3W0FA

Crystal structure of mouse endonuclease viii-like 3 (mneil3)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
255
Chain Sequence
VEGPGCTLNGEKIRARVLPGQAVTGVRGTALQSLLDSGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMKGSILINPREGENSPALAVQLTRDLICFYDSSVELRNSVESQQRVRVMEELDICSPKFSFSRAESEVKKQGDRMLCDVLLDQRVLPGVGNIIKNEALFDSGLHPAVKVCQLSDKQACHLVKMTRDFSILFYRCCKAGSAISKHCKVYKRPNCDQCHSKITVCRFGENSRMTYFCPHCQKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease 8-like 3
publication title Structural Characterization of a Mouse Ortholog of Human NEIL3 with a Marked Preference for Single-Stranded DNA
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 84
structure length 255
sequence length 282
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3w0fA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3w0fA01
4DR3M 4B3SM 4PDIA 4YHHM 4JI0M 2UXBM 1MX0A 4KHPM 1IBKM 4B3RM 3VK7A 4JI3M 3GPXA 3A45A 5A2QS 2UUBM 2Q2EB 2XZUA 3GQ4A 5ITTA 4G4RA 2F5PA 3SBJA 4LF4M 4LF8M 1PJJA 3GP1A 3SAVA 4LF7M 3GQ3A 1IBMM 1HNWM 2F5OA 3DOAA 1EE8A 4DR6M 4X66M 2F4VM 3T1HM 3J7AS 1Z59A 1XC8A 4LFCM 2F5SA 3T1YM 1MU5A 3U6CA 3GPYA 4DR5M 4LF9M 4DR2M 2UXDM 3A42A 3U6MA 1L2DA 4X65M 4DV4M 4G4OA 1IBLM 3SARA 4YY3M 4B3MM 1R2ZA 2UUAM 1TDZA 5BR8M 3U6LA 4NRVA 4DUZM 3U6OA 5FLXS 1XNQM 5ITUA 2VQFM 5ITXE 1HNXM 4LF6M 2EA0A 4ITQA 1K3WA 5IT9S 3TWMA 1Q3BA 3OTOM 4DV1M 4GKJM 4JI1M 4DUYM 2HHHM 4NXMM 1R2YA 4PD2A 1N34M 3GPUA 4GKKM 3SATA 4CISA 4AQYM 2XZFA 1J5EM 1HR0M 3TWLA 2VQEM 4JYAM 1I94M 2F5NA 3J81S 2UU9M 1Q39A 1PJIA 1KFVA 3JAMS 3GQ5A 4OX9M 5LMUM 4JI6M 4X64M 4DV5M 5LMNM 4PCZA 1PM5A 3SAWA 3J80S 4DR7M 4LFBM 2UXCM 4DV3M 4JI4M 1TDHA 5ITXA 1NNJA 4G4NA 5ITYA 1L1TA 4LFAM 5ITQA 1Q3CA 3U6PA 3SAUA 4DV7M 1XMOM 4JI5M 4JV5M 4DV2M 1Z5AA 3SASA 4JI7M 4LF5M 1XMQM 1XNRM 4B3TM 2ZM6M 1L2CA 3U6QA 2OPFA 4G4QA 3A46A 3U6SA 1L1ZA 4PDGA 2E5LM 4MB7A 3C58A 1Z5CA 1N32M 4DR1M 3GPPA 5ITRA 2F5QA 4NXNM 1N33M 4DV0M 1Z5BA 1N36M 3U6DA 2UUCM 1L2BA 3JR5A 2ZBKB 3W0FA 3GO8A 1K3XA 4DV6M 4JI8M 1FJGM 5IWAM 1HNZM 4X62M 3VK8A 3TWKA 3JR4A 1K82A 2HKJA 2OQ4A 4NRWA 3U6EA 4K0KM 4JI2M 4DR4M
chains in the Genus database with same CATH superfamily
2O25A 2YQZA 3TQSA 3GLIB 2FOIC 2GQFA 3QYBA 2LVNC 5C1BA 4IBJA 1MX0A 3KSJA 5JI2E 1IBKM 2ZAOA 4B3RM 2CHGA 2LVAA 3Q8XA 3VK7A 5A2QS 4D80A 2JY5A 1OFHA 4M9ZA 1ZMUA 4IBGA 2F5PA 5FTKA 1N77A 1VG5A 3KP0E 1FNNA 4LF4M 4LF8M 3SAVA 4XK8F 3D8LA 1YLAA 2LHGA 3T38A 3T1HM 3J7AS 4P17A 5EXTA 2V1CA 4LZZA 3TL4X 1TTEA 3T1YM 3I51A 3GLHA 3U6CA 2YNMD 1F4IA 4S12A 4DR2M 4Z6YA 4GRIA 2J7NA 3GRUA 4X65M 2ZAMA 1R4GA 2VDBB 3FUVA 4NRVA 3R8FA 5ITUA 4GEWA 3L25A 5BPVA 2EA0A 5IT9S 4IBBA 4L15A 1ZMWA 1SG9A 4QHTA 3OTOM 2QP9X 3W67A 4DUYM 3HHXA 2HHHM 1R2YA 2L09A 1NJFA 1SXJE 3M6AA 3GLFE 4GKKM 8CATA 3B74A 1C7YA 3HKPA 3MMPA 3SATA 4CISA 4B08A 1G59A 2XFSA 1J5EM 4JYAM 3F92A 3B7QA 2F5NA 1SXJB 4I81A 3MK6A 2CP8A 3CF0A 3CTWB 1XB2B 7CATA 4X64M 4JI6M 1IXRC 4RNAA 2O5RA 3EIEA 3TPZA 1IN5A 5LMNM 1QDRA 3KVWA 3PVSA 2ZANA 3GLGE 4NSRA 4BBAA 1OAOC 3FE3A 4CIZA 4EIWA 3ZCBB 4FVMA 4G4NA 3HJQA 1L1TA 1DGHB 2OO9A 4M0DA 3ZH9B 1Q3CA 3U6PA 3GLGB 2C9OA 1X37A 4WURA 4AW4A 2QBYA 4IBCA 3RGSA 4DV7M 1G71A 3VKHA 2V1UA 4L4UA 5H37D 2D7GA 4NL4H 4DV2M 2MROB 1SXJC 1Z5AA 1DO0A 1E94E 1LTMA 1PJQA 4GMQA 4M9XA 3VDUA 1LV7A 4OU7A 4TUWA 2HAKA 4B3TM 3E21A 3RFWA 2ZM6M 3KS4A 4G4QA 4GIPA 4AZFA 1R5LA 2CFOA 2LWXA 4QOSA 2E5LM 2WSEF 2BWBA 4MB7A 3C58A 1N32M 3AOEC 1QUTA 3HWSA 2LTUA 3GRYA 3VLFB 5F3WA 2RRUA 2DVWB 3J2PB 3U6DA 3VDPA 4NRWA 2WZJA 2QSFX 1OTRA 1VDDA 5C18A 1QDTA 3GLFA 4AKHA 3W0FA 3KFUG 2CV1A 3PFIA 3WHKA 2ZTCA 4I4LA 4LCBA 2G5GX 2L2DA 1TR8A 2ZTDA 2Y21A 2BWEA 1A5TA 3C3EA 1IN7A 1OQYA 1IY1A 3SHGB 3TWKA 1K82A 2Z3XA 2LHCA 1JR3D 3U6EA 1XXHE 4JXJA 4B3SM 1N78A 4B7GA 3GLHB 1L8QA 2JUJA 2BJWA 3I04M 5FTMA 4JI0M 1T6OA 4YHHM 3K1JA 1TH4A 3K9OA 4KHPM 3SYLA 5EXPA 2KZSA 2FNAA 3I4VA 1E9SA 2UUBM 3W68A 2R4JA 3UGJA 3FUTA 2LNHC 3GRVA 4L16A 4GHAA 3GQ4A 5ITTA 3AFHA 5IREB 4LJ4A 3I01M 2DAEA 2KNZA 1IBMM 1NY6A 1TF0B 3HGIA 