3W0FA

Crystal structure of mouse endonuclease viii-like 3 (mneil3)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
255
Chain Sequence
VEGPGCTLNGEKIRARVLPGQAVTGVRGTALQSLLDSGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMKGSILINPREGENSPALAVQLTRDLICFYDSSVELRNSVESQQRVRVMEELDICSPKFSFSRAESEVKKQGDRMLCDVLLDQRVLPGVGNIIKNEALFDSGLHPAVKVCQLSDKQACHLVKMTRDFSILFYRCCKAGSAISKHCKVYKRPNCDQCHSKITVCRFGENSRMTYFCPHCQKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endonuclease 8-like 3
publication title Structural Characterization of a Mouse Ortholog of Human NEIL3 with a Marked Preference for Single-Stranded DNA
pubmed doi rcsb
source organism Mus musculus
total genus 84
structure length 255
sequence length 282
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3w0fA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3w0fA01
5IT9S 4PDGA 3DOAA 3TWMA 3GPPA 1Z5BA 1MX0A 4DR4M 3GPYA 3C58A 4DUYM 1IBMM 4YY3M 2VQEM 5ITYA 4JI7M 4DV7M 4PCZA 1R2ZA 3A45A 3U6DA 4G4RA 1HR0M 1L1TA 4JV5M 4X62M 3T1HM 1TDZA 4LF6M 2EA0A 3U6OA 4GKKM 2XZFA 1TDHA 4OX9M 1Q3CA 4PDIA 4G4QA 1L2DA 2UU9M 3U6LA 5ITUA 1N34M 5A2QS 3SATA 3SASA 3GP1A 2UXBM 3SAVA 1R2YA 2HHHM 4X66M 2Q2EB 3U6MA 1L2CA 4DV2M 2HKJA 2XZUA 2F5QA 4JI5M 1N33M 4LFCM 5FLXS 5ITXA 2ZBKB 3SAWA 1MU5A 4LF7M 3A42A 2UUAM 3U6EA 1XNRM 4LF9M 4DR2M 3TWKA 4DR5M 4JI6M 1EE8A 4JI8M 1KFVA 3U6PA 4LF4M 2E5LM 4B3TM 4PD2A 1XC8A 3JAMS 4DV0M 3U6QA 5ITRA 3J81S 4G4NA 3GQ3A 3J80S 4X65M 1NNJA 3A46A 3U6CA 4JI2M 3VK7A 4DV6M 4CISA 4JI4M 4LF5M 2VQFM 5ITQA 1Z59A 5IWAM 3JR4A 2F5NA 4B3MM 4DV1M 4G4OA 1HNZM 1Z5AA 1PJJA 1K3WA 4JI0M 3GPUA 4AQYM 3SBJA 5ITXE 2OPFA 4KHPM 4JI3M 4K0KM 2F4VM 4JYAM 2F5OA 4B3SM 4LFAM 1K82A 1Q39A 4DUZM 4MB7A 1I94M 1N36M 1IBLM 4DR6M 4LFBM 1L1ZA 3W0FA 1HNXM 2UUCM 3U6SA 1XNQM 1FJGM 3OTOM 4LF8M 2UUBM 4ITQA 4DR7M 3GQ4A 1K3XA 3VK8A 4B3RM 4NRWA 4X64M 4DV4M 4DV5M 2UXCM 3GQ5A 1Z5CA 3GPXA 1PM5A 5ITTA 1L2BA 5LMNM 1XMQM 5LMUM 4DV3M 1J5EM 3JR5A 4NXMM 4JI1M 1N32M 1HNWM 4NRVA 1IBKM 2F5SA 3T1YM 3J7AS 4GKJM 4DR1M 4YHHM 3TWLA 5BR8M 1Q3BA 2ZM6M 2OQ4A 3SAUA 4NXNM 1XMOM 1PJIA 3GO8A 2UXDM 3SARA 4DR3M 2F5PA
chains in the Genus database with same CATH superfamily
2JNHA 3HU1A 2DAIA 1IY0A 3ILKA 4PDGA 4FW9A 3UJNA 2Z7JA 4L15A 2DHYA 2ZTCA 2D7EA 4LJ8A 3HHXA 4LJ5A 4Y28F 2Z3XA 1MX0A 4I4LA 4DR4M 4AW4A 1IBMM 2X49A 3T38A 5DFLA 1IXSB 2KW0A 2DKLA 4DV7M 2XEPA 1N78A 2LVAA 2DHRA 3SMSA 3ZC7B 1WIVA 1L1TA 2Y0TA 2L4FA 1G4AE 2OOBA 4DBGB 1NHWC 3T1HM 1GO5A 3HGIA 4KT0F 3U6OA 3J27B 1Q3CA 4G4QA 2CV1A 1ZMVA 3U6LA 1SXJD 2L09A 2C9OA 2GNOA 3UZUA 2R6FA 1LV7A 1G8PA 1GL6A 2L6OA 3FYCA 1OFHA 3SASA 2EKKA 2HHHM 4AG6A 2R45A 1XXHE 2LVOC 5F3WA 5KPTA 1L2CA 2XZUA 2F5QA 4JI5M 3FKEA 3CF6E 3HU2A 2ZBKB 3T6PA 3SAWA 1D0KA 3QYEA 4LRTA 3NBXX 3A42A 4RNAA 3U61A 3LQRA 3U6EA 5EP2A 4XGIA 3RGSA 1XNRM 3TWKA 4M0WA 1EE8A 4ZPXA 2JY6B 4LJ9A 3U5ZB 4GHAA 1MJGM 2M60A 1DGHB 2E5LM 2CHQA 4FD2A 4PD2A 4B3TM 1XC8A 4LJ6A 2V6ZM 4P17A 3J81S 3HY5A 1V92A 3GQ3A 3KOXE 3BOSA 3CTWB 4KODA 2JY7A 3VK7A 1D0MA 2QQ8A 2C9CA 4F2LA 1OFIA 4CHTB 4CISA 4IJFA 3TL4X 4AG5A 2DI0A 3B74A 2FS1A 4LCBA 4LG2A 3NWLA 3C3DA 4LF5M 2JUJA 4GC9A 1VQ1A 4W5WA 1SXJA 3M0EA 4JXJA 1G3IA 2VQFM 2B3TA 4B3MM 3GRVA 1DO2A 2FNAA 3HJSA 1JB0F 3KS4A 3GPUA 4AQYM 2MGWA 4Z8XA 5KQDA 1OIZA 2P5TA 4JI3M 4K0KM 2DXIA 4JYAM 3KXEC 2QSFX 2Y20A 2DWZB 4G6ZA 1XXHA 4NOOB 2KEBA 4LFAM 4BB9A 4MB7A 1QUSA 4ANRA 4DR6M 3I4YA 4B7GA 1HNXM 2R4JA 4IBBA 1PGYA 3SYLA 3VLFB 3U6SA 2KHHA 2MJ5B 2CFOA 3HX3A 2FFJA 2KXEA 3OTOM 4LJ4A 3WHKA 4LF8M 1HT1E 3HHWA 2C5RA 4B7HA 1ORYB 1I4WA 2LNHC 3VK8A 1F4IA 1IFYA 3LW5F 2CP8A 3FD9A 3GLIE 2UXCM 3GQ5A 4M9SA 4XBOA 5EXXA 3GRYA 1TH2A 4FWDA 5LMNM 5LMUM 3L27A 1J5EM 3LCUA 3KSXA 5FTNA 3U60A 3DFZA 1HNWM 4NRVA 2DAKA 1YE9A 2JP7A 3J7AS 3IG8A 1OIPA 1NJFA 1QAMA 3AJIB 5FTMA 1X37A 5FSWA 3K2LA 2O01F 2FE8A 2DWNA 4QNMA 4MH0E 3VFDA 1VEKA 3GO8A 2CV0A 4I81A 3GRUA 4FCWA 5FTJA 2XGNA 2CE7A 3KOWE 5E6JA 1E9SA 3GLFE 1GLNA 3K1JA 1QUTA 4IBFA 3V76A 2C96A 2W82A 2YFQA 3PVSA 2WZJA 3QAUA 4YY3M 