3W0FA

Crystal structure of mouse endonuclease viii-like 3 (mneil3)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
255
Chain Sequence
VEGPGCTLNGEKIRARVLPGQAVTGVRGTALQSLLDSGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMKGSILINPREGENSPALAVQLTRDLICFYDSSVELRNSVESQQRVRVMEELDICSPKFSFSRAESEVKKQGDRMLCDVLLDQRVLPGVGNIIKNEALFDSGLHPAVKVCQLSDKQACHLVKMTRDFSILFYRCCKAGSAISKHCKVYKRPNCDQCHSKITVCRFGENSRMTYFCPHCQKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease 8-like 3
publication title Structural Characterization of a Mouse Ortholog of Human NEIL3 with a Marked Preference for Single-Stranded DNA
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 84
structure length 255
sequence length 282
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3w0fA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3w0fA01
4X65M 1XNRM 4DV4M 2UUBM 2F4VM 4JI4M 4DV0M 4G4OA 4LF4M 3J81S 4DV6M 2UXBM 3GPXA 4G4NA 3T1YM 4JI1M 5ITYA 4GKKM 2Q2EB 4DV5M 3SARA 2UUCM 4LF5M 4DR1M 3U6LA 3GO8A 4B3RM 2HKJA 4JI3M 5ITUA 4LF9M 3JR4A 2OQ4A 3GQ4A 2VQEM 4LF6M 4DUYM 4DUZM 3C58A 4DR7M 4AQYM 4X64M 4B3TM 3W0FA 2VQFM 1L2CA 4YHHM 3DOAA 3TWLA 4JYAM 1HNWM 2EA0A 3U6QA 4X62M 2XZFA 5ITTA 3J80S 3A46A 3VK7A 1K3WA 4PCZA 1Z5AA 2UUAM 4DR4M 1K82A 4NXMM 1Q3BA 4DV3M 2F5QA 3GQ5A 3T1HM 3SAWA 4DR2M 1XC8A 4G4RA 2F5SA 2F5PA 1R2ZA 4PD2A 4GKJM 5LMUM 2UXDM 4LFBM 2ZM6M 1HR0M 3A42A 4B3SM 2HHHM 1FJGM 1R2YA 1L1TA 4LF7M 4B3MM 3J7AS 1I94M 5IT9S 4NXNM 4JI5M 4PDGA 4DR5M 4X66M 3GQ3A 4DR6M 5ITQA 5BR8M 3U6CA 1MU5A 5ITXA 4DV1M 3TWMA 4JI2M 2UU9M 4CISA 5ITXE 1HNZM 2F5OA 1XNQM 3U6SA 3U6DA 5A2QS 4DV2M 4PDIA 1N32M 1IBKM 4NRWA 4LF8M 3U6EA 3SATA 1L1ZA 1J5EM 1IBLM 3SBJA 3U6OA 4JV5M 3A45A 4JI0M 2OPFA 1Z5BA 1K3XA 5IWAM 1Z59A 4DR3M 1EE8A 3JR5A 2XZUA 4ITQA 4LFAM 4LFCM 1Z5CA 1TDHA 3JAMS 3SAUA 4JI7M 4G4QA 3VK8A 1L2BA 4NRVA 2E5LM 4MB7A 1Q39A 1XMOM 5ITRA 1NNJA 3GPYA 3OTOM 2F5NA 1Q3CA 3SASA 1HNXM 1KFVA 4K0KM 1PJIA 4JI6M 2UXCM 1N34M 1XMQM 3GP1A 4DV7M 1PM5A 4KHPM 3SAVA 3U6PA 1N36M 5FLXS 3U6MA 3GPUA 3GPPA 2ZBKB 4JI8M 5LMNM 1MX0A 1PJJA 1N33M 4YY3M 1L2DA 4OX9M 1IBMM 1TDZA 3TWKA
chains in the Genus database with same CATH superfamily
2M60A 3FTFA 2F4VM 2KNZA 4QNRA 2LTUA 3IHPA 2G5GX 4DV0M 2ZTCA 2BWEA 4LF4M 4G4NA 4JI1M 1UFZA 4RKUF 3GLHA 1GVNA 2UUCM 4LF5M 1UM8A 3T6PA 2C9OA 4LF9M 3FYCA 3HWSA 2OQ4A 1PRBA 3HGIA 4QOZC 1IY2A 3C58A 3AL0C 2O25A 3FRHA 5FTKA 4AQYM 1NVMA 2Y21A 3W0FA 1Q02A 4L6V6 2QBYB 2EA0A 3U5ZA 3R8FA 5ITTA 3J80S 3A46A 1IXRC 3B7QA 3TQSA 1D0MA 1Z5AA 1IN6A 2BJWA 4A3VB 1JR3A 3NBXX 3MHVC 4I81A 3KW6A 3HJ8A 2EKKA 2EKFA 1SG9A 3FE3A 4L15A 2L4FA 2DAKA 4MGIE 5EXPA 4LJ4A 3SAWA 3K1JA 1XC8A 2MR9A 4R7GA 2JP7A 3E46A 1L8QA 5EP4A 5LMUM 4LFBM 2UXDM 1PJTA 1I4WA 3A42A 2KNVA 1ZMWA 3K9PA 1E94E 2CUZA 2V6ZM 3KSJA 1WJ7A 4LJ9A 5L8RF 2FS1A 1I94M 4WP2A 4NXNM 5ITRA 4JI5M 1V33A 1E9SA 4I4LA 2EJSA 3V76A 4BBAA 1R6BX 3U61B 2R46A 2H5XA 3FRIA 3CTWB 2HWJA 4IBKA 5EP2A 3UJNA 2UU9M 2F5OA 2JY7A 2H1RA 4F1IA 7CATA 1R4GA 3U6DA 3A98B 1IXZA 1N32M 2GQFA 1GL7A 2JY8A 1IBKM 3CF2A 4L78A 2K6BA 4FWHA 2DHYA 1HT2E 3GRUA 1T43A 3U6OA 2FFJA 2R18A 1KYIA 1GJTA 3CF0A 3ILKA 2EO2A 1P3QQ 3SFZA 4CGYB 5E26A 3KFUG 3M0EA 2K0BX 1X37A 2DAMA 2QENA 4QHTA 5JI3E 4DR3M 1DGHA 1T3TA 1Z5CA 3SAUA 3KOWE 4G4QA 5DFLA 4NRVA 3EIHA 2FE8A 3SYLA 2APLA 1XB2B 1JQJC 1G4AE 1NJFA 2KXEA 4QHSA 3SHGB 1YE9A 2R44A 3I4VA 1Q39A 1QVRA 2RGOA 2O01F 3H4MA 4I5SA 2ZAOA 5GKNA 2LWXA 3RFWA 4BB9A 1G41A 1XXHB 4IBIA 3MJ5A 2DXIA 5FSWA 3U60B 1PJIA 4IJEA 4JI6M 3L27A 3GLFA 2XFTA 1ZAEA 3K2LA 4AW4A 5C18A 3GLGA 1QDTA 4LCBA 2BNKA 2DKLA 2D7GA 2XSZD 1KSFX 3J7BA 5FLXS 1OAIA 2QP9X 1HQCA 2G8LA 4AG6A 3B7ZA 3HHYA 2DVWB 2I7PA 2WZJA 3PNVA 1PJJA 2R62A 2JZ1A 1DO2A 1L2DA 2MGWA 3J27B 1VEJA 3E21A 8CATA 4X65M 1R7RA 3VFDA 4DV4M 3FUUA 2UUBM 5H37D 3VKHA 2K47A 4II7A 1FNNA 2L09A 2CFOA 3I04M 3GPXA 4DV6M 2B3TA 4M9ZA 4GKKM 1NY5A 2Q2EB 3K9OA 3SARA 2CWBA 3GLHE 2N35A 3GO8A 2HKJA 3HU1A 5ITUA 1J09A 3AOGA 2HCBA 3KOXE 3GLIB 2VQEM 4DUYM 4R3DA 4DUZM 5IREB 2CE7A 4KLNA 