3UK6A 1Z59A 2F5SA 4AG6A 1QUSA 4FWGA 4XBOA 1VEGA 2KNAA 1PRBA 3GPYA 4HL4A 2QQ8A 2OOBA 2D7EA 1GVNA 3SFZA 1IBLM 4B3MM 4YY3M 2RGOA 1W5TA 5BR8M 1YUBA 3KOZE 2ERCA 3NWLA 4M0WA 4R3DA 1XNQM 5KPZA 1HQCA 4ITQA 1TGUA 3T6PA 3ILKA 4LG2A 4JI1M 4L78A 2Z8YM 2R6FA 5KQDA 4PD2A 3GRRA 5DYIA 1NV8A 1PGYA 2XH9A 4DBGB 3HJSA 5L8RF 2APLA 1HR0M 2DKLA 3UZUA 2Y0QA 3K9PA 1I94M 2QBYB 4IJFA 3J81S 3FTCA 2JY6B 5EJCA 5EP3A 5EXSA 1QQWA 1YE9A 3GQ5A 1KFVA 4OX9M 3FTEA 5EP1A 1XXHA 1IXZA 2N35A 1QANA 3B7NA 4KODA 3AJIB 4MGKE 3HHYA 4PCZA 3SAWA 3J80S 1PM5A 4IBDA 5DNYA 4DR7M 2JZ0A 4GITA 2QPAA 3FUUA 1TDHA 2V6ZM 1JB0F 1WGLA 5ITXA 3KOXE 3BBZA 4LFAM 2DHYA 1SXJD 1TH3A 2DI0A 4REZA 4D81A 1IN8A 1T3TA 2DZOB 3KW6A 1AUAA 5JI3E 1TH2A 3FRHA 1GABA 2R46A 4FW9A 4JI7M 2Z7JA 1QAQA 1XMQM 2LXEA 2DAIA 2G8LA 3GLFB 3IECA 2QZ4A 2J7OA 4LY6A 3KOWE 3CGWA 4F1IA 4LJ8A 2FE8A 3A46A 2KA6B 3R9XB 1WHCA 2J5YA 2JNHA 3KOYE 5KPRA 4FCWA 1UFZA 4BLCA 2I7NA 3QWLA 4DR1M 3LCUA 4FWDA 3M0EA 3J7BA 3KXEC 4NXNM 3TE6A 4L8RC 2MGWA 3K8ZA 2C96A 4DV0M 2B3TA 1N36M 1DO2A 1ZQ9A 2R65A 3C3DA 3HU3A 4G3OA 3AKZA 4ZPXA 2KZUA 1L2BA 2K47A 2DWMA 1IN4A 4Z8XA 2R18A 2WSFF 2KRUA 2QNJA 3L2AA 1KYIA 4DV6M 4JI8M 2XFTA 1FJGM 3RGPA 1HNZM 3VK8A 2DWZB 1GO5A 4GC5A 1AIPC 2L7HA 2MJ5B 2DWLA 1G8PA 4DR3M 1IM2A 4MGIE 1QZEA 4PDIA 2C9CA 2UXBM 1QVRA 4MM3B 3FUXA 1Q02A 4FWHA 2EJSA 3E46A 4I5SA 4NOOB 3A45A 2Q2EB 2XZUA 1NV9A 2FFJA 2LBCA 4MGHA 3AL0C 3PNVA 1J7KA 2L4FA 4MGZE 4OVZA 5DYGA 3GP1A 1PJJA 1W5SA 2K9DA 2CEAA 2F5OA 2P5TA 1EE8A 2EKKA 2KDLA 2BNKA 3DOAA 3K92A 2MH8A 2QCUA 4LJ7A 1GL6A 5IZ7D 3LQQA 4LJ6A 2F4VM 1NHGC 1XC8A 5DFLA 3T15A 1OIPA 1DGBA 3KSXA 1OJLA 3FTFA 1MU5A 1D0LA 3LQRA 3VKGA 3FTDA 4DR5M 3IG8A 4LF9M 4KLNA 4LZJA 2CHQA 2UXDM 2XF3A 3A42A 3U61A 3U6MA 3L28A 1R2ZA 2UUAM 1S3SA 1Y8GA 1BVSA 1YSYA 3LCVB 4DUZM 3HJ8A 2K0BX 3E9SA 1XXHB 4I8OA 2X49A 5ITXE 2VQFM 1EIJA 3DFZA 3TWMA 1OKSA 1Q3BA 3HY5A 4P16A 3HZJA 1HJPA 2KNVA 3MHVC 4NXMM 5FTJA 2HCBA 2FH0A 2RKOA 3FRIA 4B7FA 3GPUA 3RE8A 1VDLA 3U60A 1G4AE 1IFYA 2XZFA 3TWLA 2VQEM 3PNYA 2NQ8C 2X8AA 2M60A 4AG5A 1P3QQ 2UU9M 1Q39A 1PJIA 3WHLA 3JAMS 4QOZC 4MGYE 4DV5M 3KS8A 2X4AA 1OIZA 3L27A 3A98B 2DAKA 2L6OA 4FD2A 3D8BA 1DV0A 1IXSA 1QAMA 4LFBM 4RF1A 4IBEA 2KXEA 4IBIA 1V33A 5ITYA 2DWNA 3SAUA 1IY0A 2JY8A 2L4EA 2CE7A 3QYEA 3UMMA 3SC3A 2OOAA 1G41A 5EP2A 4MH0E 1NHWC 3DZDA 5FSWA 1QYRA 2C98A 1XMOM 2EO2A 4JI5M 2GNOA 1VEKA 4NC6A 4AI6A 4IIWA 4JV5M 2VIIA 3W0LB 4A3VB 4LF5M 2LVQD 4LJ5A 1E9RA 4HEOA 1HQYE 4WP2A 1PJTA 1WXQA 2H5XA 2DZNB 4LJAA 1L2CA 3U6QA 2OPFA 2CRUA 2K6BA 4W5WA 1GKIA 1D2NA 1IQPA 1OFIA 1WR1B 3IHPA 3U6SA 4GHLA 4QHSA 3PXGA 2DZLA 3SYKA 1GLNA 1ZAEA 4PDGA 1WIVA 2LH0A 2M5ZA 2D7HA 3GPPA 5ITRA 2F5QA 4B7HA 3EIHA 1N33M 2KW0A 4F2LA 4QNRA 2YR0A 2Y20A 2JWSA 1R6BX 2UUCM 3LVWA 3U5ZA 3HHZA 2ZBKB 1QZMA 3E4RA 3FD9A 5KPTA 3AV0A 5FTNA 4II7A 3GO8A 4RKUF 4LRSA 4WW0A 2HL7A 2KRKA 1ORYB 4OVZB 1GJTA 1ZV1A 4X62M 1MJGM 2HKJA 1VQ1A 4K0KM 1XHBA 2DAGA 2Y0TA 4DR4M 2DHRA 2XSZA 1NY5A 1JR3A 2VF7A 4CJ6A 1J09A 2R45A 4BB9A 3KDSE 3SMPA 3UJNA 1Z6TA 3IG5A 1V34A 2AHMA 3KP1E 4JI3M 3GPXA 3U61B 1I4WA 1QAOA 2C5RA 3B7ZA 1T43A 4G4RA 3SBJA 2EKFA 2DXIA 3I4YA 2CV0A 4LF7M 1NO1A 3GQ3A 4UN2B 4KO8A 4CGYB 3HX3A 4R71A 1HNWM 4DR6M 2FS1A 4X66M 2LVPC 4LFCM 3GLIA 2WSCF 1XWIA 1HT1E 2L7IA 2O01F 3K2LA 3Q8GA 1ZMVA 3U60B 1UM8A 4CHTB 2Z4SA 4NSOB 3B9PA 3M7GA 1L2DA 4G4OA 2H1RA 3SMSA 3LW5F 2RGHA 4DV4M 4FCTA 3SARA 4RF0A 2DNAA 1TDZA 3U6LA 4D82A 1GJSA 5EP4A 4PT5A 3U6OA 5FLXS 3NBXX 1HNXM 2W82A 5EQTA 4LF6M 1K3WA 4L6V6 4R7GA 1IXSB 4GKJM 4DV1M 2XEPA 4AKIA 1N34M 3VFDA 2JXNA 2JA2A 4AQYM 2C99A 4GH9A 1HT2E 4KT0F 3FYCA 4HLQA 3THGA 3C9PA 2KEBA 1VEJA 3CF6E 5LMUM 2R62A 2CHVA 3BXWA 1WJ7A 3J27B 2CWBA 5KO3A 1PJSA 2YFQA 3QAUA 4LJ9A 4XGIA 2UXCM 4DV3M 3CF2A 4JI4M 3SHFA 1NNJA 1GL7A 1NVMA 3FUWA 1V92A 1D0KA 5ITQA 3L29A 2CUZA 3HU1A 2LVOC 4QNMA 1D0MA 3H4JA 2Z4RA 3NBIA 1SXJA 1IY2A 3LMMA 2R44A 3L26A 1MN3A 2R4EA 2MR9A 3B89A 3LVVA 3SASA 2EUCA 4FCVA 1DGFA 4GC9A 5E26A 5EXXA 1CUKA 1DGGA 2G3QA 1XNRM 3GLHE 3U5ZB 2I7PA 2XSZD 5E6JA 1N75A 2KHHA 1C1KA 4IBFA 5GKNA 4LGYA 4ANRA 5FTLA 1OAIA 1E32A 3ZC7B 1DGHA 1JQJC 3DA1A 1L1ZA 3GLGA 1JR3E 3HU2A 3AOEA 3MJ5A 4IBKA 4M9SA 1Z5CA 3FKEA 2HWJA 4Y28F 2A5YB 1NJGA 1G3IA 3AOGA 2CV2A 2DENA 1Z5BA 2DAMA 4LRTA 4AKGA 3HHWA 3BOSA 4G6ZA 2QENA 4OW0A 3V76A 2QHOB 3JR5A 2JZ1A 4LGMA 2JP7A 1NNUC 3ZQJA 5KQ8A 3FYDA 1K3XA 4IJEA 1WGNA 1NSFA 4Q7JA 2R0IA 1RU3A 3GLIE 5IWAM 2JY7A 2VF8A 2XGNA 4JN6A 3JR4A 3H4MA 2XLJA 1R7RA 1IN6A 2BJVA 1EFUB 2OQ4A 4JI2M 1KSFX 1H6UA
