3W0FA

Crystal structure of mouse endonuclease viii-like 3 (mneil3)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
255
Chain Sequence
VEGPGCTLNGEKIRARVLPGQAVTGVRGTALQSLLDSGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMKGSILINPREGENSPALAVQLTRDLICFYDSSVELRNSVESQQRVRVMEELDICSPKFSFSRAESEVKKQGDRMLCDVLLDQRVLPGVGNIIKNEALFDSGLHPAVKVCQLSDKQACHLVKMTRDFSILFYRCCKAGSAISKHCKVYKRPNCDQCHSKITVCRFGENSRMTYFCPHCQKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of a Mouse Ortholog of Human NEIL3 with a Marked Preference for Single-Stranded DNA
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Endonuclease 8-like 3
total genus 84
structure length 255
sequence length 282
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3w0fA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3w0fA01
4YHHM 1XNRM 2F4VM 1N32M 1TDHA 3GPXA 1Q3BA 3GQ4A 2HHHM 4LF7M 1L2CA 1K3XA 4JV5M 1IBLM 1FJGM 1HNWM 4DR2M 5ITXA 2UUBM 4DR1M 3SAWA 2OQ4A 3JAMS 2Q2EB 4LF6M 4B3RM 4DV4M 5IT9S 3C58A 3GQ3A 1R2ZA 3SAVA 4JYAM 2E5LM 2VQEM 4X64M 3OTOM 5LMUM 2ZBKB 4G4NA 3U6MA 2XZUA 2UUAM 2UXDM 5ITTA 4NXNM 3JR4A 4DUZM 2VQFM 4DV2M 2F5PA 4CISA 2HKJA 5ITRA 4B3TM 4GKKM 3U6LA 1N36M 4NRWA 4LF8M 4LFCM 4JI7M 4LFAM 3A42A 1L1TA 4GKJM 1HR0M 4DR5M 4DR3M 3JR5A 4OX9M 3U6OA 4JI3M 4LFBM 1KFVA 3A46A 4JI6M 4DR4M 1N34M 4JI8M 3J81S 1XC8A 1PJJA 3GPYA 4AQYM 1N33M 1Q3CA 1L2BA 1XMQM 4B3SM 3U6SA 4DV3M 1Q39A 2F5SA 4JI0M 3GPPA 4JI1M 3DOAA 4DR7M 1Z5BA 3J80S 3VK7A 1HNXM 1L1ZA 3T1HM 1R2YA 1Z5AA 4PD2A 3U6CA 1XNQM 2F5OA 3TWKA 3U6PA 4PDIA 2UXBM 4K0KM 4X65M 2F5QA 4DV0M 1Z5CA 1IBMM 3J7AS 5ITXE 4X62M 4LF9M 3U6QA 3W0FA 4NRVA 3GP1A 3TWLA 4DV5M 1XMOM 4PDGA 4LF5M 1NNJA 3GO8A 3T1YM 2XZFA 4DV6M 5ITYA 3SATA 1EE8A 5FLXS 4KHPM 4PCZA 1PJIA 1MX0A 4G4QA 2OPFA 2UUCM 5ITQA 4G4RA 4ITQA 2EA0A 1Z59A 3GQ5A 3GPUA 4YY3M 4JI2M 3A45A 5IWAM 5BR8M 3VK8A 1K3WA 1IBKM 4B3MM 4LF4M 1MU5A 5LMNM 1I94M 2ZM6M 4DUYM 4JI4M 4DV1M 3U6DA 4NXMM 3SASA 1PM5A 4DR6M 2UXCM 4G4OA 1HNZM 2UU9M 4X66M 1K82A 3SBJA 5ITUA 5A2QS 3TWMA 1L2DA 1J5EM 4DV7M 3SARA 2F5NA 4MB7A 3U6EA 4JI5M 3SAUA 1TDZA
chains in the Genus database with same CATH superfamily
1X37A 1D0MA 2F4VM 1JB0F 1CUKA 1I4WA 1V33A 1IN4A 5EP1A 3GPXA 1Q3BA 3L27A 2JZ1A 2HHHM 4GIPA 2C9OA 4LF7M 3VDUA 4G6ZA 3VFDA 3AOEA 3M7GA 1HNWM 3GRVA 2QENA 4B7GA 3C3EA 3SAWA 2KRUA 2N35A 2OQ4A 4B3RM 4LGYA 4DV4M 4OW0A 3KS8A 4P16A 1PRBA 3U5ZA 3L2AA 3UK6A 5E26A 4IIWA 2NQ8C 4FW9A 3HU2A 3U6MA 5DNYA 4B08A 5ITTA 3JR4A 5KO3A 2CHQA 3R8FA 2DWNA 4RNAA 1GVNA 2RGOA 3A98B 2V1UA 2F5PA 3IHPA 1XXHE 3K1JA 4CISA 4GKKM 4NRWA 1LV7A 1NVMA 8CATA 1WJ7A 2G8LA 5EP4A 5JI3E 3W67A 1ZMWA 2BWEA 1L1TA 2XEPA 3FTDA 3U60B 3AL0C 3RGSA 3R9XB 3PNYA 1OIPA 3SYLA 3AFHA 3GLIE 3A46A 3KDSE 2XFTA 1QANA 3NBIA 3EIEA 1MJGM 2CV0A 4Q7JA 1N33M 1G41A 3E4RA 1L2BA 2DAMA 2C9CA 3M0EA 4F2LA 4B3SM 2DWZB 2CFOA 4LCBA 4IBCA 3L25A 2KXEA 1NHWC 4JI1M 1GABA 2VDBB 1NSFA 3CF2A 4FVMA 3U5ZB 1VEGA 3B89A 3I4VA 3J27B 1G71A 1HNXM 3ILKA 3Q8GA 1L1ZA 2V6ZM 1IBKM 4LJ8A 3BBZA 4ZPXA 1NJGA 3I01M 3J2PB 4NSOB 1Z5AA 1LTMA 2F5OA 3TWKA 2FH0A 2DKLA 1XXHA 1TH2A 2UXBM 1AUAA 4KO8A 2R46A 4GRIA 5JI2E 3AOGA 3KP1E 4X65M 3HHZA 4DV0M 1IN6A 1DGHB 2BJVA 4AKIA 1P3QQ 1Z5CA 2P5TA 2Y0TA 5EXTA 4CJ6A 4XBOA 4M9SA 1IBMM 4LF9M 3FUTA 2RKOA 4BB9A 2C99A 2YQZA 2GNOA 3B7QA 1DO2A 4WP2A 2R0IA 3I4YA 5EP2A 4L4UA 3HHYA 3FRHA 3GO8A 3I51A 3AKZA 5ITYA 3NWLA 2ERCA 1EIJA 2FE8A 1MX0A 3IECA 2UUCM 3KXEC 1EFUB 2JP7A 4I4LA 4LJ5A 2LVNC 2MR9A 3GQ5A 2OO9A 5DFLA 2QZ4A 3PXGA 4QOSA 3BXWA 4YY3M 3U61B 4JI2M 2Y20A 2BJWA 1YLAA 1SXJB 3A45A 2K9DA 1VG5A 3KW6A 3Q8XA 1QDRA 3QYBA 3KS4A 3VLFB 1MU5A 2KZUA 2LVAA 3HWSA 3KOYE 4RF1A 2QQ8A 5DYIA 1IY1A 4AG6A 4EIWA 2ZM6M 3U6DA 4NXMM 2RRUA 3HJSA 2UXCM 2L7IA 2KHHA 2JXNA 2J7NA 1N77A 1W5SA 3KOWE 2QCUA 5KQ8A 1G4AE 2K6BA 2Y21A 1PJTA 2QP9X 2VF7A 5FTKA 3CF6E 1N78A 5FTMA 3GLFE 4L16A 3SARA 4Y28F 3SAUA 2DXIA 1V92A 4YHHM 1T43A 1N32M 3HJQA 1XXHB 1L2CA 3RFWA 1IBLM 1FJGM 2H5XA 4IJFA 5ITXA 4OU7A 4AKHA 2CWBA 3THGA 2Q2EB 2M60A 1C1KA 3C58A 