4LJAA 4IBDA 1V34A 1L2CA 3DOAA 2D7EA 4WW0A 5KPZA 2JNHA 2P5TA 3LQQA 4OVZB 1QZEA 1EFUB 2KZUA 3J2PB 4X62M 2XZFA 1HNWM 4F2LA 2Z8YM 1K3WA 1IXSA 2MJ5B 1SXJC 2KRUA 1D2NA 1JR3E 1PGYA 4XK8F 1YLAA 3FUXA 4FCWA 4GMQA 4LJ8A 4HLQA 3GQ5A 2XF3A 2ZANA 3NBIA 1HJPA 5JI2E 3L25A 4PD2A 1QYRA 3FTCA 2LVQD 1R5LA 2ZM6M 1HR0M 1TTEA 4GITA 2LHGA 4LRSA 2CV1A 4LY6A 2KHHA 1ZMUA 2L6OA 2YFQA 3F92A 4M9SA 1R2YA 1AIPC 5KPRA 4B3MM 4LZZA 3QWLA 2DZLA 2QBYA 3UGJA 1GJSA 3KS8A 4B7GA 1TH2A 4JXJA 4CJ6A 1IFYA 2VDBB 1NNUC 2DAIA 3D8LA 1YSYA 3IG8A 5BR8M 1SXJD 4NSOB 3U6CA 2ERCA 3CF6E 2KW0A 1GKIA 3L2AA 3HHWA 2RKOA 4M9XA 4GRIA 2JUJA 3HU2A 3D8BA 4GEWA 4AKHA 4B08A 3E4RA 4FWDA 3KXEC 5EJCA 3VDUA 4LRTA 1IN4A 3RGPA 1J5EM 4LG2A 4JV5M 2Z4RA 3A45A 4LZJA 2XH9A 4LJ7A 2OPFA 3WHKA 4CHTB 1Z5BA 2C96A 3M7GA 2VF8A 4EIWA 1Z59A 3FTDA 2XSZA 1TH3A 2GNOA 3U61A 2DENA 2XZUA 1IQPA 4ITQA 3FYDA 1OQYA 1PJQA 3BXWA 3KSXA 3VK8A 1A5TA 3B9PA 1IY0A 3L29A 2LVAA 2E5LM 1G71A 1WIVA 4D82A 3ZC7B 1XMOM 3LMMA 5DYGA 4Y28F 2JWSA 4Z8XA 1E9RA 1D0LA 5EP3A 4QNMA 2CHVA 5KO3A 4LGMA 1HQYE 3AOEA 4NL4H 3GLFE 3SAVA 3U6PA 3HKPA 3GLGE 2MROB 3IECA 3UMMA 4AZFA 1IN5A 1N75A 1JB0F 1OKSA 1NJGA 2RRUA 3ZQJA 3L26A 3GPPA 1DV0A 2R4EA 1OAOC 2X4AA 4YY3M 1ORYB 2CP8A 2HL7A 1IBMM 1QAOA 3TWKA 2DNAA 2C98A 1TDZA 3I01M 2DWLA 1XNRM 2DAEA 2CEAA 2MH8A 1T6OA 4L4UA 3K8ZA 3R9XB 5FTMA 1VEGA 1WGLA 3C3EA 4RNAA 3HJQA 1XXHA 3SMPA 4FVMA 3SYKA 3U60A 3CGWA 2C99A 4NC6A 3DZDA 3W67A 1IY1A 4IBJA 4B3RM 3HZJA 3Q8GA 3JR4A 2LH0A 3GQ4A 2L4EA 2JA2A 3AOEC 4GHLA 1VDDA 1GO5A 4DR7M 2JY5A 1NHWC 2QNJA 4X64M 4TUWA 2OO9A 4MGYE 1XHBA 2VQFM 3T38A 3TPZA 2QZ4A 4YHHM 3TWLA 3KP1E 4NSRA 2QQ8A 3U6QA 4M0DA 3VK7A 2O5RA 2VF7A 2HAKA 3FUWA 4QOSA 2C5RA 1E32A 4G6ZA 4ANRA 2G3QA 3QYEA 2QHOB 3SC3A 4RF1A 4DR4M 1SXJA 1Q3BA 1TF0B 4IBBA 4DV3M 2Y0TA 2F5QA 1GABA 3C9PA 3PFIA 1DGBA 2YR0A 3T1HM 1TH4A 2R6FA 4DR2M 1QUSA 3RE8A 4G4RA 2F5SA 1WGNA 1R2ZA 3GLIA 4GKJM 1NV8A 2HHHM 2LBCA 1W5TA 4REZA 2BWBA 3LCVB 1CUKA 3THGA 1FJGM 2D7HA 2XEPA 1F4IA 1L1TA 2X8AA 1DGGA 3EIEA 2L7IA 1IM2A 2DZNB 3QYBA 1GLNA 2R65A 4OVZA 4R71A 4PDGA 4AKGA 3K92A 3MMPA 4DR5M 1OJLA 1VG5A 2DWMA 2CV0A 4X66M 1D0KA 3AKZA 5ITQA 5KQ8A 5DNYA 1G3IA 4BLCA 2Y20A 3W0LB 1EIJA 2JY6B 2WSCF 1NY6A 4MM3B 3B7NA 5ITXA 4DV1M 4JI2M 3M6AA 5DYIA 1RU3A 4XGIA 5IZ7D 2V1UA 3LQRA 1XNQM 3E9SA 4CIZA 5KPTA 3B74A 1C7YA 4PDIA 2KZSA 3I51A 4NRWA 3ZH9B 3U6EA 3UZUA 4PT5A 3SATA 4Z6YA 5EXSA 4MGHA 1L1ZA 3GRYA 2BJVA 3DFZA 4MGKE 3VKGA 2M5ZA 3L28A 1QAQA 3HX3A 2LVOC 4FW9A 1ZQ9A 4IJFA 5IWAM 1QZMA 3JR5A 5E6JA 3C3DA 4FCTA 2CV2A 4LFAM 2NQ8C 3FUTA 1J7KA 1G59A 1L2BA 1IXSB 3VDPA 3BOSA 3IG5A 2DWNA 2ZTDA 1NNJA 3GPYA 3OTOM 1IN7A 1IN8A 4KT0F 3SASA 4GH9A 1HNXM 5BPVA 1KFVA 3GLHB 4G3OA 4K0KM 1N78A 2X49A 1N34M 1XMQM 4GC9A 1VDLA 3SMSA 3GP1A 1WXQA 1PM5A 3LW5F 3FKEA 3AJIB 4IIWA 3U6MA 2DHRA 3NWLA 4LGYA 4S12A 4WURA 2EUCA 3HHZA 1MX0A 2J7OA 3AV0A 3SHFA 4NOOB 4KODA 1BVSA 4D81A 2DAGA 3U5ZB 2DI0A 4CISA 1H6UA 4FCVA 3MK6A 4JI4M 4HEOA 1ZMVA 1OTRA 3W68A 4G4OA 3J81S 4OW0A 2UXBM 3T1YM 1LTMA 1QQWA 2OOAA 4I8OA 4MGZE 4FWGA 1OFHA 1XXHE 1PJSA 5ITYA 4IBCA 4DV5M 4AI6A 4DR1M 4B7HA 3HHXA 3U6LA 3KOZE 4JI3M 1V92A 2KRKA 2DZOB 3UK6A 4LF6M 2KA6B 4UN2B 5KQDA 4B3TM 2K9DA 2QCUA 1WR1B 3BBZA 2R4JA 4JYAM 3KOYE 2A5YB 3FUVA 3Q8XA 4GIPA 2DWZB 4PCZA 1OFIA 1W5SA 2UUAM 3GRVA 3KS4A 4D80A 1K82A 4NXMM 1DGFA 1SXJE 4W5WA 5EXXA 1MJGM 2FNAA 3LVVA 1NO1A 2CHQA 3PNYA 4LJ6A 2F5PA 2V1CA 4IBFA 2XGNA 1TGUA 1N77A 1QUTA 4KO8A 3GLIE 4B3SM 1GL6A 2L2DA 3GRRA 4ZPXA 2J5YA 4LF7M 2JXNA 2OOBA 1AUAA 1ZV1A 3J7AS 5IT9S 4DBGB 2C9CA 3HU3A 3AFHA 4MH0E 4RF0A 4M0WA 3FD9A 4OU7A 1JR3D 3GQ3A 4DR6M 5F3WA 3B89A 4AKIA 2LVNC 1DGHB 2CRUA 2LHCA 2RGHA 4Q7JA 1MU5A 1G8PA 3T15A 1LV7A 1Y8GA 4GC5A 4L16A 3TWMA 3DA1A 2CHGA 2WSEF 3LCUA 1NV9A 1OIPA 3KP0E 5ITXE 1HNZM 3U6SA 5A2QS 4DV2M 2R0IA 2R45A 4LF8M 1HT1E 3PVSA 2XLJA 2VIIA 5EXTA 1QANA 4P17A 2Z3XA 4XBOA 4L8RC 3VLFB 2WSFF 1IBLM 3PXGA 3SBJA 3TL4X 3GLFB 4JI0M 2FH0A 3I4YA 4AG5A 1S3SA 3GLGB 3LVWA 2LNHC 1K3XA 1EE8A 1VEKA 2Z4SA 2KNAA 2XFSA 5FTJA 1YUBA 4B7FA 5FTLA 1MN3A 4LFCM 1TDHA 4LJ5A 3JAMS 4JI7M 4GHAA 2ZAMA 1Z6TA 2LVPC 2YNMD 3KDSE 2KDLA 2J7NA 3QAUA 4MB7A 1SXJB 2YQZA 3WHLA 1WHCA 5C1BA 5EQTA 2F5NA 2Z7JA 5FTNA 3TE6A 2QPAA 4FD2A 1DO0A 1Q3CA 1TR8A 1NHGC 4JN6A 2AHMA 2UXCM 4DV7M 1VQ1A 2JZ0A 3FTEA 4KHPM 2W82A 4P16A 1NSFA 2L7HA 2FOIC 1N36M 3KVWA 4IBGA 2I7NA 1QDRA 3HJSA 2QSFX 3ZCBB 3GPUA 1XWIA 2KEBA 2LXEA 2ZBKB 3HY5A 4HL4A 5EP1A 5LMNM 4JI8M 1C1KA 1N33M 3RGSA 1OIZA 4OX9M 4IBEA 3H4JA 2Y0QA 1QAMA