chains in the Genus database with same CATH topology
2YQZA 3TQSA 3GLIB 2FOIC 5C1BA 4IBJA 1MX0A 3KSJA 5JI2E 1IBKM 2ZAOA 4B3RM 2CHGA 3Q8XA 3VK7A 5A2QS 4D80A 4M9ZA 1OFHA 4IBGA 2F5PA 5FTKA 1N77A 3KP0E 4LF4M 1FNNA 4LF8M 3SAVA 3D8LA 3T38A 3T1HM 3J7AS 5EXTA 2V1CA 4LZZA 3TL4X 3T1YM 3I51A 3GLHA 3U6CA 2YNMD 4S12A 4DR2M 4Z6YA 4GRIA 2J7NA 3GRUA 4X65M 2ZAMA 3FUVA 4NRVA 3R8FA 5ITUA 3L25A 5BPVA 2EA0A 5IT9S 4IBBA 4L15A 4QHTA 3OTOM 2QP9X 4DUYM 2HHHM 3HHXA 1R2YA 2L09A 1NJFA 1SXJE 3M6AA 4GKKM 8CATA 3SATA 4CISA 3HKPA 4B08A 1G59A 2XFSA 1J5EM 4JYAM 2F5NA 1SXJB 4I81A 3MK6A 3CF0A 3CTWB 4JI6M 7CATA 4X64M 1IXRC 4RNAA 2O5RA 3EIEA 3TPZA 1IN5A 5LMNM 3KVWA 3PVSA 2ZANA 4NSRA 4BBAA 4EIWA 3ZCBB 4FVMA 4G4NA 3HJQA 1L1TA 1DGHB 4M0DA 3ZH9B 3U6PA 1Q3CA 3GLGB 2C9OA 1X37A 4WURA 4AW4A 2QBYA 4IBCA 3RGSA 4DV7M 3VKHA 2V1UA 4L4UA 5H37D 2D7GA 4NL4H 4DV2M 1SXJC 1Z5AA 1DO0A 1E94E 4GMQA 4M9XA 3VDUA 1LV7A 4OU7A 4TUWA 4B3TM 3RFWA 2ZM6M 3KS4A 4G4QA 4GIPA 4AZFA 2CFOA 2LWXA 4QOSA 2E5LM 4MB7A 3C58A 1N32M 3AOEC 3HWSA 3GRYA 5F3WA 3VLFB 2DVWB 3J2PB 3U6DA 3VDPA 4NRWA 1VDDA 5C18A 3GLFA 4AKHA 3W0FA 3KFUG 2CV1A 3PFIA 3WHKA 4I4LA 4LCBA 2G5GX 2Y21A 1IN7A 1IY1A 3SHGB 3TWKA 1K82A 2Z3XA 1JR3D 3U6EA 4JXJA 4B3SM 1N78A 4B7GA 3GLHB 1L8QA 5FTMA 2BJWA 4YHHM 4JI0M 3K1JA 1TH4A 4KHPM 3SYLA 5EXPA 2KZSA 2FNAA 3I4VA 1E9SA 2UUBM 3UGJA 2R4JA 3FUTA 2LNHC 3GRVA 4L16A 4GHAA 3GQ4A 5ITTA 3AFHA 5IREB 4LJ4A 1IBMM 1NY6A 3HGIA 3UK6A 1Z59A 2F5SA 4AG6A 4FWGA 4XBOA 3GPYA 4HL4A 2D7EA 1GVNA 3SFZA 1IBLM 4B3MM 4YY3M 2RGOA 1W5TA 5BR8M 1YUBA 3KOZE 2ERCA 3NWLA 4M0WA 4R3DA 1XNQM 5KPZA 1HQCA 4ITQA 1TGUA 3ILKA 4LG2A 4JI1M 4L78A 5KQDA 4PD2A 3GRRA 5DYIA 2XH9A 3HJSA 1HR0M 3UZUA 2Y0QA 2QBYB 1I94M 4IJFA 3J81S 3FTCA 1KFVA 5EJCA 5EP3A 5EXSA 1QQWA 1YE9A 3GQ5A 4OX9M 3FTEA 5EP1A 1XXHA 1IXZA 4MGKE 1QANA 4KODA 3HHYA 3AJIB 4PCZA 3SAWA 1PM5A 3J80S 4IBDA 5DNYA 4DR7M 4GITA 2QPAA 3FUUA 1TDHA 2V6ZM 5ITXA 3KOXE 4LFAM 1SXJD 1TH3A 4REZA 4D81A 1IN8A 1T3TA 2DZOB 3KW6A 5JI3E 1TH2A 2R46A 4FW9A 4JI7M 2Z7JA 1QAQA 1XMQM 2LXEA 2G8LA 3GLFB 2QZ4A 2J7OA 4LY6A 3KOWE 4LJ8A 2FE8A 3A46A 2KA6B 3R9XB 3KOYE 5KPRA 4FCWA 4BLCA 2I7NA 3QWLA 4DR1M 4FWDA 3M0EA 3J7BA 3KXEC 4NXNM 3TE6A 4L8RC 3K8ZA 2C96A 4DV0M 1N36M 1DO2A 1ZQ9A 2R65A 3HU3A 3AKZA 4ZPXA 2KZUA 1L2BA 2K47A 2DWMA 1IN4A 4Z8XA 2R18A 2KRUA 3L2AA 1KYIA 4DV6M 4JI8M 2XFTA 1FJGM 3RGPA 1HNZM 3VK8A 2DWZB 4GC5A 2L7HA 2DWLA 1G8PA 4DR3M 1IM2A 4MGIE 4PDIA 2C9CA 2UXBM 1QVRA 4MM3B 3FUXA 4FWHA 4I5SA 4NOOB 3A45A 2Q2EB 2XZUA 2FFJA 4MGHA 3AL0C 3PNVA 1J7KA 4MGZE 4OVZA 5DYGA 3GP1A 1PJJA 1W5SA 2CEAA 2F5OA 2P5TA 1EE8A 3DOAA 2BNKA 3K92A 4LJ7A 5IZ7D 2QCUA 2F4VM 1GL6A 3LQQA 4LJ6A 1NHGC 1XC8A 3T15A 3KSXA 1DGBA 3FTFA 1OJLA 3VKGA 1MU5A 3LQRA 3FTDA 4DR5M 3IG8A 4LF9M 4KLNA 4LZJA 2CHQA 2UXDM 2XF3A 3A42A 3U61A 3U6MA 3L28A 1R2ZA 2UUAM 1S3SA 1YSYA 4DUZM 3HJ8A 3E9SA 1XXHB 4I8OA 2X49A 5ITXE 2VQFM 3DFZA 3TWMA 1Q3BA 4P16A 3MHVC 4NXMM 5FTJA 2HCBA 2RKOA 4B7FA 3GPUA 3RE8A 3U60A 1G4AE 2XZFA 3TWLA 2VQEM 3PNYA 2NQ8C 2X8AA 2M60A 4AG5A 2UU9M 1Q39A 1PJIA 3WHLA 3JAMS 4QOZC 4MGYE 4DV5M 3KS8A 2X4AA 3L27A 3A98B 2L6OA 4FD2A 3D8BA 4LFBM 1QAMA 4RF1A 4IBEA 2KXEA 4IBIA 5ITYA 2DWNA 3SAUA 1IY0A 2CE7A 3UMMA 3SC3A 1G41A 5EP2A 4MH0E 1NHWC 3DZDA 5FSWA 1QYRA 2C98A 1XMOM 2EO2A 4JI5M 4AI6A 4IIWA 4JV5M 2VIIA 3W0LB 4A3VB 4LF5M 4LJ5A 1E9RA 1HQYE 1WXQA 2DZNB 4LJAA 1L2CA 3U6QA 2OPFA 4W5WA 1GKIA 1OFIA 1D2NA 1IQPA 4GHLA 3U6SA 4QHSA 3PXGA 3SYKA 1GLNA 1ZAEA 4PDGA 2LH0A 2M5ZA 2D7HA 3GPPA 5ITRA 2F5QA 4B7HA 3EIHA 1N33M 2KW0A 4QNRA 2YR0A 2Y20A 2UUCM 1R6BX 