1T3TA 4JI7M 1NY6A 1NNUC 1GJTA 2BJWA 3FUWA 3FUUA 3GLHE 4MGYE 3U6DA 2QHOB 3FYDA 1L8QA 1WGNA 4JV5M 3B7ZA 1UM8A 1QQWA 1L2DA 1QDTA 2L7HA 4F1IA 5ITUA 2AHMA 4FCVA 2YR0A 1NHGC 1R5LA 2K9DA 3AKZA 5A2QS 3SATA 1LTMA 4LJAA 3GP1A 2RGHA 1HQCA 5GKNA 2Q2EB 3TPZA 5BPVA 4LGYA 2C98A 4NSOB 4LFCM 3LVWA 5ITXA 1NV8A 2V1UA 2DWMA 1IXRC 3GLGE 4OU7A 2LH0A 4LF7M 3AV0A 4EIWA 4RKUF 5KPZA 3VDPA 2KZUA 2KNVA 3R9XB 3IHPA 4DR5M 2YNMD 3I4VA 2G5GX 1IM2A 2CWBA 3A98B 1IQPA 4TUWA 2J5YA 1CUKA 3E4RA 2C99A 3GLIB 2CUZA 4I5SA 5KO3A 4G4NA 3K92A 3U5ZA 1A5TA 1DGHA 4X65M 2ZAOA 1PJSA 2BNKA 2A5YB 1XB2B 3B7NA 1SXJC 3M7GA 3HJ8A 1VEGA 2OO9A 2JA2A 1NO1A 4Q7JA 1JR3E 2XH9A 1ZAEA 4R3DA 1JR3D 1UFZA 4LY6A 4CGYB 5ITQA 2R65A 3K9OA 1YUBA 3UK6A 5IWAM 3KDSE 2RRUA 1Z6TA 4GMQA 3TE6A 4G4OA 1PJJA 4FCTA 4JI0M 1E94E 1SG9A 4G3OA 1PJQA 2JWSA 2I7PA 4MGIE 4A3VB 3E21A 1WR1B 3HZJA 4KHPM 2D7HA 3GLFB 1OAIA 3SAUA 1K82A 4GHLA 1IBLM 3FUTA 3SHGB 5KQ8A 1NVMA 1ZQ9A 3QYBA 2APLA 3D8LA 4IBDA 3GLHB 3KOZE 1FJGM 2Z8YM 2DZNB 3KOYE 1VDDA 3SHFA 4LRSA 2UUBM 3L2AA 2LVQD 5EQTA 3FRIA 4LZZA 1XHBA 3K9PA 5JI2E 2JY8A 4DV4M 2JXNA 4P16A 2GQFA 2XLJA 4AZFA 1PM5A 5ITTA 1G59A 1RU3A 1TTEA 1QZMA 1XWIA 2BWBA 4R71A 4DV3M 3Q8GA 3H4MA 3ZCBB 1PRBA 5H37D 4QOZC 4M9ZA 4JI1M 4QHTA 1IY2A 1IBKM 3AFHA 3T1YM 3GLGB 3SYKA 4GKJM 4AKIA 2JY5A 4IBIA 5FTLA 2ZM6M 4QOSA 3RFWA 1PJIA 4L6V6 2UXDM 2OOAA 4DR3M 3RE8A 1E9RA 4IBEA 3VKGA 1NV9A 1H6UA 1YSYA 4I8OA 4KLNA 1DGFA 5EXTA 1Z5BA 1OQYA 3VDUA 5L8RF 4MGZE 1OJLA 2YQZA 4IBJA 3GPYA 5EP3A 3C58A 4DUYM 3R8FA 3BXWA 1R2ZA 4PCZA 1GL7A 5C18A 3B89A 2LTUA 2XFSA 5C1BA 1HR0M 4AI6A 4QHSA 2QENA 4LF6M 2XZFA 1TDHA 4OX9M 2UU9M 2CHVA 1TGUA 4BBAA 4B08A 2FOIC 2O25A 3FTCA 3AOGA 4RF0A 5IZ7D 2QBYA 3HKPA 2HAKA 3CF2A 4OVZB 2BJVA 2HKJA 4D81A 4REZA 1WJ7A 2JZ1A 1MU5A 3F92A 4KO8A 4QNRA 2HL7A 2DAGA 2K6BA 2CRUA 3BBZA 2O5RA 1R4GA 4HEOA 2DAEA 2DZLA 2CEAA 2UUAM 2DVWB 1KFVA 2R0IA 3U6PA 1QVRA 2EO2A 1IXSA 1KSFX 3DZDA 2J7NA 2WSEF 2Z4RA 3JAMS 5ITRA 8CATA 1IN8A 2DWLA 4NL4H 1NNJA 4AKHA 3GLIA 3I04M 3HU3A 3KW6A 2XF3A 4GH9A 4WW0A 1DO0A 2K0BX 1EFUB 2D7GA 4D80A 3KFUG 1VDLA 2ZAMA 2R44A 3PNVA 4JN6A 2EJSA 2WSCF 1W5TA 1Z59A 3FE3A 4MGKE 4L78A 3SC3A 3JR4A 3I51A 4NC6A 1WXQA 1TH3A 1Z5AA 2DZOB 2M5ZA 4II7A 4OW0A 3SBJA 1Y8GA 1K3WA 4BLCA 2HWJA 2MR9A 3AOEC 5IREB 3HJQA 2QP9X 2F5OA 3IG5A 3L28A 1GKIA 1Q39A 1D2NA 1I94M 4L16A 1N36M 2R62A 4AKGA 1IY1A 4HLQA 3W0FA 1L1ZA 2UUCM 3SFZA 3GLFA 2BWEA 1HT2E 1XNQM 3FUVA 3LMMA 3DA1A 1NSFA 3RGPA 3ZQJA 1J09A 1NJGA 2L4EA 3PFIA 2KRUA 1N75A 3GLHA 3UMMA 4DR7M 2EUCA 5DYGA 5E26A 4NRWA 1FNNA 2X8AA 4GITA 4WP2A 5EXPA 4X64M 2KNZA 1DGGA 2CV2A 3GPXA 2LHGA 4UN2B 4CJ6A 5EP4A 4IJEA 4M0DA 1C1KA 3JR5A 3E46A 2VF8A 3W68A 1OTRA 1QZEA 4GRIA 3C9PA 2V1CA 2VDBB 3KS8A 1SXJE 3KVWA 2F5SA 3WHLA 1QANA 1BVSA 4GC5A 4GEWA 2RKOA 3D8BA 1IN5A 1IN7A 4HL4A 4YHHM 1E32A 2X4AA 1QAQA 3ZH9B 2XSZD 3KSJA 2KA6B 1C7YA 1ZMWA 7CATA 5BR8M 1Q3BA 3AOEA 3J7BA 1JQJC 1OAOC 2LVPC 3E9SA 3GLGA 4IIWA 2OQ4A 2LVNC 3FUXA 3QWLA 3SARA 3EIHA 3PNYA 2F5PA 1W5SA 5IT9S 2QZ4A 4LJ7A 3DOAA 2EKFA 3TWMA 3GPPA 3MHVC 3HHYA 3W67A 2K47A 2VQEM 5ITYA 4MGHA 2Y0QA 3MMPA 3CF0A 1GVNA 3A45A 1QDRA 4PT5A 3Q8XA 4G4RA 2KZSA 2R18A 4IBCA 3FTFA 5JI3E 1T43A 3KP1E 4X62M 1TDZA 2L2DA 2EA0A 4GKKM 4L4UA 3K8ZA 1AUAA 1PJTA 3HWSA 4PDIA 4CIZA 5DNYA 1N77A 1ZMUA 2NQ8C 1JR3A 3C3EA 1N34M 1TH4A 2ZTDA 1NY5A 1T6OA 3FRHA 1DV0A 3MJ5A 2UXBM 3SAVA 1R2YA 3B9PA 4X66M 3U6MA 4DV2M 5EJCA 2KDLA 4B7FA 1N33M 1J7KA 1QYRA 1YLAA 2JZ0A 5FLXS 4FWGA 3U61B 1Q02A 1EIJA 5FTKA 3FTEA 4OVZA 4R7GA 3B7QA 4S12A 1OKSA 4GIPA 3I01M 4MM3B 2QPAA 2XSZA 5EP1A 3HHZA 2QNJA 5EXSA 3THGA 2H1RA 4LF9M 4DR2M 4JI6M 4JI8M 4LF4M 1R7RA 1V34A 3CGWA 4LZJA 2MROB 2QCUA 2Y21A 4DV0M 3U6QA 2XFTA 4RF1A 2CHGA 4XK8F 3J80S 2LXEA 3J2PB 3GRRA 2G3QA 3A46A 1MN3A 3U6CA 4JI2M 3PXGA 3KP0E 4DV6M 3L25A 3T15A 1KYIA 1SXJB 2DENA 3NBIA 1ZV1A 2LWXA 1TR8A 1VEJA 1HQYE 4JI4M 2KNAA 3LQQA 2F5NA 1IN4A 3MK6A 1IXZA 4FVMA 2G8LA 4DV1M 1HNZM 1XXHB 3AL0C 1G41A 5ITXE 2OPFA 3LCVB 2F4VM 3L29A 2R46A 2VIIA 4B3SM 2WSFF 4LFBM 4WURA 2ERCA 5DYIA 3L26A 4DUZM 2LBCA 2Z4SA 3M6AA 2ZANA 2L7IA 2HCBA 5KPRA 2J7OA 1AIPC 1V33A 1DGBA 1QAOA 4LGMA 2I7NA 1WHCA 3EIEA 1S3SA 3FTDA 1HJPA 4ITQA 4IBGA 3W0LB 1GJSA 3VKHA 3GQ4A 1K3XA 3H4JA 4L8RC 4B3RM 2DAMA 4FWHA 2R4EA 2N35A 4Z6YA 4DV5M 3U60B 1Z5CA 1P3QQ 1R6BX 4NSRA 1L2BA 1VG5A 3TQSA 1XMQM 1G71A 1WGLA 3SMPA 2KRKA 3LVVA 4M9XA 2FH0A 2LHCA 4NXMM 4D82A 1N32M 2QBYB 3UGJA 4IBKA 1IN6A 4DR1M 1TF0B 2H5XA 2DNAA 3TWLA 3IECA 2RGOA 4NXNM 1XMOM 1GABA 1D0LA 2MH8A 2VF7A