chains in the Genus database with same CATH topology
2M60A 3FTFA 2F4VM 4QNRA 4DV0M 4LF4M 2G5GX 4G4NA 4JI1M 3GLHA 1GVNA 2UUCM 4LF5M 1UM8A 2C9OA 4LF9M 3FYCA 3HWSA 2OQ4A 3HGIA 4QOZC 1IY2A 3C58A 3AL0C 4AQYM 5FTKA 1NVMA 2Y21A 3W0FA 2QBYB 2EA0A 3U5ZA 3R8FA 5ITTA 3J80S 3A46A 1IXRC 3TQSA 1Z5AA 1IN6A 2BJWA 4A3VB 1JR3A 3MHVC 4I81A 3KW6A 3HJ8A 4L15A 4MGIE 5EXPA 4LJ4A 3SAWA 3K1JA 1XC8A 4R7GA 1L8QA 5EP4A 5LMUM 4LFBM 2UXDM 1I4WA 3A42A 1E94E 2CUZA 2V6ZM 3KSJA 4LJ9A 1I94M 4NXNM 4JI5M 1E9SA 4I4LA 4BBAA 1R6BX 3U61B 2R46A 3CTWB 4IBKA 5EP2A 3UJNA 2UU9M 2F5OA 2H1RA 7CATA 3U6DA 3A98B 1IXZA 1N32M 1GL7A 1IBKM 3CF2A 4L78A 4FWHA 1HT2E 3GRUA 3U6OA 2FFJA 2R18A 1KYIA 3CF0A 3ILKA 2EO2A 3SFZA 4CGYB 3KFUG 5E26A 3M0EA 1X37A 4DR3M 2QENA 4QHTA 5JI3E 1DGHA 1T3TA 1Z5CA 3SAUA 3KOWE 4G4QA 4NRVA 3EIHA 2FE8A 3SYLA 1JQJC 1G4AE 1NJFA 2KXEA 4QHSA 3SHGB 1YE9A 3I4VA 1Q39A 1QVRA 2RGOA 3H4MA 4I5SA 5GKNA 2ZAOA 3RFWA 2LWXA 4BB9A 5ITRA 1G41A 1XXHB 4IBIA 3MJ5A 2DXIA 5FSWA 3U60B 1PJIA 4IJEA 4JI6M 3L27A 3GLFA 2XFTA 1ZAEA 3K2LA 4AW4A 5C18A 3GLGA 4LCBA 2BNKA 2XSZD 2D7GA 3J7BA 1KSFX 5FLXS 2QP9X 1HQCA 2G8LA 4AG6A 3HHYA 2DVWB 2I7PA 3PNVA 1PJJA 2R62A 1DO2A 1L2DA 3J27B 8CATA 4X65M 1R7RA 3VFDA 4DV4M 3FUUA 2UUBM 5H37D 3VKHA 2K47A 4II7A 1FNNA 2L09A 2CFOA 4DV6M 3GPXA 4M9ZA 4GKKM 1NY5A 2Q2EB 3SARA 3GO8A 2HKJA 3HU1A 5ITUA 1J09A 3AOGA 2HCBA 3KOXE 3GLIB 2VQEM 4DUYM 4R3DA 4DUZM 5IREB 2CE7A 4KLNA 4LJAA 4IBDA 1L2CA 3DOAA 2D7EA 4WW0A 5KPZA 3LQQA 2P5TA 4OVZB 1HNWM 2KZUA 3J2PB 4X62M 2XZFA 1K3WA 1SXJC 2KRUA 1D2NA 4FCWA 3FUXA 4GMQA 4LJ8A 4HLQA 3GQ5A 2XF3A 2ZANA 3NBIA 5JI2E 3L25A 4PD2A 1QYRA 3FTCA 2ZM6M 1HR0M 4GITA 4LRSA 2CV1A 4LY6A 2L6OA 2YFQA 1R2YA 4M9SA 5KPRA 4B3MM 4LZZA 3QWLA 2QBYA 3UGJA 3KS8A 4B7GA 1TH2A 4JXJA 1NNUC 3D8LA 1YSYA 3IG8A 5BR8M 1SXJD 4NSOB 3U6CA 2ERCA 3CF6E 2KW0A 1GKIA 3L2AA 3HHWA 2RKOA 4M9XA 4GRIA 3HU2A 3D8BA 4AKHA 4B08A 3E4RA 4FWDA 3KXEC 5EJCA 3VDUA 4LRTA 1IN4A 3RGPA 1J5EM 4LG2A 4JV5M 2Z4RA 3A45A 4LZJA 2XH9A 4LJ7A 2OPFA 3WHKA 4CHTB 1Z5BA 2C96A 3M7GA 4EIWA 1Z59A 3FTDA 2XSZA 1TH3A 3U61A 2XZUA 4ITQA 1IQPA 3FYDA 3KSXA 3VK8A 3B9PA 1IY0A 3L29A 2E5LM 4D82A 3ZC7B 1XMOM 3LMMA 5DYGA 4Z8XA 1E9RA 5EP3A 4QNMA 2CHVA 5KO3A 4LGMA 1HQYE 3AOEA 4NL4H 3SAVA 3U6PA 3HKPA 3UMMA 4AZFA 1IN5A 1N75A 1NJGA 3L26A 3GPPA 2R4EA 2X4AA 4YY3M 1ORYB 2HL7A 1IBMM 1QAOA 3TWKA 1TDZA 2C98A 2DWLA 1XNRM 3R9XB 2CEAA 4L4UA 3K8ZA 5FTMA 4RNAA 3HJQA 1XXHA 3SMPA 4FVMA 3SYKA 3U60A 2C99A 3DZDA 1IY1A 4IBJA 4B3RM 3JR4A 2LH0A 3GQ4A 2JA2A 3AOEC 4GHLA 1VDDA 4DR7M 1NHWC 4X64M 4TUWA 4MGYE 1XHBA 2VQFM 3T38A 3TPZA 2QZ4A 4YHHM 3TWLA 3KP1E 4NSRA 3U6QA 4M0DA 3VK7A 2O5RA 4QOSA 3FUWA 2C5RA 1E32A 4G6ZA 3SC3A 4RF1A 4DR4M 1SXJA 1Q3BA 4DV3M 4IBBA 2F5QA 2Y0TA 3PFIA 1DGBA 2YR0A 3T1HM 1TH4A 4DR2M 3RE8A 4G4RA 2F5SA 1R2ZA 3GLIA 4GKJM 2HHHM 3THGA 1W5TA 4REZA 1FJGM 2D7HA 2XEPA 1L1TA 2X8AA 1DGGA 3EIEA 2L7IA 1IM2A 2DZNB 1GLNA 2R65A 4OVZA 4PDGA 4AKGA 3K92A 4DR5M 1OJLA 2DWMA 2CV0A 4X66M 3AKZA 5ITQA 5KQ8A 5DNYA 1G3IA 4BLCA 2Y20A 3W0LB 1NY6A 4MM3B 5ITXA 4DV1M 4JI2M 3M6AA 5DYIA 5IZ7D 4XGIA 3LQRA 1XNQM 3E9SA 5KPTA 4PDIA 2KZSA 3I51A 4NRWA 3ZH9B 3U6EA 3UZUA 4PT5A 3SATA 4Z6YA 5EXSA 4MGHA 1L1ZA 3GRYA 2BJVA 3DFZA 4MGKE 3VKGA 2M5ZA 3L28A 1QAQA 4FW9A 1ZQ9A 4IJFA 5IWAM 1QZMA 3JR5A 5E6JA 4FCTA 2CV2A 4LFAM 2NQ8C 3FUTA 1J7KA 1G59A 1L2BA 1IXSB 3VDPA 3BOSA 3IG5A 2DWNA 1NNJA 3GPYA 3OTOM 1IN7A 1IN8A 3SASA 4GH9A 1HNXM 5BPVA 1KFVA 3GLHB 1N78A 4K0KM 2X49A 1N34M 1XMQM 4GC9A 3GP1A 3SMSA 1PM5A 1WXQA 3FKEA 3AJIB 4IIWA 3U6MA 2DHRA 3NWLA 4LGYA 4S12A 4WURA 