3LVWA 3U5ZA 3HHZA 2ZBKB 1QZMA 3E4RA 3FD9A 5KPTA 3AV0A 5FTNA 4II7A 3GO8A 4LRSA 4WW0A 2HL7A 2KRKA 1ORYB 4OVZB 4X62M 2HKJA 4K0KM 1XHBA 2Y0TA 4DR4M 2DHRA 2XSZA 1NY5A 1JR3A 1J09A 2R45A 4BB9A 3KDSE 3SMPA 3UJNA 1Z6TA 3IG5A 2AHMA 3KP1E 4JI3M 3GPXA 3U61B 1I4WA 1QAOA 2C5RA 4G4RA 3SBJA 2DXIA 3I4YA 2CV0A 4LF7M 3GQ3A 4CGYB 4KO8A 1HNWM 4DR6M 4X66M 4LFCM 3GLIA 1XWIA 1HT1E 2L7IA 3K2LA 3U60B 1UM8A 4CHTB 2Z4SA 4NSOB 3B9PA 3M7GA 1L2DA 4G4OA 2H1RA 3SMSA 4DV4M 2RGHA 3SARA 4FCTA 4RF0A 1TDZA 3U6LA 4D82A 5EP4A 4PT5A 3U6OA 5FLXS 1HNXM 2W82A 5EQTA 4LF6M 1K3WA 4R7GA 1IXSB 4GKJM 4DV1M 2XEPA 4AKIA 1N34M 3VFDA 2JA2A 4AQYM 2C99A 4GH9A 1HT2E 3FYCA 4HLQA 3THGA 2KEBA 3CF6E 5LMUM 2R62A 2CHVA 3J27B 5KO3A 2YFQA 3QAUA 4LJ9A 4XGIA 2UXCM 4DV3M 4JI4M 3SHFA 1NNJA 1GL7A 1NVMA 3FUWA 5ITQA 3L29A 2CUZA 3HU1A 4QNMA 2Z4RA 3NBIA 1SXJA 1IY2A 3LMMA 3L26A 2R4EA 3LVVA 3SASA 2EUCA 4FCVA 1DGFA 4GC9A 5E26A 5EXXA 1DGGA 1XNRM 3U5ZB 2I7PA 2XSZD 5E6JA 1N75A 4IBFA 1C1KA 5GKNA 5FTLA 4LGYA 1E32A 3ZC7B 1DGHA 1JQJC 3DA1A 1L1ZA 3GLGA 3HU2A 3AOEA 3MJ5A 4IBKA 4M9SA 1Z5CA 3FKEA 2A5YB 1NJGA 1G3IA 3AOGA 2CV2A 1Z5BA 4LRTA 4AKGA 3HHWA 3BOSA 4G6ZA 2QENA 4OW0A 3JR5A 4LGMA 1NNUC 5KQ8A 3FYDA 1K3XA 4IJEA 1NSFA 5IWAM 2XGNA 4JN6A 3JR4A 3H4MA 2XLJA 1R7RA 1IN6A 2BJVA 3CF2A 2OQ4A 4JI2M 1KSFX 1H6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 M;  4B3S M;  4PDI A;  4YHH M;  4JI0 M;  2UXB M;  1MX0 A;  4KHP M;  1IBK M;  4B3R M;  3VK7 A;  4JI3 M;  3GPX A;  3A45 A;  5A2Q S;  2UUB M;  2Q2E B;  2XZU A;  3GQ4 A;  5ITT A;  4G4R A;  2F5P A;  3SBJ A;  4LF4 M;  4LF8 M;  1PJJ A;  3GP1 A;  3SAV A;  4LF7 M;  3GQ3 A;  1IBM M;  1HNW M;  2F5O A;  3DOA A;  1EE8 A;  4DR6 M;  4X66 M;  2F4V M;  3T1H M;  3J7A S;  1Z59 A;  1XC8 A;  4LFC M;  2F5S A;  3T1Y M;  1MU5 A;  3U6C A;  3GPY A;  4DR5 M;  4LF9 M;  4DR2 M;  2UXD M;  3A42 A;  3U6M A;  1L2D A;  4X65 M;  4DV4 M;  4G4O A;  1IBL M;  3SAR A;  4YY3 M;  4B3M M;  1R2Z A;  2UUA M;  1TDZ A;  5BR8 M;  3U6L A;  4NRV A;  4DUZ M;  3U6O A;  5FLX S;  1XNQ M;  5ITU A;  2VQF M;  5ITX E;  1HNX M;  4LF6 M;  2EA0 A;  4ITQ A;  1K3W A;  5IT9 S;  3TWM A;  1Q3B A;  3OTO M;  4DV1 M;  4GKJ M;  4JI1 M;  4DUY M;  2HHH M;  4NXM M;  1R2Y A;  4PD2 A;  1N34 M;  3GPU A;  4GKK M;  3SAT A;  4CIS A;  4AQY M;  2XZF A;  1J5E M;  1HR0 M;  3TWL A;  2VQE M;  4JYA M;  1I94 M;  2F5N A;  3J81 S;  2UU9 M;  1Q39 A;  1PJI A;  1KFV A;  3JAM S;  3GQ5 A;  4OX9 M;  5LMU M;  4JI6 M;  4X64 M;  4DV5 M;  5LMN M;  4PCZ A;  1PM5 A;  3SAW A;  3J80 S;  4DR7 M;  4LFB M;  2UXC M;  4DV3 M;  4JI4 M;  1TDH A;  5ITX A;  1NNJ A;  4G4N A;  5ITY A;  1L1T A;  4LFA M;  5ITQ A;  1Q3C A;  3U6P A;  3SAU A;  4DV7 M;  1XMO M;  4JI5 M;  4JV5 M;  4DV2 M;  1Z5A A;  3SAS A;  4JI7 M;  4LF5 M;  1XMQ M;  1XNR M;  4B3T M;  2ZM6 M;  1L2C A;  3U6Q A;  2OPF A;  4G4Q A;  3A46 A;  3U6S A;  1L1Z A;  4PDG A;  2E5L M;  4MB7 A;  3C58 A;  1Z5C A;  1N32 M;  4DR1 M;  3GPP A;  5ITR A;  2F5Q A;  4NXN M;  1N33 M;  4DV0 M;  1Z5B A;  1N36 M;  3U6D A;  2UUC M;  1L2B A;  3JR5 A;  2ZBK B;  3W0F A;  3GO8 A;  1K3X A;  4DV6 M;  4JI8 M;  1FJG M;  5IWA M;  1HNZ M;  4X62 M;  3VK8 A;  3TWK A;  3JR4 A;  1K82 A;  2HKJ A;  2OQ4 A;  4NRW A;  3U6E A;  4K0K M;  4JI2 M;  4DR4 M; 
#chains in the Genus database with same CATH topology
 2O25 A;  2YQZ A;  3TQS A;  3GLI B;  2FOI C;  2GQF A;  3QYB A;  2LVN C;  5C1B A;  4IBJ A;  1MX0 A;  3KSJ A;  5JI2 E;  1IBK M;  2ZAO A;  4B3R M;  2CHG A;  2LVA A;  3Q8X A;  3VK7 A;  5A2Q S;  4D80 A;  2JY5 A;  1OFH A;  4M9Z A;  1ZMU A;  4IBG A;  2F5P A;  5FTK A;  1N77 A;  1VG5 A;  3KP0 E;  1FNN A;  4LF4 M;  4LF8 M;  3SAV A;  4XK8 F;  3D8L A;  1YLA A;  2LHG A;  3T38 A;  3T1H M;  3J7A S;  4P17 A;  5EXT A;  2V1C A;  4LZZ A;  3TL4 X;  1TTE A;  3T1Y M;  3I51 A;  3GLH A;  3U6C A;  2YNM D;  1F4I A;  4S12 A;  4DR2 M;  4Z6Y A;  4GRI A;  2J7N A;  3GRU A;  4X65 M;  2ZAM A;  1R4G A;  2VDB B;  3FUV A;  4NRV A;  3R8F A;  5ITU A;  4GEW A;  3L25 A;  5BPV A;  2EA0 A;  5IT9 S;  