3FTFA

Crystal structure of a. aeolicus ksga in complex with rna and sah
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
246
Chain Sequence
MVRLKKSFGQHLLVSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 60
structure length 246
sequence length 246
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftfA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftfA01
2CWWA 3VSEA 4ER5A 4BP3A 3MCTA 3EMDA 4MWZA 3AY0A 4YUXA 2A14A 2JG3A 1DL5A 2O0LA 2G1PA 4FS8A 1H1DA 2PWYA 3CKKA 3GO4A 5EZSA 1BHJA 1DUSA 4GF5A 3E05A 5IKMA 2NP7A 3LECA 1EJ6A 2YXEA 3BWMA 3EVEA 3MGGA 5EPEA 5EQJB 1TPYA 2H00A 5HIKA 2HR1A 1UIRA 1KPHA 1KXZA 3KPYA 4X41A 3HVKA 1O9HA 2QM3A 4QQKA 3BWBA 3HP7A 1JG2A 1EIZA 3GRRA 2GAFA 3ANXA 3UA3A 1KR5A 3WSTA 4BLWA 2GLUA 3DMHA 2WA1A 3HVJA 3UZUA 5GOZA 4E31A 1X1CA 3R3HA 5ICEA 1IM8A 5KS2A 3I9FA 3B89A 2EFJA 3EVBA 3OE5A 2DPMA 1JG4A 4E30A 1G6Q1 3GCZA 2PSSA 4PCLA 2ZTHA 4EMSA 4RTMA 1XVAA 9MHTA 3LDFA 5CM2Z 3DLCA 1JTFA 3KR2A 3OCJA 5LQRA 1EAMA 4G56A 1FBNA 5FA5A 3KQPA 2QRVB 3D2LA 2JHAA 3A26A 2VS1A 4GOMD 5CCXA 1NE2A 3FPGA 2ZIEA 3P2IA 5T64A 5EOVA 5E1OA 5E9WA 3MHTA 3LX6A 2OO3A 2XYVA 3VYWA 4X63A 1INLA 1RJGA 4BLVA 1Z3CA 4HRAA 3ID6C 4X60A 1IXKA 2IGTA 2P1DA 3I5UA 5DTRA 4LWOA 2PT6A 3DXXA 3V8VA 3PB3A 3O4FA 3EVZA 4C08A 3HNRA 2FK7A 5IH3A 2ONYA 5FA8A 1JSXA 3HEMA 5HOQA 4DF3A 3OU7A 3KQSA 1EJ0A 4FZVA 2VDUE 4E2WA 4KIFA 2EJTA 4MHTA 4MIKA 4E2YA 3G2OA 2F8LA 2AVDA 4PIPA 3OPNA 3BXOA 5FADA 4YV0A 3GRVA 3ER8A 3SX0A 3DULA 3VC1A 2P3LA 5LQKA 1P1CA 3EGIA 5EMMA 1ZG3A 2IBTA 3MCZA 3A7DA 1NW5A 5DWQA 2XVMA 2ZULA 3GRYA 4K6MA 1JG3A 2IPXA 5EZQA 2ZIFA 5K0BA 2AOXA 2QYOA 3KQQA 3ELWA 1M6EX 4QTTB 4V0QA 1G8SA 1KHHA 2NXCA 3BUSA 2AVNA 2PLWA 5DTQA 2ONZA 5H02A 4OQDA 3HTXA 2B25A 2YX1A 3KKZA 3CCFA 2I6GA 2O07A 3HA7A 2GH1A 4PYQA 5DSXA 3DUWA 2PJDA 3UJAA 5LQAA 4KWCA 2OB2A 2R3SA 3EGVA 4M37A 4R6XA 2GB4A 1P39A 5DXJA 1JQEA 3KQVA 3QOWA 2IFTA 2PXAA 2P3OA 2WK1A 3PVCA 3UWPA 4PIMA 5D1HA 5CVUA 4OX9Y 1PRYA 4GC9A 4HTFA 2Y1XA 3EPPA 3EVCA 3KPVA 5GM1A 3SXJA 3TM5A 3EVGA 3G2QA 3MAGA 1KYWA 3L8DA 5DM2A 1NV9A 5DX1A 4DZRA 1QAMA 3B3FA 3G8BA 3B3GA 3I53A 3BGVA 5T6BA 10MHA 4DA4A 2ZZMA 3IV6A 4PYOA 2HNKA 2ZWVA 1KIAA 5C0OE 4ER0A 3A27A 4BP1A 5LQNA 2AOTB 3G88A 3FTDA 3R6TA 4AZTA 4AZVA 4DCMA 4YV1A 1VP9A 4RTJA 1SVUA 1TW3A 4KVZA 3KQYA 2BZGA 3MQ2A 1NKVA 3RW9A 3TR6A 3UJDA 4C03A 1M0EA 2ADMA 1G8AA 2AZTA 1JSZA 2IP2A 2PWPA 1BC5A 1G55A 2ZSUA 1D2HA 2G8NA 3E8SA 1SKMA 3EVAA 4PGGA 4M36A 4CKCA 3DLIA 1L9KA 3G7UA 4R8RA 2NYUA 3C6KA 4F85A 3JWHA 2PT9A 3ME5A 3KQOA 1NW8A 5EMJA 2G72A 5FTWA 4QTUB 4HG2A 2UYHA 4PYLA 5FQOA 2O57A 4YUYA 1R6AA 2B78A 4GBED 5DT2A 4IWNA 2FCAA 1QYRA 1T43A 2P41A 3EGEA 3KR1A 4OBXA 5FHRA 1DCTA 3GU3A 3H2BA 3FUTA 5CVEA 4RTKA 5KQSA 3SSOA 2YXLA 2Z6AA 2AN3A 3TFWA 1QAOA 3AWIA 2AOWA 2I62A 3KPUA 5DM0A 1U2ZA 4OBWA 2HWKA 2HV9A 3OZTA 3SGLA 3UBTA 3KQWA 5EEHA 3NVKI 3EMBA 1AQIA 5B1SA 3FPHA 1JQ3A 3PFHA 1XCJA 4GOND 5BXYA 1UFKA 3OFKA 3MB5A 1RJEA 3C3PA 1AF7A 2B2CA 2UYCA 2PXXA 3MTIA 3FPEA 3FUUA 1VBFA 4GOLD 3PX2A 4AX8A 2ZZKA 4PGHA 3P9NA 3ORHA 3QOXA 4HGYA 5HFJA 5MHTA 3G2MA 1XDSA 3OU6A 4KRGA 5DXAA 1XJ5A 5BW4A 3VC2A 1NBIA 4C05A 3FPFA 2B9EA 3U81A 4RTLA 3LGAA 2V74B 1M6YA 1SG9A 5HEKA 4A6DA 4F86A 1O9GA 2IIPA 1L1EA 5KQRA 2BH2A 2H11A 3LBFA 5FWDA 2FPOA 3NDIA 3LKDA 3PFGA 5KVAA 1YUBA 2Z6UA 5GIOE 4DQ0A 2EG5A 3EVDA 4HSGA 2EJUA 5EEGA 1YFJA 2BM9A 2C7PA 2JHPA 5EGSA 1L3BA 3T7SA 2G70A 2NXEA 3CC8A 4P7KA 5E8JA 4YUZA 5LQJA 3HCFA 4DMGA 4OA8A 4RTPA 1MHTA 2GPYA 1R18A 3AXSA 3M4XA 4CKBA 1B42A 2HTEA 2JJQA 2AS0A 2PV0A 3P9IA 4O29A 5ICFA 3KQMA 2IDJA 5GP1A 3EVFA 3BWCA 3C6MA 3NWEA 4FT4A 2C7RA 1SQGA 4QDKA 3FTFA 4GQBA 4RTQA 2GS9A 2P7IA 2PX5A 5G02A 3LCCA 3FUVA 4HC4A 3M70A 3GRZA 4YUWA 3G8AA 3M6WA 1G38A 1ZKDA 2PKWA 1VPTA 2P3QA 3NVMB 4L7VA 4PWYA 5CCBA 2AN5A 2JH8A 3PTAA 4C06A 3HCDA 1YZ3A 3CBGA 3SM3A 2C7OA 3REOA 1VP3A 4RTRA 4R8SA 3KPWA 2I9KA 4Z2YA 3FUXA 1NW3A 1KPIA 1R8XA 4PYKA 2I7CA 2JH9A 1L3IA 2P7HA 2YXDA 5EIWA 1ORIA 3A4TA 3SSMA 2Z6QA 4GEKA 5CVVA 3NW9A 1HNNA 2FRXA 5CUQA 4P7GA 5K0JA 1EG2A 5EHIA 5DX8A 4XUEA 1YF3A 1I4WA 1IY9A 3LPMA 3R0QA 5HIMA 4EQZA 5FHQA 3HVHA 2FYTA 1ZQ9A 3DTNA 1WXWA 1O54A 3IHTA 1D2CA 3TM4A 4CKEA 3JWIA 4AZWA 2N47A 1FP2A 1VLMA 2ZBPA 3BZBA 3DH0A 5DX0A 1NV8A 3THRA 3FZGA 3P8ZA 4NECA 4RX1A 3IYLW 4U7TB 5HZMA 5K05A 1AV6A 3JWJA 2E5WA 3HCEA 3NTVA 5GWXA 1OR8A 1RI3A 4EVIA 1JR4A 5LQUA 2Y1WA 5GINE 5EG5A 3UA4A 4FP9A 5FQNA 3NJRA 1JG1A 5E9QA 1ZGJA 4RVDA 4QQNA 2GA9A 3OFJA 1AQJA 2VZ9A 1Q0SA 2NXJA 5DSTA 4ATNA 5ERGB 2IBSA 3BGIA 4YMGA 1RJFA 3FRHA 5K0LA 2OB1A 4CWAA 1NW7A 5ICGA 1PJZA 1Q0TA 2PBFA 4HGZA 2CL5A 2ZLBA 4GOOD 3PLAE 1EQAA 1P1BA 3M33A 5E9JA 1QZZA 5F2KA 1R8YA 3IEIA 2V7EA 1XXLA 3EEOA 4ER7A 3G89A 3HA3A 5LQCA 5DRYA 3BT7A 5EHGA 2P40A 3UJCA 3FTCA 3G5LA 4P7JA 4CTKA 3C3YA 4RVGA 3AXTA 3R24A 1X1DA 4KW7A 5FUBA 1G60A 4KIGA 2YVLA 4MTLA 2NP6A 