2EUCA 3HHZA 1MX0A 2J7OA 3AV0A 3SHFA 4NOOB 4KODA 4D81A 3U5ZB 4CISA 1H6UA 4FCVA 3MK6A 4JI4M 4G4OA 3J81S 4OW0A 2UXBM 3T1YM 1QQWA 5ITYA 4I8OA 4MGZE 4FWGA 1OFHA 4DV5M 4AI6A 4IBCA 4DR1M 4B7HA 3HHXA 3U6LA 3KOZE 4JI3M 2KRKA 2DZOB 3UK6A 4LF6M 2KA6B 5KQDA 4B3TM 2QCUA 2R4JA 4JYAM 3KOYE 2A5YB 3FUVA 3Q8XA 4GIPA 2DWZB 4PCZA 1OFIA 1W5SA 2UUAM 3GRVA 3KS4A 4D80A 1K82A 4NXMM 1DGFA 1SXJE 4W5WA 5EXXA 2FNAA 3LVVA 4LJ6A 2CHQA 3PNYA 2F5PA 2V1CA 4IBFA 2XGNA 1TGUA 1N77A 4KO8A 4B3SM 1GL6A 3GRRA 4ZPXA 4LF7M 3J7AS 5IT9S 2C9CA 3HU3A 3AFHA 4MH0E 4RF0A 4M0WA 3FD9A 4OU7A 1JR3D 3GQ3A 4DR6M 5F3WA 4AKIA 1DGHB 2RGHA 1MU5A 1G8PA 3T15A 1LV7A 4GC5A 4L16A 3TWMA 3DA1A 2CHGA 5ITXE 1HNZM 3KP0E 3U6SA 5A2QS 4DV2M 2R45A 4LF8M 1HT1E 3PVSA 2XLJA 2VIIA 5EXTA 1QANA 2Z3XA 4XBOA 4L8RC 3VLFB 1IBLM 3PXGA 3SBJA 3TL4X 3GLFB 4JI0M 3I4YA 4AG5A 1S3SA 3GLGB 3LVWA 2LNHC 1K3XA 1EE8A 2Z4SA 4B7FA 2XFSA 5FTJA 1YUBA 5FTLA 4LFCM 1TDHA 4LJ5A 3JAMS 4JI7M 4GHAA 2ZAMA 1Z6TA 2YNMD 3KDSE 2J7NA 3QAUA 3WHLA 4MB7A 1SXJB 2YQZA 5C1BA 5EQTA 2F5NA 2Z7JA 5FTNA 3TE6A 2QPAA 4FD2A 1DO0A 1Q3CA 1NHGC 4JN6A 2AHMA 2UXCM 4DV7M 3FTEA 4KHPM 2W82A 4P16A 1NSFA 2L7HA 2FOIC 1N36M 3KVWA 4IBGA 2I7NA 3HJSA 3GPUA 3ZCBB 1XWIA 2KEBA 2LXEA 2ZBKB 4HL4A 5EP1A 5LMNM 4JI8M 1C1KA 1N33M 3RGSA 2V1UA 4OX9M 4IBEA 2Y0QA 1QAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 M;  1XNR M;  4DV4 M;  2UUB M;  2F4V M;  4JI4 M;  4DV0 M;  4G4O A;  4LF4 M;  3J81 S;  4DV6 M;  2UXB M;  3GPX A;  4G4N A;  3T1Y M;  4JI1 M;  5ITY A;  4GKK M;  2Q2E B;  4DV5 M;  3SAR A;  2UUC M;  4LF5 M;  4DR1 M;  3U6L A;  3GO8 A;  4B3R M;  2HKJ A;  4JI3 M;  5ITU A;  4LF9 M;  3JR4 A;  2OQ4 A;  3GQ4 A;  2VQE M;  4LF6 M;  4DUY M;  4DUZ M;  3C58 A;  4DR7 M;  4AQY M;  4X64 M;  4B3T M;  3W0F A;  2VQF M;  1L2C A;  4YHH M;  3DOA A;  3TWL A;  4JYA M;  1HNW M;  2EA0 A;  3U6Q A;  4X62 M;  2XZF A;  5ITT A;  3J80 S;  3A46 A;  3VK7 A;  1K3W A;  4PCZ A;  1Z5A A;  2UUA M;  4DR4 M;  1K82 A;  4NXM M;  1Q3B A;  4DV3 M;  2F5Q A;  3GQ5 A;  3T1H M;  3SAW A;  4DR2 M;  1XC8 A;  4G4R A;  2F5S A;  2F5P A;  1R2Z A;  4PD2 A;  4GKJ M;  5LMU M;  2UXD M;  4LFB M;  2ZM6 M;  1HR0 M;  3A42 A;  4B3S M;  2HHH M;  1FJG M;  1R2Y A;  1L1T A;  4LF7 M;  4B3M M;  3J7A S;  1I94 M;  5IT9 S;  4NXN M;  4JI5 M;  4PDG A;  4DR5 M;  4X66 M;  3GQ3 A;  4DR6 M;  5ITQ A;  5BR8 M;  3U6C A;  1MU5 A;  5ITX A;  4DV1 M;  3TWM A;  4JI2 M;  2UU9 M;  4CIS A;  5ITX E;  1HNZ M;  2F5O A;  1XNQ M;  3U6S A;  3U6D A;  5A2Q S;  4DV2 M;  4PDI A;  1N32 M;  1IBK M;  4NRW A;  4LF8 M;  3U6E A;  3SAT A;  1L1Z A;  1J5E M;  1IBL M;  3SBJ A;  3U6O A;  4JV5 M;  3A45 A;  4JI0 M;  2OPF A;  1Z5B A;  1K3X A;  5IWA M;  1Z59 A;  4DR3 M;  1EE8 A;  3JR5 A;  2XZU A;  4ITQ A;  4LFA M;  4LFC M;  1Z5C A;  1TDH A;  3JAM S;  3SAU A;  4JI7 M;  4G4Q A;  3VK8 A;  1L2B A;  4NRV A;  2E5L M;  4MB7 A;  1Q39 A;  1XMO M;  5ITR A;  1NNJ A;  3GPY A;  3OTO M;  2F5N A;  1Q3C A;  3SAS A;  1HNX M;  1KFV A;  4K0K M;  1PJI A;  4JI6 M;  2UXC M;  1N34 M;  1XMQ M;  3GP1 A;  4DV7 M;  1PM5 A;  4KHP M;  3SAV A;  3U6P A;  1N36 M;  5FLX S;  3U6M A;  3GPU A;  3GPP A;  2ZBK B;  4JI8 M;  5LMN M;  1MX0 A;  1PJJ A;  1N33 M;  4YY3 M;  1L2D A;  4OX9 M;  1IBM M;  1TDZ A;  3TWK A; 
#chains in the Genus database with same CATH topology
 2M60 A;  3FTF A;  2F4V M;  2KNZ A;  4QNR A;  2LTU A;  3IHP A;  2G5G X;  4DV0 M;  2ZTC A;  2BWE A;  4LF4 M;  4G4N A;  4JI1 M;  1UFZ A;  4RKU F;  3GLH A;  1GVN A;  2UUC M;  4LF5 M;  1UM8 A;  3T6P A;  2C9O A;  4LF9 M;  3FYC A;  3HWS A;  2OQ4 A;  1PRB A;  3HGI A;  4QOZ C;  1IY2 A;  3C58 A;  3AL0 C;  2O25 A;  3FRH A;  5FTK A;  4AQY M;  1NVM A;  2Y21 A;  3W0F A;  1Q02 A;  4L6V 6;  2QBY B;  2EA0 A;  3U5Z A;  3R8F A;  5ITT A;  3J80 S;  3A46 A;  1IXR C;  3B7Q A;  3TQS A;  1D0M A;  1Z5A A;  1IN6 A;  2BJW A;  4A3V B;  1JR3 A;  3NBX X;  3MHV C;  4I81 A;  3KW6 A;  3HJ8 A;  2EKK A;  2EKF A;  1SG9 A;  3FE3 A;  4L15 A;  2L4F A;  2DAK A;  4MGI E;  5EXP A;  4LJ4 A;  3SAW A;  