 2KA6B 4MM3B 3GRUA 4FWHA 4LRTA 1EE8A 2NQ8C 2EO2A 4MH0E 3SAUA 1NY5A 1GVNA 4GIPA 3PXGA 3GO8A 4LJ6A 1HNXM 4LF7M 4GKJM 3HHZA 3GLFB 5ITUA 4W5WA 4B08A 3HWSA 3KSXA 4QNMA 3M0EA 5EXXA 2QBYB 4BBAA 2D7EA 4B7FA 4BB9A 1G4AE 4JI0M 3A42A 3TE6A 2L09A 1QANA 4IBIA 1T3TA 2CHVA 5C18A 1IQPA 4KLNA 5EXSA 3THGA 2R65A 1G41A 2DVWB 2V1UA 4AI6A 2KRUA 4DUZM 3L27A 3L29A 3UK6A 4G4OA 1R6BX 2C5RA 2CHQA 3GQ3A 4X64M 1TH4A 2YNMD 2CE7A 4QNRA 4S12A 3QAUA 5EP3A 3CF2A 3U6MA 5ITYA 4ZPXA 1XWIA 3U6SA 1IXSB 1H6UA 4KODA 4LF6M 3FUVA 1QAMA 1MU5A 3JR5A 3W0FA 3J7BA 2HL7A 1DGHA 2M60A 4DV7M 3KOYE 3NWLA 3K1JA 4FWDA 1DO2A 2CV2A 3ZC7B 2YQZA 3SATA 5EJCA 3J7AS 2P5TA 3GQ5A 4PD2A 4D80A 4GMQA 4GHAA 1QAOA 3VFDA 1QYRA 1TH2A 2JA2A 4AG6A 1OFHA 2KXEA 5FTJA 3U60A 3R8FA 1SXJB 3M7GA 3RGPA 3U6DA 4IBCA 4D82A 3GLIA 3A98B 2AHMA 4IIWA 4L15A 3SC3A 3SAVA 2XFTA 4JI3M 3KFUG 2R4JA 4JI1M 1GKIA 2CUZA 4FCTA 1N36M 2FE8A 3VLFB 1XMQM 1SXJE 4YY3M 4JI7M 4LZZA 4DV2M 1C1KA 3HJSA 3T1YM 2CV0A 3KP1E 3J27B 2QENA 1DGGA 3U6QA 3ILKA 2OPFA 1XMOM 4NXNM 4ITQA 4NRWA 4IBJA 2CFOA 2XSZA 4LJ7A 4LFCM 1ORYB 5IZ7D 5IREB 2C99A 4M0WA 2DWZB 3C58A 3K8ZA 4QOZC 2FNAA 3AJIB 4JI5M 2YFQA 3JAMS 2F5NA 4PCZA 4IBGA 1HNWM 1OJLA 3KOZE 5EP2A 2DWNA 4B3SM 2LH0A 4OX9M 2RGOA 4MGZE 3TQSA 3EIHA 2DWLA 3L28A 3HU3A 3U6PA 1N75A 3GLHA 3FYCA 1IBKM 1JQJC 2XZFA 3GP1A 1HNZM 4NSRA 3PVSA 1GL6A 1E32A 5ITQA 1XXHA 2LXEA 2V1CA 3KOXE 5LMNM 4B7HA 3KVWA 4QOSA 5A2QS 1KYIA 2X4AA 5KPRA 3SARA 4M9SA 4DV5M 1IM2A 4LY6A 3SMPA 2DZNB 3VK7A 3W0LB 4NXMM 2HHHM 2VQEM 1LV7A 3TL4X 5H37D 5KPTA 3TWMA 3U60B 1R2YA 3K2LA 5KQDA 3B9PA 2R62A 4IJEA 4JI4M 4EIWA 2XFSA 2OQ4A 3GPUA 1R7RA 3GLGB 2VIIA 3SAWA 1IY2A 2BJVA 2I7NA 5ITXE 2C96A 4JI8M 2W82A 3FTCA 3L2AA 4BLCA 5EP4A 4JV5M 3EIEA 2R4EA 2E5LM 3KDSE 3GPXA 5EP1A 1NJGA 3HKPA 1NHGC 2EUCA 2F4VM 4D81A 5C1BA 4PDGA 2Z7JA 3U6EA 5DYIA 3KW6A 4NSOB 3RFWA 4M9XA 1IXRC 2KRKA 1DGBA 1Z5AA 3DA1A 3GPYA 2F5SA 3J81S 3LMMA 3FUTA 5FTMA 2Y0TA 2Q2EB 2F5PA 3FKEA 4AKHA 3SYLA 1X37A 2CEAA 3VKHA 3AV0A 2C9CA 2XEPA 3D8BA 4GC9A 4DV1M 1K82A 5IT9S 4CHTB 1QAQA 3HU1A 3SHGB 4TUWA 3PFIA 1NVMA 2HKJA 2J7OA 1D2NA 2LNHC 1MX0A 3RGSA 4DV4M 2QCUA 1IN6A 2XSZD 3FTDA 1FJGM 3E9SA 3GLHB 2UU9M 2D7HA 3HGIA 4DR4M 2DXIA 3JR4A 3TWKA 1HT2E 5JI3E 2G8LA 1HQYE 3HJ8A 2ZBKB 4QHTA 1GLNA 4L4UA 5E26A 1TDZA 4M0DA 4GITA 1JR3D 2QP9X 1XXHB 5FTNA 2Y21A 4QHSA 4MGKE 1K3XA 4Z8XA 1ZAEA 2H1RA 1QZMA 3Q8XA 3R9XB 4LFAM 2KZUA 1IBLM 1FNNA 4JI2M 1Q39A 3HHXA 4AKIA 1IN7A 3FUWA 3KS4A 2M5ZA 3L26A 3LVWA 4LG2A 3ZH9B 3NBIA 4B3MM 3I4YA 1G3IA 1Z59A 2G5GX 1L2DA 5DYGA 2X49A 4IJFA 1L2BA 4LF5M 1SXJD 2C98A 2V6ZM 2UUAM 4K0KM 2L7IA 4KO8A 5BR8M 1ZQ9A 3OTOM 2XZUA 2DZOB 2ZAMA 1IN8A 1TH3A 1Z5BA 1E94E 4M9ZA 1IY1A 4AQYM 1IN5A 4REZA 2EA0A 2BNKA 2R45A 1PJJA 4B3TM 1PM5A 1K3WA 1NY6A 3AOEC 1Z5CA 4DV3M 3MJ5A 4OVZA 1TDHA 1N33M 2UXBM 4MGIE 5JI2E 1VDDA 3A46A 1J7KA 1R2ZA 3AOGA 3LQQA 4DR2M 1IXZA 3AFHA 8CATA 1NJFA 3WHLA 1N78A 4LZJA 2RGHA 