chains in the Genus database with same CATH topology
3HU1A 1IY0A 3ILKA 4PDGA 4FW9A 3UJNA 2Z7JA 4L15A 4LJ8A 2Z3XA 2D7EA 3HHXA 4LJ5A 1MX0A 4I4LA 4DR4M 4AW4A 1IBMM 2X49A 3T38A 1IXSB 2KW0A 4DV7M 2XEPA 1N78A 2DHRA 3SMSA 3ZC7B 1L1TA 2Y0TA 1G4AE 3T1HM 1NHWC 3HGIA 3U6OA 3J27B 1Q3CA 4G4QA 2CV1A 3U6LA 1SXJD 2L09A 2C9OA 3UZUA 1LV7A 1G8PA 1GL6A 2L6OA 3FYCA 1OFHA 3SASA 2HHHM 4AG6A 2R45A 5F3WA 1L2CA 5KPTA 2XZUA 2F5QA 4JI5M 3FKEA 3CF6E 3HU2A 2ZBKB 3SAWA 4LRTA 3A42A 4RNAA 3U61A 3LQRA 3U6EA 5EP2A 4XGIA 3RGSA 1XNRM 3TWKA 4M0WA 1EE8A 4ZPXA 4LJ9A 3U5ZB 4GHAA 2M60A 1DGHB 2E5LM 2CHQA 4FD2A 4PD2A 4B3TM 1XC8A 4LJ6A 2V6ZM 3J81S 3GQ3A 3KOXE 3BOSA 3CTWB 4KODA 3VK7A 2C9CA 1OFIA 4CHTB 4CISA 4IJFA 3TL4X 4AG5A 4LCBA 4LG2A 3NWLA 4LF5M 4GC9A 4W5WA 2VQFM 1SXJA 3M0EA 4JXJA 1G3IA 4B3MM 3GRVA 1DO2A 2FNAA 3HJSA 3KS4A 3GPUA 4AQYM 4Z8XA 5KQDA 2P5TA 4JI3M 4K0KM 2DXIA 4JYAM 3KXEC 4NOOB 2Y20A 2DWZB 4G6ZA 1XXHA 2KEBA 4LFAM 4BB9A 4MB7A 4DR6M 3I4YA 4B7GA 1HNXM 2R4JA 4IBBA 3SYLA 3VLFB 3U6SA 2CFOA 3OTOM 2FFJA 2KXEA 4LJ4A 3WHKA 4LF8M 1HT1E 3HHWA 2C5RA 4B7HA 1ORYB 1I4WA 2LNHC 3VK8A 3FD9A 2UXCM 3GQ5A 4M9SA 4XBOA 5EXXA 3GRYA 1TH2A 4FWDA 5LMNM 5LMUM 3L27A 1J5EM 5FTNA 3KSXA 3U60A 3DFZA 1HNWM 4NRVA 1YE9A 3J7AS 3IG8A 1NJFA 1QAMA 3AJIB 5FTMA 1X37A 5FSWA 3K2LA 2FE8A 2DWNA 4QNMA 4MH0E 3VFDA 3GO8A 2CV0A 4I81A 4FCWA 5FTJA 2XGNA 2CE7A 3KOWE 5E6JA 1E9SA 1GLNA 3K1JA 4IBFA 2C96A 2W82A 2YFQA 3PVSA 3QAUA 4YY3M 1T3TA 4JI7M 1NY6A 1NNUC 2BJWA 3FUUA 3FUWA 4MGYE 3U6DA 3FYDA 1L8QA 4JV5M 1UM8A 1QQWA 1L2DA 2L7HA 5ITUA 2AHMA 4FCVA 2YR0A 1NHGC 3AKZA 5A2QS 3SATA 4LJAA 3GP1A 2RGHA 1HQCA 5GKNA 2Q2EB 3TPZA 5BPVA 4LGYA 2C98A 4NSOB 4LFCM 3LVWA 5ITXA 2V1UA 2DWMA 1IXRC 4OU7A 2LH0A 4LF7M 3AV0A 4EIWA 5KPZA 3VDPA 2KZUA 3R9XB 4DR5M 2YNMD 3I4VA 2G5GX 1IM2A 3A98B 1IQPA 4TUWA 3E4RA 2C99A 3GLIB 2CUZA 4I5SA 5KO3A 4G4NA 3K92A 3U5ZA 4X65M 1DGHA 2ZAOA 2BNKA 2A5YB 1SXJC 3M7GA 3HJ8A 2JA2A 2XH9A 1ZAEA 4R3DA 1JR3D 4LY6A 4CGYB 5ITQA 2R65A 3UK6A 1YUBA 5IWAM 3KDSE 1Z6TA 4GMQA 3TE6A 4G4OA 1PJJA 4FCTA 4JI0M 1E94E 2I7PA 4MGIE 4A3VB 4KHPM 2D7HA 3GLFB 1K82A 4GHLA 1IBLM 3FUTA 3SHGB 5KQ8A 1NVMA 1ZQ9A 3D8LA 4IBDA 3GLHB 3KOZE 1FJGM 2DZNB 3KOYE 1VDDA 3SHFA 4LRSA 2UUBM 3L2AA 5EQTA 4LZZA 1XHBA 5JI2E 4DV4M 4P16A 2XLJA 4AZFA 1PM5A 5ITTA 1G59A 4DV3M 1QZMA 1XWIA 4QOZC 3ZCBB 3H4MA 5H37D 4M9ZA 4JI1M 4QHTA 1IY2A 1IBKM 3AFHA 3T1YM 3GLGB 3SYKA 4GKJM 4AKIA 4IBIA 5FTLA 2ZM6M 4QOSA 3RFWA 1PJIA 2UXDM 4DR3M 3RE8A 1E9RA 4IBEA 3VKGA 1YSYA 1H6UA 4I8OA 4KLNA 1DGFA 5EXTA 1Z5BA 3VDUA 4MGZE 1OJLA 2YQZA 4IBJA 3GPYA 5EP3A 3C58A 4DUYM 3R8FA 1R2ZA 4PCZA 1GL7A 5C18A 2XFSA 5C1BA 1HR0M 4AI6A 4QHSA 2QENA 4LF6M 2XZFA 1TDHA 4OX9M 2UU9M 2CHVA 1TGUA 4BBAA 4B08A 2FOIC 3FTCA 3AOGA 4RF0A 5IZ7D 2QBYA 3HKPA 3CF2A 4OVZB 2BJVA 2HKJA 4D81A 4REZA 1MU5A 4KO8A 4QNRA 2HL7A 2O5RA 2CEAA 2UUAM 2DVWB 1KFVA 3U6PA 1QVRA 2EO2A 1KSFX 3DZDA 2J7NA 2Z4RA 3JAMS 5ITRA 8CATA 1IN8A 2DWLA 4NL4H 1NNJA 4AKHA 3GLIA 3HU3A 3KW6A 2XF3A 4GH9A 4WW0A 1DO0A 2D7GA 4D80A 3KFUG 2ZAMA 3PNVA 4JN6A 1W5TA 1Z59A 4MGKE 4L78A 3SC3A 3JR4A 3I51A 1WXQA 1TH3A 1Z5AA 2DZOB 2M5ZA 4II7A 4OW0A 3SBJA 1K3WA 4BLCA 5IREB 3AOEC 3HJQA 2QP9X 2F5OA 3IG5A 3L28A 1GKIA 1Q39A 1D2NA 1I94M 4L16A 1N36M 2R62A 4AKGA 1IY1A 4HLQA 3W0FA 1L1ZA 2UUCM 3SFZA 3GLFA 1HT2E 1XNQM 3FUVA 3LMMA 3DA1A 1NSFA 3RGPA 1J09A 1NJGA 3PFIA 2KRUA 1N75A 3GLHA 3UMMA 4DR7M 2EUCA 5DYGA 5E26A 4NRWA 1FNNA 2X8AA 4GITA 5EXPA 4X64M 1DGGA 2CV2A 3GPXA 5EP4A 4IJEA 4M0DA 1C1KA 3JR5A 4GRIA 3KS8A 2V1CA 1SXJE 3KVWA 2F5SA 3WHLA 1QANA 4GC5A 2RKOA 