3W0FA

Crystal structure of mouse endonuclease viii-like 3 (mneil3)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
255
Chain Sequence
VEGPGCTLNGEKIRARVLPGQAVTGVRGTALQSLLDSGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMKGSILINPREGENSPALAVQLTRDLICFYDSSVELRNSVESQQRVRVMEELDICSPKFSFSRAESEVKKQGDRMLCDVLLDQRVLPGVGNIIKNEALFDSGLHPAVKVCQLSDKQACHLVKMTRDFSILFYRCCKAGSAISKHCKVYKRPNCDQCHSKITVCRFGENSRMTYFCPHCQKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of a Mouse Ortholog of Human NEIL3 with a Marked Preference for Single-Stranded DNA
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Endonuclease 8-like 3
total genus 84
structure length 255
sequence length 282
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3w0fA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3w0fA01
5ITXA 4DR5M 1N32M 4G4NA 4X64M 5IWAM 4DR2M 1I94M 2UXBM 1TDZA 3GQ4A 1XNQM 3A46A 2UXCM 1HNXM 5LMNM 4DR7M 4K0KM 4DUZM 4ITQA 4DV7M 1NNJA 4LF7M 4JI8M 3J7AS 3A42A 3U6QA 1XC8A 3U6OA 2F5NA 4GKKM 1N33M 5ITXE 4JI3M 4NXMM 4AQYM 2UUAM 1FJGM 3J81S 4JI5M 1HR0M 4DV2M 5IT9S 3J80S 3JR5A 3SATA 4LF9M 1Z5AA 2HHHM 1IBLM 4YY3M 1IBMM 2UUCM 3GP1A 1L2CA 3DOAA 4DV5M 2UU9M 4NRVA 4CISA 4NRWA 4B3TM 4LF4M 1TDHA 3U6PA 4LFCM 1XNRM 2UXDM 1HNWM 4PCZA 3JR4A 4NXNM 4LF6M 5ITTA 2EA0A 4DR4M 4DR6M 2F5QA 1L2BA 5FLXS 5ITQA 4DV0M 3U6SA 1R2YA 4LF8M 1Q3BA 1Z5CA 3GQ5A 4JYAM 2OPFA 2ZBKB 2UUBM 3A45A 1EE8A 3GPPA 3T1HM 4JI0M 4DV1M 4DUYM 2F5OA 1IBKM 3U6EA 4G4QA 4DR3M 4LFBM 1J5EM 3TWMA 1PM5A 1PJJA 4DV3M 2F5SA 2VQEM 1KFVA 3GO8A 4B3SM 3OTOM 5LMUM 3VK7A 5A2QS 4KHPM 1R2ZA 5ITRA 3SAWA 1K3XA 1L2DA 1K82A 1N34M 4B3MM 4JI7M 1L1TA 3U6CA 4X66M 3SBJA 1MU5A 4JI6M 4MB7A 4G4RA 2OQ4A 4OX9M 3SAUA 4PD2A 3GPUA 1HNZM 1Q3CA 3T1YM 5ITYA 3C58A 4DR1M 4JI2M 1XMQM 4B3RM 1K3WA 4GKJM 4X62M 3U6MA 3SASA 4JI1M 3GQ3A 3W0FA 1Q39A 3JAMS 1MX0A 3SAVA 2F4VM 2XZUA 2Q2EB 2F5PA 4DV6M 4PDGA 4YHHM 3TWLA 2ZM6M 1PJIA 1N36M 1Z59A 5BR8M 4JV5M 3SARA 2HKJA 5ITUA 1XMOM 4X65M 3VK8A 1L1ZA 1Z5BA 3GPYA 4PDIA 4G4OA 4LF5M 3TWKA 3U6LA 3GPXA 4DV4M 2XZFA 2E5LM 2VQFM 4JI4M 3U6DA 4LFAM
chains in the Genus database with same CATH superfamily
4DR2M 8CATA 3BBZA 1GJSA 3VKGA 4LRTA 2BNKA 2L09A 4R71A 1AIPC 3KW6A 4RKUF 2JY6B 3E9SA 5FTMA 4DUZM 4JI7M 2MROB 3THGA 3U5ZA 2LVPC 1VEJA 2LXEA 3LW5F 2H5XA 3PFIA 3T15A 2J5YA 4JXJA 5H37D 3U6OA 4DBGB 4ANRA 2F5NA 1G41A 1IY2A 4L6V6 4LJ6A 3GLGB 2OOAA 3E21A 4HEOA 1VDLA 4P17A 4JI5M 1LTMA 1QVRA 3BXWA 3J80S 4II7A 3Q8GA 1JR3E 1Z5AA 4Y28F 2HHHM 4AW4A 2DWMA 3GP1A 4GEWA 1R4GA 1ORYB 2UU9M 2WSFF 3E46A 3MMPA 1QZEA 4GITA 4Q7JA 1XNRM 1T43A 2UXDM 3BOSA 3SC3A 1R6BX 4AKIA 1DV0A 3CF6E 1QAOA 2I7PA 3T6PA 3FYDA 1Y8GA 4DV0M 4LZJA 3HU2A 1OAOC 3J27B 4GRIA 3A98B 4LJ7A 4CHTB 2HWJA 1Z6TA 2R45A 5EQTA 1N77A 4IBFA 1G59A 2V1UA 4TUWA 1JB0F 5EP1A 4CJ6A 3FTEA 1PRBA 3F92A 2ZBKB 1D2NA 4XK8F 4B7GA 1XB2B 2Z3XA 5E26A 4D80A 4M9SA 1AUAA 2AHMA 3GRUA 1GJTA 4IBIA 2R0IA 4GIPA 3U6EA 1TGUA 1PJSA 3I51A 1LV7A 1DGBA 2XFSA 4JN6A 3C3DA 3B7NA 3LCVB 3U60B 4XBOA 4IBKA 5EP4A 3HJ8A 4GC9A 2JUJA 2H1RA 2DZLA 2R44A 1MN3A 1KFVA 3TPZA 4FCVA 1J09A 2FOIC 2CHGA 2LH0A 2R4JA 4NSOB 4RF1A 3K9OA 1ZQ9A 1R2ZA 1XXHA 3IG8A 4HLQA 1SXJD 3PNVA 3KDSE 1ZMVA 4QOZC 1OIZA 1OIPA 5L8RF 2L7HA 3FUWA 3RGPA 4B3MM 1FNNA 3VKHA 3FE3A 2KNVA 4OX9M 4L15A 2DAMA 3KS8A 2CV2A 1E94E 3L27A 2FH0A 2DENA 5ITYA 3C58A 1XXHE 2LBCA 2UXBM 3PVSA 2NQ8C 2O25A 1NO1A 2KZSA 3FKEA 4B3RM 1OJLA 5IZ7D 2P5TA 4GKJM 2ZTCA 3HKPA 2BJWA 4KLNA 2VF8A 5DYGA 4LCBA 3W0FA 1Q39A 2HL7A 1V33A 1MX0A 2Q2EB 3KS4A 4M9XA 1PJIA 1GL6A 1CUKA 3EIHA 2LVNC 3CF0A 5BR8M 4JV5M 2HKJA 3SMSA 2GNOA 2VF7A 3EIEA 4AKGA 2KRKA 3GPYA 2DI0A 1QYRA 2QP9X 4G4OA 1IQPA 2O5RA 3ILKA 3GPXA 2XZFA 3KFUG 2R18A 3GLFE 3I04M 5EP2A 2VQFM 4JI4M 1DGGA 2C9OA 2GQFA 3SHGB 3KXEC 5ITXA 1QAQA 1QAMA 2R46A 3GRVA 4W5WA 2CHVA 2HCBA 1ZMWA 3SFZA 4B7FA 5IWAM 5E6JA 2G5GX 3GQ4A 1YUBA 2VIIA 3K92A 4DR7M 4K0KM 1N78A 3NBXX 2EKKA 2D7GA 2ZTDA 2KNZA 4DV7M 4LF7M 2B3TA 2RGOA 3MJ5A 3HHZA 4JI8M 1NY6A 2O01F 1WHCA 4AG5A 1L8QA 