3A45A 1I4WA 4R3DA 3SHFA 4DV6M 3U61A 2A5YB 3LQRA 4NL4H 4DR5M 1DGHB 1TGUA 1XHBA 3ZCBB 2L6OA 4AW4A 4DR1M 4B3RM 2KW0A 3DFZA 3SYKA 3DZDA 4X65M 2RKOA 3WHKA 1E9SA 1L1ZA 1G59A 1N34M 1DO0A 2R18A 5FTLA 2QPAA 1PJIA 3CF6E 2XF3A 3RE8A 2UUBM 4FCWA 4HLQA 4I8OA 4AZFA 1KFVA 4L8RC 2UXDM 1L2CA 4MGYE 3DOAA 3FUUA 3T38A 4A3VB 3UJNA 2XLJA 3FD9A 2ZANA 4XGIA 3KSJA 1J5EM 3GLIB 1Q3BA 3SBJA 4R7GA 3J2PB 1XNRM 4RNAA 4LGMA 4GC5A 4PDIA 5FLXS 4I4LA 3D8LA 5DNYA 4G4NA 3I4VA 3SFZA 4YHHM 1NHWC 2LWXA 3FTEA 4AKGA 2D7GA 2KEBA 3KP0E 2ZM6M 4AG5A 2XH9A 3HHYA 4X66M 3U6LA 2FOIC 1KSFX 4Z6YA 1Z6TA 1N32M 2Z3XA 2QZ4A 4IBBA 3CTWB 4LJ9A 5IWAM 3U6CA 4MB7A 3UMMA 3FTFA 5LMUM 3FYDA 4NRVA 5EXTA 4HL4A 4II7A 5BPVA 2HCBA 3GRRA 3AOEA 4LFBM 2DWMA 4LJ8A 3GRYA 1G8PA 2DHRA 3QWLA 4XBOA 2ERCA 1S3SA 4B7GA 3FUXA 3T15A 3MHVC 4OVZB 1IBMM 3VKGA 2Z4RA 3PNYA 1QVRA 1HR0M 1DGFA 4GRIA 4L78A 1Q3CA 1W5SA 3KXEC 4IBKA 1QQWA 1HQCA 5E6JA 3IG8A 5F3WA 1SXJC 3K92A 2O5RA 4DR3M 2CV1A 3HHWA 1GL7A 4OU7A 3U5ZA 4FW9A 1XC8A 4LGYA 2YR0A 3HJQA 4P16A 3U61B 3HU2A 1YE9A 5EXPA 4LF9M 1N77A 3KOWE 4JXJA 3GLFA 5KO3A 3U6OA 4KHPM 2R46A 4WURA 5ITRA 3AL0C 5ITXA 1I94M 4GKKM 4LJ5A 2QBYA 4LRSA 2J7NA 4IBFA 4LF8M 2Y0QA 1NNJA 4DR7M 4WW0A 5FTKA 4CGYB 3I51A 3TPZA 3SASA 3GLGA 4RF1A 3H4MA 4G6ZA 3GRVA 4GH9A 3CF0A 4L16A 2ZAOA 3GPPA 3PNVA 3VK8A 4JI6M 4FVMA 2XGNA 1HT1E 1NSFA 2K47A 4JN6A 4MGHA 1YUBA 2Y20A 4OW0A 4FWGA 4DV0M 3T1HM 4LCBA 2F5OA 5ITTA 5EQTA 3BOSA 3M6AA 2VQFM 1YSYA 2UXCM 1OFIA 2F5QA 4FCVA 4NOOB 3E4RA 2I7PA 3L25A 3GQ4A 3SMSA 2CHGA 1JR3A 4DR6M 1XNQM 1WXQA 3VDUA 4GHLA 4RF0A 3VDPA 4DUYM 4I5SA 3J80S 1L1TA 5KQ8A 4G4QA 4LF4M 2L7HA 1E9RA 3UGJA 7CATA 3IG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 M;  4X66 M;  3U6L A;  3U6Q A;  2HKJ A;  2OPF A;  1XMO M;  4NXN M;  3TWL A;  4ITQ A;  4NRW A;  1N32 M;  1MX0 A;  4CIS A;  2UUC M;  4DV4 M;  4LFC M;  1FJG M;  5IWA M;  3U6C A;  4MB7 A;  2UU9 M;  5LMU M;  4G4R A;  4NRV A;  4DR4 M;  3C58 A;  3JR4 A;  3TWK A;  4JI5 M;  1TDZ A;  2ZBK B;  4JYA M;  4X62 M;  3JAM S;  2F5N A;  4LFB M;  4PCZ A;  1K3X A;  1HNW M;  4B3S M;  4LFA M;  1EE8 A;  4OX9 M;  1IBL M;  3SAU A;  1HNX M;  4JI2 M;  3GO8 A;  4LF7 M;  1Q39 A;  4GKJ M;  5ITU A;  4B3M M;  1IBM M;  1Z59 A;  3U6P A;  1L2D A;  1HR0 M;  1IBK M;  1L2B A;  4LF5 M;  2XZF A;  1Q3C A;  3GP1 A;  1HNZ M;  2UUA M;  4K0K M;  5IT9 S;  5BR8 M;  4JI0 M;  3A42 A;  4DR3 M;  3OTO M;  2XZU A;  1XC8 A;  5ITQ A;  1Z5B A;  5LMN M;  4AQY M;  2EA0 A;  4DUZ M;  5A2Q S;  4LF9 M;  4G4O A;  1PJJ A;  4B3T M;  1PM5 A;  1K3W A;  3U6O A;  4KHP M;  3GQ3 A;  1Z5C A;  4X64 M;  4DV5 M;  4DV3 M;  3SAR A;  5ITR A;  1TDH A;  1N33 M;  2UXB M;  5ITX A;  1I94 M;  4GKK M;  3VK7 A;  3U6M A;  4NXM M;  3A46 A;  2HHH M;  1R2Z A;  2VQE M;  5ITY A;  4LF8 M;  1NNJ A;  4DR7 M;  1R2Y A;  3TWM A;  3U6S A;  4DR2 M;  4LF6 M;  1MU5 A;  3SAS A;  3JR5 A;  4JI4 M;  3W0F A;  4DV7 M;  3A45 A;  4DV6 