3D8BA 1IN5A 1IN7A 4HL4A 4YHHM 1E32A 2X4AA 1QAQA 3ZH9B 2XSZD 3KSJA 2KA6B 7CATA 5BR8M 1Q3BA 3AOEA 3J7BA 1JQJC 3E9SA 3GLGA 2OQ4A 3SAUA 4IIWA 3QWLA 3FUXA 3SARA 3EIHA 3PNYA 2F5PA 1W5SA 5IT9S 2QZ4A 4LJ7A 3DOAA 3TWMA 3GPPA 3MHVC 3HHYA 2K47A 2VQEM 5ITYA 4MGHA 2Y0QA 3CF0A 1GVNA 3A45A 4PT5A 3Q8XA 4G4RA 2KZSA 2R18A 4IBCA 3FTFA 5JI3E 3KP1E 4X62M 1TDZA 4GKKM 2EA0A 4L4UA 3K8ZA 3HWSA 4PDIA 5DNYA 1N77A 2NQ8C 1JR3A 1N34M 1TH4A 1NY5A 3MJ5A 2UXBM 3SAVA 1R2YA 3B9PA 4X66M 3U6MA 4DV2M 5EJCA 4B7FA 1N33M 1J7KA 1QYRA 5FLXS 3U61B 4FWGA 5FTKA 3FTEA 4OVZA 4R7GA 4S12A 4GIPA 4MM3B 2QPAA 2XSZA 5EP1A 3HHZA 5EXSA 3THGA 2H1RA 4LF9M 4DR2M 4JI6M 4JI8M 4LF4M 1R7RA 4LZJA 2QCUA 2Y21A 4DV0M 3U6QA 2XFTA 4RF1A 2CHGA 3J80S 2LXEA 3J2PB 3GRRA 3A46A 3U6CA 4JI2M 3PXGA 3KP0E 4DV6M 3L25A 3T15A 1KYIA 1SXJB 3NBIA 2LWXA 1HQYE 4JI4M 3LQQA 2F5NA 1IN4A 3MK6A 1IXZA 4FVMA 2G8LA 4DV1M 1HNZM 1XXHB 3AL0C 1G41A 5ITXE 2OPFA 2F4VM 3L29A 2R46A 2VIIA 4B3SM 4LFBM 4WURA 2ERCA 5DYIA 3L26A 4DUZM 2Z4SA 3M6AA 2ZANA 2L7IA 2HCBA 5KPRA 2J7OA 1DGBA 1QAOA 4LGMA 2I7NA 3EIEA 3FTDA 1S3SA 4ITQA 3VKHA 4IBGA 3W0LB 3GQ4A 1K3XA 4L8RC 4B3RM 4FWHA 2R4EA 4Z6YA 3U60B 4DV5M 1Z5CA 4NSRA 1R6BX 1L2BA 3TQSA 1XMQM 3SMPA 2KRKA 3LVVA 4M9XA 4NXMM 4D82A 1N32M 2QBYB 3UGJA 4IBKA 1IN6A 4DR1M 3TWLA 2RGOA 4NXNM 1XMOM 3GRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 S;  4PDG A;  3DOA A;  3TWM A;  3GPP A;  1Z5B A;  1MX0 A;  4DR4 M;  3GPY A;  3C58 A;  4DUY M;  1IBM M;  4YY3 M;  2VQE M;  5ITY A;  4JI7 M;  4DV7 M;  4PCZ A;  1R2Z A;  3A45 A;  3U6D A;  4G4R A;  1HR0 M;  1L1T A;  4JV5 M;  4X62 M;  3T1H M;  1TDZ A;  4LF6 M;  2EA0 A;  3U6O A;  4GKK M;  2XZF A;  1TDH A;  4OX9 M;  1Q3C A;  4PDI A;  4G4Q A;  1L2D A;  2UU9 M;  3U6L A;  5ITU A;  1N34 M;  5A2Q S;  3SAT A;  3SAS A;  3GP1 A;  2UXB M;  3SAV A;  1R2Y A;  2HHH M;  4X66 M;  2Q2E B;  3U6M A;  1L2C A;  4DV2 M;  2HKJ A;  2XZU A;  2F5Q A;  4JI5 M;  1N33 M;  4LFC M;  5FLX S;  5ITX A;  2ZBK B;  3SAW A;  1MU5 A;  4LF7 M;  3A42 A;  2UUA M;  3U6E A;  1XNR M;  4LF9 M;  4DR2 M;  3TWK A;  4DR5 M;  4JI6 M;  1EE8 A;  4JI8 M;  1KFV A;  3U6P A;  4LF4 M;  2E5L M;  4B3T M;  4PD2 A;  1XC8 A;  3JAM S;  4DV0 M;  3U6Q A;  5ITR A;  3J81 S;  4G4N A;  3GQ3 A;  3J80 S;  4X65 M;  1NNJ A;  3A46 A;  3U6C A;  4JI2 M;  3VK7 A;  4DV6 M;  4CIS A;  4JI4 M;  4LF5 M;  2VQF M;  5ITQ A;  1Z59 A;  5IWA M;  3JR4 A;  2F5N A;  4B3M M;  4DV1 M;  4G4O A;  1HNZ M;  1Z5A A;  1PJJ A;  1K3W A;  4JI0 M;  3GPU A;  4AQY M;  3SBJ A;  5ITX E;  2OPF A;  4KHP M;  4JI3 M;  4K0K M;  2F4V M;  4JYA M;  2F5O A;  4B3S M;  4LFA M;  1K82 A;  1Q39 A;  4DUZ M;  4MB7 A;  1I94 M;  1N36 M;  1IBL M;  4DR6 M;  4LFB M;  1L1Z A;  3W0F A;  1HNX M;  2UUC M;  3U6S A;  1XNQ M;  1FJG M;  3OTO M;  4LF8 M;  2UUB M;  4ITQ A;  4DR7 M;  3GQ4 A;  1K3X A;  3VK8 A;  4B3R M;  4NRW A;  4X64 M;  4DV4 M;  4DV5 M;  2UXC M;  3GQ5 A;  1Z5C A;  3GPX A;  1PM5 A;  5ITT A;  1L2B A;  5LMN M;  1XMQ M;  5LMU M;  4DV3 M;  1J5E M;  3JR5 A;  4NXM M;  4JI1 M;  1N32 M;  1HNW M;  4NRV A;  1IBK M;  2F5S A;  3T1Y M;  3J7A S;  4GKJ M;  4DR1 M;  4YHH M;  3TWL A;  5BR8 M;  1Q3B A;  2ZM6 M;  2OQ4 A;  3SAU A;  4NXN M;  1XMO M;  1PJI A;  3GO8 A;  2UXD M;  3SAR A;  4DR3 M;  2F5P A; 
#chains in the Genus database with same CATH topology
 2JNH A;  3HU1 A;  2DAI A;  1IY0 A;  3ILK A;  4PDG A;  4FW9 A;  3UJN A;  2Z7J A;  4L15 A;  2DHY A;  2ZTC A;  2D7E A;  4LJ8 A;  3HHX A;  4LJ5 A;  4Y28 F;  2Z3X A;  1MX0 A;  4I4L A;  4DR4 M;  4AW4 A;  1IBM M;  2X49 A;  3T38 A;  5DFL A;  1IXS B;  2KW0 A;  2DKL A;  4DV7 M;  2XEP A;  1N78 A;  2LVA A;  2DHR A;  3SMS A;  3ZC7 B;  1WIV A;  1L1T A;  2Y0T A;  2L4F A;  1G4A E;  2OOB A;  4DBG B;  1NHW C;  3T1H M;  1GO5 A;  3HGI A;  4KT0 F;  3U6O A;  3J27 B;  1Q3C A;  4G4Q A;  2CV1 A;  1ZMV A;  3U6L A;  1SXJ D;  2L09 A;  2C9O A;  2GNO A;  3UZU A;  2R6F A;  1LV7 A;  1G8P A;  1GL6 A;  2L6O A;  3FYC A;  1OFH A;  3SAS A;  2EKK A;  2HHH M;  4AG6 A;  2R45 A;  1XXH E;  2LVO