5E1MA 2YTZA 3LCUA 1RI5A 4C04A 4DM3A 4AUKA 3E7PA 4RTSA 1JTEA 5EC8A 5C9ZA 4YV2A 2O05A 3LKZA 3OZSA 4RWZA 3GXOA 5E1DA 4Y30A 2QE6A 3BKWA 3RODA 1X1BA 2H1RA 4FSXA 1WY7A 3LDGA 4XUCA 2HMYB 3UJ6A 3I64A 3M6UA 3NDJA 5LSAA 3CJTA 3TKAA 4A6EA 5CVJA 1Y8CA 4EK9A 1VE3A 2XYRA 2PY6A 2ZIGA 3A7EA 4WVLA 3CVOA 1WXXA 3T7RA 4OA5A 3QV2A 5K01A 5F2NA 4PCAA 5DTMA 3B7PA 5CIYA 2EX4A 4OQEA 3BKXA 1FPQA 2YUIA 3TMAA 4IV0A 4PYNA 4X61A 3UFBA 4LG1A 5K0CA 4E33A 2P35A 5K0GA 4GC5A 3I58A 3OZRA 3KR0A 5BW5A 1VQ1A 2PXCA 4HTFB 3UJ7A 1RI4A 3OU2A 2UYOA 1R74A 3KHKA 4XCXA 5CD1A 1N7JA 2CKDA 5EIFA 2AOUA 3RIEA 4DCGA 4UOEA 1KPGA 4RTOA 3KQTA 5DPMA 1BOOA 2OXTA 4PONA 3DMFA 4MQ4A 5FWAA 3TLJA 3S68A 4RTNA 5CVDA 4PYIA 5K09A 2ZBRA 1SUIA 4RV9A 1ZHFA 4ISCA 5E2AA 3Q87B 5DRTA 1WS6A 3HCAA 1N7IA 4KDCA 1WG8A 4PYMA 4POOA 1QAQA 4DKJA 3GNLA 4FT2A 3P97A 3LHDA 4EKGA 2LD4A 3F4KA 3SSNA 3GGDA 3TOSA 1SUSA 3P2EA 4QVKA 3V97A 4E2ZA 5EKUA 3CJRA 3DMGA 2QY6A 3G5TA 2ZW9A 3MERA 4PYJA 1NT2A 1KYZA 3HCBA 4YMHA 3LL7A 4CXMA 3DR5A 2KW5A 3Q7EA 4QDJA 2DULA 3LCVB 3UJ9A 3DXYA 2VDVE 3E23A 3HA5A 8MHTA 1ZGAA 3T7TA 4LWPA 3HCCA 2NNWB 1V39A 5BP7A 5C1IA 1I1NA 4HH4A 3UJ8A 2IH5A 2ESRA 1WZNA 1D2GA 2UYQA 5FULA 1XTPA 4ER3A 3KR9A 4FGZA 1TW2A 3P71T 4IKPA 1P91A 2AOTA 2P8JA 4WXHA 5DLYA 1RI1A 5FCDA 4CTJA 4E32A 5K0NA 4E2XA 3TKYA 3O7WA 1RJDA 1R00A 4QVGA 5E8RA 4EKIA 3NMUF 3P2KA 5K0EA 2FK8A 7MHTA 1JQDA 5F2OA 3TQSA 3LBYA 3P9KA 3THSA 4PNEA 2O06A 1SQFA 3JWGA 2NXNA 3GDHA 2CMGA 1VL5A 2YR0A 4QPPA 2ORED 4R6WA 4AZSA 4F84A 2IH2A 5HIJA 1X19A 5E2BA 2OPBA 2AOUB 3GIWA 4X1OA 3KPJA 4B17A 3B3JA 1F3LA 2WA2A 3EEYA 5EKXA 3SVZA 3FYCA 2AR0A 5K8VA 3CGGA 5GIPE 4P58A 2PX4A 4BLUA 3TRKA 1L3CA 3CJQA 1MJFA 4R05A 5LR6A 3ELUA 3P9CA 2PGXA 3HM2A 4U7PB 3O31A 5DM4A 3PX3A 2AOVA 3M6XA 3ELYA 2ERCA 1XDUA 3AJDA 1NW6A 3DP7A 3FPJA 3KU1A 2VP3A 5EMLA 2ZVJA 2OZVA 1XCLA 4FSDA 3GJYA 4H0NA 5K0FA 2BR5A 3DXZA 2JHCA 3FUWA 5GM2A 4FR0A 4M7RA 5T67A 5ICCA 2BM8A 1N2XA 3C0KA 1XDZA 1F38A 4ER6A 4ZTBA 3LDUA 3R9XB 2ZWAA 2VDWA 3ELDA 5DM1A 5K03A 4XUDA 2XVAA 3GRUA 2OYRA 2BR4A 3ER9A 3ERCA 1KP9A 2PX8A 2IH4A 1I9GA 3TPZA 3X0DA 1BKYA 4GUAA 2ZZNA 4V0RA 1NBHA 1ORHA 3A25A 5KYGA 4C07A 2B3TA 3HVIA 2ZBQA 3PT9A 5EMKA 3OE4A 3K6RA 4RSRA 1X1AA 3PS9A 2CMHA 4RVFA 2G71A 2PX2A 4RVHA 1FJXA 3FTEA 4JXJA 4Y2HA 3UJBA 2K4MA 2UZ4A 5E1BA 2FHPA 5P8WA 2PVCA 5JR3A 3MTEA 2QRVA 1RI2A 4M38A 2XBMA 5HIIA 5U4XA 5JUWA 3BWYA 4C4AA 4P7FA 3NWBA 1YB2A 5HILA 1VIDA 4YUVA 4RYLA 5M5BA 1QANA 4LECA 4QPNA 5EVJA 4E70A 2OKCA 3K0BA 3SR4A 3SMQA 2ZFUA 2OBFA 2OY0A 3M6VA 4KDRA 1UWVA 2BR3A 2R6ZA 2AN4A 3B5IA 3BGDA 4IV8A 3G2PA 3GWZA 3DOUA 5D1NA 2C7QA 3FRIA 2Q41A 1HMYA 4PINA 1YFLA 2ZCJA 4BY9E 2IDKA 3FYDA 2XYQA 2YQZA 1YZHA 3T0IA 1FP1D 3LSTA
chains in the Genus database with same CATH superfamily
1CB7A 4MJLA 2OFFA 2R5WA 4E1VA 5ALZA 1FFSA 4I2NA 2VJMB 5L4LA 2AW5A 3CKLA 4WY2A 3ESDA 3K05A 2E1PA 3WTBA 1MT0A 5KS2A 1HUQA 1S2MA 4GLOA 1B8VA 2RH8A 4XB1A 1MLDA 3A26A 3BFVA 3W05A 4OOFA 1N8KA 3ND6A 3MYYA 1J5PA 1SBHA 5P21A 1XVUA 4H4EA 3PE3A 3RS4A 1AJEA 4PXYA 2R1UA 3AEQA 5DK4A 5JASA 1XA0A 4FX5A 2QL5A 1YDHA 2IGBA 1E0SA 2HLNA 2IV7A 1YJBA 1DQRA 1W36C 4UBKA 4NV3A 4KE7A 3STHA 2ODEA 3CKYA 4X1YB 4ANRA 4ZYZA 4RIHA 4YP0A 4MWBA 3M9WA 1U6KA 4OAQA 1CDDA 2R65A 3WLOA 3LRTA 3RJMA 1TF7A 4ANFA 4Y28F 2WJHA 3C58A 3JWEA 1XMJA 2XE6A 3X2SA 4KDEA 5C46F 2Q6KA 2OAQ1 3PXCX 1NW4A 4H3VA 5UKDA 4MCHA 2IEDA 4NCIA 5FI1B 2YUTA 3PFCA 5JTTA 4P0PB 4PC1A 2N46A 4LJAA 5E6UA 3LQ2A 1GQQA 5JZOA 1OH6A 2VYND 4NKRA 5F35A 4KLRA 3UT5B 2HC9A 1U0EA 4W8HA 1DMSA 3ANNA 1UOQA 4QYTA 1JJ7A 2PZ8A 3OIFA 2O8FB 1E1NA 1PZNA 5DO9A 2D2XA 1L7QA 4WASA 5KTYA 4CZ2A 3IQEA 3CW2A 1Z4KA 5EA2A 1NDQA 3K0SA 3NUQA 1G5TA 4NDNE 1F2UB 1AQNA 4I5IA 3JAKB 5LNK1 2W6JA 1KI3A 4HAXA 4ITRC 5JFOA 2X8WA 2GCEA 3UAWA 1WHSB 2PL1A 4P08A 4AZ0B 4HGZA 3PVSA 3BMQA 1XXLA 5CB6A 3TPCA 2HU5A 1W36B 3V4OA 4B3TM 5ES4B 5ECWA 3OP4A 1UBLS 3OI7A 2D5LA 1ENZA 4M9ZA 4RAOA 4M4SA 2QLBA 2YINC 3PC6A 3TTXA 3LUBA 3QV2A 4M55A 3HK2A 3MBKA 1CJVC 1L5HB 2I76A 4TX1A 3BSFA 3RVPA 3VPAA 4PSVA 1J09A 3CPHA 1K1EA 1OXVA 1Z5CA 1XOIA 1KOLA 4K46A 2WLSA 3AI2A 4WXYB 1KFBB 1UJ5A 3K32A 1LTMA 5MFZA 3MJ5A 2BHNA 1MNQA 1TR8A 2B7LA 4MO9A 2DFNA 2DUNA 1HF3A 4QVGA 3FGZA 3LZCA 4JJKA 3ST7A 1E0DA 4D8YA 3ZQ4A 5K8VA 2ZJFA 1W581 1EYZA 2W2PA 3UBMA 6AT1A 3I9V6 1JPUA 2P1ZA 1W4ZA 4K7JA 1L5GB 4M1QA 2E7ZA 1KEZA 2DVMA 3DLAA 2PRJA 4MV6A 1CNEA 1E1CB 2BMDA 3JCZA 3SQXA 2JB9A 4BO2A 1UAYA 5JNRA 3USZA 1YVPA 4YCJA 4OXIA 3EASA 3EH2A 2XCOA 4PTLA 1NP7A 4Q3BA 5L3QA 2J59A 1XA3A 1MB0A 3F67A 1KA9H 3M2TA 1NGSA 4JB8A 1D6NA 1YB5A 4JN6A 2ZIVB 1LVGA 1GQYA 2XKJE 4KH0A 4IX1A 4E2FA 2GAIA 1IM8A 4WVFA 4D5GA 1NQOA 4Q7JB 2WUGA 3DS8A 4PXSA 3BC1A 3QBTA 3RYFA 1DTSA 3CEPB 1M2WA 4PX2A 2NAFA 3UMMA 1BMFD 2WR8A 2PFSA 2Y9MB 3CGWA 4BO4A 3BXOA 2XDAA 5B5SA 2ZT8A 4A91A 5A5VA 2WJGA 1A95A 4Y2RA 2ENWA 4YJHB 3KIPA 1U3WA 