3GRUA 1J09A 3K8ZA 4IBKA 1R2ZA 3LVVA 3L26A 3SAVA 4R7GA 3K2LA 3CTWB 4L78A 2JWSA 4X64M 4G4NA 2XLJA 1GLNA 1JR3E 4LRSA 5KQDA 3HHWA 4MGYE 4LJ7A 3HHXA 3PNVA 4NXNM 2QBYA 2VQFM 5E6JA 2D7GA 4CIZA 4DV2M 2L7HA 4B7FA 3KFUG 5ITRA 1G8PA 1YSYA 2XSZD 4GC9A 1OAOC 4RKUF 5EQTA 3SFZA 3U6LA 1N36M 1DGGA 2ZTCA 4MH0E 4LF8M 1QVRA 4AG5A 3TPZA 4GEWA 3PFIA 4IBBA 3GRRA 3H4JA 1D2NA 4LFAM 4Z6YA 4JI7M 4MM3B 2J5YA 3SMPA 4GKJM 4XK8F 4D81A 1WGNA 4GITA 1JQJC 4OX9M 2QHOB 4FWDA 3QYEA 3ZQJA 4LFBM 2LVOC 2VIIA 3B9PA 1HT1E 1ZMVA 4DR4M 1R4GA 3RGPA 3J81S 2HCBA 1FNNA 3HJ8A 1XC8A 2D7EA 4FCVA 3J7BA 1Q3CA 1IQPA 4UN2B 3GPYA 2GQFA 4M0DA 3UZUA 2DZLA 2KRKA 3KP0E 3NBXX 5FSWA 2X49A 3MK6A 1QAMA 4DR7M 3J80S 2I7PA 2MJ5B 2JA2A 1QZEA 2KDLA 4LG2A 3SMSA 3VKHA 1IN8A 5C1BA 1BVSA 1TTEA 4W5WA 1GL6A 4PD2A 1N75A 2KNVA 4PDIA 1QUTA 2VF8A 4K0KM 2F5QA 1NJFA 2CHVA 4BLCA 4R3DA 3WHKA 4OVZA 3FYCA 1TGUA 4M9ZA 3HX3A 2R4JA 1R5LA 4LRTA 2DAKA 4MGZE 3HU1A 3U6QA 2DI0A 1OTRA 3C3DA 3W0FA 3DA1A 1WIVA 2L4EA 4LJ6A 2KNAA 1VEKA 2Z7JA 5EJCA 4GMQA 4LF5M 4DV6M 1OIZA 2BNKA 3D8LA 5FLXS 4PCZA 2DZOB 3LMMA 4AKGA 3K92A 3MHVC 1NO1A 1NV9A 5C18A 2OOBA 3GLHA 3V76A 1Z59A 4HLQA 1HQCA 3LQQA 1XHBA 4QHTA 2C96A 5IWAM 1K3WA 4L15A 1DV0A 2LHCA 2KW0A 1HJPA 2CRUA 2LXEA 3LQRA 4IBEA 4IBGA 3FTFA 1TH4A 3GLGA 3MMPA 4FCTA 4LZJA 4DV1M 4FD2A 3T15A 4R71A 1DGFA 2CEAA 1A5TA 2LWXA 2ZANA 4MGHA 3TQSA 3HZJA 5BPVA 4X66M 2YR0A 1K82A 1L2DA 2R65A 3D8BA 2APLA 1NV8A 3W0LB 1UFZA 1UM8A 3KVWA 4JI5M 1TDZA 2EUCA 3AJIB 1XNRM 2J7OA 5DYGA 1R6BX 1TDHA 3GQ4A 2Y0QA 1K3XA 1GKIA 2Z8YM 2DNAA 2B3TA 1E9RA 1XWIA 1JR3D 2EKKA 3HU3A 2UUBM 2M5ZA 4DR1M 1IXZA 1IN5A 3T6PA 4LF6M 3FTCA 2AHMA 4I81A 4JN6A 2KZSA 3FUXA 4IBJA 1QQWA 2XH9A 4QOZC 4JYAM 2VQEM 2DHYA 3UGJA 3OTOM 2ZBKB 3IG5A 1VDDA 5LMUM 2R6FA 2UUAM 1D0KA 2UXDM 2HWJA 2EJSA 4AI6A 4DUZM 2L09A 1DGBA 3KSXA 2HKJA 2DHRA 3QWLA 3FUUA 1OFHA 2CV2A 1T3TA 4B3TM 2XFSA 4GHLA 4LFCM 1GJSA 1QAQA 4LGMA 1WR1B 4F1IA 3A42A 2QBYB 1W5TA 3K9OA 4DR5M 1OJLA 1Z6TA 4DR3M 1F4IA 3PVSA 3JR5A 3SHFA 2QPAA 2JZ0A 2JUJA 2JNHA 2X8AA 1PJQA 2WZJA 3K9PA 4IJEA 4LY6A 4B7HA 4FCWA 2DAGA 1KFVA 4HL4A 2Z4SA 3KOZE 2BWBA 1KSFX 1VQ1A 4CHTB 5IZ7D 1PJJA 4AQYM 1TR8A 3VKGA 2R18A 3U6SA 1XB2B 1IXSA 3L28A 1Q39A 2F5SA 3GLGE 4JI0M 3BOSA 4S12A 1V34A 2FFJA 1Z5BA 3GLFB 3VK7A 3LCUA 5KPTA 4LJAA 2L6OA 1OKSA 3GLHB 2LVPC 1R7RA 5GKNA 2RGHA 3FYDA 3KOXE 2JY6B 3U6CA 1XNQM 5H37D 2FOIC 3U6PA 4REZA 4MGIE 1NNUC 3LVWA 1SXJE 4KT0F 3IG8A 1VEJA 2C5RA 3ZC7B 2QSFX 5EXXA 4JXJA 1G59A 3J7AS 5ITXE 1SG9A 2WSFF 3C9PA 2W82A 4I5SA 1XMOM 1TH3A 3SC3A 1HT2E 5EXSA 3T1YM 1QZMA 5FTLA 1EE8A 3FUVA 2H1RA 1ZQ9A 2G5GX 4KHPM 1IXSB 2LH0A 1NY5A 2K47A 1ZV1A 4GH9A 4NC6A 4ANRA 3GLIA 5ITQA 1PJIA 4TUWA 4G4RA 4ITQA 3CGWA 2CP8A 4QHSA 2EA0A 2Z3XA 7CATA 3HY5A 1WHCA 1ZMUA 1PJSA 1SXJD 4G3OA 1IM2A 4LJ4A 4LZZA 3I04M 1NY6A 4PT5A 3GRYA 1ORYB 1G3IA 4NSRA 4AW4A 4IBIA 5LMNM 4DUYM 3LCVB 2I7NA 4JI4M 3FTEA 3E9SA 3SASA 1NHGC 3FRIA 1PM5A 4M0WA 3U60A 3DZDA 1HNZM 2QNJA 2KA6B 3ZCBB 3ZH9B 5EP3A 1E9SA 5ITUA 3SBJA 4A3VB 1J5EM 2F5NA 4MB7A 2LBCA 3WHLA 3B7NA 2DAEA 4XGIA 3M6AA 2O25A 2KNZA 2KEBA 1Y8GA 5FTNA 4JV5M 1IY0A 2A5YB 3E46A 4FWHA 4QNRA 3DFZA 4DR2M 2DVWB 4D82A 2WSEF 4MGKE 3JAMS 5IT9S 3GQ3A 2CUZA 5KPZA 2E5LM 2XZUA 1VDLA 5L8RF 2L4FA 4HEOA 2CHGA 3MJ5A 4RF0A 2G3QA 2R62A 3QAUA 2XSZA 1KYIA 2OOAA 4II7A 3TE6A 2MROB 3UJNA 1QUSA 1GJTA 2O01F 3HGIA 4NL4H 1SXJA 3FE3A 5F3WA 2R44A 1YUBA 2R45A 1Q02A 2MH8A 1HR0M 1IXRC 1C7YA 2K0BX 2HAKA 4I8OA 3RE8A 1IFYA 1E32A 3U6OA 4JI3M 2LNHC 3TL4X 4M9XA 2EKFA 4D80A 3GLHE 2XF3A 4JI6M 1L8QA 2LVQD 2LTUA 2Z4RA 1N34M 4JI8M 3VDPA 2CV1A 3GLFA 2ZAMA 2C98A 4KODA 3SYKA 3GLGB 1XMQM 1WGLA 4DV3M 1GL7A 1S3SA 1TF0B 2HL7A 4IBDA 3E21A 3GPPA 4WW0A 2WSCF 4KLNA 2O5RA 3DOAA 5KPRA 2R4EA 3HKPA 3T1HM 2D7HA 2MGWA 3FUWA 1R2YA 1OFIA 2ZTDA 4Z8XA 1SXJC 1J7KA 4P17A 2LHGA 4IBFA 1JR3A 5IREB 3SHGB 1PGYA 1ZAEA 2DENA 3LW5F 4X62M 2JY5A 1T6OA 1QDTA 2DWMA 4OVZB 4NOOB 1QAOA 4NRVA 3GP1A 3L29A 4L8RC 1RU3A 5FTJA 3GLIB 3TWLA 2YFQA 2JY8A 4DV5M 3F92A 4GHAA 1YE9A 2DAIA 3B7ZA 4WURA 4PDGA 1NNJA 1D0LA 2XZFA 3SATA 4BBAA 3UMMA 3B74A 2CE7A 1DGHA 3AOEC 4G4QA 2OPFA 1E94E 2FNAA 1WXQA 3KSJA 3H4MA 3W68A 4DBGB 1QYRA 3GPUA 2ZAOA 1IY2A 5EXPA 3EIHA 2FS1A 1AIPC 5BR8M 3VK8A 4B3MM 1H6UA 1OQYA 4LF4M 2DZNB 2JY7A 1IN7A 1I94M 4LJ9A 2L2DA 3CF0A 4QNMA 2V1CA 2YNMD 3AV0A 4L6V6 3FKEA 4AZFA 3U61A 4DR6M 4FWGA 2XGNA 4G4OA 2UU9M 1GO5A 1OAIA 2EO2A 5A2QS 3T38A 3TWMA 4CGYB 2DWLA 4DV7M 4GC5A 3FD9A 1MN3A 3U6EA 2X4AA 1DO0A 1HQYE