C;  5F3W A;  5KPT A;  1L2C A;  2XZU A;  2F5Q A;  4JI5 M;  3FKE A;  3CF6 E;  3HU2 A;  2ZBK B;  3T6P A;  3SAW A;  1D0K A;  3QYE A;  4LRT A;  3NBX X;  3A42 A;  4RNA A;  3U61 A;  3LQR A;  3U6E A;  5EP2 A;  4XGI A;  3RGS A;  1XNR M;  3TWK A;  4M0W A;  1EE8 A;  4ZPX A;  2JY6 B;  4LJ9 A;  3U5Z B;  4GHA A;  1MJG M;  2M60 A;  1DGH B;  2E5L M;  2CHQ A;  4FD2 A;  4PD2 A;  4B3T M;  1XC8 A;  4LJ6 A;  2V6Z M;  4P17 A;  3J81 S;  3HY5 A;  1V92 A;  3GQ3 A;  3KOX E;  3BOS A;  3CTW B;  4KOD A;  2JY7 A;  3VK7 A;  1D0M A;  2QQ8 A;  2C9C A;  4F2L A;  1OFI A;  4CHT B;  4CIS A;  4IJF A;  3TL4 X;  4AG5 A;  2DI0 A;  3B74 A;  2FS1 A;  4LCB A;  4LG2 A;  3NWL A;  3C3D A;  4LF5 M;  2JUJ A;  4GC9 A;  1VQ1 A;  4W5W A;  1SXJ A;  3M0E A;  4JXJ A;  1G3I A;  2VQF M;  2B3T A;  4B3M M;  3GRV A;  1DO2 A;  2FNA A;  3HJS A;  1JB0 F;  3KS4 A;  3GPU A;  4AQY M;  2MGW A;  4Z8X A;  5KQD A;  1OIZ A;  2P5T A;  4JI3 M;  4K0K M;  2DXI A;  4JYA M;  3KXE C;  2QSF X;  2Y20 A;  2DWZ B;  4G6Z A;  1XXH A;  4NOO B;  2KEB A;  4LFA M;  4BB9 A;  4MB7 A;  1QUS A;  4ANR A;  4DR6 M;  3I4Y A;  4B7G A;  1HNX M;  2R4J A;  4IBB A;  1PGY A;  3SYL A;  3VLF B;  3U6S A;  2KHH A;  2MJ5 B;  2CFO A;  3HX3 A;  2FFJ A;  2KXE A;  3OTO M;  4LJ4 A;  3WHK A;  4LF8 M;  1HT1 E;  3HHW A;  2C5R A;  4B7H A;  1ORY B;  1I4W A;  2LNH C;  3VK8 A;  1F4I A;  1IFY A;  3LW5 F;  2CP8 A;  3FD9 A;  3GLI E;  2UXC M;  3GQ5 A;  4M9S A;  4XBO A;  5EXX A;  3GRY A;  1TH2 A;  4FWD A;  5LMN M;  5LMU M;  3L27 A;  1J5E M;  3LCU A;  3KSX A;  5FTN A;  3U60 A;  3DFZ A;  1HNW M;  4NRV A;  2DAK A;  1YE9 A;  2JP7 A;  3J7A S;  3IG8 A;  1OIP A;  1NJF A;  1QAM A;  3AJI B;  5FTM A;  1X37 A;  5FSW A;  3K2L A;  2O01 F;  2FE8 A;  2DWN A;  4QNM A;  4MH0 E;  3VFD A;  1VEK A;  3GO8 A;  2CV0 A;  4I81 A;  3GRU A;  4FCW A;  5FTJ A;  2XGN A;  2CE7 A;  3KOW E;  5E6J A;  1E9S A;  3GLF E;  1GLN A;  3K1J A;  1QUT A;  4IBF A;  3V76 A;  2C96 A;  2W82 A;  2YFQ A;  3PVS A;  2WZJ A;  3QAU A;  4YY3 M;  1T3T A;  4JI7 M;  1NY6 A;  1NNU C;  1GJT A;  2BJW A;  3FUW A;  3FUU A;  3GLH E;  4MGY E;  3U6D A;  2QHO B;  3FYD A;  1L8Q A;  1WGN A;  4JV5 M;  3B7Z A;  1UM8 A;  1QQW A;  1L2D A;  1QDT A;  2L7H A;  4F1I A;  5ITU A;  2AHM A;  4FCV A;  2YR0 A;  1NHG C;  1R5L A;  2K9D A;  3AKZ A;  5A2Q S;  3SAT A;  1LTM A;  4LJA A;  3GP1 A;  2RGH A;  1HQC A;  5GKN A;  2Q2E B;  3TPZ A;  5BPV A;  4LGY A;  2C98 A;  4NSO B;  4LFC M;  3LVW A;  5ITX A;  1NV8 A;  2V1U A;  2DWM A;  1IXR C;  3GLG E;  4OU7 A;  2LH0 A;  4LF7 M;  3AV0 A;  4EIW A;  4RKU F;  5KPZ A;  3VDP A;  2KZU A;  2KNV A;  3R9X B;  3IHP A;  4DR5 M;  2YNM D;  3I4V A;  2G5G X;  1IM2 A;  2CWB A;  3A98 B;  1IQP A;  4TUW A;  2J5Y A;  1CUK A;  3E4R A;  2C99 A;  3GLI B;  2CUZ A;  4I5S A;  5KO3 A;  4G4N A;  3K92 A;  3U5Z A;  1A5T A;  1DGH A;  4X65 M;  2ZAO A;  1PJS A;  2BNK A;  2A5Y B;  1XB2 B;  3B7N A;  1SXJ C;  3M7G A;  3HJ8 A;  1VEG A;  2OO9 A;  2JA2 A;  1NO1 A;  4Q7J A;  1JR3 E;  2XH9 A;  1ZAE A;  4R3D A;  1JR3 D;  1UFZ A;  4LY6 A;  4CGY B;  5ITQ A;  2R65 A;  3K9O A;  1YUB A;  3UK6 A;  5IWA M;  3KDS E;  2RRU A;  1Z6T A;  4GMQ A;  3TE6 A;  4G4O A;  1PJJ A;  4FCT A;  4JI0 M;  1E94 E;  1SG9 A;  4G3O A;  1PJQ A;  2JWS A;  2I7P A;  4MGI E;  4A3V B;  3E21 A;  1WR1 B;  3HZJ A;  4KHP M;  2D7H A;  3GLF B;  1OAI A;  3SAU A;  1K82 A;  4GHL A;  1IBL M;  3FUT A;  3SHG B;  5KQ8 A;  1NVM A;  1ZQ9 A;  3QYB A;  2APL A;  3D8L A;  4IBD A;  3GLH B;  3KOZ E;  1FJG M;  2Z8Y M;  2DZN B;  3KOY E;  1VDD A;  3SHF A;  4LRS A;  2UUB M;  3L2A A;  2LVQ D;  5EQT A;  3FRI A;  4LZZ A;  1XHB A;  3K9P A;  5JI2 E;  2JY8 A;  4DV4 M;  2JXN A;  4P16 A;  2GQF A;  2XLJ A;  4AZF A;  1PM5 A;  5ITT A;  1G59 A;  1RU3 A;  1TTE A;  1QZM A;  1XWI A;  2BWB A;  4R71 A;  4DV3 M;  3Q8G A;  3H4M A;  3ZCB B;  1PRB A;  5H37 D;  4QOZ C;  4M9Z A;  4JI1 M;  4QHT A;  1IY2 A;  1IBK M;  3AFH A;  3T1Y M;  3GLG B;  3SYK A;  4GKJ M;  4AKI A;  2JY5 A;  4IBI A;  5FTL A;  2ZM6 M;  4QOS A;  