3K1J A;  1XC8 A;  2MR9 A;  4R7G A;  2JP7 A;  3E46 A;  1L8Q A;  5EP4 A;  5LMU M;  4LFB M;  2UXD M;  1PJT A;  1I4W A;  3A42 A;  2KNV A;  1ZMW A;  3K9P A;  1E94 E;  2CUZ A;  2V6Z M;  3KSJ A;  1WJ7 A;  4LJ9 A;  5L8R F;  2FS1 A;  1I94 M;  4WP2 A;  4NXN M;  5ITR A;  4JI5 M;  1V33 A;  1E9S A;  4I4L A;  2EJS A;  3V76 A;  4BBA A;  1R6B X;  3U61 B;  2R46 A;  2H5X A;  3FRI A;  3CTW B;  2HWJ A;  4IBK A;  5EP2 A;  3UJN A;  2UU9 M;  2F5O A;  2JY7 A;  2H1R A;  4F1I A;  7CAT A;  1R4G A;  3U6D A;  3A98 B;  1IXZ A;  1N32 M;  2GQF A;  1GL7 A;  2JY8 A;  1IBK M;  3CF2 A;  4L78 A;  2K6B A;  4FWH A;  2DHY A;  1HT2 E;  3GRU A;  1T43 A;  3U6O A;  2FFJ A;  2R18 A;  1KYI A;  1GJT A;  3CF0 A;  3ILK A;  2EO2 A;  1P3Q Q;  3SFZ A;  4CGY B;  5E26 A;  3KFU G;  3M0E A;  2K0B X;  1X37 A;  2DAM A;  2QEN A;  4QHT A;  5JI3 E;  4DR3 M;  1DGH A;  1T3T A;  1Z5C A;  3SAU A;  3KOW E;  4G4Q A;  5DFL A;  4NRV A;  3EIH A;  2FE8 A;  3SYL A;  2APL A;  1XB2 B;  1JQJ C;  1G4A E;  1NJF A;  2KXE A;  4QHS A;  3SHG B;  1YE9 A;  2R44 A;  3I4V A;  1Q39 A;  1QVR A;  2RGO A;  2O01 F;  3H4M A;  4I5S A;  2ZAO A;  5GKN A;  2LWX A;  3RFW A;  4BB9 A;  1G41 A;  1XXH B;  4IBI A;  3MJ5 A;  2DXI A;  5FSW A;  3U60 B;  1PJI A;  4IJE A;  4JI6 M;  3L27 A;  3GLF A;  2XFT A;  1ZAE A;  3K2L A;  4AW4 A;  5C18 A;  3GLG A;  1QDT A;  4LCB A;  2BNK A;  2DKL A;  2D7G A;  2XSZ D;  1KSF X;  3J7B A;  5FLX S;  1OAI A;  2QP9 X;  1HQC A;  2G8L A;  4AG6 A;  3B7Z A;  3HHY A;  2DVW B;  2I7P A;  2WZJ A;  3PNV A;  1PJJ A;  2R62 A;  2JZ1 A;  1DO2 A;  1L2D A;  2MGW A;  3J27 B;  1VEJ A;  3E21 A;  8CAT A;  4X65 M;  1R7R A;  3VFD A;  4DV4 M;  3FUU A;  2UUB M;  5H37 D;  3VKH A;  2K47 A;  4II7 A;  1FNN A;  2L09 A;  2CFO A;  3I04 M;  3GPX A;  4DV6 M;  2B3T A;  4M9Z A;  4GKK M;  1NY5 A;  2Q2E B;  3K9O A;  3SAR A;  2CWB A;  3GLH E;  2N35 A;  3GO8 A;  2HKJ A;  3HU1 A;  5ITU A;  1J09 A;  3AOG A;  2HCB A;  3KOX E;  3GLI B;  2VQE M;  4DUY M;  4R3D A;  4DUZ M;  5IRE B;  2CE7 A;  4KLN A;  4LJA A;  4IBD A;  1V34 A;  1L2C A;  3DOA A;  2D7E A;  4WW0 A;  5KPZ A;  2JNH A;  2P5T A;  3LQQ A;  4OVZ B;  1QZE A;  1EFU B;  2KZU A;  3J2P B;  4X62 M;  2XZF A;  1HNW M;  4F2L A;  2Z8Y M;  1K3W A;  1IXS A;  2MJ5 B;  1SXJ C;  2KRU A;  1D2N A;  1JR3 E;  1PGY A;  4XK8 F;  1YLA A;  3FUX A;  4FCW A;  4GMQ A;  4LJ8 A;  4HLQ A;  3GQ5 A;  2XF3 A;  2ZAN A;  3NBI A;  1HJP A;  5JI2 E;  3L25 A;  4PD2 A;  1QYR A;  3FTC A;  2LVQ D;  1R5L A;  2ZM6 M;  1HR0 M;  1TTE A;  4GIT A;  2LHG A;  4LRS A;  2CV1 A;  4LY6 A;  2KHH A;  1ZMU A;  2L6O A;  2YFQ A;  3F92 A;  4M9S A;  1R2Y A;  1AIP C;  5KPR A;  4B3M M;  4LZZ A;  3QWL A;  2DZL A;  2QBY A;  3UGJ A;  1GJS A;  3KS8 A;  4B7G A;  1TH2 A;  4JXJ A;  4CJ6 A;  1IFY A;  2VDB B;  1NNU C;  2DAI A;  3D8L A;  1YSY A;  3IG8 A;  5BR8 M;  1SXJ D;  4NSO B;  3U6C A;  2ERC A;  3CF6 E;  2KW0 A;  1GKI A;  3L2A A;  3HHW A;  2RKO A;  4M9X A;  4GRI A;  2JUJ A;  3HU2 A;  3D8B A;  4GEW A;  4AKH A;  4B08 A;  3E4R A;  4FWD A;  3KXE C;  5EJC A;  3VDU A;  4LRT A;  1IN4 A;  3RGP A;  1J5E M;  4LG2 A;  4JV5 M;  2Z4R A;  3A45 A;  4LZJ A;  2XH9 A;  4LJ7 A;  2OPF A;  3WHK A;  4CHT B;  1Z5B A;  2C96 A;  3M7G A;  2VF8 A;  4EIW A;  1Z59 A;  3FTD A;  2XSZ A;  1TH3 A;  2GNO A;  3U61 A;  2DEN A;  2XZU A;  1IQP A;  4ITQ A;  3FYD A;  1OQY A;  1PJQ A;  3BXW A;  3KSX A;  3VK8 A;  1A5T A;  3B9P A;  1IY0 A;  3L29 A;  2LVA A;  2E5L M;  1G71 A;  1WIV A;  4D82 A;  3ZC7 B;  1XMO M;  3LMM A;  5DYG A;  4Y28 F;  2JWS A;  4Z8X A;  1E9R A;  1D0L A;  5EP3 A;  4QNM A;  2CHV A;  5KO3 A;  4LGM A;  1HQY E;  3AOE A;  4NL4 H;  3GLF E;  3SAV A;  3U6P A;  3HKP A;  3GLG E;  2MRO B;  3IEC A;  3UMM A;  4AZF A;  1IN5 A;  1N75 A;  1JB0 F;  1OKS A;  1NJG A;  2RRU A;  3ZQJ A;  3L26 A;  3GPP A;  1DV0 A;  2R4E A;  1OAO C;  2X4A A;  4YY3 M;  1ORY B;  2CP8 A;  2HL7 A;  1IBM M;  1QAO A;  3TWK A;  2DNA A;  2C98 A;  1TDZ A;  3I01 M;  2DWL A;  1XNR M;  2DAE A;  2CEA A;  2MH8 A;  1T6O A;  4L4U