chains in the Genus database with same CATH topology
1X37A 2F4VM 1I4WA 1IN4A 5EP1A 3GPXA 1Q3BA 3L27A 2HHHM 4LF7M 4GIPA 2C9OA 3VDUA 4G6ZA 3VFDA 3AOEA 3M7GA 1HNWM 3GRVA 2QENA 4B7GA 3SAWA 2KRUA 2OQ4A 4B3RM 4LGYA 4DV4M 4OW0A 3KS8A 4P16A 3U5ZA 3L2AA 3UK6A 5E26A 4IIWA 2NQ8C 4FW9A 3HU2A 3U6MA 5DNYA 4B08A 5ITTA 3JR4A 5KO3A 2CHQA 3R8FA 2DWNA 4RNAA 1GVNA 2RGOA 3A98B 2V1UA 2F5PA 4CISA 4GKKM 3K1JA 4NRWA 1LV7A 1NVMA 8CATA 2G8LA 5EP4A 5JI3E 1L1TA 2XEPA 3FTDA 3AL0C 3RGSA 3R9XB 3PNYA 3SYLA 3AFHA 3A46A 3KDSE 2XFTA 1QANA 3NBIA 3EIEA 2CV0A 1N33M 1G41A 3E4RA 1L2BA 2C9CA 3M0EA 4B3SM 2DWZB 2CFOA 4LCBA 4IBCA 3L25A 2KXEA 1NHWC 4JI1M 4FVMA 1NSFA 3CF2A 3U5ZB 3I4VA 3J27B 1HNXM 3ILKA 1L1ZA 2V6ZM 4LJ8A 4ZPXA 1NJGA 3J2PB 4NSOB 1Z5AA 2F5OA 3TWKA 1XXHA 1TH2A 2UXBM 4KO8A 2R46A 4GRIA 5JI2E 3AOGA 3KP1E 4X65M 3HHZA 4DV0M 1IN6A 1DGHB 2BJVA 4AKIA 1Z5CA 2P5TA 2Y0TA 5EXTA 1IBMM 4XBOA 4M9SA 4LF9M 3FUTA 2RKOA 4BB9A 2C99A 2YQZA 1DO2A 3I4YA 5EP2A 3HHYA 4L4UA 3GO8A 3I51A 3AKZA 5ITYA 3NWLA 2ERCA 2FE8A 1MX0A 2UUCM 3KXEC 4I4LA 4LJ5A 3U61B 3GQ5A 2QZ4A 3PXGA 4QOSA 4YY3M 4JI2M 2Y20A 2BJWA 3A45A 1SXJB 3Q8XA 5DYIA 1IBKM 3KW6A 3VLFB 3KS4A 1MU5A 2KZUA 4RF1A 3HWSA 3KOYE 4EIWA 2ZM6M 3U60B 1IY1A 4AG6A 3U6DA 4NXMM 3HJSA 2UXCM 2L7IA 2J7NA 1N77A 1W5SA 3KOWE 2QCUA 5KQ8A 1G4AE 2Y21A 1N78A 2QP9X 5FTKA 3CF6E 5FTMA 3SARA 4L16A 3SAUA 2DXIA 4YHHM 1N32M 3HJQA 1XXHB 1L2CA 3RFWA 1IBLM 1FJGM 4IJFA 5ITXA 4OU7A 4AKHA 3THGA 2Q2EB 2M60A 1C1KA 3C58A 3GRUA 1J09A 3K8ZA 4IBKA 1R2ZA 3LVVA 3L26A 3SAVA 4R7GA 3K2LA 3CTWB 4L78A 4G4NA 4X64M 2XLJA 1GLNA 4LRSA 5KQDA 3HHWA 4MGYE 4LJ7A 3HHXA 3PNVA 4NXNM 2QBYA 2VQFM 5E6JA 2D7GA 3KFUG 4DV2M 2L7HA 4B7FA 5ITRA 4GC9A 1G8PA 1YSYA 2XSZD 3U6LA 1N36M 5EQTA 3SFZA 4LF8M 1DGGA 4MH0E 1QVRA 4AG5A 3TPZA 3PFIA 4IBBA 3GRRA 4LFAM 1D2NA 4Z6YA 4JI7M 4MM3B 3SMPA 4GKJM 4D81A 4GITA 1JQJC 4OX9M 4FWDA 4LFBM 2VIIA 3B9PA 1HT1E 4DR4M 3RGPA 3J81S 2HCBA 1FNNA 3HJ8A 1XC8A 2D7EA 4FCVA 3J7BA 1Q3CA 1IQPA 3GPYA 4M0DA 3UZUA 2KRKA 3KP0E 5FSWA 2X49A 3MK6A 1QAMA 4DR7M 3J80S 2I7PA 2JA2A 4LG2A 3SMSA 3VKHA 1IN8A 5C1BA 4W5WA 1GL6A 4PD2A 1N75A 4PDIA 4K0KM 2F5QA 1NJFA 2CHVA 4BLCA 4R3DA 3WHKA 4OVZA 3FYCA 1TGUA 4M9ZA 2R4JA 4LRTA 4MGZE 3HU1A 3U6QA 3W0FA 3DA1A 4LJ6A 2Z7JA 5EJCA 4GMQA 4LF5M 4DV6M 2BNKA 3D8LA 5FLXS 4PCZA 2DZOB 3LMMA 4AKGA 3MHVC 3K92A 5C18A 3GLHA 1Z59A 4HLQA 1HQCA 3LQQA 1XHBA 4QHTA 2C96A 5IWAM 1K3WA 4L15A 2LXEA 2KW0A 4IBEA 3LQRA 3FTFA 4IBGA 1TH4A 3GLGA 4FCTA 4DV1M 4LZJA 4FD2A 3T15A 1DGFA 2CEAA 2LWXA 2ZANA 4MGHA 3TQSA 5BPVA 4X66M 2YR0A 1K82A 1L2DA 2R65A 3D8BA 3W0LB 4JI5M 3KVWA 1UM8A 1TDZA 2EUCA 3AJIB 1XNRM 2J7OA 5DYGA 1R6BX 1TDHA 3GQ4A 2Y0QA 1K3XA 1GKIA 1E9RA 1XWIA 1JR3D 3HU3A 2UUBM 2M5ZA 4DR1M 1IXZA 1IN5A 4LF6M 3FTCA 2AHMA 4I81A 4JN6A 2KZSA 3FUXA 4IBJA 1QQWA 2XH9A 4QOZC 4JYAM 2VQEM 5LMUM 3UGJA 3OTOM 2ZBKB 3IG5A 1VDDA 2UUAM 2UXDM 4AI6A 4DUZM 2L09A 1DGBA 3KSXA 2HKJA 2DHRA 3QWLA 3FUUA 1OFHA 2CV2A 1T3TA 4B3TM 2XFSA 4GHLA 4LFCM 1QAQA 4LGMA 2QBYB 3A42A 1W5TA 4DR5M 1OJLA 1Z6TA 4DR3M 3PVSA 3JR5A 3SHFA 2QPAA 2X8AA 4IJEA 4LY6A 4B7HA 4FCWA 1KFVA 4HL4A 2Z4SA 3KOZE 1KSFX 4CHTB 5IZ7D 1PJJA 4AQYM 3VKGA 2R18A 3U6SA 3L28A 1Q39A 2F5SA 4JI0M 3BOSA 4S12A 2FFJA 1Z5BA 3GLFB 3VK7A 5KPTA 4LJAA 2L6OA 3GLHB 1R7RA 5GKNA 2RGHA 3FYDA 3KOXE 3U6CA 1XNQM 5H37D 2FOIC 3U6PA 4REZA 4MGIE 1NNUC 3LVWA 1SXJE 3IG8A 2C5RA 3ZC7B 5EXXA 4JXJA 1G59A 3J7AS 5ITXE 2W82A 4I5SA 1XMOM 1TH3A 3SC3A 1HT2E 5EXSA 3T1YM 1QZMA 5FTLA 1EE8A 3FUVA 2H1RA 1ZQ9A 2G5GX 4KHPM 1IXSB 1NY5A 4GH9A 2K47A 2LH0A 1PJIA 4TUWA 3GLIA 5ITQA 4G4RA 4ITQA 4QHSA 