M;  2OQ4 A;  3GPU A;  3VK8 A;  3GPP A;  4DR5 M;  4JI6 M;  3SAW A;  4DR1 M;  5ITX E;  4B3R M;  4JI8 M;  3SAT A;  3J7A S;  4X65 M;  4JV5 M;  3GQ5 A;  1L1Z A;  4PD2 A;  2E5L M;  1N34 M;  3GPX A;  4DV0 M;  3T1H M;  2F5O A;  5ITT A;  1PJI A;  2F4V M;  2UUB M;  4PDG A;  2VQF M;  3U6E A;  2UXC M;  1KFV A;  2F5Q A;  2UXD M;  1L2C A;  3DOA A;  3U6D A;  3GPY A;  1Z5A A;  3GQ4 A;  2F5S A;  3J81 S;  3SAV A;  4JI3 M;  1J5E M;  1XNQ M;  4DR6 M;  1Q3B A;  3SBJ A;  4JI1 M;  2F5P A;  2Q2E B;  1XNR M;  1N36 M;  4PDI A;  5FLX S;  4DUY M;  4YY3 M;  1XMQ M;  4JI7 M;  4G4N A;  3J80 S;  4DV2 M;  1L1T A;  4YHH M;  4G4Q A;  4LF4 M;  4DV1 M;  3T1Y M;  1K82 A; 
#chains in the Genus database with same CATH topology
 3MK6 A;  3B7N A;  1L8Q A;  1V33 A;  3QYE A;  2KHH A;  5GKN A;  5FSW A;  1J09 A;  2WZJ A;  3TWL A;  2KZS A;  3LVV A;  4CIS A;  1SXJ A;  2Z4S A;  2UUC M;  2LHC A;  3AKZ A;  3MMP A;  3UZU A;  4IBE A;  1NNU C;  4G4R A;  1UM8 A;  4IBD A;  1IY0 A;  4FD2 A;  3KS8 A;  4PT5 A;  1GAB A;  2FFJ A;  4LJ4 A;  2X8A A;  4LJA A;  4I81 A;  3U5Z B;  1IN4 A;  4X62 M;  4JYA M;  5KPZ A;  1W5T A;  2BJW A;  2C9O A;  2KA6 B;  2ZTC A;  4MM3 B;  3GRU A;  1WR1 B;  4FWH A;  4LRT A;  1EE8 A;  2NQ8 C;  2EO2 A;  4MH0 E;  3SAU A;  1GVN A;  1NY5 A;  4GIP A;  3PXG A;  3GO8 A;  4LJ6 A;  1HNX M;  4LF7 M;  4GKJ M;  3HHZ A;  2CP8 A;  3GLF B;  3F92 A;  5ITU A;  4W5W A;  2R44 A;  1TR8 A;  4B08 A;  2OOB A;  3HWS A;  3KSX A;  4QNM A;  3M0E A;  5EXX A;  2QBY B;  4BBA A;  2D7E A;  4B7F A;  4BB9 A;  1G4A E;  3E46 A;  4JI0 M;  3A42 A;  3TE6 A;  2HAK A;  2L09 A;  1QAN A;  3GLF E;  4IBI A;  1T3T A;  2MH8 A;  2EKF A;  2CHV A;  5C18 A;  1IQP A;  4KLN A;  5EXS A;  3THG A;  2R65 A;  1G41 A;  2DVW B;  2V1U A;  4AI6 A;  3FE3 A;  2KRU A;  4DUZ M;  3C3E A;  3L27 A;  3L29 A;  3UK6 A;  1RU3 A;  4G4O A;  1R6B X;  2JUJ A;  2C5R A;  2CHQ A;  3GQ3 A;  4X64 M;  1TH4 A;  2DZL A;  2YNM D;  2CE7 A;  4QNR A;  3IHP A;  3QAU A;  4S12 A;  5EP3 A;  3UGJ A;  2Z8Y M;  2JP7 A;  3CF2 A;  3U6M A;  1EIJ A;  4CIZ A;  2MRO B;  5ITY A;  4ZPX A;  1XWI A;  3U6S A;  1IXS B;  1H6U A;  4KOD A;  4LF6 M;  3FUV A;  1QAM A;  1MU5 A;  3JR5 A;  3W0F A;  1GJT A;  3J7B A;  2HL7 A;  1DGH A;  2M60 A;  2VF8 A;  1EFU B;  4DV7 M;  3H4J A;  3KOY E;  3LCU A;  3NWL A;  3K1J A;  2JZ0 A;  4FWD A;  1DO2 A;  2CV2 A;  2R6F A;  1SG9 A;  3ZC7 B;  3NBX X;  2YQZ A;  3SAT A;  3HX3 A;  5L8R F;  1UFZ A;  5EJC A;  3J7A S;  1PRB A;  2P5T A;  2WSE F;  3GQ5 A;  4PD2 A;  4D80 A;  4GMQ A;  4GHA A;  1QAO A;  3VFD A;  2JY8 A;  1JR3 E;  1QYR A;  1TH2 A;  3BXW A;  2JA2 A;  4AG6 A;  1OFH A;  2KXE A;  5FTJ A;  3U60 A;  3R8F A;  1SXJ B;  1VG5 A;  3M7G A;  3RGP A;  3U6D A;  4IBC A;  4D82 A;  3GLI A;  1P3Q Q;  3A98 B;  1HJP A;  2AHM A;  4IIW A;  4L15 A;  3SC3 A;  2LVP C;  2XFT A;  4JI3 M;  3SAV A;  3KFU G;  2R4J A;  4JI1 M;  1GKI A;  2CUZ A;  4FCT A;  