3TZCA 721PA 3U6SA 3PFNA 1QTRA 3VSCA 1QGDA 3GEIA 4EMTA 3UO8B 1TI7A 4Q21A 4YYEA 3KXEC 3NALA 2OHXA 3TZQA 4J7UA 1K98A 1UQUA 4ZMRA 2AA3A 2W42A 2J1LA 2IYEA 2VK8A 2AEJA 5AW1A 2C3PA 2GFQA 3KR1A 3ROGA 1I3NA 4KWEA 1ORDA 3BGWA 2NYVA 5JYCA 1U2ZA 3CA8A 4C0AC 2NN3C 2HT1A 4FE7A 1A7JA 4MR8A 4FDVA 3LVBA 3QOXA 4D4JA 4UMFA 4M8NE 1PGPA 5BW4A 4RTLA 4G5RA 1AQYA 1BGVA 4J76A 1ZNZA 1NYLA 2ID4A 3FZQA 2JHPA 3L7AA 1HKHA 5KO3A 3DBVO 1BDMA 3HUFA 3UT0A 4B85A 3M4XA 5AVKA 1Y5RA 2YYSA 2RHLA 2BEWB 4TLAA 5F5XA 3S2FA 4JB3A 2X3YA 2NUTA 2BEVA 4L7VA 3UXHA 3MPOA 3D4PA 1RYBA 1VP3A 1KDVA 1L3IA 3EXIA 4CG1A 4KACA 3TWLA 1LTKA 3T3OA 3LJKA 2CV1A 3QNWA 3DYIA 3HCEA 1GL7A 2BM0A 1I7QB 3RYHA 2P9TA 1K3FA 1K7FB 1K6EA 1XEFA 2UUPA 1W2HA 2Q62A 5MN6A 2NZXA 3HJSA 2XQGA 2YJZA 3EEOA 2DHEA 3CF2A 1K06A 1XNQM 3IBGA 3H7AA 1D1PA 2UVDA 3HUUA 3CEJA 4QHTA 1ZL2A 2A9FA 2J0SA 3HLTA 3S7ZA 1I6KA 4BVJA 3JZMA 5C9ZA 1N5OX 2QMUA 3NAGA 3RIGA 5HCIA 4M9CA 2ZS7A 4MYUA 4L8FA 1GU0A 5AVYA 2P69A 2BSXA 4IHKA 2C5GA 4NARA 2WSBA 3H97A 2CLEB 2VZEA 3H9EO 1Z35A 3E21A 3M1YA 1DV0A 4JI6B 4WZZA 4EJSC 2HRQA 1RWXA 2GTHA 2HSWA 3SSNA 4B6OA 1Y5IA 3HM9A 1GZVA 1N8TA 3WP0A 5BNFA 4DIMA 1EZZA 5KDLA 4LQCA 3JQ8A 3B1VA 1YJ8A 3SEQA 1UJCA 1Z4NA 2R6DA 2HUNA 1T8YA 1VDDA 4L8WB 3N2KA 2IP4A 1Y7HA 1NNI1 1E32A 2QDXA 1H9BA 2Q4TA 1S3FA 3UC5A 1JMKC 2HWWA 4C6TB 2H4ZA 4QATA 3AR7A 1UK8A 5C2JB 5EKXA 4C89A 3C7TA 4PHCA 4EA7A 5IDQA 5JNTA 1NJ5A 4V02A 4DSZA 3LKBA 2IOFK 3OTOB 4M49A 1NNUC 3USCS 2NX2A 3HCPA 2A5GA 1H4SA 3LK6A 3DDOA 1ZZGA 2P6RA 1O0SA 1H94A 5CDHA 3GOHA 2ZE6A 2GXSA 4KJZA 5D51S 3CLTD 4Y2YA 5DTJA 4P7FA 1TU3A 1ZGCA 4QPNA 1M83A 4P3KA 4O4HB 2J9GA 2I2FA 3TFOA 3L7JA 2MYPA 4RMJA 1XNHA 2EBFX 4BP3A 4HJXA 4KRYA 4LXQA 3S8YA 4UREA 1C7RA 3QYBA 1QORA 4UVGA 1WPXA 4RZSA 1KDPA 3DTVA 3E1GA 4PX9A 5GOZA 2F3TA 1S8NA 3EVBA 3GJSA 1G6Q1 5AW4A 1OFHA 4MB6A 1WU8A 1KH3A 1X1SA 5CCDA 4F8EA 2FLWA 4P80A 4B4WA 2DU8A 4OX9B 3PHLA 4KGXA 3ISVA 1V4BA 5IJXA 1MU0A 4ZZ2A 5BYAA 3HHWA 2PD6A 5CM8B 3NQ41 4P8RA 1WM1A 2INGX 2QUJA 2P27A 3IQZA 3QVGB 3KXLA 4IIVA 1TIBA 1RC0A 3KLOA 4QU8A 4BOYA 1WE2A 4UPEA 1KHHA 5LZ5A 3NONA 5KJ1A 5HGJA 2PJDA 4KWCA 3QU4A 5MF6A 3L25A 2WK1A 2WTXA 4P53A 3HJRA 2O2SA 4FONA 4BQOA 2H5IA 1Q0PA 4GRDA 5EVCA 3ZNOA 1D5WA 5B7GA 3EZ6A 5DNYA 5CH5A 4DV3B 3DLIA 4H1TA 3F0TA 4ZHQF 4BNXA 4G25A 4WZBB 5DT9A 1W94A 3D64A 4GSKA 3ZWAA 1GFZA 2H2IA 2CXQA 3SDBA 3U3RA 3A1TA 2BL4A 2XWQA 2X42A 4NYMR 1CHDA 4B3IA 4TV8F 1EPUA 2X0FA 4DV2B 5KNBH 2DF8A 2XCIA 2Z6UA 4DQ0A 2BI7A 4G41A 1Y33E 4O5AA 2AMVA 1KRHA 5ICFA 4KNWA 1Z4MA 3JY6A 4ZVVA 1FFGA 3AVOA 2FPPB 2VYCA 3TE7A 3HI6A 4BVLA 3C97A 5BR8B 3IAEA 1BCRA 4BIMA 2A0YA 3N07A 4RVSA 4KREA 1VHWA 3MLAA 4R8SA 4HDNB 2QD1A 2I7CA 1DOHA 1HNNA 1CRLA 1H9AA 1G6HA 4ACAA 2N0SA 1QRRA 1ND5A 4GU5A 5TS3A 4Q3KA 3HQ4O 3BERA 3B2QA 4H1HA 4EF6A 3L0ZA 2JASA 4ID9A 1N3BA 3JAMA 3V8RA 1AURA 3F3YA 5ETJA 4HGQA 3ZY4A 3FPLA 5JC8A 3I2GA 5K6AA 1MJNA 4D6PA 2HHLA 5I7VA 1A5ZA 1SUWA 1BX1A 4XPIB 2YTZA 1XMQM 1E5QA 3DLTA 4YB8A 2DKOA 1KC3A 2JAUA 1N1EA 4BZPA 5HUQA 3NDJA 4CKEB 1M10A 1DDIA 4JQYA 4C20A 2WNIA 4M0FA 2ORYA 1TZKA 1C14A 3TMAA 3W68A 1EVEA 3SJUA 3MWGA 2WHQA 2L7IA 4IIFA 4NBKA 1P5FA 2ZI4A 3WA6A 4EM6A 4C4YA 4GRIA 3O83A 5JNSA 3U0VA 5CFZA 2HLDA 1FVHA 4AS3A 1DCMA 5EKUA 1X9IA 3I0NA 2Z2ZA 2C9CA 3E23A 3KYJB 4J0GA 4ND6A 1ZPDA 4FYVA 5I5EA 5TB5A 1TW2A 4O2BF 2F5OA 5DLYA 3WWYA 4FWHA 3CR3C 1CUUA 1PT5A 2OMKA 2H1VA 2BEUA 1IEXA 2ZM6M 4CQJA 1JIIA 3R4CA 1PFWA 4GGOA 2AG8A 1OJ7A 1MTOA 1LWNA 1EX9A 3HZJA 4AJJA 3FSJX 2EW1A 4EG4A 2JGLA 3H18A 5HNKA 2OLKA 2VZLA 2R5FA 1WJGA 2VI5A 4QPDA 3VPGA 3VTAA 4KXXA 5JAIA 5JMOA 1BVHA 8AT1A 3RC8A 1GGMA 3ZGNA 1HYQA 2FFJA 3DZHA 2O1WA 2IKQA 3NAZA 1KK3A 3K5WA 3MTJA 3WLHA 3AQ4A 4NBWA 1NVMB 4JX9A 2NVBA 5BWBA 1FFCA 3BJRA 5JXWA 5LP6F 4UFPA 3HGIA 2GNPA 4OK6A 4ZPJA 4OUKX 2AWOA 1EB8A 1TPYA 1DXHA 3THOA 1CQWA 3KPYA 1BDJA 4B7XA 4QQKA 1X7WB 1M3SA 4EG5A 2I2DA 4OG2A 2C61A 4MV7A 2AXNA 2BN4A 1JKJB 2C57A 2REBA 2IV3A 5CVTA 3ZCSA 3C9PA 2ATEA 3SMVA 1HKUA 3HKDB 5CCXA 1E58A 2ZUBA 5D5HA 3WYGA 1N3IA 4EYOA 2Q9BA 3HJQA 2VATA 2XYGA 5HOQA 4YIHA 1NXTA 4FFSA 1CZUA 1T91A 1DC7A 4F3CA 3TFQA 5T3YA 5LOVB 2PL5A 3LW7A 1ZA2A 3F8TA 2XRFA 3HA7A 4JYAM 3P2YA 1R5NA 4LRYA 4Q4AA 3R40A 1Y1RA 2CFCA 4BPRA 1C3OA 1DTWA 3FI9A 4JJ4A 4MKRA 4QECA 5IHPA 3TKLA 4ASUA 2AZTA 3ZWVA 1VCIA 3CRNA 4WX2B 3DEJA 5H3CA 1ULAA 2AHOA 5FQOA 1NG9A 4IWNA 4BVKA 1IDOA 1W44A 1HFEL 3VV2A 3O95A 4PVCA 1ZD8A 4MW6A 3VC2A 1OI3A 4ZV7A 3E9QA 3RVSA 3LFHA 3JATB 3UV7A 3DV0A 4N6OA 4ARZA 4CU2A 4YUZA 1JKFA 1UJ6A 2VJBA 2J30A 1NSYA 1O57A 2IYFA 3DOIA 2IYRA 3LUAA 1O5OA 4RTRA 3ONVA 5H8WA 3ADPA 5FPKA 3EPKA 4KFTA 1O54A 2VH2A 2HOQA 4HH3C 2BONA 4Q7QA 4CDGA 1ZSNA 3KT3A 1XQ6A 5D86A 2WHPB 1TYDE 1PBNA 2XB9A 1JR4A 2J5KA 1BWRA 3EG5A 1C9NA 2Y20A 1XZQA 3ND8A 3N70A 4QBTA 4FU0A 3ESZA 2Y1FA 1EQAA 4UHDA 1SXJC 3IQFA 1DXOA 4AN1A 3T7IA 1QF6A 1QMPA 4G97A 1JKXA 4U8GA 1M8FA 1Z73A 4C04A 2LP4Y 2WV9A 2X1MA 3QVJA 3W2HA 1UEXC 1CQJA 2X15A 4B4UA 4K0KB 5AVOA 2XYRA 1NL3A 4Q48A 2DWZB 2VBCA 2W6JD 2XB6A 5IZCA 3P9RA 4DA8A 2H06A 3CR8A 3I0MA 4XYLA 1PR0A 3MRSA 5JCOA 4RTOA 3ETGA 2DAEA 1MO4A 3BA6A 1EE2A 1NVVQ 3AVWA 5JE8A 5CH8A 3WLEA 3U0BA 2VRNA 3WGMA 3RF7A 3CX8A 2W4IA 3HDHA 1WDKA 4FMBB 4GICA 3LCVB 4OATA 4D9JA 3DL0A 2IUYA 5BP7A 1D4FA 1WZNA 1A9ZA 1AS3A 4LI3X 1DG3A 1D0LA 2HQBA 2MSLA 3ZGOA 2C8VA 3TZEA 3V4RA 1SC4A 2JIBA 1D8AA 4UE3S 3RUHA 3L3BA 4UCQA 4XB2A 2IODA 4OEHA 4PZCA 4F3NA 3F2VA 2ERCA 3JAWB 1PQUA 5ICCA 5IREB 2PQ6A 3PGMA 2C4WA 2GBIA 3Q0TA 4X85A 1Z0DA 4Q1FA 3PQFA 2EW8A 4G26A 1SXJB 4NRVA 4PY2A 1OZAA 4A6PA 3OQNA 1XB2A 1TKAA 1DFIA 3UGKA 3SR0A 5B3KA 5KBYA 5HP4A 1JUDA 1UKCA 2ZG6A 1Z4PX 3ZHUA 4MWOA 3ABRB 3C6ZA 4NVRA 3GJXC 5LZ9A 4YO8A 4I8IA 2X49A 4BNWA 2BFCB 4PYRA 4LYEA 4AW4A 1JX6A 3PPWA 3O8QA 1G42A 1ORYB 3HBNA 5EERA 4M0DA 4ER5A 4MKFA 1E79A 3D7MA 1MRZA 3ASVA 3VHXB 1VLVA 3KD2A 3V4FA 2VT7A 1OJLA 2ZBKB 2X4DA 4E21A 3H4IA 3L1VA 3NC1C 2XMBA 1VL1A 4YJ3F 4DW8A 3B13B 4D1YA 4HWRA 5F3WA 2GYVA 2X1LA 5TPZA 3VJLA 1SVMA 1YNSA 1RJGA 2EHJA 1A82A 3GFRA 1Q74A 3A10A 2Q0SA 4PZAA 2VYFA 3EXEA 1HORA 3G9XA 3OE1A 4UM9B 5J2TB 1HDXA 3FFWA 2ZJ8A 1G59A 2J41A 1PNOA 4IHQA 5BO5A 3PIDA 3K9FC 2NPIA 1WMSA 3TXYA 2LVQD 4DV0M 4UOQA 1Z8FA 3DVAA 3SXJA 3KE9A 4MW5A 3E3LA 5CXUA 1L5WA 2XGNA 1WP9A 5T6MA 4EG1A 2LCFA 2F9LA 1DEHA 4M89A 3N05A 4M36A 4ZO7A 2J6CA 2P6NA 2F1JA 3PUYA 4TRNA 1JAZA 2P2ZA 4CIZA 4Q9DA 3EF1A 2FOXA 1TA0A 2Z4RA 3GZ4A 2AG5A 4D8UA 1P7YA 1YS7A 3OX3A 1UFKA 2H2AA 3FFTA 1RWMA 4QOZC 1GJSA 1FRFS 1F14A 1NVBA 1UH5A 3RV4A 4AMVA 4MNTA 4BATA 3AFNA 4A4DA 3GG2A 4LPKA 3LDHA 4NBTA 1PYOA 1NJGA 1T9ZA 4ZWNA 4J0HA 5AM2A 4E5VA 3V80A 4WFQA 2HY7A 3OIYA 3RSZA 4GQIA 4TYPA 5JT1A 2C0CA 4D4LA 4ZOLA 1KYXA 4KDFA 5AKJA 5L4NA 5ALQA 3U7IA 3PI6A 4PNHA 3GI1A 1Y1PA 3WFIA 4MUBA 4F06A 1IZYA 3GEEA 1E98A 3EC7A 5IABA 3JARA 2C29D 3KLMX 2HFJA 1Z6PA 1Z22A 3ADOA 4KGVA 3GLFB 3L0YA 4HS9A 5K6TA 2KRKA 4Y2VA 1Q6YA 5IBQA 4DIOA 4G0QA 3SIPA 3GPLA 1C50A 2ZDQA 1YONA 1ZNYA 4ZK2A 1V8PA 4K86A 1GP2A 3Q41A 2KYRA 1N6LA 1K7SN 4ON9A 1EDOA 1T6OA 4A6EA 5JEDA 3A2NA 3VBEA 1XCPA 3GGPA 3RE1A 5GVRA 4DR5M 4MKXA 4MYSA 2OHFA 3KSUA 4HTFB 1ZLYA 2IXAA 3TR0A 5IYZA 5TR9A 5TT1A 2WSLA 2XD4A 1XXHA 3OLVA 5KJCA 1AM4D 1TL7C 3ND9A 2AE2A 1C30A 4OFXA 1TB4A 1XZLA 1GQFA 3E27A 1HNXM 2CNDA 3CT4A 2CVHA 1JT2A 3IAHA 4EHJA 1BSVA 3Q3VA 2WYUA 4RGBA 2D1TA 1RJWA 3EZYA 2HDHA 4E32A 3B6IA 1QDUA 2BJHA 5I9SA 1A8PA 2W2KB 4BFLA 2O20A 3ZW7A 2ORED 4MB7A 2ZRNA 3D7SA 3URMA 3BXGA 2F4VM 4C3ZA 2EJWA 3V8EA 4C7XA 4CM8A 5FBQB 3EZ7A 2HRDA 2W8ZA 2WQ7A 3DCJA 4JKOA 3A25A 2QRGA 5CDTA 4ZALA 3WG9A 2PVCA 4HAYA 4N6GA 1DJPA 1ZMOA 3QA3E 3A6ZA 3C3EA 1GL9B 4Y1EA 5GZ6A 4RF3A 4EYEA 5F78A 2RB4A 1WCV1 1I51A 3IAM6 3E82A 1OX6A 3A4YA 4DLSA 4XLZA 4HDCA 1GRRA 1CHNA 2VT2A 5JEEA 1RQRA 2B1GA 4NZ9A 2A59A 5IMBA 3WWPA 3FVRA 2QTHA 3VUFA 3DR3A 3AG6A 1M0SA 4U4AA 2V6JA 4B8ZA 1C4XA 3LT5A 1QDRA 3KSDO 2AQHA 4D42A 3QAUA 4G5FA 1ZH6A 2EGGA 4FGJA 2C8LA 1WB6A 2XYVA 4BLVA 5A1JA 4BKMA 2FG7C 3MC1A 1IXKA 4G1BA 3DXXA 2F3SA 2ONYA 2BMVA 2UXDB 1DBIA 3K09A 4E2YA 5J2UF 4BTVA 3JQBC 3HJGA 2HQOA 2Y4OA 4RVNA 3IRVA 3NI2A 3GG9A 1M1UA 1HGXA 3VU9A 3DZCA 3HTXA 3DTVD 4YN3A 1YA8A 2LIPA 1QGYA 1L2BA 1ZJZA 4X8HA 1FYFA 3TXXA 2O8CA 3I5XA 1Z07A 1XKTA 3T9CA 8OHMA 3G2QA 2COUA 1VGVA 3QW2A 3W5AA 1JL3A 4N6NA 4G36A 5ADVA 1FJGB 5HKKA 3AMVA 3LW5F 5A9SA 5KNLA 1CT9A 3QLEA 3I2HA 3EGEA 4KQFA 1YZQA 2Z6VA 1OWMA 4RTKA 1H2HA 2P5SA 3BD9A 4LI0A 4A15A 2C9BA 2FW6A 5J4HA 2XB2A 3V9PA 5JH7B 1D1SA 3K9HA 5K3BA 3WHPA 1LBHA 1SVWA 4O29A 2IQ5A 2H9AA 4E6EA 1XD2B 1WCYA 4A8HA 2XGJA 3AFGA 2I2WA 3RTEA 3OMLA 4MQ5A 2KNVA 1XWIA 3RUCA 2LKDA 1P19A 4R5MA 4FFLA 2YRWA 2BSQA 2C4MA 2YXDA 2JEZA 1EG2A 4KOAA 5F1PA 4NCXA 1EVLA 3L1HA 4YREA 4HYYA 4G5GA 3SC3A 4MGIR 3R0VA 4BN4A 2WIKA 3LHIA 3RGPA 5DSTA 1WXQA 3ZTTA 1C8LA 1CZHA 3OEEA 5BSHA 3BL8A 3Q6MA 1QWOA 2K47A 4IDOA 3OM8A 1WMBA 3BFPA 2CLSA 3OQ6A 1OAAA 3D02A 1ONNA 3QQPA 4JGBA 2GEBA 5CVJA 2FZWA 3AESB 2EFDB 1Z8DA 4Z49A 1MG5A 1G1MA 3WGKA 1AHHA 3EPJA 3DE3X 1OPXA 1R2YA 3G0IA 2FH0A 4LCBA 4EB0A 5K8TA 1ZL0A 3DBRA 1GRVA 3NGXA 4I4NA 1KEUA 4OJQA 1H5QA 4W5OA 5A4FS 1L1FA 5IUKC 2CK3A 4CF3A 2KJQA 1TC1A 2P6PA 2W90A 2XAUA 3DFUA 1JEYB 3TQHA 3IAUA 1LXCA 4G0UA 1FYDA 3BXWA 4NSRA 3AX6A 1AY0A 1N1MA 2XZTA 3HE3A 2JP7A 2I7DA 4HDMB 4FC6A 1WUHS 1WQ4A 3ZV6A 2MMGA 2QTAA 9ABPA 4N48A 3K9LA 2PRZA 1WKCA 3TSAA 4G84A 2HLDD 3OECA 4HD8A 2FPIA 1ZJJA 3EK2A 2VSFA 4AROA 1BCSA 4HAVA 1QGOA 3L77A 3IJ5A 1E8NA 4C07A 4LXHA 4NC6A 4HUQA 3TNFA 2QUHA 3QPWA 5IM4F 3ZXXA 4JI0M 4JC0A 1XRMA 2FW1A 1VDLA 2O4CA 1JU4A 2VTVA 3G23A 3NEPX 2X41A 5C51B 4O3FA 5B3JA 2VQ3A 2JRCA 1P74A 4KOEC 3MCTA 4WCVA 3RKUA 1DL5A 1P8AA 4C4SA 1E2GA 4PZUA 1LQ2A 1JLRA 2FN7A 1SG6A 1F20A 2O0HA 1NR5A 5AVSA 1P4AA 2EFJA 4NS1A 4GYWA 3KEGA 4EMSA 