3GLFA 2Z8YM 3A42A 3U6QA 2QZ4A 2LHGA 2LTUA 3C3EA 2QPAA 4AQYM 4R7GA 1FJGM 2M60A 5IREB 1XWIA 1SXJC 1GO5A 1GVNA 3K9PA 2MGWA 4DV2M 2DNAA 4LF9M 4MM3B 3AOEC 2L7IA 3W67A 1IBLM 1QANA 3AV0A 1L2CA 2LWXA 3QYEA 1ZAEA 4DV5M 1W5TA 4NRVA 4BB9A 4CISA 4B3TM 3GLHB 4NL4H 1G8PA 2X4AA 4PCZA 3U61A 1G4AE 3IG5A 4LF6M 4DR4M 1C7YA 2OO9A 4WURA 1VQ1A 5FTJA 1QQWA 2R6FA 2YR0A 1R2YA 2K6BA 3IHPA 3VFDA 2N35A 3AFHA 3HHXA 4I4LA 5DFLA 2JZ1A 3GLFB 2LNHC 2UUBM 1H6UA 3A45A 1EE8A 3RFWA 4Z6YA 4I5SA 2XLJA 3GPPA 1UM8A 1DGHA 2XEPA 4REZA 3T1HM 4FCWA 3K2LA 4LY6A 4DUYM 3HJQA 2F5OA 3GLGE 2JY8A 1J5EM 4FD2A 1IXZA 2C96A 2EJSA 2Z4SA 5EXXA 3KVWA 4KT0F 2VQEM 4IBDA 4EIWA 4B3SM 3OTOM 5KPRA 5A2QS 4GHLA 2X49A 2ERCA 1BVSA 4M9ZA 5ITRA 3SAWA 1L2DA 1YE9A 2CHQA 4AZFA 4LZZA 1K82A 5EP3A 1PGYA 1TR8A 3U6CA 1HQCA 4X66M 2R65A 1R5LA 3KOZE 3GLIA 1WXQA 4I8OA 4LRSA 2XGNA 4RF0A 2Y0QA 4PD2A 2ZAOA 3GPUA 3KSXA 1HNZM 3MK6A 1QUSA 1W5SA 1JR3D 2CE7A 1TH2A 3HHWA 3KOXE 1HQYE 2ZAMA 3HY5A 1OAIA 4G6ZA 3KSJA 4B08A 3T1YM 2XF3A 4OVZA 3I01M 2BWBA 5GKNA 4A3VB 1K3WA 1DGHB 1WR1B 2JY7A 2V6ZM 3B89A 1IN8A 3FYCA 1QDRA 4IBBA 4PT5A 1IN5A 3ZC7B 1C1KA 3HJSA 4MGYE 3SHFA 3NBIA 4CGYB 3SAVA 2DWNA 4F2LA 3HU3A 5FTLA 3KOWE 4PDGA 1NV8A 3LQRA 4IBEA 2RKOA 1Z59A 2CP8A 1EIJA 4LG2A 2BWEA 4M0DA 2M5ZA 1N75A 2EUCA 5ITUA 1XMOM 4X65M 1D0KA 1GKIA 1TTEA 1Z5BA 4IIWA 3RE8A 4AG6A 2DHRA 4MGZE 1GL7A 2DAIA 1VG5A 3ZH9B 4QHSA 1VEGA 4Z8XA 3U6LA 4DV4M 3GLIB 1P3QQ 2K9DA 4BLCA 3GRRA 4LFAM 3KP0E 3V76A 2J7NA 1IXRC 1QUTA 4FWDA 4X64M 1OKSA 1SXJB 4IBJA 3ZCBB 3L28A 1XNQM 1HNXM 4OVZB 1J7KA 1YSYA 1GABA 5JI3E 1A5TA 1NHWC 3LCUA 2QSFX 4LGMA 1X37A 2LVOC 1DO2A 1R7RA 1UFZA 5FTKA 1KYIA 1YLAA 5KQDA 2KNAA 5ITXE 4GKKM 1N33M 4NXMM 2K47A 3HU1A 3DFZA 2Z7JA 2JXNA 1D0LA 2UUAM 1IN7A 2KA6B 1T6OA 2MJ5B 1WGNA 1WGLA 2DKLA 3TE6A 2DVWB 1HR0M 5DYIA 3JR5A 3SATA 3QWLA 3LVVA 2ZANA 2WSEF 3VDPA 3M7GA 1SG9A 2FNAA 3FRHA 3DOAA 4NRWA 4CIZA 4LF4M 2KRUA 2J7OA 1TDHA 2DHYA 3U6PA 1HNWM 3R9XB 3L29A 5ITTA 4LGYA 2F5QA 3VLFB 1L2BA 1JQJC 5FLXS 1HT1E 1S3SA 3L25A 1TF0B 2W82A 1Z5CA 3GQ5A 5EXTA 2Y0TA 3FRIA 4WP2A 4JYAM 2XSZD 3GLIE 3LVWA 2L4EA 5KO3A 2K0BX 1RU3A 2KXEA 4LJ5A 5FSWA 4JI0M 2DWZB 2EO2A 1EFUB 4GH9A 3TWMA 1IN6A 3AOGA 2KHHA 1E32A 2VDBB 4D81A 4DV3M 3K8ZA 3U5ZB 1MJGM 2JP7A 2LVQD 3FUUA 3VK7A 4KHPM 2CEAA 3GLHE 1K3XA 3UK6A 1NSFA 2DAGA 5BPVA 1VEKA 7CATA 1OQYA 2DAEA 2DZOB 2JWSA 4LJ9A 2L6OA 4G3OA 3RGSA 3GLGA 4NSRA 4GHAA 2G3QA 2XH9A 3FUVA 3QAUA 4MB7A 4G4RA 2OQ4A 4GMQA 3AOEA 4FWGA 3HZJA 1E9RA 1IY1A 2C99A 3B7QA 1I4WA 1Q02A 2KW0A 4R3DA 4MGIE 4L4UA 4JI2M 2OOBA 3FTCA 1G3IA 1XMQM 2C9CA 2D7EA 4FW9A 4LJ8A 2YQZA 3UZUA 3SMPA 4X62M 2G8LA 3GRYA 3LQQA 3AJIB 4JI1M 4MGHA 2XSZA 4RNAA 1V34A 3I4YA 2FS1A 3JAMS 2F4VM 2DWLA 2F5PA 3GLHA 1F4IA 2APLA 2RGHA 2ZM6M 1N36M 2YFQA 3D8BA 2X8AA 3QYBA 3CF2A 1I94M 3U61B 2CV1A 4L8RC 2QBYB 1E9SA 4L16A 1QZMA 2C5RA 2Y20A 1T3TA 1OFHA 1QDTA 2JY5A 3B74A 1L1ZA 4PDIA 2KZUA 3CGWA 1NV9A 4LF5M 1NY5A 3TWKA 2L2DA 2BJVA 3CTWB 4IBCA 2E5LM 3HWSA 2QQ8A 3SASA 2MH8A 3Q8XA 4BBAA 2QCUA 4DR5M 2V1CA 1N32M 4G4NA 1TDZA 3A46A 4QHTA 2UXCM 1IXSB 5LMNM 4IBGA 4LJ4A 1PJQA 4ITQA 2KEBA 5KQ8A 3J7BA 3W0LB 1NNJA 3KOYE 3VDUA 3H4MA 2R62A 1SXJE 3J7AS 1NJFA 2CRUA 3MHVC 2WZJA 1XC8A 3R8FA 4NC6A 2HAKA 4JI3M 1TH4A 1IY0A 3J81S 4L78A 2QNJA 4OW0A 3DA1A 1DO0A 3FTFA 3IECA 2JA2A 1TH3A 3M6AA 5IT9S 1OTRA 2CFOA 3PNYA 4UN2B 3ZQJA 4B7HA 4YY3M 1IBMM 1ZV1A 2LVAA 3PXGA 2UUCM 3HHYA 1ZMUA 3UJNA 1NJGA 2LHCA 3HX3A 4GC5A 3WHLA 3U60A 3W68A 2MR9A 3TQSA 4LFCM 4AKHA 3JR4A 3B7ZA 1HT2E 4NXNM 2EA0A 4DR6M 3L2AA 5EXSA 5ITQA 3U6SA 4FCTA 3LMMA 4LF8M 2FE8A 2YNMD 3UGJA 1HJPA 1Q3BA 1V92A 1WJ7A 3TL4X 2OPFA 5C1BA 5EJCA 5KPTA 2DAKA 1NHGC 4KO8A 4DV1M 1OFIA 2L4FA 1IBKM 1KSFX 3K1JA 4F1IA 5C18A 4G4QA 4DR3M 4LFBM 4D82A 1IFYA 4QNRA 4WW0A 4QOSA 1PM5A 2QENA 1PJJA 2F5SA 3B9PA 2DZNB 3E4RA 3GO8A 1NNUC 4LJAA 3AKZA 1XHBA 5LMUM 3SYLA 4I81A 2JZ0A 5F3WA 3KP1E 5FTNA 4FVMA 4IJFA 2RRUA 2Y21A 1N34M 4P16A 1L1TA 3D8LA 1IM2A 3WHKA 4OU7A 1MU5A 2WSCF 3SBJA 4JI6M 2C98A 3C9PA 3T38A 1XXHB 2EKFA 3UMMA 2CWBA 3SAUA 5JI2E 2CUZA 3SYKA 1D0MA 1Q3CA 5KPZA 3J2PB 4IJEA 3DZDA 4NOOB 4DR1M 1GLNA 2Z4RA 2FFJA 4XGIA 3U6MA 2KDLA 1DGFA 1WIVA 3M0EA 2QBYA 3GQ3A 1G71A 3AL0C 3H4JA 2A5YB 4HL4A 5DNYA 1PJTA 2XZUA 4DV6M 4YHHM 3TWLA 3HGIA 2I7NA 3L26A 3FUXA 2JNHA 1SXJA 4ZPXA 4S12A 2R4EA 3FD9A 1VDDA 3SARA 2DXIA 3FUTA 4FWHA 3VK8A 4MH0E 1IN4A 3FTDA 1NVMA 3I4VA 4KODA 4MGKE 2XFTA 1IXSA 2QHOB 4QNMA 2CV0A 3NWLA 5EXPA 3U6DA 2D7HA 1JR3A 4M0WA 4AI6A