2EA0A 2Z3XA 7CATA 1SXJD 4LZZA 1IM2A 4LJ4A 4PT5A 1NY6A 3GRYA 1ORYB 1G3IA 4NSRA 4AW4A 4IBIA 5LMNM 4DUYM 4JI4M 2I7NA 3FTEA 3E9SA 3SASA 1NHGC 1PM5A 4M0WA 3U60A 3DZDA 1HNZM 2KA6B 3ZCBB 3ZH9B 5EP3A 1E9SA 5ITUA 3SBJA 4A3VB 1J5EM 2F5NA 4MB7A 3WHLA 4XGIA 3M6AA 2KEBA 5FTNA 4JV5M 1IY0A 2A5YB 4FWHA 4QNRA 3DFZA 4DR2M 2DVWB 4D82A 4MGKE 3JAMS 5IT9S 3GQ3A 2CUZA 5KPZA 2E5LM 2XZUA 2CHGA 3MJ5A 4RF0A 2R62A 3QAUA 4II7A 2XSZA 1KYIA 3TE6A 3UJNA 3HGIA 4NL4H 1SXJA 5F3WA 1YUBA 2R45A 1HR0M 1IXRC 4I8OA 3RE8A 1E32A 3U6OA 4JI3M 2LNHC 3TL4X 4M9XA 4D80A 4JI6M 2XF3A 1L8QA 2Z4RA 1N34M 4JI8M 3VDPA 2CV1A 3GLFA 2ZAMA 2C98A 4KODA 3SYKA 3GLGB 1XMQM 4DV3M 1GL7A 1S3SA 4IBDA 2HL7A 3GPPA 4WW0A 4KLNA 2O5RA 3DOAA 5KPRA 2R4EA 3HKPA 3T1HM 2D7HA 3FUWA 1R2YA 1OFIA 4Z8XA 1SXJC 1J7KA 4IBFA 1JR3A 5IREB 3SHGB 1ZAEA 4X62M 2DWMA 4OVZB 4NOOB 1QAOA 4NRVA 3GP1A 3L29A 4L8RC 5FTJA 3GLIB 3TWLA 2YFQA 4DV5M 4GHAA 1YE9A 4WURA 4PDGA 1NNJA 2XZFA 3SATA 4BBAA 3UMMA 2CE7A 1DGHA 3AOEC 4G4QA 2OPFA 1E94E 2FNAA 1WXQA 3KSJA 3H4MA 1QYRA 3GPUA 2ZAOA 1IY2A 5EXPA 3EIHA 5BR8M 3VK8A 4B3MM 1H6UA 4LF4M 2DZNB 1I94M 1IN7A 4LJ9A 3CF0A 4QNMA 2V1CA 2YNMD 3AV0A 3U61A 3FKEA 4AZFA 4DR6M 4FWGA 2XGNA 4G4OA 2UU9M 2EO2A 5A2QS 3T38A 3TWMA 4CGYB 2DWLA 4DV7M 4GC5A 3FD9A 3U6EA 2X4AA 1DO0A 1HQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH M;  1XNR M;  2F4V M;  1N32 M;  1TDH A;  3GPX A;  1Q3B A;  3GQ4 A;  2HHH M;  4LF7 M;  1L2C A;  1K3X A;  4JV5 M;  1IBL M;  1FJG M;  1HNW M;  4DR2 M;  5ITX A;  2UUB M;  4DR1 M;  3SAW A;  2OQ4 A;  3JAM S;  2Q2E B;  4LF6 M;  4B3R M;  4DV4 M;  5IT9 S;  3C58 A;  3GQ3 A;  1R2Z A;  3SAV A;  4JYA M;  2E5L M;  2VQE M;  4X64 M;  3OTO M;  5LMU M;  2ZBK B;  4G4N A;  3U6M A;  2XZU A;  2UUA M;  2UXD M;  5ITT A;  4NXN M;  3JR4 A;  4DUZ M;  2VQF M;  4DV2 M;  2F5P A;  4CIS A;  2HKJ A;  5ITR A;  4B3T M;  4GKK M;  3U6L A;  1N36 M;  4NRW A;  4LF8 M;  4LFC M;  4JI7 M;  4LFA M;  3A42 A;  1L1T A;  4GKJ M;  1HR0 M;  4DR5 M;  4DR3 M;  3JR5 A;  4OX9 M;  3U6O A;  4JI3 M;  4LFB M;  1KFV A;  3A46 A;  4JI6 M;  4DR4 M;  1N34 M;  4JI8 M;  3J81 S;  1XC8 A;  1PJJ A;  3GPY A;  4AQY M;  1N33 M;  1Q3C A;  1L2B A;  1XMQ M;  4B3S M;  3U6S A;  4DV3 M;  1Q39 A;  2F5S A;  4JI0 M;  3GPP A;  4JI1 M;  3DOA A;  4DR7 M;  1Z5B A;  3J80 S;  3VK7 A;  1HNX M;  1L1Z A;  3T1H M;  1R2Y A;  1Z5A A;  4PD2 A;  3U6C A;  1XNQ M;  2F5O A;  3TWK A;  3U6P A;  4PDI A;  2UXB M;  4K0K M;  4X65 M;  2F5Q A;  4DV0 M;  1Z5C A;  1IBM M;  3J7A S;  5ITX E;  4X62 M;  4LF9 M;  3U6Q A;  3W0F A;  4NRV A;  3GP1 A;  3TWL A;  4DV5 M;  1XMO M;  4PDG A;  4LF5 M;  1NNJ A;  3GO8 A;  3T1Y M;  2XZF A;  4DV6 M;  5ITY A;  3SAT A;  1EE8 A;  5FLX S;  4KHP M;  4PCZ A;  1PJI A;  1MX0 A;  4G4Q A;  2OPF A;  2UUC M;  5ITQ A;  4G4R A;  4ITQ A;  2EA0 A;  1Z59 A;  3GQ5 A;  3GPU A;  4YY3 M;  4JI2 M;  3A45 A;  5IWA M;  5BR8 M;  3VK8 A;  1K3W A;  1IBK M;  4B3M M;  4LF4 M;  1MU5 A;  5LMN M;  1I94 M;  2ZM6 M;  4DUY M;  4JI4 M;  4DV1 M;  3U6D A;  4NXM M;  3SAS A;  1PM5 A;  4DR6 M;  2UXC M;  4G4O A;  1HNZ M;  2UU9 M;  4X66 M;  1K82 A;  3SBJ A;  5ITU A;  5A2Q S;  3TWM A;  1L2D A;  1J5E M;  4DV7 M;  3SAR A;  2F5N A;  4MB7 A;  3U6E A;  4JI5 M;  3SAU A;  1TDZ A; 
#chains in the Genus database with same CATH topology
 1X37 A;  1D0M A;  2F4V M;  1JB0 F;  1CUK A;  1I4W A;  1V33 A;  1IN4 A;  5EP1 A;  3GPX A;  1Q3B A;  3L27 A;  2JZ1 A;  2HHH M;  4GIP A;  2C9O A;  4LF7 M;  3VDU A;  4G6Z A;  3VFD A;  3AOE A;  3M7G A;  1HNW M;  3GRV A;  2QEN A;  4B7G A;  3C3E A;  3SAW A;  2KRU A;  2N35 A;  2OQ4 A;  4B3R M;  4LGY A;  4DV4 M;  4OW0 A;  3KS8 A;  4P16 A;  1PRB A;  3U5Z A;  3L2A A;  3UK6 A;  5E26 A;  4IIW A;  2NQ8 C;  4FW9 A;  3HU2 A;  3U6M A;  5DNY A;  4B08 A;  5ITT A;  3JR4 A;  5KO3 A;  2CHQ A;  3R8F A;  2DWN A;  4RNA A;  1GVN A;  2RGO A;  3A98 B;  2V1U A;  2F5P A;  3IHP A;  1XXH E;  3K1J A;  4CIS A;  4GKK M;  4NRW A;  1LV7 A;  1NVM A;  8CAT A;  1WJ7 A;  2G8L A;  5EP4 A;  5JI3 E;  3W67 A;  1ZMW