A;  3K8Z A;  3R9X B;  5FTM A;  1VEG A;  1WGL A;  3C3E A;  4RNA A;  3HJQ A;  1XXH A;  3SMP A;  4FVM A;  3SYK A;  3U60 A;  3CGW A;  2C99 A;  4NC6 A;  3DZD A;  3W67 A;  1IY1 A;  4IBJ A;  4B3R M;  3HZJ A;  3Q8G A;  3JR4 A;  2LH0 A;  3GQ4 A;  2L4E A;  2JA2 A;  3AOE C;  4GHL A;  1VDD A;  1GO5 A;  4DR7 M;  2JY5 A;  1NHW C;  2QNJ A;  4X64 M;  4TUW A;  2OO9 A;  4MGY E;  1XHB A;  2VQF M;  3T38 A;  3TPZ A;  2QZ4 A;  4YHH M;  3TWL A;  3KP1 E;  4NSR A;  2QQ8 A;  3U6Q A;  4M0D A;  3VK7 A;  2O5R A;  2VF7 A;  2HAK A;  3FUW A;  4QOS A;  2C5R A;  1E32 A;  4G6Z A;  4ANR A;  2G3Q A;  3QYE A;  2QHO B;  3SC3 A;  4RF1 A;  4DR4 M;  1SXJ A;  1Q3B A;  1TF0 B;  4IBB A;  4DV3 M;  2Y0T A;  2F5Q A;  1GAB A;  3C9P A;  3PFI A;  1DGB A;  2YR0 A;  3T1H M;  1TH4 A;  2R6F A;  4DR2 M;  1QUS A;  3RE8 A;  4G4R A;  2F5S A;  1WGN A;  1R2Z A;  3GLI A;  4GKJ M;  1NV8 A;  2HHH M;  2LBC A;  1W5T A;  4REZ A;  2BWB A;  3LCV B;  1CUK A;  3THG A;  1FJG M;  2D7H A;  2XEP A;  1F4I A;  1L1T A;  2X8A A;  1DGG A;  3EIE A;  2L7I A;  1IM2 A;  2DZN B;  3QYB A;  1GLN A;  2R65 A;  4OVZ A;  4R71 A;  4PDG A;  4AKG A;  3K92 A;  3MMP A;  4DR5 M;  1OJL A;  1VG5 A;  2DWM A;  2CV0 A;  4X66 M;  1D0K A;  3AKZ A;  5ITQ A;  5KQ8 A;  5DNY A;  1G3I A;  4BLC A;  2Y20 A;  3W0L B;  1EIJ A;  2JY6 B;  2WSC F;  1NY6 A;  4MM3 B;  3B7N A;  5ITX A;  4DV1 M;  4JI2 M;  3M6A A;  5DYI A;  1RU3 A;  4XGI A;  5IZ7 D;  2V1U A;  3LQR A;  1XNQ M;  3E9S A;  4CIZ A;  5KPT A;  3B74 A;  1C7Y A;  4PDI A;  2KZS A;  3I51 A;  4NRW A;  3ZH9 B;  3U6E A;  3UZU A;  4PT5 A;  3SAT A;  4Z6Y A;  5EXS A;  4MGH A;  1L1Z A;  3GRY A;  2BJV A;  3DFZ A;  4MGK E;  3VKG A;  2M5Z A;  3L28 A;  1QAQ A;  3HX3 A;  2LVO C;  4FW9 A;  1ZQ9 A;  4IJF A;  5IWA M;  1QZM A;  3JR5 A;  5E6J A;  3C3D A;  4FCT A;  2CV2 A;  4LFA M;  2NQ8 C;  3FUT A;  1J7K A;  1G59 A;  1L2B A;  1IXS B;  3VDP A;  3BOS A;  3IG5 A;  2DWN A;  2ZTD A;  1NNJ A;  3GPY A;  3OTO M;  1IN7 A;  1IN8 A;  4KT0 F;  3SAS A;  4GH9 A;  1HNX M;  5BPV A;  1KFV A;  3GLH B;  4G3O A;  4K0K M;  1N78 A;  2X49 A;  1N34 M;  1XMQ M;  4GC9 A;  1VDL A;  3SMS A;  3GP1 A;  1WXQ A;  1PM5 A;  3LW5 F;  3FKE A;  3AJI B;  4IIW A;  3U6M A;  2DHR A;  3NWL A;  4LGY A;  4S12 A;  4WUR A;  2EUC A;  3HHZ A;  1MX0 A;  2J7O A;  3AV0 A;  3SHF A;  4NOO B;  4KOD A;  1BVS A;  4D81 A;  2DAG A;  3U5Z B;  2DI0 A;  4CIS A;  1H6U A;  4FCV A;  3MK6 A;  4JI4 M;  4HEO A;  1ZMV A;  1OTR A;  3W68 A;  4G4O A;  3J81 S;  4OW0 A;  2UXB M;  3T1Y M;  1LTM A;  1QQW A;  2OOA A;  4I8O A;  4MGZ E;  4FWG A;  1OFH A;  1XXH E;  1PJS A;  5ITY A;  4IBC A;  4DV5 M;  4AI6 A;  4DR1 M;  4B7H A;  3HHX A;  3U6L A;  3KOZ E;  4JI3 M;  1V92 A;  2KRK A;  2DZO B;  3UK6 A;  4LF6 M;  2KA6 B;  4UN2 B;  5KQD A;  4B3T M;  2K9D A;  2QCU A;  1WR1 B;  3BBZ A;  2R4J A;  4JYA M;  3KOY E;  2A5Y B;  3FUV A;  3Q8X A;  4GIP A;  2DWZ B;  4PCZ A;  1OFI A;  1W5S A;  2UUA M;  3GRV A;  3KS4 A;  4D80 A;  1K82 A;  4NXM M;  1DGF A;  1SXJ E;  4W5W A;  5EXX A;  1MJG M;  2FNA A;  3LVV A;  1NO1 A;  2CHQ A;  3PNY A;  4LJ6 A;  2F5P A;  2V1C A;  4IBF A;  2XGN A;  1TGU A;  1N77 A;  1QUT A;  4KO8 A;  3GLI E;  4B3S M;  1GL6 A;  2L2D A;  3GRR A;  4ZPX A;  2J5Y A;  4LF7 M;  2JXN A;  2OOB A;  1AUA A;  1ZV1 A;  3J7A S;  5IT9 S;  4DBG B;  2C9C A;  3HU3 A;  3AFH A;  4MH0 E;  4RF0 A;  4M0W A;  3FD9 A;  4OU7 A;  1JR3 D;  3GQ3 A;  4DR6 M;  5F3W A;  3B89 A;  4AKI A;  2LVN C;  1DGH B;  2CRU A;  2LHC A;  2RGH A;  4Q7J A;  1MU5 A;  1G8P A;  3T15 A;  1LV7 A;  1Y8G A;  4GC5 A;  4L16 A;  3TWM A;  3DA1 A;  2CHG A;  2WSE F;  3LCU A;  1NV9 A;  1OIP A;  3KP0 E;  5ITX E;  1HNZ M;  3U6S A;  5A2Q S;  4DV2 M;  2R0I A;  2R45 A;  4LF8 M;  1HT1 E;  3PVS A;  2XLJ A;  2VII A;  5EXT A;  1QAN A;  4P17 A;  2Z3X A;  4XBO A;  4L8R C;  3VLF B;  2WSF F;  1IBL M;  3PXG A;  3SBJ A;  3TL4 X;  3GLF B;  4JI0 M;  2FH0 A;  3I4Y A;  4AG5 A;  1S3S A;  3GLG B;  3LVW A;  2LNH C;  1K3X A;  1EE8 A;  1VEK A;  2Z4S A;  2KNA A;  2XFS A;  5FTJ A;  1YUB A;  4B7F A;  5FTL A;  1MN3 A;  4LFC M;  1TDH A;  4LJ5 A;  3JAM S;  4JI7 M;  4GHA A;  2ZAM A;  1Z6T A;  2LVP C;  2YNM D;  3KDS E;  2KDL A;  2J7N A;  3QAU A;  4MB7 A;  1SXJ B;  2YQZ A;  3WHL A;  1WHC A;  5C1B A;  5EQT A;  2F5N A;  2Z7J A;  5FTN A;  3TE6 A;  2QPA A;  4FD2 A;  1DO0 A;  1Q3C A;  1TR8 A;  1NHG C;  4JN6 A;  2AHM A;  2UXC M;  4DV7 M;  1VQ1 A;  2JZ0 A;  3FTE A;  4KHP M;  2W82 A;  4P16 A;  1NSF A;  2L7H A;  2FOI C;  1N36 M;  3KVW A;  4IBG A;  2I7N A;  1QDR A;  3HJS A;  2QSF X;  3ZCB B;  3GPU A;  1XWI A;  2KEB A;  2LXE A;  2ZBK B;  3HY5 A;  4HL4 A;  5EP1 A;  5LMN M;  4JI8 M;  1C1K A;  1N33 M;  3RGS A;  1OIZ A;  4OX9 M;  4IBE A;  3H4J A;  2Y0Q A;  1QAM A; 
#chains in the Genus database with same CATH homology
 2M60 A;  3FTF A;  2F4V M;  4QNR A;  4DV0 M;  4LF4 M;  2G5G X;  4G4N A;  4JI1 M;  3GLH A;  1GVN A;  2UUC M;  4LF5 M;  1UM8 A;  2C9O A;  4LF9 M;  3FYC A;  3HWS A;  2OQ4 A;  3HGI A;  4QOZ C;  1IY2 A;  3C58 A;  3AL0 C;  4AQY M;  5FTK A;  1NVM A;  2Y21 A;  3W0F A;  2QBY B;  2EA0 A;  3U5Z A;  3R8F A;  5ITT A;  3J80 S;  3A46 A;  1IXR C;  3TQS A;  1Z5A A;  1IN6 A;  2BJW A;  4A3V B;  1JR3 A;  3MHV C;  4I81 A;  3KW6 A;  3HJ8 A;  4L15 A;  4MGI E;  5EXP A;  4LJ4 A;  3SAW A;  3K1J A;  1XC8 A;  4R7G A;  1L8Q A;  5EP4 A;  5LMU M;  4LFB M;  2UXD M;  1I4W A;  3A42 A;  1E94 E;  2CUZ A;  2V6Z M;  3KSJ A;  4LJ9 A;  1I94 M;  4NXN M;  4JI5 M;  1E9S A;  4I4L A;  4BBA A;  1R6B X;  3U61 B;  2R46 A;  3CTW B;  4IBK A;  5EP2 A;  3UJN A;  2UU9 M;  2F5O A;  2H1R A;  7CAT A;  3U6D A;  3A98 B;  1IXZ A;  1N32 M;  1GL7 A;  1IBK M;  3CF2 A;  4L78 A;  4FWH A;  1HT2 E;  3GRU A;  3U6O A;  2FFJ A;  2R18 A;  1KYI A;  3CF0 A;  3ILK A;  2EO2 A;  3SFZ A;  4CGY B;  3KFU G;  5E26 A;  3M0E A;  1X37 A;  4DR3 M;  2QEN A;  4QHT A;  5JI3 E;  1DGH A;  1T3T A;  1Z5C A;  3SAU A;  3KOW E;  4G4Q A;  4NRV A;  3EIH A;  2FE8 A;  3SYL A;  1JQJ C;  1G4A E;  1NJF A;  2KXE A;  4QHS A;  3SHG B;  1YE9 A;  3I4V A;  1Q39 A;  1QVR A;  2RGO A;  3H4M A;  4I5S A;  5GKN A;  2ZAO A;  3RFW A;  2LWX A;  4BB9 A;  5ITR A;  1G41 A;  1XXH B;  4IBI A;  3MJ5 A;  2DXI A;  5FSW A;  3U60 B;  1PJI A;  4IJE A;  4JI6 M;  3L27 A;  3GLF A;  2XFT A;  1ZAE A;  3K2L A;  4AW4 A;  5C18 A;  3GLG A;  4LCB A;  2BNK A;  2XSZ D;  2D7G A;  3J7B A;  1KSF X;  5FLX S;  2QP9 X;  1HQC A;  2G8L A;  4AG6 A;  3HHY A;  2DVW B;  2I7P A;  3PNV A;  1PJJ A;  2R62 A;  1DO2 A;  1L2D A;  3J27 B;  8CAT A;  4X65 M;  1R7R A;  3VFD A;  4DV4 M;  3FUU A;  2UUB M;  5H37 D;  3VKH A;  2K47 A;  4II7 A;  1FNN A;  2L09 A;  2CFO A;  4DV6 M;  3GPX A;  4M9Z A;  4GKK M;  1NY5 A;  2Q2E B;  3SAR A;  3GO8 A;  2HKJ A;  3HU1 A;  5ITU A;  1J09 A;  3AOG A;  2HCB A;  3KOX E;  3GLI B;  2VQE M;  4DUY M;  4R3D A;  4DUZ M;  5IRE B;  2CE7 A;  4KLN A;  4LJA A;  4IBD A;  1L2C A;  3DOA A;  2D7E A;  4WW0 A;  5KPZ A;  3LQQ A;  2P5T A;  4OVZ B;  1HNW M;  2KZU A;  3J2P B;  4X62 M;  2XZF A;  1K3W A;  1SXJ C;  2KRU A;  1D2N A;  4FCW A;  3FUX A;  4GMQ A;  4LJ8 A;  4HLQ A;  3GQ5 A;  2XF3 A;  2ZAN A;  3NBI A;  5JI2 E;  3L25 A;  4PD2 A;  1QYR A;  3FTC A;  2ZM6 M;  1HR0 M;  4GIT A;  4LRS A;  2CV1 A;  4LY6 A;  2L6O A;  2YFQ A;  1R2Y A;  4M9S A;  5KPR A;  4B3M M;  4LZZ A;  3QWL A;  2QBY A;  3UGJ A;  3KS8 A;  4B7G A;  1TH2 A;  4JXJ A;  1NNU C;  3D8L A;  1YSY A;  3IG8 A;  5BR8 M;  1SXJ D;  4NSO B;  3U6C A;  2ERC A;  3CF6 E;  2KW0 A;  1GKI A;  3L2A A;  3HHW A;  2RKO A;  4M9X A;  4GRI A;  3HU2 A;  3D8B A;  4AKH A;  4B08 A;  3E4R A;  4FWD A;  3KXE C;  5EJC A;  3VDU A;  4LRT A;  1IN4 A;  3RGP A;  1J5E M;  4LG2 A;  4JV5 M;  2Z4R A;  3A45 A;  4LZJ A;  2XH9 A;  4LJ7 A;  2OPF A;  3WHK A;  4CHT B;  1Z5B A;  2C96 A;  3M7G A;  4EIW A;  1Z59 A;  3FTD A;  2XSZ A;  1TH3 A;  3U61 A;  2XZU A;  4ITQ A;  1IQP A;  3FYD A;  3KSX A;  3VK8 A;  3B9P A;  1IY0 A;  3L29 A;  2E5L M;  4D82 A;  3ZC7 B;  1XMO M;  3LMM A;  5DYG A;  4Z8X A;  1E9R A;  5EP3 A;  4QNM A;  2CHV A;  5KO3 A;  4LGM A;  