chains in the Genus database with same CATH topology
4DR2M 8CATA 3VKGA 4LRTA 2BNKA 2L09A 3KW6A 3E9SA 4DUZM 5FTMA 3THGA 3U5ZA 2LXEA 3PFIA 3T15A 4JXJA 5H37D 3U6OA 2F5NA 1G41A 1IY2A 4LJ6A 3GLGB 4JI5M 1QVRA 3J80S 4II7A 1Z5AA 2HHHM 4AW4A 2DWMA 3GP1A 1ORYB 2UU9M 4GITA 1XNRM 2UXDM 3BOSA 3SC3A 1R6BX 4AKIA 3CF6E 1QAOA 2I7PA 3FYDA 4DV0M 4LZJA 3HU2A 3J27B 4GRIA 4LJ7A 3A98B 4CHTB 1N77A 2R45A 1Z6TA 5EQTA 1G59A 2V1UA 4IBFA 4TUWA 5EP1A 3FTEA 2ZBKB 1D2NA 4B7GA 2Z3XA 5E26A 4D80A 4M9SA 2AHMA 3GRUA 4IBIA 4GIPA 3U6EA 1TGUA 3I51A 4JN6A 1LV7A 1DGBA 2XFSA 4XBOA 4IBKA 5EP4A 3HJ8A 4GC9A 2H1RA 1KFVA 3TPZA 4FCVA 1J09A 2FOIC 2CHGA 2LH0A 2R4JA 4NSOB 4RF1A 1ZQ9A 1R2ZA 1XXHA 3IG8A 4HLQA 1SXJD 3PNVA 3KDSE 4QOZC 2L7HA 3FUWA 3RGPA 4B3MM 1FNNA 3VKHA 4OX9M 4L15A 3KS8A 2CV2A 1E94E 3L27A 5ITYA 3C58A 2UXBM 3PVSA 2NQ8C 3FKEA 2KZSA 4B3RM 1OJLA 5IZ7D 2P5TA 4GKJM 3HKPA 2BJWA 4KLNA 5DYGA 4LCBA 3W0FA 1Q39A 2HL7A 1MX0A 2Q2EB 3KS4A 4M9XA 1PJIA 1GL6A 3EIHA 3CF0A 5BR8M 4JV5M 2HKJA 3SMSA 3EIEA 4AKGA 2KRKA 3GPYA 1QYRA 2QP9X 4G4OA 1IQPA 2O5RA 3ILKA 3GPXA 2XZFA 3KFUG 2R18A 5EP2A 2VQFM 4JI4M 1DGGA 2C9OA 3SHGB 3KXEC 5ITXA 1QAQA 1QAMA 2R46A 3GRVA 4W5WA 2CHVA 2HCBA 3SFZA 4B7FA 5IWAM 3GQ4A 5E6JA 2G5GX 1YUBA 2VIIA 3K92A 4DR7M 4K0KM 1N78A 2D7GA 4DV7M 4LF7M 3MJ5A 2RGOA 3HHZA 4JI8M 1NY6A 4AG5A 1L8QA 3GLFA 3A42A 3U6QA 2QZ4A 2QPAA 4AQYM 4R7GA 1FJGM 2M60A 5IREB 1XWIA 1SXJC 1GVNA 4DV2M 4LF9M 4MM3B 3AOEC 2L7IA 1IBLM 1QANA 3AV0A 1L2CA 2LWXA 1ZAEA 4DV5M 1W5TA 4NRVA 4BB9A 4CISA 4B3TM 3GLHB 4NL4H 1G8PA 2X4AA 4PCZA 3U61A 1G4AE 3IG5A 4LF6M 4DR4M 4WURA 5FTJA 1QQWA 2YR0A 1R2YA 3VFDA 3AFHA 3HHXA 4I4LA 3GLFB 2LNHC 2UUBM 1H6UA 3A45A 1EE8A 3RFWA 4Z6YA 4I5SA 2XLJA 3GPPA 1UM8A 1DGHA 2XEPA 4REZA 3T1HM 4FCWA 3K2LA 4LY6A 4DUYM 3HJQA 2F5OA 1J5EM 4FD2A 1IXZA 2C96A 2Z4SA 5EXXA 3KVWA 2VQEM 4IBDA 4EIWA 4B3SM 3OTOM 5KPRA 5A2QS 4GHLA 2X49A 2ERCA 4M9ZA 5ITRA 3SAWA 1L2DA 1YE9A 2CHQA 4AZFA 4LZZA 1K82A 5EP3A 3U6CA 1HQCA 4X66M 2R65A 3KOZE 3GLIA 1WXQA 4I8OA 4LRSA 2XGNA 4RF0A 2Y0QA 4PD2A 2ZAOA 3GPUA 3KSXA 1HNZM 3MK6A 1W5SA 1JR3D 2CE7A 1TH2A 3HHWA 3KOXE 1HQYE 2ZAMA 4G6ZA 3T1YM 3KSJA 4B08A 2XF3A 4OVZA 5GKNA 4A3VB 1K3WA 1DGHB 2V6ZM 3U60B 3FYCA 1IN8A 4IBBA 4PT5A 1IN5A 3ZC7B 1C1KA 3HJSA 4MGYE 3SHFA 3NBIA 4CGYB 3SAVA 2DWNA 3HU3A 5FTLA 3KOWE 4PDGA 3LQRA 4IBEA 2RKOA 1Z59A 4LG2A 4M0DA 2M5ZA 1N75A 2EUCA 5ITUA 1XMOM 4X65M 1GKIA 3RE8A 1Z5BA 4IIWA 4AG6A 2DHRA 4MGZE 1GL7A 3U6LA 3ZH9B 4QHSA 4Z8XA 4DV4M 3GLIB 4BLCA 3GRRA 4LFAM 3KP0E 2J7NA 1IXRC 4FWDA 4X64M 1SXJB 4IBJA 3ZCBB 3L28A 1XNQM 1HNXM 4OVZB 1J7KA 1YSYA 5JI3E 1NHWC 4LGMA 1X37A 1DO2A 1R7RA 5FTKA 1KYIA 5KQDA 4GKKM 5ITXE 1N33M 4NXMM 2K47A 3HU1A 3DFZA 2Z7JA 2UUAM 1IN7A 2KA6B 3TE6A 2DVWB 1HR0M 5DYIA 3JR5A 3SATA 3QWLA 3LVVA 2ZANA 3VDPA 3M7GA 2FNAA 3DOAA 4NRWA 4LF4M 2KRUA 2J7OA 1TDHA 3U6PA 1HNWM 3R9XB 3L29A 5ITTA 4LGYA 2F5QA 3VLFB 1L2BA 1JQJC 5FLXS 1HT1E 1S3SA 3L25A 2W82A 1Z5CA 3GQ5A 5EXTA 2Y0TA 4JYAM 2XSZD 3LVWA 5KO3A 2KXEA 4LJ5A 5FSWA 4JI0M 2DWZB 2EO2A 4GH9A 3TWMA 1IN6A 3AOGA 1E32A 4D81A 4DV3M 3K8ZA 3U5ZB 3FUUA 3VK7A 4KHPM 2CEAA 1K3XA 3UK6A 1NSFA 5BPVA 7CATA 4JI7M 2DZOB 4LJ9A 3RGSA 2L6OA 3GLGA 4GHAA 4NSRA 2XH9A 3QAUA 3FUVA 4MB7A 4G4RA 2OQ4A 4GMQA 3AOEA 4FWGA 1E9RA 1IY1A 2C99A 1I4WA 2KW0A 4R3DA 4MGIE 4L4UA 4JI2M 3FTCA 1G3IA 1XMQM 2C9CA 2D7EA 4FW9A 4LJ8A 2YQZA 3UZUA 3SMPA 4X62M 2G8LA 3GRYA 3LQQA 3AJIB 4JI1M 4MGHA 2XSZA 4RNAA 3I4YA 3JAMS 2F4VM 2DWLA 2F5PA 3GLHA 2RGHA 2ZM6M 1N36M 2YFQA 3D8BA 2X8AA 1I94M 3CF2A 2CV1A 3U61B 4L8RC 2QBYB 1E9SA 4L16A 1QZMA 2C5RA 2Y20A 1T3TA 1OFHA 