5LQRA 1R0RE 4NESA 2YL2A 3IOMA 5CGQB 4Z6YA 4JLVA 3EQ7A 5IJZA 5B1IA 2D06A 1KOJA 2Z4SA 1X8JA 3NHJA 4IHJF 4MOWA 1FB5A 1JVSA 1L8QA 1F1BA 3G2OA 1CFJA 2W9XA 2XXAA 2C7BA 4UBIA 4O59O 5DWQA 2UVPA 2GZ1A 5KWSA 2H1LA 3CUSA 4JLBA 3QSYA 3HY5A 5K0BA 5HF9A 2AOXA 1FDTA 2RGUA 1CY7A 2CLOB 3VJMA 9LDBA 3AV3A 5DXJA 16PKA 3FAKA 2VHWA 1YBAA 5DX1A 2IS1A 5LC1A 1KH1A 2GKSA 4HR7A 5I45A 1X6VA 3TSWA 1NX9A 2ADMA 2NLOA 5COAA 1SHLA 2HM7A 4MV5A 2AFIB 3F9CA 2JS7A 1LPSA 3MJTA 2VP4A 1KEWA 1IOVA 4FVMA 4F2HA 1W25A 4EF5A 4C0XA 1V92A 2FMHA 3VJKA 4QOFA 5AD1A 4HK4A 4MRAA 2QLMA 3H2HA 4X91A 2RGYA 1MGPA 4OB6A 2RRUA 1YI1A 3U3XA 4R1OA 1K75A 4N7BA 2H0RA 5TT0A 3SXUB 4ASUD 5H16A 1KO8A 1KI7A 2G1AA 1YC5A 5B6JA 2R87A 3MOIA 1FTGA 3IXQA 1PR5A 2GA8A 3JASB 3HU5A 3LLCA 2LH0A 4N8DA 5T3UA 1JMVA 1TXGA 4QQRA 3PTAA 2AN5A 4O8CA 3CPEA 1ZZEA 5DCLA 4FI3F 2P5UA 2NUAA 4D97A 4WH0A 1ZN7A 3VU8A 3QE3A 2XDQB 1D0VA 3AM3A 1ATZA 3O9VA 4YASA 2XUJA 2WYIA 2XOKA 4AO7A 4TYWA 5E3JA 1ILEA 1KMHA 2BNKA 4G4OA 4E09A 3U09A 4PAMA 1N4AA 4MVJI 1IVSA 3EN0A 4FCTA 5KYUB 1RJFA 3EARA 3IE1A 4V1CI 5J63A 1G3RA 9LDTA 3DKIA 3RADC 4ESOA 2YYZA 1NJSA 2PUHA 1MV5A 4UTXA 4BO9A 4DR4M 2RBGA 1QLWA 3GNQA 3O3NB 3SX2A 4HY3A 2A9KA 2JL1A 4DSTA 4HAZA 2PIAA 3PEFA 4X61A 2JBAA 1CY0A 1YZNA 4C3VA 3ETJA 5GV8A 3C48A 1E3SA 4FGWA 3OSUA 5I7FA 1N2IA 1V35A 4JGGA 3HR8A 2OORA 4DADA 4YAOA 2K87A 1CEXA 1RRCA 3ERCA 1NVWQ 3TUZC 1Z62A 1GGKA 1X3LA 4CEHB 4IXNA 3S5JA 1PNTA 4OJNA 3H9UA 2Q6VA 4PHFA 3SKXA 4DMFA 1G3QA 4C0BA 4JQCA 3KFVA 2XCTB 4ZOAA 4IRUB 2H52A 2B20A 1TMYA 1LLQA 1M6WA 1PT6A 4A27A 3UWMA 5IC6A 1Z82A 2O06A 4QYMA 5TPWA 1WR8A 2WTUA 4ZOBA 4KP7A 3QU7A 1U8ZA 1JG6A 1VM6A 5ER9A 5KSOA 4GKJB 1RLMA 3Q72A 3PWTA 4ABTA 3GVHA 3UANA 3VR0A 1M75A 4H7IA 1CUVA 1G6OA 1U81A 1B3RA 2B3TA 4KL8S 1K5GA 3ZUGA 5EMKA 3K2IA 3G0DA 1CSEE 1OAOA 1KJYA 4O4IA 2UYGA 1XEWY 5BUSA 4JJAA 5ILQA 1R5JA 3GLSA 3CRVA 3LF1A 3B5IA 5G41A 2A1IA 1TYCA 2ZRHA 4LGCA 5JDCC 5EUQB 3CLKA 2FN4A 1NWHA 3QUSA 5LYJB 4W5WA 4GKKM 1SK8A 4X41A 4WZAE 1Z15A 2GARA 2GAFA 5CDUA 4M21A 4ZQCB 4TLMB 4B6SA 3PNSA 5HS6A 1QYXA 2ETVA 5IMSA 2IJGX 1EUZA 4P4UA 3OIUA 3MTAA 1RQGA 4IQGA 4IX9A 3VYRB 2DBRA 1TH4A 4JOSA 5K20A 4BNTA 2L19A 1E79D 1DAKA 2AVDA 2ZSFA 3AL2A 2JCBA 3IVXA 4ZOEA 2KQUA 1ZD3A 3GQBA 4C7MA 1R3DA 2YOHA 1GTVA 1N2CE 4IP0A 1JVBA 5B4VA 4YYZA 3I51A 1V43A 1CNMA 2ZQ5A 2GLXA 4BE9A 4LF5B 2P4UA 3UWPA 4CKYA 1NNJA 1R9MA 3TOZA 3TCKA 5TPZD 1SHJA 2OO7A 1N6PA 1CU1A 4AN0A 3PZRA 5FNVA 4TTJA 2CJXA 3VOSA 2WT8A 3G7UA 1KO4A 3CX6A 3RROA 2WZDA 3HB7A 1K86A 3DBHB 5K0TA 2IUUA 3CH7A 2GN8A 2FLVA 4RZHA 4ND8A 3L8HA 1VE5A 3TMYA 2GYWA 2OOKA 4AX8A 2RJOA 5KWEA 2ZKIA 3ILSA 1VG5A 1NBIA 2D8AA 1FMCA 1M6YA 1TRKA 4ECEA 3GEMA 2Y1LA 1AUQA 3H75A 3UIEA 3D2AA 5DOZA 5ECYA 4QELA 1N3LA 1VEJA 1RRKA 2J7PA 4QBFA 4IH4A 3GEDA 1U4NA 1G4UR 2LKCA 3C39A 1S9HA 1U2RA 4RFSB 4L0DA 5L6LB 2C7OA 1JXAA 4JD5A 1R5BA 1Z0JA 4FW9A 5K0JA 3C87A 3KL4A 3G79A 4UNIA 2IIVA 4EJ6A 1ABFA 4ALMA 1PZHA 5JSZA 3GJ8A 4WMLA 3RYIA 2PWAA 4MGKR 3PYMA 5C1OA 2Y1EA 3EQ2A 4PW0A 2VP6A 4MYTA 4ZA2A 3RUPA 2A3NA 1CY6A 3UOWA 4RJ2A 1PJZA 2AE1A 5L3VA 4XQGA 2I1VB 2OYCA 3RSHA 3SEZA 2POQX 4Q24A 1RBZA 2PYDA 4UU8A 2BKAA 3FCYA 3AONB 4KFSA 2FGKA 2W5UA 2JCXA 1AB6A 3F6BX 1HNWB 4FKZA 4JV5B 1LF5A 4MTCA 1C4WA 1NFQA 1CLEA 2H1OA 4MVJH 1JHDA 2WAOA 3ICWA 4KHPB 3IAS6 3HP4A 1V11A 3VO1A 2I4RA 1IBLB 4JLKA 1JECA 2Q5IA 5TXGA 1TK9A 1EM8A 3ZHXA 1E2FA 2XCRB 1N78A 4WUVA 2DUMA 2QR5A 2NADA 2J3IA 3QKRB 2IZ7A 1R9JA 5GOTA 2HCBA 2FPLA 2GYUA 2CFTA 4MQLA 1KRWA 2D3WA 5EZYA 4JLWA 3TXAA 3CF4A 1TKRA 5F21A 4ME6A 4LSZA 1IWOA 2IYUA 3JWGA 1B15A 3U7QB 1U9CA 2VUHB 3UT6A 1QQ6A 2H7YA 5BPHA 4Q6BA 1ESZA 4K9LA 3VO9A 1H05A 4J1TC 3SZ3A 4XRRA 2D00A 3NP9A 1EIJA 4IUCS 1QIFA 4J7CA 3ORSA 3TZ6A 2O7QA 5KCZA 3UCEA 2VIIA 1JPJA 2ZBUA 2ZRJA 5EIOA 5FPQA 3WMEA 1EVYA 2JGDA 2HMUA 5F7XA 4DGQA 4G37A 1S1MA 3ZVLA 4E70A 5EPOA 4CJ6A 5EY5B 2G25A 3ZWYA 5ESWA 2F5PA 3L05A 1GTL1 4HLDA 3EMDA 3VNVA 2XT9A 4L2IA 4RAQA 4LDPA 4LQDA 2V9PA 3SZRA 1ZGBA 2H00A 4DSUA 4LFAB 3KVVA 4LXGA 1U2QA 2JIQA 4EQ6B 3DDSA 4Z0TA 3VAYA 3L7KA 5F98A 2WMNB 1JG4A 4B6QA 3RKSA 4JBNA 5LA6B 5C1DA 3OCJA 3PUWA 1CUWA 4LXTA 3R5XA 1VB3A 4TRJA 5E9WA 5ITRA 4RIGA 2PMBA 3D0QA 4X60A 1UPUA 4LBYA 4Y2QA 3QF4A 4YBRA 3EEQA 4CM5A 1JBQA 3GGCA 3GRVA 1U90A 3Q8GA 4YP9A 3BCUA 2AJBA 3ZW9A 1GN9A 4RF0A 2CNNA 5EZQA 2QAGA 4GMKA 1I0ZA 1JAHA 3GH3A 3BCSA 3PRKE 1GXSB 5ITTA 4WFIA 5FOSA 2GVZC 5I01A 3DUWA 2GEVA 3B1FA 3IDSA 2XY4A 4KO1S 4LY9A 3T99A 2HI0A 2B4AA 2CFRA 4LG2A 3L4BA 3WGZA 5JY1A 1AA6A 4NYJR 3IHLA 5KSWB 3ZGLA 4TTAA 5IW8A 2ZBDA 2XRYA 4G07A 3FDZA 1JSZA 2WUVA 1F4PA 3K15A 3JQCA 1PR2A 4NPAA 2W11A 3WZLA 3AHFA 1E5TA 2XMPA 1Y5NA 2WSIA 2QA5A 1LI5A 2UUBB 3FUTA 2RGRA 2AKEA 2YOGA 5BRNA 2F8SA 4RNAA 1QUTA 2CHEA 2DHRA 4PLVA 3EGOA 4G5XA 2MDTA 5EN4A 1SCIA 3LLVA 5EIAA 1YCGA 4EGQA 4ZDIA 2VDRB 4ALNA 4IRMA 3NT5A 3KZNA 3ZK9A 5HKKD 4X8LA 