A;  2BWE A;  1L1T A;  2XEP A;  3FTD A;  3U60 B;  3AL0 C;  3RGS A;  3R9X B;  3PNY A;  1OIP A;  3SYL A;  3AFH A;  3GLI E;  3A46 A;  3KDS E;  2XFT A;  1QAN A;  3NBI A;  3EIE A;  1MJG M;  2CV0 A;  4Q7J A;  1N33 M;  1G41 A;  3E4R A;  1L2B A;  2DAM A;  2C9C A;  3M0E A;  4F2L A;  4B3S M;  2DWZ B;  2CFO A;  4LCB A;  4IBC A;  3L25 A;  2KXE A;  1NHW C;  4JI1 M;  1GAB A;  2VDB B;  1NSF A;  3CF2 A;  4FVM A;  3U5Z B;  1VEG A;  3B89 A;  3I4V A;  3J27 B;  1G71 A;  1HNX M;  3ILK A;  3Q8G A;  1L1Z A;  2V6Z M;  1IBK M;  4LJ8 A;  3BBZ A;  4ZPX A;  1NJG A;  3I01 M;  3J2P B;  4NSO B;  1Z5A A;  1LTM A;  2F5O A;  3TWK A;  2FH0 A;  2DKL A;  1XXH A;  1TH2 A;  2UXB M;  1AUA A;  4KO8 A;  2R46 A;  4GRI A;  5JI2 E;  3AOG A;  3KP1 E;  4X65 M;  3HHZ A;  4DV0 M;  1IN6 A;  1DGH B;  2BJV A;  4AKI A;  1P3Q Q;  1Z5C A;  2P5T A;  2Y0T A;  5EXT A;  4CJ6 A;  4XBO A;  4M9S A;  1IBM M;  4LF9 M;  3FUT A;  2RKO A;  4BB9 A;  2C99 A;  2YQZ A;  2GNO A;  3B7Q A;  1DO2 A;  4WP2 A;  2R0I A;  3I4Y A;  5EP2 A;  4L4U A;  3HHY A;  3FRH A;  3GO8 A;  3I51 A;  3AKZ A;  5ITY A;  3NWL A;  2ERC A;  1EIJ A;  2FE8 A;  1MX0 A;  3IEC A;  2UUC M;  3KXE C;  1EFU B;  2JP7 A;  4I4L A;  4LJ5 A;  2LVN C;  2MR9 A;  3GQ5 A;  2OO9 A;  5DFL A;  2QZ4 A;  3PXG A;  4QOS A;  3BXW A;  4YY3 M;  3U61 B;  4JI2 M;  2Y20 A;  2BJW A;  1YLA A;  1SXJ B;  3A45 A;  2K9D A;  1VG5 A;  3KW6 A;  3Q8X A;  1QDR A;  3QYB A;  3KS4 A;  3VLF B;  1MU5 A;  2KZU A;  2LVA A;  3HWS A;  3KOY E;  4RF1 A;  2QQ8 A;  5DYI A;  1IY1 A;  4AG6 A;  4EIW A;  2ZM6 M;  3U6D A;  4NXM M;  2RRU A;  3HJS A;  2UXC M;  2L7I A;  2KHH A;  2JXN A;  2J7N A;  1N77 A;  1W5S A;  3KOW E;  2QCU A;  5KQ8 A;  1G4A E;  2K6B A;  2Y21 A;  1PJT A;  2QP9 X;  2VF7 A;  5FTK A;  3CF6 E;  1N78 A;  5FTM A;  3GLF E;  4L16 A;  3SAR A;  4Y28 F;  3SAU A;  2DXI A;  1V92 A;  4YHH M;  1T43 A;  1N32 M;  3HJQ A;  1XXH B;  1L2C A;  3RFW A;  1IBL M;  1FJG M;  2H5X A;  4IJF A;  5ITX A;  4OU7 A;  4AKH A;  2CWB A;  3THG A;  2Q2E B;  2M60 A;  1C1K A;  3C58 A;  3GRU A;  1J09 A;  3K8Z A;  4IBK A;  1R2Z A;  3LVV A;  3L26 A;  3SAV A;  4R7G A;  3K2L A;  3CTW B;  4L78 A;  2JWS A;  4X64 M;  4G4N A;  2XLJ A;  1GLN A;  1JR3 E;  4LRS A;  5KQD A;  3HHW A;  4MGY E;  4LJ7 A;  3HHX A;  3PNV A;  4NXN M;  2QBY A;  2VQF M;  5E6J A;  2D7G A;  4CIZ A;  4DV2 M;  2L7H A;  4B7F A;  3KFU G;  5ITR A;  1G8P A;  1YSY A;  2XSZ D;  4GC9 A;  1OAO C;  4RKU F;  5EQT A;  3SFZ A;  3U6L A;  1N36 M;  1DGG A;  2ZTC A;  4MH0 E;  4LF8 M;  1QVR A;  4AG5 A;  3TPZ A;  4GEW A;  3PFI A;  4IBB A;  3GRR A;  3H4J A;  1D2N A;  4LFA M;  4Z6Y A;  4JI7 M;  4MM3 B;  2J5Y A;  3SMP A;  4GKJ M;  4XK8 F;  4D81 A;  1WGN A;  4GIT A;  1JQJ C;  4OX9 M;  2QHO B;  4FWD A;  3QYE A;  3ZQJ A;  4LFB M;  2LVO C;  2VII A;  3B9P A;  1HT1 E;  1ZMV A;  4DR4 M;  1R4G A;  3RGP A;  3J81 S;  2HCB A;  1FNN A;  3HJ8 A;  1XC8 A;  2D7E A;  4FCV A;  3J7B A;  1Q3C A;  1IQP A;  4UN2 B;  3GPY A;  2GQF A;  4M0D A;  3UZU A;  2DZL A;  2KRK A;  3KP0 E;  3NBX X;  5FSW A;  2X49 A;  3MK6 A;  1QAM A;  4DR7 M;  3J80 S;  2I7P A;  2MJ5 B;  2JA2 A;  1QZE A;  2KDL A;  4LG2 A;  3SMS A;  3VKH A;  1IN8 A;  5C1B A;  1BVS A;  1TTE A;  4W5W A;  1GL6 A;  4PD2 A;  1N75 A;  2KNV A;  4PDI A;  1QUT A;  2VF8 A;  4K0K M;  2F5Q A;  1NJF A;  2CHV A;  4BLC A;  4R3D A;  3WHK A;  4OVZ A;  3FYC A;  1TGU A;  4M9Z A;  3HX3 A;  2R4J A;  1R5L A;  4LRT A;  2DAK A;  4MGZ E;  3HU1 A;  3U6Q A;  2DI0 A;  1OTR A;  3C3D A;  3W0F A;  3DA1 A;  1WIV A;  2L4E A;  4LJ6 A;  2KNA A;  1VEK A;  2Z7J A;  5EJC A;  4GMQ A;  4LF5 M;  4DV6 M;  1OIZ A;  2BNK A;  3D8L A;  5FLX S;  4PCZ A;  2DZO B;  3LMM A;  4AKG A;  3K92 A;  3MHV C;  1NO1 A;  1NV9 A;  5C18 A;  2OOB A;  3GLH A;  3V76 A;  1Z59 A;  4HLQ A;  1HQC A;  3LQQ A;  1XHB A;  4QHT A;  2C96 A;  5IWA M;  1K3W A;  4L15 A;  1DV0 A;  2LHC A;  2KW0 A;  1HJP A;  2CRU A;  2LXE A;  3LQR A;  4IBE A;  4IBG A;  3FTF A;  1TH4 A;  3GLG A;  3MMP A;  4FCT A;  4LZJ A;  4DV1 