1L1ZA 4PDIA 2KZUA 4LF5M 1NY5A 3TWKA 2BJVA 3CTWB 4IBCA 2E5LM 3HWSA 3SASA 3Q8XA 4BBAA 2QCUA 4DR5M 2V1CA 1N32M 4G4NA 1TDZA 3A46A 4QHTA 2UXCM 1IXSB 5LMNM 4IBGA 4LJ4A 4ITQA 2KEBA 5KQ8A 3J7BA 3W0LB 1NNJA 3KOYE 3VDUA 3H4MA 2R62A 1SXJE 3J7AS 1NJFA 3MHVC 1XC8A 3R8FA 4JI3M 1TH4A 1IY0A 3J81S 4L78A 4OW0A 3DA1A 1DO0A 3FTFA 2JA2A 1TH3A 3M6AA 5IT9S 2CFOA 3PNYA 4B7HA 4YY3M 1IBMM 3PXGA 2UUCM 3HHYA 3UJNA 1NJGA 4GC5A 3WHLA 3U60A 4LFCM 3TQSA 4AKHA 3JR4A 1HT2E 4NXNM 2EA0A 4DR6M 3L2AA 5EXSA 5ITQA 3U6SA 4FCTA 3LMMA 4LF8M 2FE8A 2YNMD 3UGJA 1Q3BA 3TL4X 2OPFA 5C1BA 5EJCA 5KPTA 1NHGC 4KO8A 4DV1M 1OFIA 1IBKM 1KSFX 3K1JA 5C18A 4G4QA 4DR3M 4LFBM 4D82A 4QNRA 4WW0A 4QOSA 1PM5A 2QENA 1PJJA 2F5SA 3B9PA 2DZNB 3E4RA 3GO8A 1NNUC 4LJAA 3AKZA 1XHBA 5LMUM 3SYLA 4I81A 5F3WA 3KP1E 5FTNA 4FVMA 4IJFA 2Y21A 1N34M 4P16A 1L1TA 3D8LA 1IM2A 3WHKA 4OU7A 1MU5A 3SBJA 4JI6M 2C98A 3T38A 1XXHB 3UMMA 3SAUA 5JI2E 2CUZA 3SYKA 1Q3CA 5KPZA 3J2PB 4IJEA 3DZDA 4NOOB 4DR1M 1GLNA 2Z4RA 2FFJA 4XGIA 3U6MA 1DGFA 3M0EA 2QBYA 3GQ3A 3AL0C 2A5YB 4HL4A 5DNYA 2XZUA 4DV6M 4YHHM 3TWLA 3HGIA 2I7NA 3L26A 3FUXA 1SXJA 4ZPXA 4S12A 2R4EA 3FD9A 1VDDA 3SARA 2DXIA 3FUTA 4FWHA 3VK8A 4MH0E 1IN4A 3FTDA 1NVMA 3I4VA 4KODA 4MGKE 2XFTA 4QNMA 2CV0A 3NWLA 5EXPA 3U6DA 2D7HA 1JR3A 4M0WA 4AI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITX A;  4DR5 M;  1N32 M;  4G4N A;  4X64 M;  5IWA M;  4DR2 M;  1I94 M;  2UXB M;  1TDZ A;  3GQ4 A;  1XNQ M;  3A46 A;  2UXC M;  1HNX M;  5LMN M;  4DR7 M;  4K0K M;  4DUZ M;  4ITQ A;  4DV7 M;  1NNJ A;  4LF7 M;  4JI8 M;  3J7A S;  3A42 A;  3U6Q A;  1XC8 A;  3U6O A;  2F5N A;  4GKK M;  1N33 M;  5ITX E;  4JI3 M;  4NXM M;  4AQY M;  2UUA M;  1FJG M;  3J81 S;  4JI5 M;  1HR0 M;  4DV2 M;  5IT9 S;  3J80 S;  3JR5 A;  3SAT A;  4LF9 M;  1Z5A A;  2HHH M;  1IBL M;  4YY3 M;  1IBM M;  2UUC M;  3GP1 A;  1L2C A;  3DOA A;  4DV5 M;  2UU9 M;  4NRV A;  4CIS A;  4NRW A;  4B3T M;  4LF4 M;  1TDH A;  3U6P A;  4LFC M;  1XNR M;  2UXD M;  1HNW M;  4PCZ A;  3JR4 A;  4NXN M;  4LF6 M;  5ITT A;  2EA0 A;  4DR4 M;  4DR6 M;  2F5Q A;  1L2B A;  5FLX S;  5ITQ A;  4DV0 M;  3U6S A;  1R2Y A;  4LF8 M;  1Q3B A;  1Z5C A;  3GQ5 A;  4JYA M;  2OPF A;  2ZBK B;  2UUB M;  3A45 A;  1EE8 A;  3GPP A;  3T1H M;  4JI0 M;  4DV1 M;  4DUY M;  2F5O A;  1IBK M;  3U6E A;  4G4Q A;  4DR3 M;  4LFB M;  1J5E M;  3TWM A;  1PM5 A;  1PJJ A;  4DV3 M;  2F5S A;  2VQE M;  1KFV A;  3GO8 A;  4B3S M;  3OTO M;  5LMU M;  3VK7 A;  5A2Q S;  4KHP M;  1R2Z A;  5ITR A;  3SAW A;  1K3X A;  1L2D A;  1K82 A;  1N34 M;  4B3M M;  4JI7 M;  1L1T A;  3U6C A;  4X66 M;  3SBJ A;  1MU5 A;  4JI6 M;  4MB7 A;  4G4R A;  2OQ4 A;  4OX9 M;  3SAU A;  4PD2 A;  3GPU A;  1HNZ M;  1Q3C A;  3T1Y M;  5ITY A;  3C58 A;  4DR1 M;  4JI2 M;  1XMQ M;  4B3R M;  1K3W A;  4GKJ M;  4X62 M;  3U6M A;  3SAS A;  4JI1 M;  3GQ3 A;  3W0F A;  1Q39 A;  3JAM S;  1MX0 A;  3SAV A;  2F4V M;  2XZU A;  2Q2E B;  2F5P A;  4DV6 M;  4PDG A;  4YHH M;  3TWL A;  2ZM6 M;  1PJI A;  1N36 M;  1Z59 A;  5BR8 M;  4JV5 M;  3SAR A;  2HKJ A;  5ITU A;  1XMO M;  4X65 M;  3VK8 A;  1L1Z A;  1Z5B A;  3GPY A;  4PDI A;  4G4O A;  4LF5 M;  3TWK A;  3U6L A;  3GPX A;  4DV4 M;  2XZF A;  2E5L M;  2VQF M;  4JI4 M;  3U6D A;  4LFA M; 
#chains in the Genus database with same CATH topology
 4DR2 M;  8CAT A;  3BBZ A;  1GJS A;  3VKG A;  4LRT A;  2BNK A;  2L09 A;  4R71 A;  1AIP C;  3KW6 A;  4RKU F;  2JY6 B;  3E9S A;  5FTM A;  4DUZ M;  4JI7 M;  2MRO B;  3THG A;  3U5Z A;  2LVP C;  1VEJ A;  2LXE A;  3LW5 F;  2H5X A;  3PFI A;  3T15 A;  2J5Y A;  4JXJ A;  5H37 D;  3U6O A;  4DBG B;  4ANR A;  2F5N A;  1G41 A;  1IY2 A;  4L6V 6;  4LJ6 A;  3GLG B;  2OOA A;  3E21 A;  4HEO A;  1VDL A;  4P17 A;  4JI5 M;  1LTM A;  1QVR A;  3BXW A;  3J80 S;  4II7 A;  3Q8G A;  1JR3 E;  1Z5A A;  4Y28 F;  2HHH M;  4AW4 A;  2DWM A;  3GP1 A;  4GEW A;  1R4G A;  1ORY B;  2UU9 M;  2WSF F;  3E46 A;  3MMP A;  1QZE A;  4GIT A;  4Q7J A;  1XNR M;  1T43 A;  2UXD M;  3BOS A;  3SC3 A;  1R6B X;  4AKI A;  1DV0 