2Z8ZA 1VL2A 3C6MA 4AJLA 5EJMA 1D1TA 5BURA 5DHSA 2XAAA 4EECA 3TSOA 2W2NA 3R0XA 1RHRA 1IJEA 2QVBA 2Z6QA 2IXEA 3V7WA 3KYCB 1P9NA 3CZMA 3HVHA 3DE0X 3RFUA 2CNWA 3BN3A 1GHTA 2X6QA 3C8UA 4OHWA 1OR8A 2I3ZA 2JLBA 2I87A 2A7XA 3GUCA 3I4FA 4MLCA 1TCBA 1W5TA 4GMHA 2XBLA 1G21A 1YE9A 1ORVA 1U8FO 5CG2A 1ZVQA 2XRMA 1WDWB 4XLTA 4D2IA 5FUBA 1O97D 3CB4A 1JTEA 5GV7A 2HIMA 1EE1A 3T06B 4CMIA 3KSMA 3HHYA 3BYZA 4LRTA 4ZCRA 3AM5A 3RSSA 1QG0A 1FPQA 4ALLA 3KR0A 1DBWA 3T9FA 3RBXA 3OEED 5AOBA 4DLTA 3L8GA 4NR0A 2R1VB 3JSXA 2WVJA 2XDWA 4KWHA 1C3LA 1OCEA 1CQXA 4LJSA 2CHQA 3I6MA 4U3JB 3HCBA 1BN6A 3NWPA 4XGKA 2GVDC 5EXEA 1S3GA 4G01B 5DP1A 4U63A 1ZO8A 1J1IA 4JKYA 2JIRA 4WOPA 3W0LB 1L7RA 2NXNA 1L7DA 1LSSA 3Q7PA 1EX6A 4F5DA 3EEBA 1PV2A 3FYCA 5LR6A 2DP4E 5DM4A 2WG1A 3KOYE 2C1XA 5CX4A 1OFUX 5FSWA 3UPTA 2CK3D 3V1NA 3T3NA 2VBGA 2CSXA 2PX8A 4MDFA 1QIMA 1A9SA 3FTEA 3QZUA 5E1BA 1TT7A 3N8KA 2LE0A 3P0JA 4DLVA 4NMHA 4RYLA 1GL3A 1ZIPA 2BR3A 3NOOA 3I4VA 1NZDA 3T1TA 2O0LA 2BDUA 4GX5A 4EFLA 1ST3A 3ILVA 3VV3A 5EQJB 1CQZA 4IH1A 2RCYA 3PJEA 4RA9B 3V33A 4C0LA 1IUKA 3N2GA 1GCUA 2EWMA 1QHHB 4WQMA 4F0JA 1UZLA 4XDHA 1YBFA 2YV5A 1GG2A 1R4MA 4LSGA 5CM2Z 3L7YA 4L4UA 3B78A 1YZVA 3QJGA 1TGUA 3TIGA 2BJVA 3WK4A 3IOYA 5HIAA 3UWDA 1RAGA 2QNBA 3WDKA 2XZFA 3SJ7A 4UEOA 4I1YA 4G85A 2GR9A 3MIZA 4RSHA 4JIMA 2X0IA 1DRJA 4JHXA 4YCDA 1LPAB 1RIFA 3GEPA 4PIMA 4LDNA 3CIFA 1OLSA 1GSAA 2PU7A 3NHKA 3BGVA 1AH2A 2ZZMA 5JNUA 4JI3M 5LQNA 1X80B 1DKLA 2BELA 3BFKA 3COWA 4E5NA 3R7AA 4ZVTA 1E6WA 3C1AA 4D99A 4MHSA 5AI0A 2BWBA 1C29B 4AKGA 1YASA 1II0A 4ND4A 2JLQA 3DHEA 4YUYA 2OCXA 2NSHA 1XVLA 4D98A 4P84A 4Y1FA 2Q29A 1QLJA 3V4LA 2VTBA 2GAOA 2OO5C 4N39A 1FRVA 2BKVA 5IHXA 1FSPA 4C1NA 1NVTA 3UAGA 4JL6A 4LBWA 3PX2A 4ZVMA 1BH6A 4EUHA 3K1AA 2Q1XA 2C9DA 3DOHA 4JI2B 2XNCA 1JFFA 3OCWA 3FMFA 1M67A 4TQAA 3CMCO 4RS4A 2I8CA 3QEJA 4LV5B 1MRSA 1TJ3A 1DDGA 3W6NA 3A6DA 2PZEA 4MAMA 4N7RA 1BFDA 1ZMTA 2J3JA 2OVFA 3DZBA 4N5HX 2WIFA 5EIEA 3K9CA 2IPNA 5ULLA 1Z2PX 3ZWOA 1FUUA 2VNKA 5CTAA 3RM3A 2OGUA 1W9HA 5FF9A 3HU3A 3TIFA 4JI4B 4P31A 1RKVA 4LF9M 2XNKA 4N3NA 3EE6A 3IYLW 3JVIA 4PRYA 3JRWA 3GLGE 3ENNA 2GFHA 2NXJA 1DGQA 3QLUA 4G5QA 3W7AA 5L9AA 1H3FA 4EEZA 5JAOA 5GJCA 4RH1A 1VBKA 4MVJM 4ZARA 3ASYA 4TYMA 3W7BA 1WZUA 5K6RA 1WZ2A 1ITZA 3BZWA 4YCMA 1LCIA 4OHOA 2XOKD 1Q39A 2VJLA 2CT8A 3O9MA 2XVZA 2JGAA 5KSPA 2XMCA 3OKCA 1W5BA 4REQB 3GVCA 1M2HA 3SPXA 2GT1A 5BVHB 1MIHA 2BGJA 2ATIA 3N5CA 1C0PA 3FTPA 4LHVA 2WKSA 3SR3A 4F3KA 1U0TA 4RADA 5JW6A 4I1RA 4W99A 1E60A 4X44A 4A1OA 4AI6A 1HDIA 1YKFA 2W6QA 1NXWA 3L26A 5A7FA 1QUSA 5HF6A 3QI2A 3ZDFA 2OPBA 1Q1ZA 4TMVA 1O94C 3CGGA 1PL7A 2HF7A 4IVQA 5I4CA 1X8LA 2BP7A 3NNNA 4IEFB 3VNUA 2OZVA 4BQFA 2Z58A 4K6CA 5KX5B 1VEGA 2ZQYA 4Y2PA 1W4BA 2ZS9A 2V4MA 4BQNA 1QYIA 4FN5A 4ED9A 5DHUA 4H2DA 2JJ1A 4UULA 4F91B 1JW9B 4Q9JA 1QH1B 1I80A 3KVRA 1J0BA 2SECE 2Q3BA 3T34A 4ZMSA 3OEHA 2BTQB 2ZUTA 2JY8A 4HAUA 1J0EA 3EHEA 2AGVA 2BW0A 3CURA 4M83A 1VI6A 2R44A 4AECA 5LZ8A 2A78A 5JS1A 3GJZA 4FOLA 4HMOA 2DBQA 2H4XA 2ZUFA 3HHPA 2BHRA 1UPCA 4X1KB 1YVEI 3EIWA 1OBHA 3TD9A 5DFLA 3PQ5A 1DC3A 4AMBA 4EG7A 4N65A 2D13A 2W4MA 4IQ8A 1W6UA 3T3GA 4H31A 1HEYA 2OO3A 4B7ZA 5A4DA 2RJ3A 4ZU3A 3PXGA 5AMXA 2J3EA 1YIAA 2MYTA 1W48A 3IEVA 1B8PA 3RFTA 4OBEA 3WLAA 1F4LA 4P3OA 2L2DA 1A5SB 1QGUB 1BMDA 3HB5X 2OC9A 4Q7EA 3RS3A 2YX1A 3L6DA 3WGVA 1ZH2A 1J8FA 2DC1A 1JHXA 2VHQA 2PXAA 5D1HA 5J4YA 1HSOA 2FEMA 4Q15A 4OJKA 3GT7A 1YI8A 4LVNA 4PM4A 3AK4A 4NL4H 2AMLA 4JVLA 3ISJA 1QP8A 1PTJA 3LT0A 5KNCA 3T52A 2ZSUA 4RE5A 3MRTA 5IVPA 4MVJE 5ADWA 2ZJ4A 1XAGA 4HNGA 3PD7A 4YRSA 1MDFA 5JQGB 1ICIA 1BVRA 1DAMA 3JQ7B 3IP8A 5DGXA 2PWZA 3LVVA 3OFKA 2ZETA 1YDGA 4R3NA 3NBMA 3I4LA 3FLMA 1XDSA 1XJ5A 5U4QA 1KHTA 3TTSA 1ENYA 2B82A 3HRIA 1VE6A 1X7DA 3I2YX 1R4ZA 2ASEA 1A77A 1NFFA 2DHDA 5IULC 4OJYA 3J7AC 4GLLA 4URWR 4HGRA 4MJXA 2M6SA 1R3UA 1O0CA 3UJ3X 4LRSB 4Q1EA 2F00A 5DB4A 1KDYA 1YS9A 3HLKA 1M54A 1VPTA 5LB2A 2FWAA 1OLOA 1NAHA 2WU0A 3ZZ0A 1KAGA 2DT5A 2FF7A 2EKQA 2WD8A 1UM9A 2ZRDA 1I4WA 3DHYA 2Y66A 4N0EA 4JP5A 4X6UA 2HEGA 1W4AA 5DWVA 1G8PA 4TVKA 4KPFC 3MWDB 2QX9A 2RAPA 4OGLA 4AUEA 2J7PD 4AL4A 1LJLA 4ZU1X 6LDHA 2NTNA 2V7EA 3OH8A 3T1YB 2C03A 3H2SA 3R1IA 3RFWA 1L2TA 1L1TA 2BFAA 1PLJA 5SZJA 2H8GA 3TD2A 2Q4BA 2WICA 3FRJA 3OLXA 3V6LA 3WWOA 3X1JA 1QG6A 1BHSA 4F21A 1PJJA 1U2TA 4EATA 3D0RA 5AVJA 5DGCA 4WDQA 5BWNA 4GC5A 4B43A 3HVUA 3GHHA 4GOJA 5HUHA 1A8IA 2IY8A 1G0NA 4HXYA 5DYNA 1CRWG 3ILYA 1JF8A 1NT4A 3QLTA 2C3UA 3NYIA 4R41A 3LQKA 5D5QA 3HVRA 1XJ0A 2UVQA 3OHPA 3T5TA 4Q3AA 4B47A 3PK0A 4GPD1 3X1ZA 4MINA 1BA3A 1O6CA 6REQB 2FK8A 1ZV1A 1XAHA 1U2DA 2YIMA 2CYBA 3HX3A 5E2BA 5C53B 3KAJA 4WESA 2GN0A 1IMOA 2EATA 3VC7A 2BSAA 3ROEA 3SS9X 4I50F 1WXDA 2BCGY 2WD7A 4M7RA 2XTAA 2TMDA 2XZLA 1TLFA 2G0NA 4NXMB 3FPSA 3GW8A 4CQLB 3V8BA 2DUUA 1P75A 2X9NA 3OF3A 2WWIA 4MIEA 1JIXA 4HVAA 