3RFW A;  1PJI A;  4L6V 6;  2UXD M;  2OOA A;  4DR3 M;  3RE8 A;  1E9R A;  4IBE A;  3VKG A;  1NV9 A;  1H6U A;  1YSY A;  4I8O A;  4KLN A;  1DGF A;  5EXT A;  1Z5B A;  1OQY A;  3VDU A;  5L8R F;  4MGZ E;  1OJL A;  2YQZ A;  4IBJ A;  3GPY A;  5EP3 A;  3C58 A;  4DUY M;  3R8F A;  3BXW A;  1R2Z A;  4PCZ A;  1GL7 A;  5C18 A;  3B89 A;  2LTU A;  2XFS A;  5C1B A;  1HR0 M;  4AI6 A;  4QHS A;  2QEN A;  4LF6 M;  2XZF A;  1TDH A;  4OX9 M;  2UU9 M;  2CHV A;  1TGU A;  4BBA A;  4B08 A;  2FOI C;  2O25 A;  3FTC A;  3AOG A;  4RF0 A;  5IZ7 D;  2QBY A;  3HKP A;  2HAK A;  3CF2 A;  4OVZ B;  2BJV A;  2HKJ A;  4D81 A;  4REZ A;  1WJ7 A;  2JZ1 A;  1MU5 A;  3F92 A;  4KO8 A;  4QNR A;  2HL7 A;  2DAG A;  2K6B A;  2CRU A;  3BBZ A;  2O5R A;  1R4G A;  4HEO A;  2DAE A;  2DZL A;  2CEA A;  2UUA M;  2DVW B;  1KFV A;  2R0I A;  3U6P A;  1QVR A;  2EO2 A;  1IXS A;  1KSF X;  3DZD A;  2J7N A;  2WSE F;  2Z4R A;  3JAM S;  5ITR A;  8CAT A;  1IN8 A;  2DWL A;  4NL4 H;  1NNJ A;  4AKH A;  3GLI A;  3I04 M;  3HU3 A;  3KW6 A;  2XF3 A;  4GH9 A;  4WW0 A;  1DO0 A;  2K0B X;  1EFU B;  2D7G A;  4D80 A;  3KFU G;  1VDL A;  2ZAM A;  2R44 A;  3PNV A;  4JN6 A;  2EJS A;  2WSC F;  1W5T A;  1Z59 A;  3FE3 A;  4MGK E;  4L78 A;  3SC3 A;  3JR4 A;  3I51 A;  4NC6 A;  1WXQ A;  1TH3 A;  1Z5A A;  2DZO B;  2M5Z A;  4II7 A;  4OW0 A;  3SBJ A;  1Y8G A;  1K3W A;  4BLC A;  2HWJ A;  2MR9 A;  3AOE C;  5IRE B;  3HJQ A;  2QP9 X;  2F5O A;  3IG5 A;  3L28 A;  1GKI A;  1Q39 A;  1D2N A;  1I94 M;  4L16 A;  1N36 M;  2R62 A;  4AKG A;  1IY1 A;  4HLQ A;  3W0F A;  1L1Z A;  2UUC M;  3SFZ A;  3GLF A;  2BWE A;  1HT2 E;  1XNQ M;  3FUV A;  3LMM A;  3DA1 A;  1NSF A;  3RGP A;  3ZQJ A;  1J09 A;  1NJG A;  2L4E A;  3PFI A;  2KRU A;  1N75 A;  3GLH A;  3UMM A;  4DR7 M;  2EUC A;  5DYG A;  5E26 A;  4NRW A;  1FNN A;  2X8A A;  4GIT A;  4WP2 A;  5EXP A;  4X64 M;  2KNZ A;  1DGG A;  2CV2 A;  3GPX A;  2LHG A;  4UN2 B;  4CJ6 A;  5EP4 A;  4IJE A;  4M0D A;  1C1K A;  3JR5 A;  3E46 A;  2VF8 A;  3W68 A;  1OTR A;  1QZE A;  4GRI A;  3C9P A;  2V1C A;  2VDB B;  3KS8 A;  1SXJ E;  3KVW A;  2F5S A;  3WHL A;  1QAN A;  1BVS A;  4GC5 A;  4GEW A;  2RKO A;  3D8B A;  1IN5 A;  1IN7 A;  4HL4 A;  4YHH M;  1E32 A;  2X4A A;  1QAQ A;  3ZH9 B;  2XSZ D;  3KSJ A;  2KA6 B;  1C7Y A;  1ZMW A;  7CAT A;  5BR8 M;  1Q3B A;  3AOE A;  3J7B A;  1JQJ C;  1OAO C;  2LVP C;  3E9S A;  3GLG A;  4IIW A;  2OQ4 A;  2LVN C;  3FUX A;  3QWL A;  3SAR A;  3EIH A;  3PNY A;  2F5P A;  1W5S A;  5IT9 S;  2QZ4 A;  4LJ7 A;  3DOA A;  2EKF A;  3TWM A;  3GPP A;  3MHV C;  3HHY A;  3W67 A;  2K47 A;  2VQE M;  5ITY A;  4MGH A;  2Y0Q A;  3MMP A;  3CF0 A;  1GVN A;  3A45 A;  1QDR A;  4PT5 A;  3Q8X A;  4G4R A;  2KZS A;  2R18 A;  4IBC A;  3FTF A;  5JI3 E;  1T43 A;  3KP1 E;  4X62 M;  1TDZ A;  2L2D A;  2EA0 A;  4GKK M;  4L4U A;  3K8Z A;  1AUA A;  1PJT A;  3HWS A;  4PDI A;  4CIZ A;  5DNY A;  1N77 A;  1ZMU A;  2NQ8 C;  1JR3 A;  3C3E A;  1N34 M;  1TH4 A;  2ZTD A;  1NY5 A;  1T6O A;  3FRH A;  1DV0 A;  3MJ5 A;  2UXB M;  3SAV A;  1R2Y A;  3B9P A;  4X66 M;  3U6M A;  4DV2 M;  5EJC A;  2KDL A;  4B7F A;  1N33 M;  1J7K A;  1QYR A;  1YLA A;  2JZ0 A;  5FLX S;  4FWG A;  3U61 B;  1Q02 A;  1EIJ A;  5FTK A;  3FTE A;  4OVZ A;  4R7G A;  3B7Q A;  4S12 A;  1OKS A;  4GIP A;  3I01 M;  4MM3 B;  2QPA A;  2XSZ A;  5EP1 A;  3HHZ A;  2QNJ A;  5EXS A;  3THG A;  2H1R A;  4LF9 M;  4DR2 M;  4JI6 M;  4JI8 M;  4LF4 M;  1R7R A;  1V34 A;  3CGW A;  4LZJ A;  2MRO B;  2QCU A;  2Y21 A;  4DV0 M;  3U6Q A;  2XFT A;  4RF1 A;  2CHG A;  4XK8 F;  3J80 S;  2LXE A;  3J2P B;  3GRR A;  2G3Q A;  3A46 A;  1MN3 A;  3U6C A;  4JI2 M;  3PXG A;  3KP0 E;  4DV6 M;  3L25 A;  3T15 A;  1KYI A;  1SXJ B;  2DEN A;  3NBI A;  1ZV1 A;  2LWX A;  1TR8 A;  1VEJ A;  1HQY E;  4JI4 M;  2KNA A;  3LQQ A;  2F5N A;  1IN4 A;  3MK6 A;  1IXZ A;  4FVM A;  2G8L A;  4DV1 M;  1HNZ M;  1XXH B;  3AL0 C;  1G41 A;  5ITX E;  2OPF A;  3LCV B;  2F4V M;  3L29 A;  2R46 A;  2VII A;  4B3S M;  2WSF F;  4LFB M;  4WUR A;  