4IBB A;  4L15 A;  1ZMW A;  1SG9 A;  4QHT A;  3OTO M;  2QP9 X;  3W67 A;  4DUY M;  3HHX A;  2HHH M;  1R2Y A;  2L09 A;  1NJF A;  1SXJ E;  3M6A A;  3GLF E;  4GKK M;  8CAT A;  3B74 A;  1C7Y A;  3HKP A;  3MMP A;  3SAT A;  4CIS A;  4B08 A;  1G59 A;  2XFS A;  1J5E M;  4JYA M;  3F92 A;  3B7Q A;  2F5N A;  1SXJ B;  4I81 A;  3MK6 A;  2CP8 A;  3CF0 A;  3CTW B;  1XB2 B;  7CAT A;  4X64 M;  4JI6 M;  1IXR C;  4RNA A;  2O5R A;  3EIE A;  3TPZ A;  1IN5 A;  5LMN M;  1QDR A;  3KVW A;  3PVS A;  2ZAN A;  3GLG E;  4NSR A;  4BBA A;  1OAO C;  3FE3 A;  4CIZ A;  4EIW A;  3ZCB B;  4FVM A;  4G4N A;  3HJQ A;  1L1T A;  1DGH B;  2OO9 A;  4M0D A;  3ZH9 B;  1Q3C A;  3U6P A;  3GLG B;  2C9O A;  1X37 A;  4WUR A;  4AW4 A;  2QBY A;  4IBC A;  3RGS A;  4DV7 M;  1G71 A;  3VKH A;  2V1U A;  4L4U A;  5H37 D;  2D7G A;  4NL4 H;  4DV2 M;  2MRO B;  1SXJ C;  1Z5A A;  1DO0 A;  1E94 E;  1LTM A;  1PJQ A;  4GMQ A;  4M9X A;  3VDU A;  1LV7 A;  4OU7 A;  4TUW A;  2HAK A;  4B3T M;  3E21 A;  3RFW A;  2ZM6 M;  3KS4 A;  4G4Q A;  4GIP A;  4AZF A;  1R5L A;  2CFO A;  2LWX A;  4QOS A;  2E5L M;  2WSE F;  2BWB A;  4MB7 A;  3C58 A;  1N32 M;  3AOE C;  1QUT A;  3HWS A;  2LTU A;  3GRY A;  3VLF B;  5F3W A;  2RRU A;  2DVW B;  3J2P B;  3U6D A;  3VDP A;  4NRW A;  2WZJ A;  2QSF X;  1OTR A;  1VDD A;  5C18 A;  1QDT A;  3GLF A;  4AKH A;  3W0F A;  3KFU G;  2CV1 A;  3PFI A;  3WHK A;  2ZTC A;  4I4L A;  4LCB A;  2G5G X;  2L2D A;  1TR8 A;  2ZTD A;  2Y21 A;  2BWE A;  1A5T A;  3C3E A;  1IN7 A;  1OQY A;  1IY1 A;  3SHG B;  3TWK A;  1K82 A;  2Z3X A;  2LHC A;  1JR3 D;  3U6E A;  1XXH E;  4JXJ A;  4B3S M;  1N78 A;  4B7G A;  3GLH B;  1L8Q A;  2JUJ A;  2BJW A;  3I04 M;  5FTM A;  4JI0 M;  1T6O A;  4YHH M;  3K1J A;  1TH4 A;  3K9O A;  4KHP M;  3SYL A;  5EXP A;  2KZS A;  2FNA A;  3I4V A;  1E9S A;  2UUB M;  3W68 A;  2R4J A;  3UGJ A;  3FUT A;  2LNH C;  3GRV A;  4L16 A;  4GHA A;  3GQ4 A;  5ITT A;  3AFH A;  5IRE B;  4LJ4 A;  3I01 M;  2DAE A;  2KNZ A;  1IBM M;  1NY6 A;  1TF0 B;  3HGI A;  3UK6 A;  1Z59 A;  2F5S A;  4AG6 A;  1QUS A;  4FWG A;  4XBO A;  1VEG A;  2KNA A;  1PRB A;  3GPY A;  4HL4 A;  2QQ8 A;  2OOB A;  2D7E A;  1GVN A;  3SFZ A;  1IBL M;  4B3M M;  4YY3 M;  2RGO A;  1W5T A;  5BR8 M;  1YUB A;  3KOZ E;  2ERC A;  3NWL A;  4M0W A;  4R3D A;  1XNQ M;  5KPZ A;  1HQC A;  4ITQ A;  1TGU A;  3T6P A;  3ILK A;  4LG2 A;  4JI1 M;  4L78 A;  2Z8Y M;  2R6F A;  5KQD A;  4PD2 A;  3GRR A;  5DYI A;  1NV8 A;  1PGY A;  2XH9 A;  4DBG B;  3HJS A;  5L8R F;  2APL A;  1HR0 M;  2DKL A;  3UZU A;  2Y0Q A;  3K9P A;  1I94 M;  2QBY B;  4IJF A;  3J81 S;  3FTC A;  2JY6 B;  5EJC A;  5EP3 A;  5EXS A;  1QQW A;  1YE9 A;  3GQ5 A;  1KFV A;  4OX9 M;  3FTE A;  5EP1 A;  1XXH A;  1IXZ A;  2N35 A;  1QAN A;  3B7N A;  4KOD A;  3AJI B;  4MGK E;  3HHY A;  4PCZ A;  3SAW A;  3J80 S;  1PM5 A;  4IBD A;  5DNY A;  4DR7 M;  2JZ0 A;  4GIT A;  2QPA A;  3FUU A;  1TDH A;  2V6Z M;  1JB0 F;  1WGL A;  5ITX A;  3KOX E;  3BBZ A;  4LFA M;  2DHY A;  1SXJ D;  1TH3 A;  2DI0 A;  4REZ A;  4D81 A;  1IN8 A;  1T3T A;  2DZO B;  3KW6 A;  1AUA A;  5JI3 E;  1TH2 A;  3FRH A;  1GAB A;  2R46 A;  4FW9 A;  4JI7 M;  2Z7J A;  1QAQ A;  1XMQ M;  2LXE A;  2DAI A;  2G8L A;  3GLF B;  3IEC A;  2QZ4 A;  2J7O A;  4LY6 A;  3KOW E;  3CGW A;  4F1I A;  4LJ8 A;  2FE8 A;  3A46 A;  2KA6 B;  3R9X B;  1WHC A;  2J5Y A;  2JNH A;  3KOY E;  5KPR A;  4FCW A;  1UFZ A;  4BLC A;  2I7N A;  3QWL A;  4DR1 M;  3LCU A;  4FWD A;  3M0E A;  3J7B A;  3KXE C;  4NXN M;  3TE6 A;  4L8R C;  2MGW A;  3K8Z A;  2C96 A;  4DV0 M;  2B3T A;  1N36 M;  1DO2 A;  1ZQ9 A;  2R65 A;  3C3D A;  3HU3 A;  4G3O A;  3AKZ A;  4ZPX A;  2KZU A;  1L2B A;  2K47 A;  2DWM A;  1IN4 A;  4Z8X A;  2R18 A;  2WSF F;  2KRU A;  2QNJ A;  3L2A A;  1KYI A;  4DV6 M;  4JI8 M;  2XFT A;  1FJG M;  3RGP A;  1HNZ M;  3VK8 A;  2DWZ B;  1GO5 A;  4GC5 A;  1AIP C;  2L7H A;  2MJ5 B;  2DWL A;  1G8P A;  4DR3 M;  1IM2 A;  4MGI E;  1QZE A;  4PDI A;  2C9C A;  2UXB M;  1QVR A;  4MM3 B;  3FUX A;  1Q02 