A;  3CF6 E;  1QAO A;  2I7P A;  3T6P A;  3FYD A;  1Y8G A;  4DV0 M;  4LZJ A;  3HU2 A;  1OAO C;  3J27 B;  4GRI A;  3A98 B;  4LJ7 A;  4CHT B;  2HWJ A;  1Z6T A;  2R45 A;  5EQT A;  1N77 A;  4IBF A;  1G59 A;  2V1U A;  4TUW A;  1JB0 F;  5EP1 A;  4CJ6 A;  3FTE A;  1PRB A;  3F92 A;  2ZBK B;  1D2N A;  4XK8 F;  4B7G A;  1XB2 B;  2Z3X A;  5E26 A;  4D80 A;  4M9S A;  1AUA A;  2AHM A;  3GRU A;  1GJT A;  4IBI A;  2R0I A;  4GIP A;  3U6E A;  1TGU A;  1PJS A;  3I51 A;  1LV7 A;  1DGB A;  2XFS A;  4JN6 A;  3C3D A;  3B7N A;  3LCV B;  3U60 B;  4XBO A;  4IBK A;  5EP4 A;  3HJ8 A;  4GC9 A;  2JUJ A;  2H1R A;  2DZL A;  2R44 A;  1MN3 A;  1KFV A;  3TPZ A;  4FCV A;  1J09 A;  2FOI C;  2CHG A;  2LH0 A;  2R4J A;  4NSO B;  4RF1 A;  3K9O A;  1ZQ9 A;  1R2Z A;  1XXH A;  3IG8 A;  4HLQ A;  1SXJ D;  3PNV A;  3KDS E;  1ZMV A;  4QOZ C;  1OIZ A;  1OIP A;  5L8R F;  2L7H A;  3FUW A;  3RGP A;  4B3M M;  1FNN A;  3VKH A;  3FE3 A;  2KNV A;  4OX9 M;  4L15 A;  2DAM A;  3KS8 A;  2CV2 A;  1E94 E;  3L27 A;  2FH0 A;  2DEN A;  5ITY A;  3C58 A;  1XXH E;  2LBC A;  2UXB M;  3PVS A;  2NQ8 C;  2O25 A;  1NO1 A;  2KZS A;  3FKE A;  4B3R M;  1OJL A;  5IZ7 D;  2P5T A;  4GKJ M;  2ZTC A;  3HKP A;  2BJW A;  4KLN A;  2VF8 A;  5DYG A;  4LCB A;  3W0F A;  1Q39 A;  2HL7 A;  1V33 A;  1MX0 A;  2Q2E B;  3KS4 A;  4M9X A;  1PJI A;  1GL6 A;  1CUK A;  3EIH A;  2LVN C;  3CF0 A;  5BR8 M;  4JV5 M;  2HKJ A;  3SMS A;  2GNO A;  2VF7 A;  3EIE A;  4AKG A;  2KRK A;  3GPY A;  2DI0 A;  1QYR A;  2QP9 X;  4G4O A;  1IQP A;  2O5R A;  3ILK A;  3GPX A;  2XZF A;  3KFU G;  2R18 A;  3GLF E;  3I04 M;  5EP2 A;  2VQF M;  4JI4 M;  1DGG A;  2C9O A;  2GQF A;  3SHG B;  3KXE C;  5ITX A;  1QAQ A;  1QAM A;  2R46 A;  3GRV A;  4W5W A;  2CHV A;  2HCB A;  1ZMW A;  3SFZ A;  4B7F A;  5IWA M;  5E6J A;  2G5G X;  3GQ4 A;  1YUB A;  2VII A;  3K92 A;  4DR7 M;  4K0K M;  1N78 A;  3NBX X;  2EKK A;  2D7G A;  2ZTD A;  2KNZ A;  4DV7 M;  4LF7 M;  2B3T A;  2RGO A;  3MJ5 A;  3HHZ A;  4JI8 M;  1NY6 A;  2O01 F;  1WHC A;  4AG5 A;  1L8Q A;  3GLF A;  2Z8Y M;  3A42 A;  3U6Q A;  2QZ4 A;  2LHG A;  2LTU A;  3C3E A;  2QPA A;  4AQY M;  4R7G A;  1FJG M;  2M60 A;  5IRE B;  1XWI A;  1SXJ C;  1GO5 A;  1GVN A;  3K9P A;  2MGW A;  4DV2 M;  2DNA A;  4LF9 M;  4MM3 B;  3AOE C;  2L7I A;  3W67 A;  1IBL M;  1QAN A;  3AV0 A;  1L2C A;  2LWX A;  3QYE A;  1ZAE A;  4DV5 M;  1W5T A;  4NRV A;  4BB9 A;  4CIS A;  4B3T M;  3GLH B;  4NL4 H;  1G8P A;  2X4A A;  4PCZ A;  3U61 A;  1G4A E;  3IG5 A;  4LF6 M;  4DR4 M;  1C7Y A;  2OO9 A;  4WUR A;  1VQ1 A;  5FTJ A;  1QQW A;  2R6F A;  2YR0 A;  1R2Y A;  2K6B A;  3IHP A;  3VFD A;  2N35 A;  3AFH A;  3HHX A;  4I4L A;  5DFL A;  2JZ1 A;  3GLF B;  2LNH C;  2UUB M;  1H6U A;  3A45 A;  1EE8 A;  3RFW A;  4Z6Y A;  4I5S A;  2XLJ A;  3GPP A;  1UM8 A;  1DGH A;  2XEP A;  4REZ A;  3T1H M;  4FCW A;  3K2L A;  4LY6 A;  4DUY M;  3HJQ A;  2F5O A;  3GLG E;  2JY8 A;  1J5E M;  4FD2 A;  1IXZ A;  2C96 A;  2EJS A;  2Z4S A;  5EXX A;  3KVW A;  4KT0 F;  2VQE M;  4IBD A;  4EIW A;  4B3S M;  3OTO M;  5KPR A;  5A2Q S;  4GHL A;  2X49 A;  2ERC A;  1BVS A;  4M9Z A;  5ITR A;  3SAW A;  1L2D A;  1YE9 A;  2CHQ A;  4AZF A;  4LZZ A;  1K82 A;  5EP3 A;  1PGY A;  1TR8 A;  3U6C A;  1HQC A;  4X66 M;  2R65 A;  1R5L A;  3KOZ E;  3GLI A;  1WXQ A;  4I8O A;  4LRS A;  2XGN A;  4RF0 A;  2Y0Q A;  4PD2 A;  2ZAO A;  3GPU A;  3KSX A;  1HNZ M;  3MK6 A;  1QUS A;  1W5S A;  1JR3 D;  2CE7 A;  1TH2 A;  3HHW A;  3KOX E;  1HQY E;  2ZAM A;  3HY5 A;  1OAI A;  4G6Z A;  3KSJ A;  4B08 A;  3T1Y M;  2XF3 A;  4OVZ A;  3I01 M;  2BWB A;  5GKN A;  4A3V B;  1K3W A;  1DGH B;  1WR1 B;  2JY7 A;  2V6Z M;  3B89 A;  1IN8 A;  3FYC A;  1QDR A;  4IBB A;  4PT5 A;  1IN5 A;  3ZC7 B;  1C1K A;  3HJS A;  4MGY E;  3SHF A;  3NBI A;  4CGY B;  3SAV A;  2DWN A;  4F2L A;  3HU3 A;  5FTL A;  3KOW E;  4PDG A;  1NV8 A;  3LQR A;  4IBE A;  2RKO A;  1Z59 A;  2CP8 A;  1EIJ A;  4LG2 A;  2BWE A;  4M0D A;  2M5Z A;  1N75 A;  2EUC A;  5ITU A;  1XMO M;  4X65 