3OQHA 1NXVA 4JXJA 2N35A 1MFZA 4YDQA 2YJTD 1K5DA 1IBMB 3U4AA 5D3MA 2OBFA 4BVFA 1CS4C 1P2BA 2P9YA 3U7GA 1NLFA 1PJ2A 3QPDA 4IV8A 1Y1KE 3N53A 2YQZA 2ZVDA 4ZZ3A 4BVAA 1RAFA 3RBZA 1KZYC 5KSZA 1Y3CE 3AVQA 1B41A 2PZLA 4HXFB 4XX0B 2HHHB 3KX2A 4GPAA 1NUSA 1ONPA 4MM3B 4L0CA 5B2EA 2R8XA 3S6JA 1UT8A 1PS9A 5DWDA 2QDKA 3UTCA 2QRLA 4CL0A 5AK3A 3TUJC 3PIIA 3Q85A 2WPDA 4AWBA 2Y0CA 5BSTA 2E85A 1DJMA 1L4BA 3VYWA 4AG5A 1NURA 2JGNA 3UNXA 1HT0A 1T4CB 3OIVA 4L4YA 2FK7A 4EO7A 3QVVA 3KT6A 1EHIA 3QW4B 4B3HA 4E94A 4KIFA 4WNAA 2J85A 4TSFA 1GTMA 3V32A 4Q82A 3KKKA 3I9V1 5TGZA 5SY4A 1PSZA 1U0OC 2DR0A 3BUSA 3N8GA 2M6RA 3WZMA 2DWCA 1Q3CA 1VGQA 3A1DA 2R6JA 4LKRA 1ULUA 5TVKA 3PC3A 4BP9A 2DWPA 3I53A 3UB2A 3ZCXA 3HEBA 4HRYA 4CL3A 5DBFA 4ZI7B 3AY7A 4XWYA 3KCNA 2JVKA 5K3EA 2K5UA 1Y5LA 5KZMB 3DNMA 3TO5A 4PSCA 3PC8C 1JDPA 5J58A 3KQWA 4B84A 2F43A 1QLHA 5FIUA 3OETA 4MZXA 3U5TA 5JPDA 4DR1B 3P9NA 2IX3A 1QIEA 4ZN6A 1F6DA 4EZIA 4Q4CA 1A9OA 3LKDA 2WU3A 3VUEA 5GIOE 2N1BA 3G9TA 2GPYA 2G0TA 3QGMA 4F4UA 4AF8A 3GQ3A 2ODPA 2P7IA 5C35A 1GKLA 3OQIA 2H4HA 1C3XA 3FROA 3P32A 3EVTA 1LBQA 5IPFA 3C16C 4Q9IA 2GRUA 1NV8A 1HDYA 1EB9A 1FSZA 2JI9A 2RKBA 1F0NA 1ZMBA 4ITQA 5G3YA 5LQUA 5SV2A 1DSSG 1BH2A 3DTYA 4IDHA 5KJFA 2GEUA 2V7VA 2XLBA 2PSDA 1XDBA 2MMCA 4KN6A 3N8NA 4NULA 1DKPA 4IZHA 3DE2X 2R7NA 2R8ZA 1F17A 5EJ2A 1C3JA 3PTLA 1OY1A 3UHPA 3PPVA 5I7AA 4DM3A 2R4UA 1U1FA 1GFWA 3SS7X 2CNWD 2ZJBA 3BXPA 1XZPA 1LRJA 3QXGA 1GU7A 4B0OA 1UXHA 1C0LA 1MW9X 4PC6A 2OK7A 3RIMA 2OXTA 4EEXA 3LV8A 4LOHA 2J7NA 2A67A 2BUAA 1H2ZA 1WSDA 5JVDA 3K6SA 1WS6A 4DKJA 4D6XA 5KTTA 1G63A 1MEJA 3MT0A 1QIGA 1J5XA 1DRUA 3FYSA 3O6VA 4LF6M 4GWLA 1NUPA 3GGOA 2XOEA 2DR2A 2JLXA 3K0EA 1OZHA 4FGZA 4RMHA 2JLVA 3ZDDA 3JD0A 2CLCX 4GZMA 3THXB 2Y0QA 2NIPA 3U60B 1I2MA 4LK3A 4W5JA 1RBQA 1W52X 3G59A 5CHEA 1J6UA 3LIIA 4KKXB 3IAFA 4CIAA 4BNIA 3BULA 2IHBA 1BEZA 1S01A 4GVLA 1U2EA 1BS1A 1YK0A 3HVIA 2MWMA 4JU8A 4FYWA 1O96A 5JR3A 4NNOA 3SG0A 3WOVA 1ZCFA 3WBFA 3AKEA 1DCFA 4BVGA 3FW1A 4QGHA 2NXWA 1PJ4A 2CJYA 2RD2A 1ZI9A 3VOTA 1DCKA 2WJAA 2IYNA 1V3VA 3KHUA 1EWKA 5HUJA 1DRKA 1G8JA 4BAUA 2MT9A 1ZM2A 3COPA 1XMOM 3O1IC 3W2TA 1I6LA 5EP1A 3AHDA 4HPXB 4Y2JA 2V6GA 5G0SA 4BWGA 2JHAA 4BS9A 2MSCB 4NZYA 1GSOA 1T10A 1A1SA 1SMKA 3EVZA 1ZK2A 3HNRA 2YW2A 3D7RA 3ACCA 5KOYA 5B30A 5F64A 4F6RB 3ZK8A 2DY0A 5EQTA 5CEEA 3MLEA 4ACBA 2YVUA 2J0EA 4EKYA 3VDPA 3MGBA 3TG2A 1QJCA 2PU5A 1NF8A 4NAHA 1EFLA 3PNBA 3K2QA 3QKTA 2I3DA 4KLAA 3T41A 4MB0A 2DCUA 4UQOA 3SZGA 1QAMA 2FWBA 3U40A 4YAFA 3FNQA 4L8YA 1VGRA 4ZT2A 5HRAA 1HOTA 1FSFA 4X66M 3QX9A 3EX7C 4RFVA 1PVOA 2DNAA 2WTAA 3LUGA 3ME5A 2PLNA 2FQXA 3NOXA 1VSTA 3NLLA 4WUTA 4EBBA 4RPJA 1P44A 2O2JA 4P36A 2P9HA 1WF3A 5DI3A 1IQUA 1ZIYA 3W8FA 3IR6A 2IEBA 4LX0A 1RTTA 2FDXA 4ZQHA 3F98A 2W6ZA 4ZREA 4DCUA 3F6RA 3IPYA 4Z54A 3HY3A 2HJWA 4TUYA 4AMUA 5K3FA 5JV5A 1T1SA 4WOJA 2XNJA 2R60A 3GHYA 2G0AA 3ESCA 1SH7A 2I4OA 4X9XA 4GP6A 1IPHA 3HB0A 4I4TA 2BKLA 4BX0A 2GS9A 5BWLA 3LCCA 4M3NA 4BRZA 3G2JA 1P6QA 3L93A 3S7TA 2PGIA 1S7GA 3SXPA 2PQ0A 3COVA 1KQFA 2PS1A 4YROA 1D4ZA 4YRDA 4Y6GB 4PQGA 2BTOA 4R5HA 1RLOA 4AZWA 3FJ1A 3THRA 1DGHA 1Z36A 5FTNA 1QRTA 5C8DA 2BWEA 3FDJA 2A88A 4UATA 3BS4A 2NACA 1FTSA 3FCSB 5KWIA 3NC4A 5DMXA 2ZIZA 3HSKA 4UCWA 4Z3OA 5KOJA 4YALA 2Z2YA 1F2TA 5C3MA 3IIMA 4K9RA 4QGGA 4BQIA 4QRDA 2NTJA 3JD1A 3T9DA 3T3HA 4MS3A 3DV2A 5C1PA 2PX6A 1UKEA 4ARIA 1COZA 2FRDC 1DJOA 5K0CA 4EYSA 1T9HA 1Z5NA 1T9DA 3COZA 5I4BA 3FOZA 1N36B 4Z9YA 5LZ2A 1YDWA 1YJQA 3O4RA 2FG5A 4DDWA 3NRJA 4II7A 3TLCA 1MV8A 4DR2B 3WGLA 3NGLA 2KW5A 2FP4B 3OVMA 1ZD5A 4II3A 4WGFA 2TYSB 5L3RA 2J87A 1E6CA 2PGJA 4MWDA 5AWFC 1UK7A 3INTA 4CMHA 2UXCM 2AI3A 3PXUA 4HEJA 1Q3HA 4AZFA 3KDSE 3ETNA 5KU1A 4EW3A 5H9WA 5GONB 3D3WB 2IUTA 5B36A 5CJPA 4UVEA 2JZNA 4D56A 2NPFA 1NW6A 1N9GB 1IHYA 3O8LA 2GCOB 5CIQA 4QODA 3HXLA 2DKFA 4GHLA 3VYVA 3MTBA 1RPTA 5F3DA 4MPJA 4LMBA 3VTFA 4HZGA 5ELXA 3PGKA 4IBEA 1H5NA 3GLHA 4GE0A 5CK5A 1IPEA 3QJ5A 5FKJA 5JDIC 5AHWA 1QQAA 4UEJA 1VRCA 4P4GA 3P52A 3KXDA 4PLTA 4CGYA 4DLLA 2YOFA 1N6IA 4AXXA 5D1NA 1RAIA 3KVNA 4PINA 1YJXA 5AJZA 4M60A 1VDMA 4RGYA 2OZEA 1E2DA 3HBFA 3FKSA 3LQ4A 4JR2A 3C5VA 2QOEA 5AK0A 2ANBA 5HQ3A 2RHOA 2JJ1D 4HGPA 3Q8XA 2R45A 1V5IA 3KUUA 5JPCA 4MMXB 1T6XA 5AVVA 1VMIA 1FFHA 4JZYA 5F4ZA 4IFIA 2EJCA 3UH0A 3ZJVA 3Q8LA 3OEHD 2IYPA 1RRMA 2HUPA 3QEMA 2NVOA 1OI7A 4LV8B 3GZNA 1N5RA 3ZTWA 4DA0A 3WKAA 5HTOA 1IBKB 2Q5OA 1RJ9B 1OGJA 1GVNA 4CF5A 1PWZA 4EYQA 2MGWA 3GRYA 4ZODA 5CBPA 4OGGA 4PLWA 5CLQA 4UC0A 2ZB8A 3KSAC 4ERNA 1LB1B 3SBDA 3T7EA 4C9BA 1RZ3A 1QX3A 2VN8A 3BM5A 5FPTA 2BFDB 3PQ2A 5JALA 3KPVA 5F33A 5DBOA 5KKNB 3ORQA 1FCJA 2CJFA 4EUSA 4YV1A 2XITA 1F51E 1Q7RA 3BQMB 1YQDA 3EDQA 3G9QA 3DMNA 1ZFNA 2ZROA 1TUBB 3ZE2B 4MR9B 1JH9A 4HG2A 4H35A 4E13A 1ZA1A 4AUNA 3FD8A 2Z0MA 3MAAC 2B2CA 2HLHA 3AGPA 1X70A 4O4LB 3GRAA 3V7NA 5CP8A 4DLYA 