A;  4FWH A;  2EJS A;  3E46 A;  4I5S A;  4NOO B;  3A45 A;  2Q2E B;  2XZU A;  1NV9 A;  2FFJ A;  2LBC A;  4MGH A;  3AL0 C;  3PNV A;  1J7K A;  2L4F A;  4MGZ E;  4OVZ A;  5DYG A;  3GP1 A;  1PJJ A;  1W5S A;  2K9D A;  2CEA A;  2F5O A;  2P5T A;  1EE8 A;  2EKK A;  2KDL A;  2BNK A;  3DOA A;  3K92 A;  2MH8 A;  2QCU A;  4LJ7 A;  1GL6 A;  5IZ7 D;  3LQQ A;  4LJ6 A;  2F4V M;  1NHG C;  1XC8 A;  5DFL A;  3T15 A;  1OIP A;  1DGB A;  3KSX A;  1OJL A;  3FTF A;  1MU5 A;  1D0L A;  3LQR A;  3VKG A;  3FTD A;  4DR5 M;  3IG8 A;  4LF9 M;  4KLN A;  4LZJ A;  2CHQ A;  2UXD M;  2XF3 A;  3A42 A;  3U61 A;  3U6M A;  3L28 A;  1R2Z A;  2UUA M;  1S3S A;  1Y8G A;  1BVS A;  1YSY A;  3LCV B;  4DUZ M;  3HJ8 A;  2K0B X;  3E9S A;  1XXH B;  4I8O A;  2X49 A;  5ITX E;  2VQF M;  1EIJ A;  3DFZ A;  3TWM A;  1OKS A;  1Q3B A;  3HY5 A;  4P16 A;  3HZJ A;  1HJP A;  2KNV A;  3MHV C;  4NXM M;  5FTJ A;  2HCB A;  2FH0 A;  2RKO A;  3FRI A;  4B7F A;  3GPU A;  3RE8 A;  1VDL A;  3U60 A;  1G4A E;  1IFY A;  2XZF A;  3TWL A;  2VQE M;  3PNY A;  2NQ8 C;  2X8A A;  2M60 A;  4AG5 A;  1P3Q Q;  2UU9 M;  1Q39 A;  1PJI A;  3WHL A;  3JAM S;  4QOZ C;  4MGY E;  4DV5 M;  3KS8 A;  2X4A A;  1OIZ A;  3L27 A;  3A98 B;  2DAK A;  2L6O A;  4FD2 A;  3D8B A;  1DV0 A;  1IXS A;  1QAM A;  4LFB M;  4RF1 A;  4IBE A;  2KXE A;  4IBI A;  1V33 A;  5ITY A;  2DWN A;  3SAU A;  1IY0 A;  2JY8 A;  2L4E A;  2CE7 A;  3QYE A;  3UMM A;  3SC3 A;  2OOA A;  1G41 A;  5EP2 A;  4MH0 E;  1NHW C;  3DZD A;  5FSW A;  1QYR A;  2C98 A;  1XMO M;  2EO2 A;  4JI5 M;  2GNO A;  1VEK A;  4NC6 A;  4AI6 A;  4IIW A;  4JV5 M;  2VII A;  3W0L B;  4A3V B;  4LF5 M;  2LVQ D;  4LJ5 A;  1E9R A;  4HEO A;  1HQY E;  4WP2 A;  1PJT A;  1WXQ A;  2H5X A;  2DZN B;  4LJA A;  1L2C A;  3U6Q A;  2OPF A;  2CRU A;  2K6B A;  4W5W A;  1GKI A;  1D2N A;  1IQP A;  1OFI A;  1WR1 B;  3IHP A;  3U6S A;  4GHL A;  4QHS A;  3PXG A;  2DZL A;  3SYK A;  1GLN A;  1ZAE A;  4PDG A;  1WIV A;  2LH0 A;  2M5Z A;  2D7H A;  3GPP A;  5ITR A;  2F5Q A;  4B7H A;  3EIH A;  1N33 M;  2KW0 A;  4F2L A;  4QNR A;  2YR0 A;  2Y20 A;  2JWS A;  1R6B X;  2UUC M;  3LVW A;  3U5Z A;  3HHZ A;  2ZBK B;  1QZM A;  3E4R A;  3FD9 A;  5KPT A;  3AV0 A;  5FTN A;  4II7 A;  3GO8 A;  4RKU F;  4LRS A;  4WW0 A;  2HL7 A;  2KRK A;  1ORY B;  4OVZ B;  1GJT A;  1ZV1 A;  4X62 M;  1MJG M;  2HKJ A;  1VQ1 A;  4K0K M;  1XHB A;  2DAG A;  2Y0T A;  4DR4 M;  2DHR A;  2XSZ A;  1NY5 A;  1JR3 A;  2VF7 A;  4CJ6 A;  1J09 A;  2R45 A;  4BB9 A;  3KDS E;  3SMP A;  3UJN A;  1Z6T A;  3IG5 A;  1V34 A;  2AHM A;  3KP1 E;  4JI3 M;  3GPX A;  3U61 B;  1I4W A;  1QAO A;  2C5R A;  3B7Z A;  1T43 A;  4G4R A;  3SBJ A;  2EKF A;  2DXI A;  3I4Y A;  2CV0 A;  4LF7 M;  1NO1 A;  3GQ3 A;  4UN2 B;  4KO8 A;  4CGY B;  3HX3 A;  4R71 A;  1HNW M;  4DR6 M;  2FS1 A;  4X66 M;  2LVP C;  4LFC M;  3GLI A;  2WSC F;  1XWI A;  1HT1 E;  2L7I A;  2O01 F;  3K2L A;  3Q8G A;  1ZMV A;  3U60 B;  1UM8 A;  4CHT B;  2Z4S A;  4NSO B;  3B9P A;  3M7G A;  1L2D A;  4G4O A;  2H1R A;  3SMS A;  3LW5 F;  2RGH A;  4DV4 M;  4FCT A;  3SAR A;  4RF0 A;  2DNA A;  1TDZ A;  3U6L A;  4D82 A;  1GJS A;  5EP4 A;  4PT5 A;  3U6O A;  5FLX S;  3NBX X;  1HNX M;  2W82 A;  5EQT A;  4LF6 M;  1K3W A;  4L6V 6;  4R7G A;  1IXS B;  4GKJ M;  4DV1 M;  2XEP A;  4AKI A;  1N34 M;  3VFD A;  2JXN A;  2JA2 A;  4AQY M;  2C99 A;  4GH9 A;  1HT2 E;  4KT0 F;  3FYC A;  4HLQ A;  3THG A;  3C9P A;  2KEB A;  1VEJ A;  3CF6 E;  5LMU M;  2R62 A;  2CHV A;  3BXW A;  1WJ7 A;  3J27 B;  2CWB A;  5KO3 A;  1PJS A;  2YFQ A;  3QAU A;  4LJ9 A;  4XGI A;  2UXC M;  4DV3 M;  3CF2 A;  4JI4 M;  3SHF A;  1NNJ A;  1GL7 A;  1NVM A;  3FUW A;  1V92 A;  1D0K A;  5ITQ A;  3L29 A;  2CUZ A;  3HU1 A;  2LVO C;  4QNM A;  1D0M A;  3H4J A;  2Z4R A;  3NBI A;  1SXJ A;  1IY2 A;  3LMM A;  2R44 A;  3L26 A;  1MN3 A;  2R4E A;  2MR9 A;  3B89 A;  3LVV A;  3SAS A;  2EUC A;  4FCV A;  1DGF A;  4GC9 A;  5E26 A;  5EXX A;  1CUK A;  1DGG A;  2G3Q A;  1XNR M;  3GLH E;  3U5Z B;  2I7P A;  2XSZ D;  5E6J