M;  4FD2 A;  3T15 A;  4R71 A;  1DGF A;  2CEA A;  1A5T A;  2LWX A;  2ZAN A;  4MGH A;  3TQS A;  3HZJ A;  5BPV A;  4X66 M;  2YR0 A;  1K82 A;  1L2D A;  2R65 A;  3D8B A;  2APL A;  1NV8 A;  3W0L B;  1UFZ A;  1UM8 A;  3KVW A;  4JI5 M;  1TDZ A;  2EUC A;  3AJI B;  1XNR M;  2J7O A;  5DYG A;  1R6B X;  1TDH A;  3GQ4 A;  2Y0Q A;  1K3X A;  1GKI A;  2Z8Y M;  2DNA A;  2B3T A;  1E9R A;  1XWI A;  1JR3 D;  2EKK A;  3HU3 A;  2UUB M;  2M5Z A;  4DR1 M;  1IXZ A;  1IN5 A;  3T6P A;  4LF6 M;  3FTC A;  2AHM A;  4I81 A;  4JN6 A;  2KZS A;  3FUX A;  4IBJ A;  1QQW A;  2XH9 A;  4QOZ C;  4JYA M;  2VQE M;  2DHY A;  3UGJ A;  3OTO M;  2ZBK B;  3IG5 A;  1VDD A;  5LMU M;  2R6F A;  2UUA M;  1D0K A;  2UXD M;  2HWJ A;  2EJS A;  4AI6 A;  4DUZ M;  2L09 A;  1DGB A;  3KSX A;  2HKJ A;  2DHR A;  3QWL A;  3FUU A;  1OFH A;  2CV2 A;  1T3T A;  4B3T M;  2XFS A;  4GHL A;  4LFC M;  1GJS A;  1QAQ A;  4LGM A;  1WR1 B;  4F1I A;  3A42 A;  2QBY B;  1W5T A;  3K9O A;  4DR5 M;  1OJL A;  1Z6T A;  4DR3 M;  1F4I A;  3PVS A;  3JR5 A;  3SHF A;  2QPA A;  2JZ0 A;  2JUJ A;  2JNH A;  2X8A A;  1PJQ A;  2WZJ A;  3K9P A;  4IJE A;  4LY6 A;  4B7H A;  4FCW A;  2DAG A;  1KFV A;  4HL4 A;  2Z4S A;  3KOZ E;  2BWB A;  1KSF X;  1VQ1 A;  4CHT B;  5IZ7 D;  1PJJ A;  4AQY M;  1TR8 A;  3VKG A;  2R18 A;  3U6S A;  1XB2 B;  1IXS A;  3L28 A;  1Q39 A;  2F5S A;  3GLG E;  4JI0 M;  3BOS A;  4S12 A;  1V34 A;  2FFJ A;  1Z5B A;  3GLF B;  3VK7 A;  3LCU A;  5KPT A;  4LJA A;  2L6O A;  1OKS A;  3GLH B;  2LVP C;  1R7R A;  5GKN A;  2RGH A;  3FYD A;  3KOX E;  2JY6 B;  3U6C A;  1XNQ M;  5H37 D;  2FOI C;  3U6P A;  4REZ A;  4MGI E;  1NNU C;  3LVW A;  1SXJ E;  4KT0 F;  3IG8 A;  1VEJ A;  2C5R A;  3ZC7 B;  2QSF X;  5EXX A;  4JXJ A;  1G59 A;  3J7A S;  5ITX E;  1SG9 A;  2WSF F;  3C9P A;  2W82 A;  4I5S A;  1XMO M;  1TH3 A;  3SC3 A;  1HT2 E;  5EXS A;  3T1Y M;  1QZM A;  5FTL A;  1EE8 A;  3FUV A;  2H1R A;  1ZQ9 A;  2G5G X;  4KHP M;  1IXS B;  2LH0 A;  1NY5 A;  2K47 A;  1ZV1 A;  4GH9 A;  4NC6 A;  4ANR A;  3GLI A;  5ITQ A;  1PJI A;  4TUW A;  4G4R A;  4ITQ A;  3CGW A;  2CP8 A;  4QHS A;  2EA0 A;  2Z3X A;  7CAT A;  3HY5 A;  1WHC A;  1ZMU A;  1PJS A;  1SXJ D;  4G3O A;  1IM2 A;  4LJ4 A;  4LZZ A;  3I04 M;  1NY6 A;  4PT5 A;  3GRY A;  1ORY B;  1G3I A;  4NSR A;  4AW4 A;  4IBI A;  5LMN M;  4DUY M;  3LCV B;  2I7N A;  4JI4 M;  3FTE A;  3E9S A;  3SAS A;  1NHG C;  3FRI A;  1PM5 A;  4M0W A;  3U60 A;  3DZD A;  1HNZ M;  2QNJ A;  2KA6 B;  3ZCB B;  3ZH9 B;  5EP3 A;  1E9S A;  5ITU A;  3SBJ A;  4A3V B;  1J5E M;  2F5N A;  4MB7 A;  2LBC A;  3WHL A;  3B7N A;  2DAE A;  4XGI A;  3M6A A;  2O25 A;  2KNZ A;  2KEB A;  1Y8G A;  5FTN A;  4JV5 M;  1IY0 A;  2A5Y B;  3E46 A;  4FWH A;  4QNR A;  3DFZ A;  4DR2 M;  2DVW B;  4D82 A;  2WSE F;  4MGK E;  3JAM S;  5IT9 S;  3GQ3 A;  2CUZ A;  5KPZ A;  2E5L M;  2XZU A;  1VDL A;  5L8R F;  2L4F A;  4HEO A;  2CHG A;  3MJ5 A;  4RF0 A;  2G3Q A;  2R62 A;  3QAU A;  2XSZ A;  1KYI A;  2OOA A;  4II7 A;  3TE6 A;  2MRO B;  3UJN A;  1QUS A;  1GJT A;  2O01 F;  3HGI A;  4NL4 H;  1SXJ A;  3FE3 A;  5F3W A;  2R44 A;  1YUB A;  2R45 A;  1Q02 A;  2MH8 A;  1HR0 M;  1IXR C;  1C7Y A;  2K0B X;  2HAK A;  4I8O A;  3RE8 A;  1IFY A;  1E32 A;  3U6O A;  4JI3 M;  2LNH C;  3TL4 X;  4M9X A;  2EKF A;  4D80 A;  3GLH E;  2XF3 A;  4JI6 M;  1L8Q A;  2LVQ D;  2LTU A;  2Z4R A;  1N34 M;  4JI8 M;  3VDP A;  2CV1 A;  3GLF A;  2ZAM A;  2C98 A;  4KOD A;  3SYK A;  3GLG B;  1XMQ M;  1WGL A;  4DV3 M;  1GL7 A;  1S3S A;  1TF0 B;  2HL7 A;  4IBD A;  3E21 A;  3GPP A;  4WW0 A;  2WSC F;  4KLN A;  2O5R A;  3DOA A;  5KPR A;  2R4E A;  3HKP A;  3T1H M;  2D7H A;  2MGW A;  3FUW A;  1R2Y A;  1OFI A;  2ZTD A;  4Z8X A;  1SXJ C;  1J7K A;  4P17 A;  2LHG A;  4IBF A;  1JR3 A;  5IRE B;  3SHG B;  1PGY A;  1ZAE A;  2DEN A;  3LW5 F;  4X62 M;  2JY5 A;  1T6O A;  1QDT A;  2DWM A;  4OVZ B;  4NOO B;  1QAO A;  4NRV A;  3GP1 A;  3L29 A;  4L8R C;  1RU3 A;  5FTJ A;  3GLI B;  3TWL A;  2YFQ A;  2JY8 A;  4DV5 M;  3F92 A;  