1N36 M;  2LVQ D;  2FE8 A;  3VLF B;  1XMQ M;  1SXJ E;  4YY3 M;  4JI7 M;  4LZZ A;  4DV2 M;  1C1K A;  3HJS A;  3T1Y M;  2CV0 A;  2O25 A;  3I01 M;  3KP1 E;  3J27 B;  3I04 M;  2B3T A;  2QEN A;  1DGG A;  2DAK A;  3U6Q A;  1QUS A;  2DNA A;  3ILK A;  2OPF A;  1XMO M;  4NXN M;  4ITQ A;  4NRW A;  2L2D A;  4IBJ A;  1OTR A;  2CFO A;  2XSZ A;  4LJ7 A;  1VQ1 A;  4LFC M;  2APL A;  1ORY B;  5IZ7 D;  5IRE B;  2C99 A;  2CWB A;  3K9P A;  4M0W A;  2DWZ B;  3C58 A;  3K8Z A;  4QOZ C;  2FNA A;  3AJI B;  4JI5 M;  2YFQ A;  3JAM S;  2F5N A;  4PCZ A;  4IBG A;  1HNW M;  1OJL A;  1OQY A;  2KNA A;  3KOZ E;  5EP2 A;  2DWN A;  4B3S M;  2LH0 A;  1R5L A;  4OX9 M;  4DBG B;  2RGO A;  4MGZ E;  3TQS A;  3EIH A;  2DWL A;  3L28 A;  3HU3 A;  3U6P A;  1N75 A;  2DAG A;  2DAI A;  3FYC A;  3GLH A;  1JQJ C;  1IBK M;  2XZF A;  1QUT A;  3GP1 A;  1HNZ M;  2LVN C;  2KNZ A;  1Q02 A;  2L4E A;  2QSF X;  4NSR A;  3PVS A;  1GL6 A;  1E32 A;  5ITQ A;  1XXH A;  2LXE A;  2V1C A;  3KOX E;  5LMN M;  4B7H A;  1PJQ A;  3KVW A;  4QOS A;  2JY7 A;  5A2Q S;  1KYI A;  2X4A A;  5KPR A;  2DKL A;  2OO9 A;  1NO1 A;  2K9D A;  4M9S A;  4DV5 M;  3SAR A;  1C7Y A;  1IM2 A;  4LY6 A;  3SMP A;  3B7Q A;  2DZN B;  3VK7 A;  3W0L B;  4NXM M;  2HHH M;  2VQE M;  1LV7 A;  3TL4 X;  5H37 D;  5KPT A;  3TWM A;  3U60 B;  1R2Y A;  3K2L A;  5KQD A;  3B9P A;  2QHO B;  2R62 A;  4IJE A;  4JI4 M;  4EIW A;  2XFS A;  2OQ4 A;  3GPU A;  2EJS A;  2K0B X;  1R7R A;  3GLG B;  2VII A;  3SAW A;  1IY2 A;  1T43 A;  2BJV A;  2I7N A;  5ITX E;  2KDL A;  2C96 A;  4JI8 M;  2LTU A;  2W82 A;  3FTC A;  3L2A A;  4BLC A;  5EP4 A;  4JV5 M;  3EIE A;  2R4E A;  2E5L M;  3KDS E;  3GPX A;  5EP1 A;  2MJ5 B;  1AIP C;  1NJG A;  1NHG C;  2EUC A;  3HKP A;  3GLG E;  3LW5 F;  2F4V M;  4D81 A;  2DEN A;  5C1B A;  4UN2 B;  1Y8G A;  4PDG A;  2Z7J A;  3U6E A;  5DYI A;  3KW6 A;  4NSO B;  3RFW A;  4M9X A;  3QYB A;  1IXR C;  2KRK A;  1DGB A;  1Z5A A;  1NV9 A;  3DA1 A;  3GPY A;  2VDB B;  2F5S A;  1NV8 A;  3J81 S;  3W67 A;  2QNJ A;  3LMM A;  3FUT A;  5FTM A;  2Y0T A;  2Q2E B;  2F5P A;  1MJG M;  3FKE A;  4AKH A;  3SYL A;  1X37 A;  2CEA A;  3VKH A;  2C9C A;  2XEP A;  3AV0 A;  3D8B A;  4GC9 A;  4DV1 M;  1K82 A;  5IT9 S;  4CHT B;  2BWE A;  1QAQ A;  3HU1 A;  5DFL A;  3SHG B;  4TUW A;  3PFI A;  1NVM A;  2HKJ A;  2J7O A;  1D2N A;  2LNH C;  3FRI A;  2ZTD A;  1MX0 A;  3RGS A;  3C3D A;  4DV4 M;  2QCU A;  1IN6 A;  2XSZ D;  1PGY A;  3FTD A;  1FJG M;  3E9S A;  3GLH B;  2UU9 M;  2D7H A;  3HGI A;  4DR4 M;  1T6O A;  2DXI A;  3JR4 A;  3TWK A;  1HT2 E;  4ANR A;  2QQ8 A;  2G8L A;  3C9P A;  1HQY E;  3HJ8 A;  2ZBK B;  4QHT A;  1GLN A;  4L4U A;  5E26 A;  1TDZ A;  4M0D A;  3Q8G A;  1JR3 D;  2QP9 X;  1XXH B;  4GIT A;  5FTN A;  2Y21 A;  4QHS A;  3B89 A;  1ZV1 A;  4MGK E;  4Z8X A;  1K3X A;  1ZAE A;  3GLH E;  2H1R A;  1QZM A;  3Q8X A;  3R9X B;  4LFA M;  2KZU A;  1IBL M;  