A;  1N75 A;  2KHH A;  1C1K A;  4IBF A;  5GKN A;  4LGY A;  4ANR A;  5FTL A;  1OAI A;  1E32 A;  3ZC7 B;  1DGH A;  1JQJ C;  3DA1 A;  1L1Z A;  3GLG A;  1JR3 E;  3HU2 A;  3AOE A;  3MJ5 A;  4IBK A;  4M9S A;  1Z5C A;  3FKE A;  2HWJ A;  4Y28 F;  2A5Y B;  1NJG A;  1G3I A;  3AOG A;  2CV2 A;  2DEN A;  1Z5B A;  2DAM A;  4LRT A;  4AKG A;  3HHW A;  3BOS A;  4G6Z A;  2QEN A;  4OW0 A;  3V76 A;  2QHO B;  3JR5 A;  2JZ1 A;  4LGM A;  2JP7 A;  1NNU C;  3ZQJ A;  5KQ8 A;  3FYD A;  1K3X A;  4IJE A;  1WGN A;  1NSF A;  4Q7J A;  2R0I A;  1RU3 A;  3GLI E;  5IWA M;  2JY7 A;  2VF8 A;  2XGN A;  4JN6 A;  3JR4 A;  3H4M A;  2XLJ A;  1R7R A;  1IN6 A;  2BJV A;  1EFU B;  2OQ4 A;  4JI2 M;  1KSF X;  1H6U A; 
#chains in the Genus database with same CATH homology
 2YQZ A;  3TQS A;  3GLI B;  2FOI C;  5C1B A;  4IBJ A;  1MX0 A;  3KSJ A;  5JI2 E;  1IBK M;  2ZAO A;  4B3R M;  2CHG A;  3Q8X A;  3VK7 A;  5A2Q S;  4D80 A;  4M9Z A;  1OFH A;  4IBG A;  2F5P A;  5FTK A;  1N77 A;  3KP0 E;  4LF4 M;  1FNN A;  4LF8 M;  3SAV A;  3D8L A;  3T38 A;  3T1H M;  3J7A S;  5EXT A;  2V1C A;  4LZZ A;  3TL4 X;  3T1Y M;  3I51 A;  3GLH A;  3U6C A;  2YNM D;  4S12 A;  4DR2 M;  4Z6Y A;  4GRI A;  2J7N A;  3GRU A;  4X65 M;  2ZAM A;  3FUV A;  4NRV A;  3R8F A;  5ITU A;  3L25 A;  5BPV A;  2EA0 A;  5IT9 S;  4IBB A;  4L15 A;  4QHT A;  3OTO M;  2QP9 X;  4DUY M;  2HHH M;  3HHX A;  1R2Y A;  2L09 A;  1NJF A;  1SXJ E;  3M6A A;  4GKK M;  8CAT A;  3SAT A;  4CIS A;  3HKP A;  4B08 A;  1G59 A;  2XFS A;  1J5E M;  4JYA M;  2F5N A;  1SXJ B;  4I81 A;  3MK6 A;  3CF0 A;  3CTW B;  4JI6 M;  7CAT A;  4X64 M;  1IXR C;  4RNA A;  2O5R A;  3EIE A;  3TPZ A;  1IN5 A;  5LMN M;  3KVW A;  3PVS A;  2ZAN A;  4NSR A;  4BBA A;  4EIW A;  3ZCB B;  4FVM A;  4G4N A;  3HJQ A;  1L1T A;  1DGH B;  4M0D A;  3ZH9 B;  3U6P A;  1Q3C A;  3GLG B;  2C9O A;  1X37 A;  4WUR A;  4AW4 A;  2QBY A;  4IBC A;  3RGS A;  4DV7 M;  3VKH A;  2V1U A;  4L4U A;  5H37 D;  2D7G A;  4NL4 H;  4DV2 M;  1SXJ C;  1Z5A A;  1DO0 A;  1E94 E;  4GMQ A;  4M9X A;  3VDU A;  1LV7 A;  4OU7 A;  4TUW A;  4B3T M;  3RFW A;  2ZM6 M;  3KS4 A;  4G4Q A;  4GIP A;  4AZF A;  2CFO A;  2LWX A;  4QOS A;  2E5L M;  4MB7 A;  3C58 A;  1N32 M;  3AOE C;  3HWS A;  3GRY A;  5F3W A;  3VLF B;  2DVW B;  3J2P B;  3U6D A;  3VDP A;  4NRW A;  1VDD A;  5C18 A;  3GLF A;  4AKH A;  3W0F A;  3KFU G;  2CV1 A;  3PFI A;  3WHK A;  4I4L A;  4LCB A;  2G5G X;  2Y21 A;  1IN7 A;  1IY1 A;  3SHG B;  3TWK A;  1K82 A;  2Z3X A;  1JR3 D;  3U6E A;  4JXJ A;  4B3S M;  1N78 A;  4B7G A;  3GLH B;  1L8Q A;  5FTM A;  2BJW A;  4YHH M;  4JI0 M;  3K1J A;  1TH4 A;  4KHP M;  3SYL A;  5EXP A;  2KZS A;  2FNA A;  3I4V A;  1E9S A;  2UUB M;  3UGJ A;  2R4J A;  3FUT A;  2LNH C;  3GRV A;  4L16 A;  4GHA A;  3GQ4 A;  5ITT A;  3AFH A;  5IRE B;  4LJ4 A;  1IBM M;  1NY6 A;  3HGI A;  3UK6 A;  1Z59 A;  2F5S A;  4AG6 A;  4FWG A;  4XBO A;  3GPY A;  4HL4 A;  2D7E A;  1GVN A;  3SFZ A;  1IBL M;  4B3M M;  4YY3 M;  2RGO A;  1W5T A;  5BR8 M;  1YUB A;  3KOZ E;  2ERC A;  3NWL A;  4M0W A;  4R3D A;  1XNQ M;  5KPZ A;  1HQC A;  4ITQ A;  1TGU A;  3ILK A;  4LG2 A;  4JI1 M;  4L78 A;  5KQD A;  4PD2 A;  3GRR A;  5DYI A;  2XH9 A;  3HJS A;  1HR0 M;  3UZU A;  2Y0Q A;  2QBY B;  1I94 M;  4IJF A;  3J81 S;  3FTC A;  1KFV A;  5EJC A;  5EP3 A;  5EXS A;  1QQW A;  1YE9 A;  3GQ5 A;  4OX9 M;  3FTE A;  5EP1 A;  1XXH A;  1IXZ A;  4MGK E;  1QAN A;  4KOD A;  3HHY A;  3AJI B;  4PCZ A;  3SAW A;  1PM5 A;  3J80 S;  4IBD A;  5DNY A;  4DR7 M;  4GIT A;  2QPA A;  3FUU A;  1TDH A;  2V6Z M;  5ITX A;  3KOX E;  4LFA M;  1SXJ D;  1TH3 A;  4REZ A;  4D81 A;  1IN8 A;  1T3T A;  2DZO B;  3KW6 A;  5JI3 E;  1TH2 A;  2R46 A;  4FW9 A;  4JI7 M;  2Z7J A;  1QAQ A;  1XMQ M;  2LXE A;  2G8L A;  3GLF B;  2QZ4 A;  2J7O A;  4LY6 A;  3KOW E;  4LJ8 A;  2FE8 A;  3A46 A;  2KA6 B;  3R9X B;  3KOY E;  5KPR A;  4FCW A;  4BLC A;  2I7N A;  3QWL A;  4DR1 M;  4FWD A;  3M0E A;  3J7B A;  3KXE C;  4NXN M;  3TE6 A;  4L8R C;  3K8Z A;  2C96 A;  