1HQY E;  3AOE A;  4NL4 H;  3SAV A;  3U6P A;  3HKP A;  3UMM A;  4AZF A;  1IN5 A;  1N75 A;  1NJG A;  3L26 A;  3GPP A;  2R4E A;  2X4A A;  4YY3 M;  1ORY B;  2HL7 A;  1IBM M;  1QAO A;  3TWK A;  1TDZ A;  2C98 A;  2DWL A;  1XNR M;  3R9X B;  2CEA A;  4L4U A;  3K8Z A;  5FTM A;  4RNA A;  3HJQ A;  1XXH A;  3SMP A;  4FVM A;  3SYK A;  3U60 A;  2C99 A;  3DZD A;  1IY1 A;  4IBJ A;  4B3R M;  3JR4 A;  2LH0 A;  3GQ4 A;  2JA2 A;  3AOE C;  4GHL A;  1VDD A;  4DR7 M;  1NHW C;  4X64 M;  4TUW A;  4MGY E;  1XHB A;  2VQF M;  3T38 A;  3TPZ A;  2QZ4 A;  4YHH M;  3TWL A;  3KP1 E;  4NSR A;  3U6Q A;  4M0D A;  3VK7 A;  2O5R A;  4QOS A;  3FUW A;  2C5R A;  1E32 A;  4G6Z A;  3SC3 A;  4RF1 A;  4DR4 M;  1SXJ A;  1Q3B A;  4DV3 M;  4IBB A;  2F5Q A;  2Y0T A;  3PFI A;  1DGB A;  2YR0 A;  3T1H M;  1TH4 A;  4DR2 M;  3RE8 A;  4G4R A;  2F5S A;  1R2Z A;  3GLI A;  4GKJ M;  2HHH M;  3THG A;  1W5T A;  4REZ A;  1FJG M;  2D7H A;  2XEP A;  1L1T A;  2X8A A;  1DGG A;  3EIE A;  2L7I A;  1IM2 A;  2DZN B;  1GLN A;  2R65 A;  4OVZ A;  4PDG A;  4AKG A;  3K92 A;  4DR5 M;  1OJL A;  2DWM A;  2CV0 A;  4X66 M;  3AKZ A;  5ITQ A;  5KQ8 A;  5DNY A;  1G3I A;  4BLC A;  2Y20 A;  3W0L B;  1NY6 A;  4MM3 B;  5ITX A;  4DV1 M;  4JI2 M;  3M6A A;  5DYI A;  5IZ7 D;  4XGI A;  3LQR A;  1XNQ M;  3E9S A;  5KPT A;  4PDI A;  2KZS A;  3I51 A;  4NRW A;  3ZH9 B;  3U6E A;  3UZU A;  4PT5 A;  3SAT A;  4Z6Y A;  5EXS A;  4MGH A;  1L1Z A;  3GRY A;  2BJV A;  3DFZ A;  4MGK E;  3VKG A;  2M5Z A;  3L28 A;  1QAQ A;  4FW9 A;  1ZQ9 A;  4IJF A;  5IWA M;  1QZM A;  3JR5 A;  5E6J A;  4FCT A;  2CV2 A;  4LFA M;  2NQ8 C;  3FUT A;  1J7K A;  1G59 A;  1L2B A;  1IXS B;  3VDP A;  3BOS A;  3IG5 A;  2DWN A;  1NNJ A;  3GPY A;  3OTO M;  1IN7 A;  1IN8 A;  3SAS A;  4GH9 A;  1HNX M;  5BPV A;  1KFV A;  3GLH B;  1N78 A;  4K0K M;  2X49 A;  1N34 M;  1XMQ M;  4GC9 A;  3GP1 A;  3SMS A;  1PM5 A;  1WXQ A;  3FKE A;  3AJI B;  4IIW A;  3U6M A;  2DHR A;  3NWL A;  4LGY A;  4S12 A;  4WUR A;  2EUC A;  3HHZ A;  1MX0 A;  2J7O A;  3AV0 A;  3SHF A;  4NOO B;  4KOD A;  4D81 A;  3U5Z B;  4CIS A;  1H6U A;  4FCV A;  3MK6 A;  4JI4 M;  4G4O A;  3J81 S;  4OW0 A;  2UXB M;  3T1Y M;  1QQW A;  5ITY A;  4I8O A;  4MGZ E;  4FWG A;  1OFH A;  4DV5 M;  4AI6 A;  4IBC A;  4DR1 M;  4B7H A;  3HHX A;  3U6L A;  3KOZ E;  4JI3 M;  2KRK A;  2DZO B;  3UK6 A;  4LF6 M;  2KA6 B;  5KQD A;  4B3T M;  2QCU A;  2R4J A;  4JYA M;  3KOY E;  2A5Y B;  3FUV A;  3Q8X A;  4GIP A;  2DWZ B;  4PCZ A;  1OFI A;  1W5S A;  2UUA M;  3GRV A;  3KS4 A;  4D80 A;  1K82 A;  4NXM M;  1DGF A;  1SXJ E;  4W5W A;  5EXX A;  2FNA A;  3LVV A;  4LJ6 A;  2CHQ A;  3PNY A;  2F5P A;  2V1C A;  4IBF A;  2XGN A;  1TGU A;  1N77 A;  4KO8 A;  4B3S M;  1GL6 A;  3GRR A;  4ZPX A;  4LF7 M;  3J7A S;  5IT9 S;  2C9C A;  3HU3 A;  3AFH A;  4MH0 E;  4RF0 A;  4M0W A;  3FD9 A;  4OU7 A;  1JR3 D;  3GQ3 A;  4DR6 M;  5F3W A;  4AKI A;  1DGH B;  2RGH A;  1MU5 A;  1G8P A;  3T15 A;  1LV7 A;  4GC5 A;  4L16 A;  3TWM A;  3DA1 A;  2CHG A;  5ITX E;  1HNZ M;  3KP0 E;  3U6S A;  5A2Q S;  4DV2 M;  2R45 A;  4LF8 M;  1HT1 E;  3PVS A;  2XLJ A;  2VII A;  5EXT A;  1QAN A;  2Z3X A;  4XBO A;  4L8R C;  3VLF B;  1IBL M;  3PXG A;  3SBJ A;  3TL4 X;  3GLF B;  4JI0 M;  3I4Y A;  4AG5 A;  1S3S A;  3GLG B;  3LVW A;  2LNH C;  1K3X A;  1EE8 A;  2Z4S A;  4B7F A;  2XFS A;  5FTJ A;  1YUB A;  5FTL A;  4LFC M;  1TDH A;  4LJ5 A;  3JAM S;  4JI7 M;  4GHA A;  2ZAM A;  1Z6T A;  2YNM D;  3KDS E;  2J7N A;  3QAU A;  3WHL A;  4MB7 A;  1SXJ B;  2YQZ A;  5C1B A;  5EQT A;  2F5N A;  2Z7J A;  5FTN A;  3TE6 A;  2QPA A;  4FD2 A;  1DO0 A;  1Q3C A;  1NHG C;  4JN6 A;  2AHM A;  2UXC M;  4DV7 M;  3FTE A;  4KHP M;  2W82 A;  4P16 A;  1NSF A;  2L7H A;  2FOI C;  1N36 M;  3KVW A;  4IBG A;  2I7N A;  3HJS A;  3GPU A;  3ZCB B;  1XWI A;  2KEB A;  2LXE A;  2ZBK B;  4HL4 A;  5EP1 A;  5LMN M;  4JI8 M;  1C1K A;  1N33 M;  3RGS A;  2V1U A;  4OX9 M;  4IBE A;  2Y0Q A;  1QAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...