4P17 A;  1FNN A;  4JI2 M;  1Q39 A;  1OIZ A;  3HHX A;  4AKI A;  2LVA A;  1IN7 A;  3FUW A;  3KS4 A;  2M5Z A;  3L26 A;  3LVW A;  4LG2 A;  3ZH9 B;  3NBI A;  4B3M M;  3I4Y A;  1XXH E;  1G3I A;  1Z59 A;  2G5G X;  1L2D A;  5DYG A;  2X49 A;  3B7Z A;  4IJF A;  1L2B A;  4LF5 M;  1SXJ D;  2C98 A;  2V6Z M;  2UUA M;  4K0K M;  2G3Q A;  2L7I A;  4KO8 A;  5BR8 M;  1ZQ9 A;  3OTO M;  2XZU A;  2DZO B;  2ZAM A;  1IN8 A;  1TH3 A;  1Z5B A;  1E94 E;  4M9Z A;  1IY1 A;  4AQY M;  1IN5 A;  4REZ A;  2EA0 A;  2K6B A;  2O01 F;  1QDR A;  2BNK A;  2R45 A;  1PJJ A;  1OAO C;  4B3T M;  1PM5 A;  1K3W A;  1NY6 A;  1OKS A;  3AOE C;  1Z5C A;  4DV3 M;  3MJ5 A;  2JWS A;  4OVZ A;  3K9O A;  1TDH A;  1N33 M;  2UXB M;  4MGI E;  1PJT A;  5JI2 E;  1VDD A;  2N35 A;  3A46 A;  1J7K A;  1R2Z A;  1VEG A;  3AOG A;  2LHG A;  2MGW A;  3LQQ A;  4DR2 M;  1IXZ A;  1WHC A;  3AFH A;  2R0I A;  1NJF A;  8CAT A;  2JZ1 A;  4G3O A;  4XK8 F;  3WHL A;  1N78 A;  2BWB A;  4LZJ A;  2RGH A;  3A45 A;  1I4W A;  3CGW A;  4R3D A;  3SHF A;  4DV6 M;  3U61 A;  2A5Y B;  3LQR A;  4NL4 H;  4DR5 M;  1DGH B;  1TGU A;  1XHB A;  3ZCB B;  2L6O A;  4AW4 A;  2KNV A;  1TF0 B;  4DR1 M;  4B3R M;  2KW0 A;  3DFZ A;  2WSC F;  3DZD A;  3SYK A;  5JI3 E;  4X65 M;  2RKO A;  4Y28 F;  1E9S A;  3WHK A;  1L1Z A;  1G59 A;  1N34 M;  1DO0 A;  2R18 A;  5FTL A;  2QPA A;  1PJI A;  3CF6 E;  2XF3 A;  3RE8 A;  2UUB M;  4FCW A;  4HLQ A;  4I8O A;  4AZF A;  1KFV A;  4L8R C;  2UXD M;  1L2C A;  4MGY E;  3DOA A;  3FUU A;  3T38 A;  4A3V B;  3UJN A;  1BVS A;  2XLJ A;  1CUK A;  3FD9 A;  2ZAN A;  4XGI A;  3KSJ A;  1J5E M;  3GLI B;  1Q3B A;  3SBJ A;  4R7G A;  3J2P B;  1XNR M;  4RNA A;  4LGM A;  4GC5 A;  4CJ6 A;  2H5X A;  2J5Y A;  4I4L A;  3D8L A;  4PDI A;  5DNY A;  5FLX S;  4G4N A;  1MN3 A;  3I4V A;  3SFZ A;  1NHW C;  4YHH M;  2LWX A;  3FTE A;  4AKG A;  2OOA A;  2D7G A;  1VEK A;  2KEB A;  3KP0 E;  2ZM6 M;  4AG5 A;  1F4I A;  1TTE A;  2XH9 A;  4HEO A;  4WP2 A;  3HHY A;  1A5T A;  1KSF X;  2FOI C;  4X66 M;  4Z6Y A;  3GLI E;  3U6L A;  1Z6T A;  2VF7 A;  1N32 M;  2Z3X A;  2QZ4 A;  3E21 A;  4IBB A;  1GJS A;  3CTW B;  4LJ9 A;  5IWA M;  3U6C A;  4MB7 A;  3UMM A;  3FTF A;  5LMU M;  3FYD A;  4NRV A;  1QDT A;  5EXT A;  2JY6 B;  4HL4 A;  2FS1 A;  4II7 A;  4RKU F;  5BPV A;  2GQF A;  2HCB A;  1ZMW A;  3GRR A;  3AOE A;  4LFB M;  2DWM A;  4LJ8 A;  3GRY A;  4F2L A;  1G8P A;  2DHR A;  2LVO C;  3T6P A;  3QWL A;  4GEW A;  4XBO A;  2L4F A;  2DAM A;  1WGN A;  2ERC A;  1S3S A;  4B7G A;  1V34 A;  3FUX A;  3T15 A;  3MHV C;  4OVZ B;  1IBM M;  1VDL A;  3VKG A;  2Z4R A;  3BBZ A;  3PNY A;  1QVR A;  1HR0 M;  1DGF A;  4GRI A;  4L78 A;  1Q3C A;  1W5S A;  3B74 A;  1D0M A;  3KXE C;  4IBK A;  1QQW A;  3HY5 A;  1HQC A;  4Q7J A;  3IG8 A;  5E6J A;  3W68 A;  5F3W A;  1SXJ C;  2EKK A;  3K92 A;  2O5R A;  4DR3 M;  2DAE A;  2CV1 A;  3HHW A;  1GL7 A;  4OU7 A;  3IEC A;  4FW9 