4GHA A;  1YE9 A;  2DAI A;  3B7Z A;  4WUR A;  4PDG A;  1NNJ A;  1D0L A;  2XZF A;  3SAT A;  4BBA A;  3UMM A;  3B74 A;  2CE7 A;  1DGH A;  3AOE C;  4G4Q A;  2OPF A;  1E94 E;  2FNA A;  1WXQ A;  3KSJ A;  3H4M A;  3W68 A;  4DBG B;  1QYR A;  3GPU A;  2ZAO A;  1IY2 A;  5EXP A;  3EIH A;  2FS1 A;  1AIP C;  5BR8 M;  3VK8 A;  4B3M M;  1H6U A;  1OQY A;  4LF4 M;  2DZN B;  2JY7 A;  1IN7 A;  1I94 M;  4LJ9 A;  2L2D A;  3CF0 A;  4QNM A;  2V1C A;  2YNM D;  3AV0 A;  4L6V 6;  3FKE A;  4AZF A;  3U61 A;  4DR6 M;  4FWG A;  2XGN A;  4G4O A;  2UU9 M;  1GO5 A;  1OAI A;  2EO2 A;  5A2Q S;  3T38 A;  3TWM A;  4CGY B;  2DWL A;  4DV7 M;  4GC5 A;  3FD9 A;  1MN3 A;  3U6E A;  2X4A A;  1DO0 A;  1HQY E; 
#chains in the Genus database with same CATH homology
 1X37 A;  2F4V M;  1I4W A;  1IN4 A;  5EP1 A;  3GPX A;  1Q3B A;  3L27 A;  2HHH M;  4LF7 M;  4GIP A;  2C9O A;  3VDU A;  4G6Z A;  3VFD A;  3AOE A;  3M7G A;  1HNW M;  3GRV A;  2QEN A;  4B7G A;  3SAW A;  2KRU A;  2OQ4 A;  4B3R M;  4LGY A;  4DV4 M;  4OW0 A;  3KS8 A;  4P16 A;  3U5Z A;  3L2A A;  3UK6 A;  5E26 A;  4IIW A;  2NQ8 C;  4FW9 A;  3HU2 A;  3U6M A;  5DNY A;  4B08 A;  5ITT A;  3JR4 A;  5KO3 A;  2CHQ A;  3R8F A;  2DWN A;  4RNA A;  1GVN A;  2RGO A;  3A98 B;  2V1U A;  2F5P A;  4CIS A;  4GKK M;  3K1J A;  4NRW A;  1LV7 A;  1NVM A;  8CAT A;  2G8L A;  5EP4 A;  5JI3 E;  1L1T A;  2XEP A;  3FTD A;  3AL0 C;  3RGS A;  3R9X B;  3PNY A;  3SYL A;  3AFH A;  3A46 A;  3KDS E;  2XFT A;  1QAN A;  3NBI A;  3EIE A;  2CV0 A;  1N33 M;  1G41 A;  3E4R A;  1L2B A;  2C9C A;  3M0E A;  4B3S M;  2DWZ B;  2CFO A;  4LCB A;  4IBC A;  3L25 A;  2KXE A;  1NHW C;  4JI1 M;  4FVM A;  1NSF A;  3CF2 A;  3U5Z B;  3I4V A;  3J27 B;  1HNX M;  3ILK A;  1L1Z A;  2V6Z M;  4LJ8 A;  4ZPX A;  1NJG A;  3J2P B;  4NSO B;  1Z5A A;  2F5O A;  3TWK A;  1XXH A;  1TH2 A;  2UXB M;  4KO8 A;  2R46 A;  4GRI A;  5JI2 E;  3AOG A;  3KP1 E;  4X65 M;  3HHZ A;  4DV0 M;  1IN6 A;  1DGH B;  2BJV A;  4AKI A;  1Z5C A;  2P5T A;  2Y0T A;  5EXT A;  1IBM M;  4XBO A;  4M9S A;  4LF9 M;  3FUT A;  2RKO A;  4BB9 A;  2C99 A;  2YQZ A;  1DO2 A;  3I4Y A;  5EP2 A;  3HHY A;  4L4U A;  3GO8 A;  3I51 A;  3AKZ A;  5ITY A;  3NWL A;  2ERC A;  2FE8 A;  1MX0 A;  2UUC M;  3KXE C;  4I4L A;  4LJ5 A;  3U61 B;  3GQ5 A;  2QZ4 A;  3PXG A;  4QOS A;  4YY3 M;  4JI2 M;  2Y20 A;  2BJW A;  3A45 A;  1SXJ B;  3Q8X A;  5DYI A;  1IBK M;  3KW6 A;  3VLF B;  3KS4 A;  1MU5 A;  2KZU A;  4RF1 A;  3HWS A;  3KOY E;  4EIW A;  2ZM6 M;  3U60 B;  1IY1 A;  4AG6 A;  3U6D A;  4NXM M;  3HJS A;  2UXC M;  2L7I A;  2J7N A;  1N77 A;  1W5S A;  3KOW E;  2QCU A;  5KQ8 A;  1G4A E;  2Y21 A;  1N78 A;  2QP9 X;  5FTK A;  3CF6 E;  5FTM A;  3SAR A;  4L16 A;  3SAU A;  2DXI A;  4YHH M;  1N32 M;  3HJQ A;  1XXH B;  1L2C A;  3RFW A;  1IBL M;  1FJG M;  4IJF A;  5ITX A;  4OU7 A;  4AKH A;  3THG A;  2Q2E B;  2M60 A;  1C1K A;  3C58 A;  3GRU A;  1J09 A;  3K8Z A;  4IBK A;  1R2Z A;  3LVV A;  3L26 A;  3SAV A;  4R7G A;  3K2L A;  3CTW B;  4L78 A;  4G4N A;  4X64 M;  2XLJ A;  1GLN A;  4LRS A;  5KQD A;  3HHW A;  4MGY E;  4LJ7 A;  3HHX A;  3PNV A;  4NXN M;  2QBY A;  2VQF M;  5E6J A;  2D7G A;  3KFU G;  4DV2 M;  2L7H A;  4B7F A;  5ITR A;  4GC9 A;  1G8P A;  1YSY A;  2XSZ D;  3U6L A;  1N36 M;  5EQT A;  3SFZ A;  4LF8 M;  1DGG A;  4MH0 E;  1QVR A;  4AG5 A;  3TPZ A;  3PFI A;  4IBB A;  3GRR A;  4LFA M;  1D2N A;  4Z6Y A;  4JI7 M;  4MM3 B;  3SMP A;  4GKJ M;  4D81 A;  4GIT A;  1JQJ C;  4OX9 M;  4FWD A;  4LFB M;  2VII A;  3B9P A;  1HT1 E;  4DR4 M;  3RGP A;  3J81 S;  2HCB A;  1FNN A;  3HJ8 A;  1XC8 A;  2D7E A;  4FCV A;  3J7B A;  1Q3C A;  1IQP A;  3GPY A;  4M0D A;  3UZU A;  2KRK A;  3KP0 E;  5FSW A;  2X49 A;  3MK6 A;  1QAM A;  4DR7 M;  3J80 S;  2I7P A;  2JA2 A;  4LG2 A;  3SMS A;  3VKH A;  1IN8 A;  5C1B A;  4W5W A;  1GL6 A;  4PD2 A;  1N75 A;  4PDI A;  4K0K M;  2F5Q A;  1NJF A;  2CHV A;  4BLC A;  4R3D A;  3WHK A;  4OVZ A;  3FYC A;  1TGU A;  4M9Z A;  2R4J A;  4LRT A;  4MGZ E;  3HU1 A;  