4DV0 M;  1N36 M;  1DO2 A;  1ZQ9 A;  2R65 A;  3HU3 A;  3AKZ A;  4ZPX A;  2KZU A;  1L2B A;  2K47 A;  2DWM A;  1IN4 A;  4Z8X A;  2R18 A;  2KRU A;  3L2A A;  1KYI A;  4DV6 M;  4JI8 M;  2XFT A;  1FJG M;  3RGP A;  1HNZ M;  3VK8 A;  2DWZ B;  4GC5 A;  2L7H A;  2DWL A;  1G8P A;  4DR3 M;  1IM2 A;  4MGI E;  4PDI A;  2C9C A;  2UXB M;  1QVR A;  4MM3 B;  3FUX A;  4FWH A;  4I5S A;  4NOO B;  3A45 A;  2Q2E B;  2XZU A;  2FFJ A;  4MGH A;  3AL0 C;  3PNV A;  1J7K A;  4MGZ E;  4OVZ A;  5DYG A;  3GP1 A;  1PJJ A;  1W5S A;  2CEA A;  2F5O A;  2P5T A;  1EE8 A;  3DOA A;  2BNK A;  3K92 A;  4LJ7 A;  5IZ7 D;  2QCU A;  2F4V M;  1GL6 A;  3LQQ A;  4LJ6 A;  1NHG C;  1XC8 A;  3T15 A;  3KSX A;  1DGB A;  3FTF A;  1OJL A;  3VKG A;  1MU5 A;  3LQR A;  3FTD A;  4DR5 M;  3IG8 A;  4LF9 M;  4KLN A;  4LZJ A;  2CHQ A;  2UXD M;  2XF3 A;  3A42 A;  3U61 A;  3U6M A;  3L28 A;  1R2Z A;  2UUA M;  1S3S A;  1YSY A;  4DUZ M;  3HJ8 A;  3E9S A;  1XXH B;  4I8O A;  2X49 A;  5ITX E;  2VQF M;  3DFZ A;  3TWM A;  1Q3B A;  4P16 A;  3MHV C;  4NXM M;  5FTJ A;  2HCB A;  2RKO A;  4B7F A;  3GPU A;  3RE8 A;  3U60 A;  1G4A E;  2XZF A;  3TWL A;  2VQE M;  3PNY A;  2NQ8 C;  2X8A A;  2M60 A;  4AG5 A;  2UU9 M;  1Q39 A;  1PJI A;  3WHL A;  3JAM S;  4QOZ C;  4MGY E;  4DV5 M;  3KS8 A;  2X4A A;  3L27 A;  3A98 B;  2L6O A;  4FD2 A;  3D8B A;  4LFB M;  1QAM A;  4RF1 A;  4IBE A;  2KXE A;  4IBI A;  5ITY A;  2DWN A;  3SAU A;  1IY0 A;  2CE7 A;  3UMM A;  3SC3 A;  1G41 A;  5EP2 A;  4MH0 E;  1NHW C;  3DZD A;  5FSW A;  1QYR A;  2C98 A;  1XMO M;  2EO2 A;  4JI5 M;  4AI6 A;  4IIW A;  4JV5 M;  2VII A;  3W0L B;  4A3V B;  4LF5 M;  4LJ5 A;  1E9R A;  1HQY E;  1WXQ A;  2DZN B;  4LJA A;  1L2C A;  3U6Q A;  2OPF A;  4W5W A;  1GKI A;  1OFI A;  1D2N A;  1IQP A;  4GHL A;  3U6S A;  4QHS A;  3PXG A;  3SYK A;  1GLN A;  1ZAE A;  4PDG A;  2LH0 A;  2M5Z A;  2D7H A;  3GPP A;  5ITR A;  2F5Q A;  4B7H A;  3EIH A;  1N33 M;  2KW0 A;  4QNR A;  2YR0 A;  2Y20 A;  2UUC M;  1R6B X;  3LVW A;  3U5Z A;  3HHZ A;  2ZBK B;  1QZM A;  3E4R A;  3FD9 A;  5KPT A;  3AV0 A;  5FTN A;  4II7 A;  3GO8 A;  4LRS A;  4WW0 A;  2HL7 A;  2KRK A;  1ORY B;  4OVZ B;  4X62 M;  2HKJ A;  4K0K M;  1XHB A;  2Y0T A;  4DR4 M;  2DHR A;  2XSZ A;  1NY5 A;  1JR3 A;  1J09 A;  2R45 A;  4BB9 A;  3KDS E;  3SMP A;  3UJN A;  1Z6T A;  3IG5 A;  2AHM A;  3KP1 E;  4JI3 M;  3GPX A;  3U61 B;  1I4W A;  1QAO A;  2C5R A;  4G4R A;  3SBJ A;  2DXI A;  3I4Y A;  2CV0 A;  4LF7 M;  3GQ3 A;  4CGY B;  4KO8 A;  1HNW M;  4DR6 M;  4X66 M;  4LFC M;  3GLI A;  1XWI A;  1HT1 E;  2L7I A;  3K2L A;  3U60 B;  1UM8 A;  4CHT B;  2Z4S A;  4NSO B;  3B9P A;  3M7G A;  1L2D A;  4G4O A;  2H1R A;  3SMS A;  4DV4 M;  2RGH A;  3SAR A;  4FCT A;  4RF0 A;  1TDZ A;  3U6L A;  4D82 A;  5EP4 A;  4PT5 A;  3U6O A;  5FLX S;  1HNX M;  2W82 A;  5EQT A;  4LF6 M;  1K3W A;  4R7G A;  1IXS B;  4GKJ M;  4DV1 M;  2XEP A;  4AKI A;  1N34 M;  3VFD A;  2JA2 A;  4AQY M;  2C99 A;  4GH9 A;  1HT2 E;  3FYC A;  4HLQ A;  3THG A;  2KEB A;  3CF6 E;  5LMU M;  2R62 A;  2CHV A;  3J27 B;  5KO3 A;  2YFQ A;  3QAU A;  4LJ9 A;  4XGI A;  2UXC M;  4DV3 M;  4JI4 M;  3SHF A;  1NNJ A;  1GL7 A;  1NVM A;  3FUW A;  5ITQ A;  3L29 A;  2CUZ A;  3HU1 A;  4QNM A;  2Z4R A;  3NBI A;  1SXJ A;  1IY2 A;  3LMM A;  3L26 A;  2R4E A;  3LVV A;  3SAS A;  2EUC A;  4FCV A;  1DGF A;  4GC9 A;  5E26 A;  5EXX A;  1DGG A;  1XNR M;  3U5Z B;  2I7P A;  2XSZ D;  5E6J A;  1N75 A;  4IBF A;  1C1K A;  5GKN A;  5FTL A;  4LGY A;  1E32 A;  3ZC7 B;  1DGH A;  1JQJ C;  3DA1 A;  1L1Z A;  3GLG A;  3HU2 A;  3AOE A;  3MJ5 A;  4IBK A;  4M9S A;  1Z5C A;  3FKE A;  2A5Y B;  1NJG A;  1G3I A;  3AOG A;  2CV2 A;  1Z5B A;  4LRT A;  4AKG A;  3HHW A;  3BOS A;  4G6Z A;  2QEN A;  4OW0 A;  3JR5 A;  4LGM A;  1NNU C;  5KQ8 A;  3FYD A;  1K3X A;  4IJE A;  1NSF A;  5IWA M;  2XGN A;  4JN6 A;  3JR4 A;  3H4M A;  2XLJ A;  1R7R A;  1IN6 A;  2BJV A;  3CF2 A;  2OQ4 A;  4JI2 M;  1KSF X;  1H6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...