A;  3U5Z A;  4LGY A;  2YR0 A;  3ZQJ A;  3HJQ A;  1XC8 A;  4P16 A;  3U61 B;  2WSF F;  4L6V 6;  3HU2 A;  1DV0 A;  3V76 A;  1YE9 A;  2CRU A;  5EXP A;  4LF9 M;  1QZE A;  4F1I A;  1N77 A;  1OAI A;  3KOW E;  4KT0 F;  3HZJ A;  4JXJ A;  3GLF A;  5KO3 A;  3U6O A;  4KHP M;  1ZMV A;  2DHY A;  2R46 A;  4WUR A;  5ITR A;  3LCV B;  1V92 A;  2FH0 A;  1D0K A;  1OIP A;  5ITX A;  1I94 M;  3AL0 C;  4GKK M;  4LJ5 A;  2QBY A;  4LRS A;  2J7N A;  4IBF A;  1ZMU A;  4LF8 M;  2Y0Q A;  2JNH A;  1NNJ A;  4DR7 M;  3FRH A;  1JB0 F;  4WW0 A;  5FTK A;  4CGY B;  3I51 A;  2LBC A;  2RRU A;  3TPZ A;  3SAS A;  3GLG A;  4RF1 A;  3H4M A;  4G6Z A;  3GRV A;  4GH9 A;  3CF0 A;  4L16 A;  2ZAO A;  3GPP A;  3PNV A;  3VK8 A;  2JY5 A;  4JI6 M;  4FVM A;  2XGN A;  1HT1 E;  1NSF A;  2DI0 A;  2K47 A;  4JN6 A;  1WGL A;  2JXN A;  4R71 A;  2GNO A;  4MGH A;  1LTM A;  1YUB A;  2HWJ A;  2Y20 A;  4FWG A;  4OW0 A;  4DV0 M;  1G71 A;  4LCB A;  5ITT A;  5EQT A;  3BOS A;  3M6A A;  3T1H M;  2F5O A;  1R4G A;  2MR9 A;  1D0L A;  2VQF M;  1GO5 A;  1IXS A;  1YSY A;  2UXC M;  1OFI A;  2F5Q A;  1WJ7 A;  1IFY A;  4FCV A;  4NOO B;  1PJS A;  3E4R A;  2I7P A;  3L25 A;  3GQ4 A;  3SMS A;  1VEJ A;  1JR3 A;  2CHG A;  1XNQ M;  1XB2 B;  4DR6 M;  1AUA A;  1WXQ A;  3VDU A;  4GHL A;  4RF0 A;  3VDP A;  4NC6 A;  4DUY M;  1WIV A;  4I5S A;  3J80 S;  1L1T A;  5KQ8 A;  4G4Q A;  4LF4 M;  2L7H A;  1E9R A;  1YLA A;  7CAT A;  3IG5 A; 
#chains in the Genus database with same CATH homology
 3MK6 A;  1L8Q A;  5GKN A;  5FSW A;  1J09 A;  3TWL A;  2KZS A;  3LVV A;  4CIS A;  1SXJ A;  2Z4S A;  2UUC M;  3AKZ A;  3UZU A;  4IBE A;  1NNU C;  4G4R A;  1UM8 A;  4IBD A;  1IY0 A;  4FD2 A;  3KS8 A;  4PT5 A;  2FFJ A;  4LJ4 A;  2X8A A;  4LJA A;  4I81 A;  3U5Z B;  1IN4 A;  4X62 M;  4JYA M;  5KPZ A;  1W5T A;  2BJW A;  2C9O A;  2KA6 B;  4MM3 B;  3GRU A;  4FWH A;  4LRT A;  1EE8 A;  2NQ8 C;  2EO2 A;  4MH0 E;  3SAU A;  1NY5 A;  1GVN A;  4GIP A;  3PXG A;  3GO8 A;  4LJ6 A;  1HNX M;  4LF7 M;  4GKJ M;  3HHZ A;  3GLF B;  5ITU A;  4W5W A;  4B08 A;  3HWS A;  3KSX A;  4QNM A;  3M0E A;  5EXX A;  2QBY B;  4BBA A;  2D7E A;  4B7F A;  4BB9 A;  1G4A E;  4JI0 M;  3A42 A;  3TE6 A;  2L09 A;  1QAN A;  4IBI A;  1T3T A;  2CHV A;  5C18 A;  1IQP A;  4KLN A;  5EXS A;  3THG A;  2R65 A;  1G41 A;  2DVW B;  2V1U A;  4AI6 A;  2KRU A;  4DUZ M;  3L27 A;  3L29 A;  3UK6 A;  4G4O A;  1R6B X;  2C5R A;  2CHQ A;  3GQ3 A;  4X64 M;  1TH4 A;  2YNM D;  2CE7 A;  4QNR A;  4S12 A;  3QAU A;  5EP3 A;  3CF2 A;  3U6M A;  5ITY A;  4ZPX A;  1XWI A;  3U6S A;  1IXS B;  1H6U A;  4KOD A;  4LF6 M;  3FUV A;  1QAM A;  1MU5 A;  3JR5 A;  3W0F A;  3J7B A;  2HL7 A;  1DGH A;  2M60 A;  4DV7 M;  3KOY E;  3NWL A;  3K1J A;  4FWD A;  1DO2 A;  2CV2 A;  3ZC7 B;  2YQZ A;  3SAT A;  5EJC A;  3J7A S;  2P5T A;  3GQ5 A;  4PD2 A;  4D80 A;  4GMQ A;  4GHA A;  1QAO A;  3VFD A;  1QYR A;  1TH2 A;  2JA2 A;  