M;  1D0K A;  1GKI A;  1TTE A;  1Z5B A;  4IIW A;  3RE8 A;  4AG6 A;  2DHR A;  4MGZ E;  1GL7 A;  2DAI A;  1VG5 A;  3ZH9 B;  4QHS A;  1VEG A;  4Z8X A;  3U6L A;  4DV4 M;  3GLI B;  1P3Q Q;  2K9D A;  4BLC A;  3GRR A;  4LFA M;  3KP0 E;  3V76 A;  2J7N A;  1IXR C;  1QUT A;  4FWD A;  4X64 M;  1OKS A;  1SXJ B;  4IBJ A;  3ZCB B;  3L28 A;  1XNQ M;  1HNX M;  4OVZ B;  1J7K A;  1YSY A;  1GAB A;  5JI3 E;  1A5T A;  1NHW C;  3LCU A;  2QSF X;  4LGM A;  1X37 A;  2LVO C;  1DO2 A;  1R7R A;  1UFZ A;  5FTK A;  1KYI A;  1YLA A;  5KQD A;  2KNA A;  5ITX E;  4GKK M;  1N33 M;  4NXM M;  2K47 A;  3HU1 A;  3DFZ A;  2Z7J A;  2JXN A;  1D0L A;  2UUA M;  1IN7 A;  2KA6 B;  1T6O A;  2MJ5 B;  1WGN A;  1WGL A;  2DKL A;  3TE6 A;  2DVW B;  1HR0 M;  5DYI A;  3JR5 A;  3SAT A;  3QWL A;  3LVV A;  2ZAN A;  2WSE F;  3VDP A;  3M7G A;  1SG9 A;  2FNA A;  3FRH A;  3DOA A;  4NRW A;  4CIZ A;  4LF4 M;  2KRU A;  2J7O A;  1TDH A;  2DHY A;  3U6P A;  1HNW M;  3R9X B;  3L29 A;  5ITT A;  4LGY A;  2F5Q A;  3VLF B;  1L2B A;  1JQJ C;  5FLX S;  1HT1 E;  1S3S A;  3L25 A;  1TF0 B;  2W82 A;  1Z5C A;  3GQ5 A;  5EXT A;  2Y0T A;  3FRI A;  4WP2 A;  4JYA M;  2XSZ D;  3GLI E;  3LVW A;  2L4E A;  5KO3 A;  2K0B X;  1RU3 A;  2KXE A;  4LJ5 A;  5FSW A;  4JI0 M;  2DWZ B;  2EO2 A;  1EFU B;  4GH9 A;  3TWM A;  1IN6 A;  3AOG A;  2KHH A;  1E32 A;  2VDB B;  4D81 A;  4DV3 M;  3K8Z A;  3U5Z B;  1MJG M;  2JP7 A;  2LVQ D;  3FUU A;  3VK7 A;  4KHP M;  2CEA A;  3GLH E;  1K3X A;  3UK6 A;  1NSF A;  2DAG A;  5BPV A;  1VEK A;  7CAT A;  1OQY A;  2DAE A;  2DZO B;  2JWS A;  4LJ9 A;  2L6O A;  4G3O A;  3RGS A;  3GLG A;  4NSR A;  4GHA A;  2G3Q A;  2XH9 A;  3FUV A;  3QAU A;  4MB7 A;  4G4R A;  2OQ4 A;  4GMQ A;  3AOE A;  4FWG A;  3HZJ A;  1E9R A;  1IY1 A;  2C99 A;  3B7Q A;  1I4W A;  1Q02 A;  2KW0 A;  4R3D A;  4MGI E;  4L4U A;  4JI2 M;  2OOB A;  3FTC A;  1G3I A;  1XMQ M;  2C9C A;  2D7E A;  4FW9 A;  4LJ8 A;  2YQZ A;  3UZU A;  3SMP A;  4X62 M;  2G8L A;  3GRY A;  3LQQ A;  3AJI B;  4JI1 M;  4MGH A;  2XSZ A;  4RNA A;  1V34 A;  3I4Y A;  2FS1 A;  3JAM S;  2F4V M;  2DWL A;  2F5P A;  3GLH A;  1F4I A;  2APL A;  2RGH A;  2ZM6 M;  1N36 M;  2YFQ A;  3D8B A;  2X8A A;  3QYB A;  3CF2 A;  1I94 M;  3U61 B;  2CV1 A;  4L8R C;  2QBY B;  1E9S A;  4L16 A;  1QZM A;  2C5R A;  2Y20 A;  1T3T A;  1OFH A;  1QDT A;  2JY5 A;  3B74 A;  1L1Z A;  4PDI A;  2KZU A;  3CGW A;  1NV9 A;  4LF5 M;  1NY5 A;  3TWK A;  2L2D A;  2BJV A;  3CTW B;  4IBC A;  2E5L M;  3HWS A;  2QQ8 A;  3SAS A;  2MH8 A;  3Q8X A;  4BBA A;  2QCU A;  4DR5 M;  2V1C A;  1N32 M;  4G4N A;  1TDZ A;  3A46 A;  4QHT A;  2UXC M;  1IXS B;  5LMN M;  4IBG A;  4LJ4 A;  1PJQ A;  4ITQ A;  2KEB A;  5KQ8 A;  3J7B A;  3W0L B;  1NNJ A;  3KOY E;  3VDU A;  3H4M A;  2R62 A;  1SXJ E;  3J7A S;  1NJF A;  2CRU A;  3MHV C;  2WZJ A;  1XC8 A;  3R8F A;  4NC6 A;  2HAK A;  4JI3 M;  1TH4 A;  1IY0 A;  3J81 S;  4L78 A;  2QNJ A;  4OW0 A;  3DA1 A;  1DO0 A;  3FTF A;  3IEC A;  2JA2 A;  1TH3 A;  3M6A A;  5IT9 S;  1OTR A;  2CFO A;  3PNY A;  4UN2 B;  3ZQJ A;  4B7H A;  4YY3 M;  1IBM M;  1ZV1 A;  2LVA A;  3PXG A;  2UUC M;  3HHY A;  1ZMU A;  3UJN A;  1NJG A;  2LHC A;  3HX3 A;  4GC5 A;  3WHL A;  3U60 A;  3W68 A;  2MR9 A;  3TQS A;  4LFC M;  4AKH A;  3JR4 A;  3B7Z A;  1HT2 E;  4NXN M;  2EA0 A;  4DR6 M;  3L2A A;  5EXS A;  5ITQ A;  3U6S A;  4FCT A;  3LMM A;  4LF8 M;  2FE8 A;  2YNM D;  3UGJ A;  1HJP A;  1Q3B A;  1V92 A;  1WJ7 A;  3TL4 X;  2OPF A;  5C1B A;  5EJC A;  5KPT A;  2DAK A;  1NHG C;  4KO8 A;  4DV1 M;  1OFI A;  2L4F A;  1IBK M;  1KSF X;  3K1J A;  4F1I A;  5C18 A;  4G4Q A;  4DR3 M;  4LFB M;  4D82 A;  1IFY A;  4QNR A;  4WW0 A;  4QOS A;  1PM5 A;  2QEN A;  1PJJ A;  2F5S A;  3B9P A;  2DZN B;  3E4R A;  3GO8 A;  1NNU C;  4LJA A;  3AKZ A;  1XHB A;  5LMU M;  3SYL A;  4I81 A;  2JZ0 A;  5F3W A;  3KP1 E;  5FTN A;  4FVM A;  4IJF A;  2RRU A;  2Y21 A;  1N34 M;  4P16 A;  1L1T A;  3D8L A;  1IM2 A;  3WHK A;  4OU7 A;  1MU5 A;  2WSC F;  3SBJ A;  4JI6 M;  2C98 A;  