2ERC A;  5DYI A;  3L26 A;  4DUZ M;  2LBC A;  2Z4S A;  3M6A A;  2ZAN A;  2L7I A;  2HCB A;  5KPR A;  2J7O A;  1AIP C;  1V33 A;  1DGB A;  1QAO A;  4LGM A;  2I7N A;  1WHC A;  3EIE A;  1S3S A;  3FTD A;  1HJP A;  4ITQ A;  4IBG A;  3W0L B;  1GJS A;  3VKH A;  3GQ4 A;  1K3X A;  3H4J A;  4L8R C;  4B3R M;  2DAM A;  4FWH A;  2R4E A;  2N35 A;  4Z6Y A;  4DV5 M;  3U60 B;  1Z5C A;  1P3Q Q;  1R6B X;  4NSR A;  1L2B A;  1VG5 A;  3TQS A;  1XMQ M;  1G71 A;  1WGL A;  3SMP A;  2KRK A;  3LVV A;  4M9X A;  2FH0 A;  2LHC A;  4NXM M;  4D82 A;  1N32 M;  2QBY B;  3UGJ A;  4IBK A;  1IN6 A;  4DR1 M;  1TF0 B;  2H5X A;  2DNA A;  3TWL A;  3IEC A;  2RGO A;  4NXN M;  1XMO M;  1GAB A;  1D0L A;  2MH8 A;  2VF7 A; 
#chains in the Genus database with same CATH homology
 3HU1 A;  1IY0 A;  3ILK A;  4PDG A;  4FW9 A;  3UJN A;  2Z7J A;  4L15 A;  4LJ8 A;  2Z3X A;  2D7E A;  3HHX A;  4LJ5 A;  1MX0 A;  4I4L A;  4DR4 M;  4AW4 A;  1IBM M;  2X49 A;  3T38 A;  1IXS B;  2KW0 A;  4DV7 M;  2XEP A;  1N78 A;  2DHR A;  3SMS A;  3ZC7 B;  1L1T A;  2Y0T A;  1G4A E;  3T1H M;  1NHW C;  3HGI A;  3U6O A;  3J27 B;  1Q3C A;  4G4Q A;  2CV1 A;  3U6L A;  1SXJ D;  2L09 A;  2C9O A;  3UZU A;  1LV7 A;  1G8P A;  1GL6 A;  2L6O A;  3FYC A;  1OFH A;  3SAS A;  2HHH M;  4AG6 A;  2R45 A;  5F3W A;  1L2C A;  5KPT A;  2XZU A;  2F5Q A;  4JI5 M;  3FKE A;  3CF6 E;  3HU2 A;  2ZBK B;  3SAW A;  4LRT A;  3A42 A;  4RNA A;  3U61 A;  3LQR A;  3U6E A;  5EP2 A;  4XGI A;  3RGS A;  1XNR M;  3TWK A;  4M0W A;  1EE8 A;  4ZPX A;  4LJ9 A;  3U5Z B;  4GHA A;  2M60 A;  1DGH B;  2E5L M;  2CHQ A;  4FD2 A;  4PD2 A;  4B3T M;  1XC8 A;  4LJ6 A;  2V6Z M;  3J81 S;  3GQ3 A;  3KOX E;  3BOS A;  3CTW B;  4KOD A;  3VK7 A;  2C9C A;  1OFI A;  4CHT B;  4CIS A;  4IJF A;  3TL4 X;  4AG5 A;  4LCB A;  4LG2 A;  3NWL A;  4LF5 M;  4GC9 A;  4W5W A;  2VQF M;  1SXJ A;  3M0E A;  4JXJ A;  1G3I A;  4B3M M;  3GRV A;  1DO2 A;  2FNA A;  3HJS A;  3KS4 A;  3GPU A;  4AQY M;  4Z8X A;  5KQD A;  2P5T A;  4JI3 M;  4K0K M;  2DXI A;  4JYA M;  3KXE C;  4NOO B;  2Y20 A;  2DWZ B;  4G6Z A;  1XXH A;  2KEB A;  4LFA M;  4BB9 A;  4MB7 A;  4DR6 M;  3I4Y A;  4B7G A;  1HNX M;  2R4J A;  4IBB A;  3SYL A;  3VLF B;  3U6S A;  2CFO A;  3OTO M;  2FFJ A;  2KXE A;  4LJ4 A;  3WHK A;  4LF8 M;  1HT1 E;  3HHW A;  2C5R A;  4B7H A;  1ORY B;  1I4W A;  2LNH C;  3VK8 A;  3FD9 A;  2UXC M;  3GQ5 A;  4M9S A;  4XBO A;  5EXX A;  3GRY A;  1TH2 A;  4FWD A;  5LMN M;  5LMU M;  3L27 A;  1J5E M;  5FTN A;  3KSX A;  3U60 A;  3DFZ A;  1HNW M;  4NRV A;  1YE9 A;  3J7A S;  3IG8 A;  1NJF A;  1QAM A;  3AJI B;  5FTM A;  1X37 A;  5FSW A;  3K2L A;  2FE8 A;  2DWN A;  4QNM A;  4MH0 E;  3VFD A;  3GO8 A;  2CV0 A;  4I81 A;  4FCW A;  5FTJ A;  2XGN A;  2CE7 A;  3KOW E;  5E6J A;  1E9S A;  1GLN A;  3K1J A;  4IBF A;  2C96 A;  2W82 A;  2YFQ A;  3PVS A;  3QAU A;  4YY3 M;  1T3T A;  4JI7 M;  1NY6 A;  1NNU C;  2BJW A;  3FUU A;  3FUW A;  4MGY E;  3U6D A;  3FYD A;  1L8Q A;  4JV5 M;  1UM8 A;  1QQW A;  1L2D A;  2L7H A;  5ITU A;  2AHM A;  4FCV A;  2YR0 A;  1NHG C;  3AKZ A;  5A2Q S;  3SAT A;  4LJA A;  3GP1 A;  2RGH A;  1HQC A;  5GKN A;  2Q2E B;  3TPZ A;  5BPV A;  4LGY A;  2C98 A;  4NSO B;  4LFC M;  3LVW A;  5ITX A;  2V1U A;  2DWM A;  1IXR C;  4OU7 A;  2LH0 A;  4LF7 M;  3AV0 A;  4EIW A;  5KPZ A;  3VDP A;  2KZU A;  3R9X B;  4DR5 M;  2YNM D;  3I4V A;  2G5G X;  1IM2 A;  3A98 B;  1IQP A;  4TUW A;  3E4R A;  2C99 A;  3GLI B;  2CUZ A;  4I5S A;  5KO3 A;  4G4N A;  3K92 A;  3U5Z A;  4X65 M;  1DGH A;  2ZAO A;  2BNK A;  2A5Y B;  1SXJ C;  3M7G A;  3HJ8 A;  2JA2 A;  2XH9 A;  1ZAE A;  4R3D A;  1JR3 D;  4LY6 A;  4CGY B;  5ITQ A;  2R65 A;  3UK6 A;  1YUB A;  5IWA M;  3KDS E;  1Z6T A;  4GMQ A;  3TE6 A;  4G4O A;  1PJJ A;  4FCT A;  4JI0 M;  1E94 E;  2I7P A;  4MGI E;  4A3V B;  4KHP M;  2D7H A;  3GLF B;  1K82 A;  4GHL A;  1IBL M;  3FUT A;  3SHG B;  5KQ8 A;  1NVM A;  1ZQ9 A;  3D8L A;  4IBD A;  3GLH B;  3KOZ E;  1FJG M;  2DZN B;  3KOY E;  1VDD A;  3SHF A;  4LRS A;  2UUB