3U6Q A;  3W0F A;  3DA1 A;  4LJ6 A;  2Z7J A;  5EJC A;  4GMQ A;  4LF5 M;  4DV6 M;  2BNK A;  3D8L A;  5FLX S;  4PCZ A;  2DZO B;  3LMM A;  4AKG A;  3MHV C;  3K92 A;  5C18 A;  3GLH A;  1Z59 A;  4HLQ A;  1HQC A;  3LQQ A;  1XHB A;  4QHT A;  2C96 A;  5IWA M;  1K3W A;  4L15 A;  2LXE A;  2KW0 A;  4IBE A;  3LQR A;  3FTF A;  4IBG A;  1TH4 A;  3GLG A;  4FCT A;  4DV1 M;  4LZJ A;  4FD2 A;  3T15 A;  1DGF A;  2CEA A;  2LWX A;  2ZAN A;  4MGH A;  3TQS A;  5BPV A;  4X66 M;  2YR0 A;  1K82 A;  1L2D A;  2R65 A;  3D8B A;  3W0L B;  4JI5 M;  3KVW A;  1UM8 A;  1TDZ A;  2EUC A;  3AJI B;  1XNR M;  2J7O A;  5DYG A;  1R6B X;  1TDH A;  3GQ4 A;  2Y0Q A;  1K3X A;  1GKI A;  1E9R A;  1XWI A;  1JR3 D;  3HU3 A;  2UUB M;  2M5Z A;  4DR1 M;  1IXZ A;  1IN5 A;  4LF6 M;  3FTC A;  2AHM A;  4I81 A;  4JN6 A;  2KZS A;  3FUX A;  4IBJ A;  1QQW A;  2XH9 A;  4QOZ C;  4JYA M;  2VQE M;  5LMU M;  3UGJ A;  3OTO M;  2ZBK B;  3IG5 A;  1VDD A;  2UUA M;  2UXD M;  4AI6 A;  4DUZ M;  2L09 A;  1DGB A;  3KSX A;  2HKJ A;  2DHR A;  3QWL A;  3FUU A;  1OFH A;  2CV2 A;  1T3T A;  4B3T M;  2XFS A;  4GHL A;  4LFC M;  1QAQ A;  4LGM A;  2QBY B;  3A42 A;  1W5T A;  4DR5 M;  1OJL A;  1Z6T A;  4DR3 M;  3PVS A;  3JR5 A;  3SHF A;  2QPA A;  2X8A A;  4IJE A;  4LY6 A;  4B7H A;  4FCW A;  1KFV A;  4HL4 A;  2Z4S A;  3KOZ E;  1KSF X;  4CHT B;  5IZ7 D;  1PJJ A;  4AQY M;  3VKG A;  2R18 A;  3U6S A;  3L28 A;  1Q39 A;  2F5S A;  4JI0 M;  3BOS A;  4S12 A;  2FFJ A;  1Z5B A;  3GLF B;  3VK7 A;  5KPT A;  4LJA A;  2L6O A;  3GLH B;  1R7R A;  5GKN A;  2RGH A;  3FYD A;  3KOX E;  3U6C A;  1XNQ M;  5H37 D;  2FOI C;  3U6P A;  4REZ A;  4MGI E;  1NNU C;  3LVW A;  1SXJ E;  3IG8 A;  2C5R A;  3ZC7 B;  5EXX A;  4JXJ A;  1G59 A;  3J7A S;  5ITX E;  2W82 A;  4I5S A;  1XMO M;  1TH3 A;  3SC3 A;  1HT2 E;  5EXS A;  3T1Y M;  1QZM A;  5FTL A;  1EE8 A;  3FUV A;  2H1R A;  1ZQ9 A;  2G5G X;  4KHP M;  1IXS B;  1NY5 A;  4GH9 A;  2K47 A;  2LH0 A;  1PJI A;  4TUW A;  3GLI A;  5ITQ A;  4G4R A;  4ITQ A;  4QHS A;  2EA0 A;  2Z3X A;  7CAT A;  1SXJ D;  4LZZ A;  1IM2 A;  4LJ4 A;  4PT5 A;  1NY6 A;  3GRY A;  1ORY B;  1G3I A;  4NSR A;  4AW4 A;  4IBI A;  5LMN M;  4DUY M;  4JI4 M;  2I7N A;  3FTE A;  3E9S A;  3SAS A;  1NHG C;  1PM5 A;  4M0W A;  3U60 A;  3DZD A;  1HNZ M;  2KA6 B;  3ZCB B;  3ZH9 B;  5EP3 A;  1E9S A;  5ITU A;  3SBJ A;  4A3V B;  1J5E M;  2F5N A;  4MB7 A;  3WHL A;  4XGI A;  3M6A A;  2KEB A;  5FTN A;  4JV5 M;  1IY0 A;  2A5Y B;  4FWH A;  4QNR A;  3DFZ A;  4DR2 M;  2DVW B;  4D82 A;  4MGK E;  3JAM S;  5IT9 S;  3GQ3 A;  2CUZ A;  5KPZ A;  2E5L M;  2XZU A;  2CHG A;  3MJ5 A;  4RF0 A;  2R62 A;  3QAU A;  4II7 A;  2XSZ A;  1KYI A;  3TE6 A;  3UJN A;  3HGI A;  4NL4 H;  1SXJ A;  5F3W A;  1YUB A;  2R45 A;  1HR0 M;  1IXR C;  4I8O A;  3RE8 A;  1E32 A;  3U6O A;  4JI3 M;  2LNH C;  3TL4 X;  4M9X A;  4D80 A;  4JI6 M;  2XF3 A;  1L8Q A;  2Z4R A;  1N34 M;  4JI8 M;  3VDP A;  2CV1 A;  3GLF A;  2ZAM A;  2C98 A;  4KOD A;  3SYK A;  3GLG B;  1XMQ M;  4DV3 M;  1GL7 A;  1S3S A;  4IBD A;  2HL7 A;  3GPP A;  4WW0 A;  4KLN A;  2O5R A;  3DOA A;  5KPR A;  2R4E A;  3HKP A;  3T1H M;  2D7H A;  3FUW A;  1R2Y A;  1OFI A;  4Z8X A;  1SXJ C;  1J7K A;  4IBF A;  1JR3 A;  5IRE B;  3SHG B;  1ZAE A;  4X62 M;  2DWM A;  4OVZ B;  4NOO B;  1QAO A;  4NRV A;  3GP1 A;  3L29 A;  4L8R C;  5FTJ A;  3GLI B;  3TWL A;  2YFQ A;  4DV5 M;  4GHA A;  1YE9 A;  4WUR A;  4PDG A;  1NNJ A;  2XZF A;  3SAT A;  4BBA A;  3UMM A;  2CE7 A;  1DGH A;  3AOE C;  4G4Q A;  2OPF A;  1E94 E;  2FNA A;  1WXQ A;  3KSJ A;  3H4M A;  1QYR A;  3GPU A;  2ZAO A;  1IY2 A;  5EXP A;  3EIH A;  5BR8 M;  3VK8 A;  4B3M M;  1H6U A;  4LF4 M;  2DZN B;  1I94 M;  1IN7 A;  4LJ9 A;  3CF0 A;  4QNM A;  2V1C A;  2YNM D;  3AV0 A;  3U61 A;  3FKE A;  4AZF A;  4DR6 M;  4FWG A;  2XGN A;  4G4O A;  2UU9 M;  2EO2 A;  5A2Q S;  3T38 A;  3TWM A;  4CGY B;  2DWL A;  4DV7 M;  4GC5 A;  3FD9 A;  3U6E A;  2X4A A;  1DO0 A;  1HQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...