3C9P A;  3T38 A;  1XXH B;  2EKF A;  3UMM A;  2CWB A;  3SAU A;  5JI2 E;  2CUZ A;  3SYK A;  1D0M A;  1Q3C A;  5KPZ A;  3J2P B;  4IJE A;  3DZD A;  4NOO B;  4DR1 M;  1GLN A;  2Z4R A;  2FFJ A;  4XGI A;  3U6M A;  2KDL A;  1DGF A;  1WIV A;  3M0E A;  2QBY A;  3GQ3 A;  1G71 A;  3AL0 C;  3H4J A;  2A5Y B;  4HL4 A;  5DNY A;  1PJT A;  2XZU A;  4DV6 M;  4YHH M;  3TWL A;  3HGI A;  2I7N A;  3L26 A;  3FUX A;  2JNH A;  1SXJ A;  4ZPX A;  4S12 A;  2R4E A;  3FD9 A;  1VDD A;  3SAR A;  2DXI A;  3FUT A;  4FWH A;  3VK8 A;  4MH0 E;  1IN4 A;  3FTD A;  1NVM A;  3I4V A;  4KOD A;  4MGK E;  2XFT A;  1IXS A;  2QHO B;  4QNM A;  2CV0 A;  3NWL A;  5EXP A;  3U6D A;  2D7H A;  1JR3 A;  4M0W A;  4AI6 A; 
#chains in the Genus database with same CATH homology
 4DR2 M;  8CAT A;  3VKG A;  4LRT A;  2BNK A;  2L09 A;  3KW6 A;  3E9S A;  4DUZ M;  5FTM A;  3THG A;  3U5Z A;  2LXE A;  3PFI A;  3T15 A;  4JXJ A;  5H37 D;  3U6O A;  2F5N A;  1G41 A;  1IY2 A;  4LJ6 A;  3GLG B;  4JI5 M;  1QVR A;  3J80 S;  4II7 A;  1Z5A A;  2HHH M;  4AW4 A;  2DWM A;  3GP1 A;  1ORY B;  2UU9 M;  4GIT A;  1XNR M;  2UXD M;  3BOS A;  3SC3 A;  1R6B X;  4AKI A;  3CF6 E;  1QAO A;  2I7P A;  3FYD A;  4DV0 M;  4LZJ A;  3HU2 A;  3J27 B;  4GRI A;  4LJ7 A;  3A98 B;  4CHT B;  1N77 A;  2R45 A;  1Z6T A;  5EQT A;  1G59 A;  2V1U A;  4IBF A;  4TUW A;  5EP1 A;  3FTE A;  2ZBK B;  1D2N A;  4B7G A;  2Z3X A;  5E26 A;  4D80 A;  4M9S A;  2AHM A;  3GRU A;  4IBI A;  4GIP A;  3U6E A;  1TGU A;  3I51 A;  4JN6 A;  1LV7 A;  1DGB A;  2XFS A;  4XBO A;  4IBK A;  5EP4 A;  3HJ8 A;  4GC9 A;  2H1R A;  1KFV A;  3TPZ A;  4FCV A;  1J09 A;  2FOI C;  2CHG A;  2LH0 A;  2R4J A;  4NSO B;  4RF1 A;  1ZQ9 A;  1R2Z A;  1XXH A;  3IG8 A;  4HLQ A;  1SXJ D;  3PNV A;  3KDS E;  4QOZ C;  2L7H A;  3FUW A;  3RGP A;  4B3M M;  1FNN A;  3VKH A;  4OX9 M;  4L15 A;  3KS8 A;  2CV2 A;  1E94 E;  3L27 A;  5ITY A;  3C58 A;  2UXB M;  3PVS A;  2NQ8 C;  3FKE A;  2KZS A;  4B3R M;  1OJL A;  5IZ7 D;  2P5T A;  4GKJ M;  3HKP A;  2BJW A;  4KLN A;  5DYG A;  4LCB A;  3W0F A;  1Q39 A;  2HL7 A;  1MX0 A;  2Q2E B;  3KS4 A;  4M9X A;  1PJI A;  1GL6 A;  3EIH A;  3CF0 A;  5BR8 M;  4JV5 M;  2HKJ A;  3SMS A;  3EIE A;  4AKG A;  2KRK A;  3GPY A;  1QYR A;  2QP9 X;  4G4O A;  1IQP A;  2O5R A;  3ILK A;  3GPX A;  2XZF A;  3KFU G;  2R18 A;  5EP2 A;  2VQF M;  4JI4 M;  1DGG A;  2C9O A;  3SHG B;  3KXE C;  5ITX A;  1QAQ A;  1QAM A;  2R46 A;  3GRV A;  4W5W A;  2CHV A;  2HCB A;  3SFZ A;  4B7F A;  5IWA M;  3GQ4 A;  5E6J A;  2G5G X;  1YUB A;  2VII A;  3K92 A;  4DR7 M;  4K0K M;  1N78 A;  2D7G A;  4DV7 M;  4LF7 M;  3MJ5 A;  2RGO A;  3HHZ A;  4JI8 M;  1NY6 A;  4AG5 A;  1L8Q A;  3GLF A;  3A42 A;  3U6Q A;  2QZ4 A;  2QPA A;  4AQY M;  4R7G A;  1FJG M;  2M60 A;  5IRE B;  1XWI A;  1SXJ C;  1GVN A;  4DV2 M;  4LF9 M;  4MM3 B;  3AOE C;  2L7I A;  1IBL M;  1QAN A;  3AV0 A;  1L2C A;  2LWX A;  1ZAE A;  4DV5 M;  1W5T A;  4NRV A;  4BB9 A;  4CIS A;  4B3T M;  3GLH B;  4NL4 H;  1G8P A;  2X4A A;  4PCZ A;  3U61 A;  1G4A E;  3IG5 A;  4LF6 M;  4DR4 M;  4WUR A;  5FTJ A;  1QQW A;  2YR0 A;  1R2Y A;  3VFD A;  3AFH A;  3HHX A;  4I4L A;  3GLF B;  2LNH C;  2UUB M;  1H6U A;  3A45 A;  1EE8 A;  3RFW A;  4Z6Y A;  4I5S A;  2XLJ A;  3GPP A;  1UM8 A;  1DGH A;  2XEP A;  4REZ A;  3T1H M;  4FCW A;  3K2L A;  4LY6 A;  4DUY M;  3HJQ A;  2F5O A;  1J5E M;  4FD2 A;  1IXZ A;  2C96 A;  2Z4S A;  5EXX A;  3KVW A;  2VQE M;  4IBD A;  4EIW A;  4B3S M;  3OTO M;  5KPR A;  5A2Q S;  4GHL A;  2X49 A;  2ERC A;  4M9Z A;  5ITR A;  3SAW A;  1L2D A;  1YE9 A;  2CHQ A;  4AZF A;  4LZZ A;  1K82 A;  5EP3 A;  3U6C A;  1HQC A;  4X66 M;  2R65 A;  3KOZ E;  3GLI A;  1WXQ A;  4I8O A;  4LRS A;  2XGN A;  4RF0 A;  2Y0Q A;  4PD2 A;  2ZAO A;  3GPU A;  3KSX A;  1HNZ M;  3MK6 A;  1W5S A;  1JR3 D;  2CE7 A;  1TH2 A;  3HHW A;  3KOX E;  1HQY E;  2ZAM A;  4G6Z A;  3T1Y M;  3KSJ A;  4B08 A;  2XF3 A;  4OVZ A;  5GKN A;  4A3V B;  1K3W A;  1DGH B;  2V6Z M;  3U60 B;  3FYC A;  1IN8 A;  4IBB A;  