4AG6 A;  1OFH A;  2KXE A;  5FTJ A;  3U60 A;  3R8F A;  1SXJ B;  3M7G A;  3RGP A;  3U6D A;  4IBC A;  4D82 A;  3GLI A;  3A98 B;  2AHM A;  4IIW A;  4L15 A;  3SC3 A;  3SAV A;  2XFT A;  4JI3 M;  3KFU G;  2R4J A;  4JI1 M;  1GKI A;  2CUZ A;  4FCT A;  1N36 M;  2FE8 A;  3VLF B;  1XMQ M;  1SXJ E;  4YY3 M;  4JI7 M;  4LZZ A;  4DV2 M;  1C1K A;  3HJS A;  3T1Y M;  2CV0 A;  3KP1 E;  3J27 B;  2QEN A;  1DGG A;  3U6Q A;  3ILK A;  2OPF A;  1XMO M;  4NXN M;  4ITQ A;  4NRW A;  4IBJ A;  2CFO A;  2XSZ A;  4LJ7 A;  4LFC M;  1ORY B;  5IZ7 D;  5IRE B;  2C99 A;  4M0W A;  2DWZ B;  3C58 A;  3K8Z A;  4QOZ C;  2FNA A;  3AJI B;  4JI5 M;  2YFQ A;  3JAM S;  2F5N A;  4PCZ A;  4IBG A;  1HNW M;  1OJL A;  3KOZ E;  5EP2 A;  2DWN A;  4B3S M;  2LH0 A;  4OX9 M;  2RGO A;  4MGZ E;  3TQS A;  3EIH A;  2DWL A;  3L28 A;  3HU3 A;  3U6P A;  1N75 A;  3GLH A;  3FYC A;  1IBK M;  1JQJ C;  2XZF A;  3GP1 A;  1HNZ M;  4NSR A;  3PVS A;  1GL6 A;  1E32 A;  5ITQ A;  1XXH A;  2LXE A;  2V1C A;  3KOX E;  5LMN M;  4B7H A;  3KVW A;  4QOS A;  5A2Q S;  1KYI A;  2X4A A;  5KPR A;  3SAR A;  4M9S A;  4DV5 M;  1IM2 A;  4LY6 A;  3SMP A;  2DZN B;  3VK7 A;  3W0L B;  4NXM M;  2HHH M;  2VQE M;  1LV7 A;  3TL4 X;  5H37 D;  5KPT A;  3TWM A;  3U60 B;  1R2Y A;  3K2L A;  5KQD A;  3B9P A;  2R62 A;  4IJE A;  4JI4 M;  4EIW A;  2XFS A;  2OQ4 A;  3GPU A;  1R7R A;  3GLG B;  2VII A;  3SAW A;  1IY2 A;  2BJV A;  2I7N A;  5ITX E;  2C96 A;  4JI8 M;  2W82 A;  3FTC A;  3L2A A;  4BLC A;  5EP4 A;  4JV5 M;  3EIE A;  2R4E A;  2E5L M;  3KDS E;  3GPX A;  5EP1 A;  1NJG A;  3HKP A;  1NHG C;  2EUC A;  2F4V M;  4D81 A;  5C1B A;  4PDG A;  2Z7J A;  3U6E A;  5DYI A;  3KW6 A;  4NSO B;  3RFW A;  4M9X A;  1IXR C;  2KRK A;  1DGB A;  1Z5A A;  3DA1 A;  3GPY A;  2F5S A;  3J81 S;  3LMM A;  3FUT A;  5FTM A;  2Y0T A;  2Q2E B;  2F5P A;  3FKE A;  4AKH A;  3SYL A;  1X37 A;  2CEA A;  3VKH A;  3AV0 A;  2C9C A;  2XEP A;  3D8B A;  4GC9 A;  4DV1 M;  1K82 A;  5IT9 S;  4CHT B;  1QAQ A;  3HU1 A;  3SHG B;  4TUW A;  3PFI A;  1NVM A;  2HKJ A;  2J7O A;  1D2N A;  2LNH C;  1MX0 A;  3RGS A;  4DV4 M;  2QCU A;  1IN6 A;  2XSZ D;  3FTD A;  1FJG M;  3E9S A;  3GLH B;  2UU9 M;  2D7H A;  3HGI A;  4DR4 M;  2DXI A;  3JR4 A;  3TWK A;  1HT2 E;  5JI3 E;  2G8L A;  1HQY E;  3HJ8 A;  2ZBK B;  4QHT A;  1GLN A;  4L4U A;  5E26 A;  1TDZ A;  4M0D A;  4GIT A;  1JR3 D;  2QP9 X;  1XXH B;  5FTN A;  2Y21 A;  4QHS A;  4MGK E;  1K3X A;  4Z8X A;  1ZAE A;  2H1R A;  1QZM A;  3Q8X A;  3R9X B;  4LFA M;  2KZU A;  1IBL M;  1FNN A;  4JI2 M;  1Q39 A;  3HHX A;  4AKI A;  1IN7 A;  3FUW A;  3KS4 A;  2M5Z A;  3L26 A;  3LVW A;  4LG2 A;  3ZH9 B;  3NBI A;  4B3M M;  3I4Y A;  1G3I A;  1Z59 A;  2G5G X;  1L2D A;  5DYG A;  2X49 A;  4IJF A;  1L2B A;  4LF5 M;  1SXJ D;  2C98 A;  2V6Z M;  2UUA M;  4K0K M;  2L7I A;  4KO8 A;  5BR8 M;  1ZQ9 A;  3OTO M;  2XZU A;  2DZO B;  2ZAM A;  1IN8 A;  1TH3 A;  