M;  3L2A A;  5EQT A;  4LZZ A;  1XHB A;  5JI2 E;  4DV4 M;  4P16 A;  2XLJ A;  4AZF A;  1PM5 A;  5ITT A;  1G59 A;  4DV3 M;  1QZM A;  1XWI A;  4QOZ C;  3ZCB B;  3H4M A;  5H37 D;  4M9Z A;  4JI1 M;  4QHT A;  1IY2 A;  1IBK M;  3AFH A;  3T1Y M;  3GLG B;  3SYK A;  4GKJ M;  4AKI A;  4IBI A;  5FTL A;  2ZM6 M;  4QOS A;  3RFW A;  1PJI A;  2UXD M;  4DR3 M;  3RE8 A;  1E9R A;  4IBE A;  3VKG A;  1YSY A;  1H6U A;  4I8O A;  4KLN A;  1DGF A;  5EXT A;  1Z5B A;  3VDU A;  4MGZ E;  1OJL A;  2YQZ A;  4IBJ A;  3GPY A;  5EP3 A;  3C58 A;  4DUY M;  3R8F A;  1R2Z A;  4PCZ A;  1GL7 A;  5C18 A;  2XFS A;  5C1B A;  1HR0 M;  4AI6 A;  4QHS A;  2QEN A;  4LF6 M;  2XZF A;  1TDH A;  4OX9 M;  2UU9 M;  2CHV A;  1TGU A;  4BBA A;  4B08 A;  2FOI C;  3FTC A;  3AOG A;  4RF0 A;  5IZ7 D;  2QBY A;  3HKP A;  3CF2 A;  4OVZ B;  2BJV A;  2HKJ A;  4D81 A;  4REZ A;  1MU5 A;  4KO8 A;  4QNR A;  2HL7 A;  2O5R A;  2CEA A;  2UUA M;  2DVW B;  1KFV A;  3U6P A;  1QVR A;  2EO2 A;  1KSF X;  3DZD A;  2J7N A;  2Z4R A;  3JAM S;  5ITR A;  8CAT A;  1IN8 A;  2DWL A;  4NL4 H;  1NNJ A;  4AKH A;  3GLI A;  3HU3 A;  3KW6 A;  2XF3 A;  4GH9 A;  4WW0 A;  1DO0 A;  2D7G A;  4D80 A;  3KFU G;  2ZAM A;  3PNV A;  4JN6 A;  1W5T A;  1Z59 A;  4MGK E;  4L78 A;  3SC3 A;  3JR4 A;  3I51 A;  1WXQ A;  1TH3 A;  1Z5A A;  2DZO B;  2M5Z A;  4II7 A;  4OW0 A;  3SBJ A;  1K3W A;  4BLC A;  5IRE B;  3AOE C;  3HJQ A;  2QP9 X;  2F5O A;  3IG5 A;  3L28 A;  1GKI A;  1Q39 A;  1D2N A;  1I94 M;  4L16 A;  1N36 M;  2R62 A;  4AKG A;  1IY1 A;  4HLQ A;  3W0F A;  1L1Z A;  2UUC M;  3SFZ A;  3GLF A;  1HT2 E;  1XNQ M;  3FUV A;  3LMM A;  3DA1 A;  1NSF A;  3RGP A;  1J09 A;  1NJG A;  3PFI A;  2KRU A;  1N75 A;  3GLH A;  3UMM A;  4DR7 M;  2EUC A;  5DYG A;  5E26 A;  4NRW A;  1FNN A;  2X8A A;  4GIT A;  5EXP A;  4X64 M;  1DGG A;  2CV2 A;  3GPX A;  5EP4 A;  4IJE A;  4M0D A;  1C1K A;  3JR5 A;  4GRI A;  3KS8 A;  2V1C A;  1SXJ E;  3KVW A;  2F5S A;  3WHL A;  1QAN A;  4GC5 A;  2RKO A;  3D8B A;  1IN5 A;  1IN7 A;  4HL4 A;  4YHH M;  1E32 A;  2X4A A;  1QAQ A;  3ZH9 B;  2XSZ D;  3KSJ A;  2KA6 B;  7CAT A;  5BR8 M;  1Q3B A;  3AOE A;  3J7B A;  1JQJ C;  3E9S A;  3GLG A;  2OQ4 A;  3SAU A;  4IIW A;  3QWL A;  3FUX A;  3SAR A;  3EIH A;  3PNY A;  2F5P A;  1W5S A;  5IT9 S;  2QZ4 A;  4LJ7 A;  3DOA A;  3TWM A;  3GPP A;  3MHV C;  3HHY A;  2K47 A;  2VQE M;  5ITY A;  4MGH A;  2Y0Q A;  3CF0 A;  1GVN A;  3A45 A;  4PT5 A;  3Q8X A;  4G4R A;  2KZS A;  2R18 A;  4IBC A;  3FTF A;  5JI3 E;  3KP1 E;  4X62 M;  1TDZ A;  4GKK M;  2EA0 A;  4L4U A;  3K8Z A;  3HWS A;  4PDI A;  5DNY A;  1N77 A;  2NQ8 C;  1JR3 A;  1N34 M;  1TH4 A;  1NY5 A;  3MJ5 A;  2UXB M;  3SAV A;  1R2Y A;  3B9P A;  4X66 M;  3U6M A;  4DV2 M;  5EJC A;  4B7F A;  1N33 M;  1J7K A;  1QYR A;  5FLX S;  3U61 B;  4FWG A;  5FTK A;  3FTE A;  4OVZ A;  4R7G A;  4S12 A;  4GIP A;  4MM3 B;  2QPA A;  2XSZ A;  5EP1 A;  3HHZ A;  5EXS A;  3THG A;  2H1R A;  4LF9 M;  4DR2 M;  4JI6 M;  4JI8 M;  4LF4 M;  1R7R A;  4LZJ A;  2QCU A;  2Y21 A;  4DV0 M;  3U6Q A;  2XFT A;  4RF1 A;  2CHG A;  3J80 S;  2LXE A;  3J2P B;  3GRR A;  3A46 A;  3U6C A;  4JI2 M;  3PXG A;  3KP0 E;  4DV6 M;  3L25 A;  3T15 A;  1KYI A;  1SXJ B;  3NBI A;  2LWX A;  1HQY E;  4JI4 M;  3LQQ A;  2F5N A;  1IN4 A;  3MK6 A;  1IXZ A;  4FVM A;  2G8L A;  4DV1 M;  1HNZ M;  1XXH B;  3AL0 C;  1G41 A;  5ITX E;  2OPF A;  2F4V M;  3L29 A;  2R46 A;  2VII A;  4B3S M;  4LFB M;  4WUR A;  2ERC A;  5DYI A;  3L26 A;  4DUZ M;  2Z4S A;  3M6A A;  2ZAN A;  2L7I A;  2HCB A;  5KPR A;  2J7O A;  1DGB A;  1QAO A;  4LGM A;  2I7N A;  3EIE A;  3FTD A;  1S3S A;  4ITQ A;  3VKH A;  4IBG A;  3W0L B;  3GQ4 A;  1K3X A;  4L8R C;  4B3R M;  4FWH A;  2R4E A;  4Z6Y A;  3U60 B;  4DV5 M;  1Z5C A;  4NSR A;  1R6B X;  1L2B A;  3TQS A;  1XMQ M;  3SMP A;  2KRK A;  3LVV A;  4M9X A;  4NXM M;  4D82 A;  1N32 M;  2QBY B;  3UGJ A;  4IBK A;  1IN6 A;  4DR1 M;  3TWL A;  2RGO A;  4NXN M;  1XMO M;  3GRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...