4PT5 A;  1IN5 A;  3ZC7 B;  1C1K A;  3HJS A;  4MGY E;  3SHF A;  3NBI A;  4CGY B;  3SAV A;  2DWN A;  3HU3 A;  5FTL A;  3KOW E;  4PDG A;  3LQR A;  4IBE A;  2RKO A;  1Z59 A;  4LG2 A;  4M0D A;  2M5Z A;  1N75 A;  2EUC A;  5ITU A;  1XMO M;  4X65 M;  1GKI A;  3RE8 A;  1Z5B A;  4IIW A;  4AG6 A;  2DHR A;  4MGZ E;  1GL7 A;  3U6L A;  3ZH9 B;  4QHS A;  4Z8X A;  4DV4 M;  3GLI B;  4BLC A;  3GRR A;  4LFA M;  3KP0 E;  2J7N A;  1IXR C;  4FWD A;  4X64 M;  1SXJ B;  4IBJ A;  3ZCB B;  3L28 A;  1XNQ M;  1HNX M;  4OVZ B;  1J7K A;  1YSY A;  5JI3 E;  1NHW C;  4LGM A;  1X37 A;  1DO2 A;  1R7R A;  5FTK A;  1KYI A;  5KQD A;  4GKK M;  5ITX E;  1N33 M;  4NXM M;  2K47 A;  3HU1 A;  3DFZ A;  2Z7J A;  2UUA M;  1IN7 A;  2KA6 B;  3TE6 A;  2DVW B;  1HR0 M;  5DYI A;  3JR5 A;  3SAT A;  3QWL A;  3LVV A;  2ZAN A;  3VDP A;  3M7G A;  2FNA A;  3DOA A;  4NRW A;  4LF4 M;  2KRU A;  2J7O A;  1TDH A;  3U6P A;  1HNW M;  3R9X B;  3L29 A;  5ITT A;  4LGY A;  2F5Q A;  3VLF B;  1L2B A;  1JQJ C;  5FLX S;  1HT1 E;  1S3S A;  3L25 A;  2W82 A;  1Z5C A;  3GQ5 A;  5EXT A;  2Y0T A;  4JYA M;  2XSZ D;  3LVW A;  5KO3 A;  2KXE A;  4LJ5 A;  5FSW A;  4JI0 M;  2DWZ B;  2EO2 A;  4GH9 A;  3TWM A;  1IN6 A;  3AOG A;  1E32 A;  4D81 A;  4DV3 M;  3K8Z A;  3U5Z B;  3FUU A;  3VK7 A;  4KHP M;  2CEA A;  1K3X A;  3UK6 A;  1NSF A;  5BPV A;  7CAT A;  4JI7 M;  2DZO B;  4LJ9 A;  3RGS A;  2L6O A;  3GLG A;  4GHA A;  4NSR A;  2XH9 A;  3QAU A;  3FUV A;  4MB7 A;  4G4R A;  2OQ4 A;  4GMQ A;  3AOE A;  4FWG A;  1E9R A;  1IY1 A;  2C99 A;  1I4W A;  2KW0 A;  4R3D A;  4MGI E;  4L4U A;  4JI2 M;  3FTC A;  1G3I A;  1XMQ M;  2C9C A;  2D7E A;  4FW9 A;  4LJ8 A;  2YQZ A;  3UZU A;  3SMP A;  4X62 M;  2G8L A;  3GRY A;  3LQQ A;  3AJI B;  4JI1 M;  4MGH A;  2XSZ A;  4RNA A;  3I4Y A;  3JAM S;  2F4V M;  2DWL A;  2F5P A;  3GLH A;  2RGH A;  2ZM6 M;  1N36 M;  2YFQ A;  3D8B A;  2X8A A;  1I94 M;  3CF2 A;  2CV1 A;  3U61 B;  4L8R C;  2QBY B;  1E9S A;  4L16 A;  1QZM A;  2C5R A;  2Y20 A;  1T3T A;  1OFH A;  1L1Z A;  4PDI A;  2KZU A;  4LF5 M;  1NY5 A;  3TWK A;  2BJV A;  3CTW B;  4IBC A;  2E5L M;  3HWS A;  3SAS A;  3Q8X A;  4BBA A;  2QCU A;  4DR5 M;  2V1C A;  1N32 M;  4G4N A;  1TDZ A;  3A46 A;  4QHT A;  2UXC M;  1IXS B;  5LMN M;  4IBG A;  4LJ4 A;  4ITQ A;  2KEB A;  5KQ8 A;  3J7B A;  3W0L B;  1NNJ A;  3KOY E;  3VDU A;  3H4M A;  2R62 A;  1SXJ E;  3J7A S;  1NJF A;  3MHV C;  1XC8 A;  3R8F A;  4JI3 M;  1TH4 A;  1IY0 A;  3J81 S;  4L78 A;  4OW0 A;  3DA1 A;  1DO0 A;  3FTF A;  2JA2 A;  1TH3 A;  3M6A A;  5IT9 S;  2CFO A;  3PNY A;  4B7H A;  4YY3 M;  1IBM M;  3PXG A;  2UUC M;  3HHY A;  3UJN A;  1NJG A;  4GC5 A;  3WHL A;  3U60 A;  4LFC M;  3TQS A;  4AKH A;  3JR4 A;  1HT2 E;  4NXN M;  2EA0 A;  4DR6 M;  3L2A A;  5EXS A;  5ITQ A;  3U6S A;  4FCT A;  3LMM A;  4LF8 M;  2FE8 A;  2YNM D;  3UGJ A;  1Q3B A;  3TL4 X;  2OPF A;  5C1B A;  5EJC A;  5KPT A;  1NHG C;  4KO8 A;  4DV1 M;  1OFI A;  1IBK M;  1KSF X;  3K1J A;  5C18 A;  4G4Q A;  4DR3 M;  4LFB M;  4D82 A;  4QNR A;  4WW0 A;  4QOS A;  1PM5 A;  2QEN A;  1PJJ A;  2F5S A;  3B9P A;  2DZN B;  3E4R A;  3GO8 A;  1NNU C;  4LJA A;  3AKZ A;  1XHB A;  5LMU M;  3SYL A;  4I81 A;  5F3W A;  3KP1 E;  5FTN A;  4FVM A;  4IJF A;  2Y21 A;  1N34 M;  4P16 A;  1L1T A;  3D8L A;  1IM2 A;  3WHK A;  4OU7 A;  1MU5 A;  3SBJ A;  4JI6 M;  2C98 A;  3T38 A;  1XXH B;  3UMM A;  3SAU A;  5JI2 E;  2CUZ A;  3SYK A;  1Q3C A;  5KPZ A;  3J2P B;  4IJE A;  3DZD A;  4NOO B;  4DR1 M;  1GLN A;  2Z4R A;  2FFJ A;  4XGI A;  3U6M A;  1DGF A;  3M0E A;  2QBY A;  3GQ3 A;  3AL0 C;  2A5Y B;  4HL4 A;  5DNY A;  2XZU A;  4DV6 M;  4YHH M;  3TWL A;  3HGI A;  2I7N A;  3L26 A;  3FUX A;  1SXJ A;  4ZPX A;  4S12 A;  2R4E A;  3FD9 A;  1VDD A;  3SAR A;  2DXI A;  3FUT A;  4FWH A;  3VK8 A;  4MH0 E;  1IN4 A;  3FTD A;  1NVM A;  3I4V A;  4KOD A;  4MGK E;  2XFT A;  4QNM A;  2CV0 A;  3NWL A;  5EXP A;  3U6D A;  2D7H A;  1JR3 A;  4M0W A;  4AI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...