1Z5B A;  1E94 E;  4M9Z A;  1IY1 A;  4AQY M;  1IN5 A;  4REZ A;  2EA0 A;  2BNK A;  2R45 A;  1PJJ A;  4B3T M;  1PM5 A;  1K3W A;  1NY6 A;  3AOE C;  1Z5C A;  4DV3 M;  3MJ5 A;  4OVZ A;  1TDH A;  1N33 M;  2UXB M;  4MGI E;  5JI2 E;  1VDD A;  3A46 A;  1J7K A;  1R2Z A;  3AOG A;  3LQQ A;  4DR2 M;  1IXZ A;  3AFH A;  8CAT A;  1NJF A;  3WHL A;  1N78 A;  4LZJ A;  2RGH A;  3A45 A;  1I4W A;  4R3D A;  3SHF A;  4DV6 M;  3U61 A;  2A5Y B;  3LQR A;  4NL4 H;  4DR5 M;  1DGH B;  1TGU A;  1XHB A;  3ZCB B;  2L6O A;  4AW4 A;  4DR1 M;  4B3R M;  2KW0 A;  3DFZ A;  3SYK A;  3DZD A;  4X65 M;  2RKO A;  3WHK A;  1E9S A;  1L1Z A;  1G59 A;  1N34 M;  1DO0 A;  2R18 A;  5FTL A;  2QPA A;  1PJI A;  3CF6 E;  2XF3 A;  3RE8 A;  2UUB M;  4FCW A;  4HLQ A;  4I8O A;  4AZF A;  1KFV A;  4L8R C;  2UXD M;  1L2C A;  4MGY E;  3DOA A;  3FUU A;  3T38 A;  4A3V B;  3UJN A;  2XLJ A;  3FD9 A;  2ZAN A;  4XGI A;  3KSJ A;  1J5E M;  3GLI B;  1Q3B A;  3SBJ A;  4R7G A;  3J2P B;  1XNR M;  4RNA A;  4LGM A;  4GC5 A;  4PDI A;  5FLX S;  4I4L A;  3D8L A;  5DNY A;  4G4N A;  3I4V A;  3SFZ A;  4YHH M;  1NHW C;  2LWX A;  3FTE A;  4AKG A;  2D7G A;  2KEB A;  3KP0 E;  2ZM6 M;  4AG5 A;  2XH9 A;  3HHY A;  4X66 M;  3U6L A;  2FOI C;  1KSF X;  4Z6Y A;  1Z6T A;  1N32 M;  2Z3X A;  2QZ4 A;  4IBB A;  3CTW B;  4LJ9 A;  5IWA M;  3U6C A;  4MB7 A;  3UMM A;  3FTF A;  5LMU M;  3FYD A;  4NRV A;  5EXT A;  4HL4 A;  4II7 A;  5BPV A;  2HCB A;  3GRR A;  3AOE A;  4LFB M;  2DWM A;  4LJ8 A;  3GRY A;  1G8P A;  2DHR A;  3QWL A;  4XBO A;  2ERC A;  1S3S A;  4B7G A;  3FUX A;  3T15 A;  3MHV C;  4OVZ B;  1IBM M;  3VKG A;  2Z4R A;  3PNY A;  1QVR A;  1HR0 M;  1DGF A;  4GRI A;  4L78 A;  1Q3C A;  1W5S A;  3KXE C;  4IBK A;  1QQW A;  1HQC A;  5E6J A;  3IG8 A;  5F3W A;  1SXJ C;  3K92 A;  2O5R A;  4DR3 M;  2CV1 A;  3HHW A;  1GL7 A;  4OU7 A;  3U5Z A;  4FW9 A;  1XC8 A;  4LGY A;  2YR0 A;  3HJQ A;  4P16 A;  3U61 B;  3HU2 A;  1YE9 A;  5EXP A;  4LF9 M;  1N77 A;  3KOW E;  4JXJ A;  3GLF A;  5KO3 A;  3U6O A;  4KHP M;  2R46 A;  4WUR A;  5ITR A;  3AL0 C;  5ITX A;  1I94 M;  4GKK M;  4LJ5 A;  2QBY A;  4LRS A;  2J7N A;  4IBF A;  4LF8 M;  2Y0Q A;  1NNJ A;  4DR7 M;  4WW0 A;  5FTK A;  4CGY B;  3I51 A;  3TPZ A;  3SAS A;  3GLG A;  4RF1 A;  3H4M A;  4G6Z A;  3GRV A;  4GH9 A;  3CF0 A;  4L16 A;  2ZAO A;  3GPP A;  3PNV A;  3VK8 A;  4JI6 M;  4FVM A;  2XGN A;  1HT1 E;  1NSF A;  2K47 A;  4JN6 A;  4MGH A;  1YUB A;  2Y20 A;  4OW0 A;  4FWG A;  4DV0 M;  3T1H M;  4LCB A;  2F5O A;  5ITT A;  5EQT A;  3BOS A;  3M6A A;  2VQF M;  1YSY A;  2UXC M;  1OFI A;  2F5Q A;  4FCV A;  4NOO B;  3E4R A;  2I7P A;  3L25 A;  3GQ4 A;  3SMS A;  2CHG A;  1JR3 A;  4DR6 M;  1XNQ M;  1WXQ A;  3VDU A;  4GHL A;  4RF0 A;  3VDP A;  4DUY M;  4I5S A;  3J80 S;  1L1T A;  5KQ8 A;  4G4Q A;  4LF4 M;  2L7H A;  1E9R A;  3UGJ A;  7CAT A;  3IG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...