1EXMA 4YJ2F 2IVZA 1YCHA 3BF8A 2YFKA 3UAZA 3KTAB 1Y42X 2QN6A 3LHFA 4RPHA 1RLUA 5FWDA 1T0IA 5JIBA 4IILA 3SQLA 4X7RA 5KNCD 1PSDA 1KBQA 3HJAA 2YJ3A 3QMWA 1ZYUA 1KI6B 4LMAA 1B42A 1XZGA 1YC2A 2FWJA 3BK7A 5GP1A 3AFHA 3DZJA 2VAMA 1YVRA 3D1JA 4YAKA 3ZNPA 3S8EA 1PGQA 3NVMB 4J1SA 1NSTA 3M81A 4EGSA 5H4HA 2JH9A 5I9TA 1NQVA 4OYLA 3AM4A 1Z0UA 4QOGA 2JAXA 2IL1A 5FPYA 1VLMA 5DV9A 3RIHA 1I3MA 1APBA 3QVKA 5EG5A 3LUPA 2B92A 3LRPA 1EJ2A 4ATNA 2YRXA 4NK5A 3QYEA 4N9QA 1D7AA 5CPFA 1WY5A 2ZB2A 4IBJA 1KY2A 1OTYA 4QARA 5T8KC 4F4DA 3GA7A 4AP5A 5BN5A 1U3VA 2IE0A 3O3CA 4NQZA 4PG4A 3PHIA 4OXKA 3TNLA 2YZKA 2CLIB 5EAIA 5BOSA 5A9TA 2ZUSA 4RANA 4KQCA 4Y30A 1I2DA 2JAOA 1UMCB 4PLFA 1AZTA 5AOAA 5BN4B 2BM1A 3CLRC 4FFBA 5TQ2A 2P35A 1N7JA 4XPZA 3KQTA 1M7GA 3M83A 1ID1A 4INPA 1GNVA 5CD9A 3N0WA 3E9DA 121PA 1U0JA 3PKJA 2RGGA 2R0QC 4YMHA 4R9SA 4X90A 1U2GA 5DBHX 1J42A 3AIMA 1UT5A 3ZJ5A 1UEIA 1GCIA 4DCVA 4R0VA 4QBKA 1WV1A 5EUBA 2Z8YA 1W0KA 2H7XA 2I5PO 3P5BA 4FIDA 2OQVA 4CTJA 3CO0S 2LBPA 2AJLI 4D43A 4YRQA 4IZ6A 2VHJA 4G1CA 3EZGA 4RH3A 4JOBA 3V1KA 4FHDA 1UJ4A 1NJ1A 2ZE5A 2JBWA 1LV7A 4QT4A 1EZ4A 2W2TA 4XDGA 1A7UA 2SKCA 3W5HA 3ZOZA 5E9AA 4ZTBA 2Y2VA 4L16A 1XRJA 1JXOA 1KTIA 1EXWA 5K2OA 1KIMA 1Q22A 2V6FA 3TPZA 4CG0A 4RHXA 3KAPA 4IIXA 1NBHA 1GZHB 1Y34E 3ITNA 3KYDA 4XR9A 1E7WA 1PG0A 4O4JB 4RVFA 5DE3A 3IUBA 2B2NA 5FI0B 2APLA 1XF1A 5H5JA 1U98A 3H17A 1J0AA 1HETA 4M1TA 3D5QA 2EW2A 2W4QA 2GJKA 1KAHA 1MC8A 4MVWA 3LBIA 3ZUPA 1VXRA 3EVEA 3W8RA 2Q5QA 2EOAA 2Y1GA 1IQPA 1PJQA 1U3UA 4YAWA 4YJGA 1BN7A 1KVQA 4G67A 2G63A 3NIBA 2PSSA 4I2VA 3ZHQA 3DLCA 1NYTA 4ETIA 4Y6QA 4C7VA 5K3DA 1L6RA 3SN6A 3I8XA 1MAWA 5AI6A 1PKXA 3FVQA 4AY6A 3RHFA 1QXSA 4KXWA 3UXYA 5IFLA 3W8NA 4YR7A 4BBJA 3HKEB 1P7VA 3UK0A 1RQNA 2FSVA 2UUAM 3PSHA 4FC7A 5I7HA 3OHSX 2MR5A 1EGQA 1N6RA 3EZ9A 2AJCA 1W7AA 3GP1A 3MHVC 2WPDD 5IN5A 5HG0A 4AJHA 3KETA 4V2IA 4OQNA 1JAXA 3JALA 3AFMA 5ALVA 5C0OE 5TE9A 3P9ZA 3OBIA 3S70A 3GNSA 5M04A 5HK9A 1ZITA 2XB8A 3PDJA 1V71A 4TSFD 3T1HM 4FFMA 4JBHA 2XWPA 5KOIA 3DQQA 1OT5A 3CN7A 1OC4A 2EG9A 4GBED 4A2WA 3OZ7A 4JDUA 2GBFA 1RE0A 3COYA 1D3AA 3GRKA 5DHQA 4IDBA 1RKQA 2LVBA 5DYYA 2WNHA 2JY6B 3UAXA 2JAHA 5CAEB 4Q37A 5LJIA 1MH1A 4OHPA 4MRSA 3O26A 3LRXA 1OX4B 1T6BY 1KOFA 3CH4B 1G2OA 4J43A 4XVHA 3EFEA 5EJAA 3PFGA 3CNOA 1KBZA 4FOSA 3P0EA 4OUDA 1L9XA 2B1QA 4DXDA 1JFLA 4HDKA 1P9OA 3ORFA 3TLAA 4C7OA 2L09A 4LVOA 3EYWA 2AN1A 3AJRA 2IP1A 3DB2A 2PUJA 3NBKA 4F5WA 4J0IA 3VI3B 3FUXA 2KEBA 3ITDA 2QVCA 3F2IA 1NDUA 1V37A 1YF3A 2ATVA 2DQ4A 3TM4A 4BNZA 1YTLA 4NZNA 2GILA 2XGGA 4KUHA 1CY1A 4ZOQI 4K8OA 1Z33A 1RVDA 1DAHA 4P2GA 1PZEA 5E7IA 4LF8M 1TE2A 3QX7A 3JQ6A 3RAEC 3PGA1 1WMDA 3O8OB 5A4AA 2GZSA 5E9JA 4HWPA 3RVMA 4JVOA 3KU4A 3FTCA 3REFA 1YDEA 2NU6B 2OZLA 3CWQA 3E7PA 4RTSA 2P3SA 2RHDA 3KEFA 3RU2A 1QDEA 2PGAA 1WXXA 2G4LA 1O9BA 3P96A 5B1EA 1P4SA 5LKAA 1U8EA 5HZGA 3V3KA 3X44A 1BROA 4WXPA 4RK4A 1AUOA 4EI7A 2HBZA 1EXNA 4PYMA 1L5NA 4CBVA 3GNLA 4ZCMA 1G3UA 2X5KO 2HA7A 2LHGA 5DASA 3UW1A 3QPVA 2LXNA 2AOTA 1ZCZA 2ZJYA 2AK2A 5TQJA 1JG7A 2DENA 4Q1DA 2ODQA 2GMWA 5LFAA 4CQMB 4Z9FA 3R8FA 3W6UA 1FFYA 1X19A 3O75A 4BLOA 1DVRA 3DE5X 3WYAA 1F4VA 2OLEA 3WNBA 2BMWA 2F9FA 4KQ2A 1JA1A 2MSDB 4CV3A 3EF3A 3IURA 2YZMA 1RI2A 4IMJB 2I7NA 4NHEA 3FDIA 4BQRA 1YB2A 3ASUA 4N5NA 2I3GA 1BIFA 4EPVA 1GRQA 5FEUA 4Y0NA 2JFQA 3F97A 2B5OA 4HBZA 3I73A 3CKKA 4EPTA 3AH8A 4GF5A 1HT2E 1ULSA 5ITZB 3AWDA 3SKYA 3H5OA 3B1XA 2KRUA 2YZGA 1DG9A 3TQIA 3HP7A 3D2CA 2DPMA 3AKDA 3ED1A 2VYVA 3SFTA 3IUSA 1VG9B 4O08A 1UMBB 2VS1A 3IVAA 2AJTA 1DQNA 1WD7A 3LUCA 3DCIA 5IDWA 1K89A 2AFVA 1THZA 3GZTB 5B7NA 1QBKC 4ZI3A 1WLSA 1F6BA 2WAAA 3NV7A 1EWRA 2HWYA 4QAQA 4B3BA 1Z2CA 4P86A 3AUXA 1HI9A 2HAKA 5HBRA 3HZOA 2VXBA 1NPYA 3EVCA 4MW1A 4HLCA 5F76A 1E1KA 1CULC 2J6HA 2ZRLA 4DJTA 2BWJA 5JXHA 2GUWA 3R6TA 1G2IA 1OIWA 1UKZA 2QEQA 4U8HA 4Y3UA 2EJSA 1EDBA 3CVVA 3UT5A 1UPBA 2LR0A 4UE6A 4JS0A 2YFYA 3K30A 3EGXB 2Z3XA 3KJXA 2AV6A 4XWKA 4D82A 5K9ZA 4HQFA 2G6BA 3JAKA 2C8KA 3QI7A 5L7WA 3ZBTA 2G70A 3GLIB 4JP1A 1WHSA 2QT0A 2JLWA 5IXJA 3T3IA 1VSVA 2GBGA 2O23A 3GRZA 3TLYA 1C7FA 3E7WA 4PCUA 2B4RO 3AUSA 5DP2A 3RFXA 2M2IA 1L7VC 1AHNA 1H6DA 5HFNA 1O58A 3DH0A 2V3VA 4MV9A 1J25A 2ZB4A 4YDSA 4PGFA 5DHPA 2XFTA 1UBJS 1RPZA 2E5WA 1QHFA 4C88A 1RYMA 1I13A 3T6PA 3NEJA 4X54A 4WOCA 2GD2A 1G98A 3PUXA 3L41A 3IEKA 5SZHB 4OAOA 3ESXA 4LYFA 5IU6A 3L43A 4UU1A 2GWHA 1Q3KA 2DG2A 1XSEA 2FEAA 1NJ8A 1R2QA 2EZ8A 2W2XA 3CVJA 1ECLA 5JCZA 2WE7A 3DF7A 4C76A 1SIWA 3W6ZA 4EHAA 2WP0A 4XUCA 2G88A 2YDYA 3E6AA 4HFNA 4D9IA 4WP2A 4WADA 3RIEA 4EUNA 4KBFA 3CVXA 3T1NA 4OJMX 2VWGA 5ITQA 3CUWA 5G2OA 2G07A 3RI3A 3E8MA 3PQ4A 4FS3A 2AYXA 3VHLB 1BHO1 7ADHA 1MN3A 4NCNA 1E1CA 8LDHA 1X39A 1NXQA 3KR9A 1DAGA 1ACJA 2BFEA 2SNIE 2WV7A 4KYUA 1I10A 5G1OA 4CV1A 2D7EA 1SURA 2KLBA 3B7GA 4FHCA 3B3JA 3TZKA 4X97A 2Z1DA 1Z6QA 1IATA 1AC5A 4YFVA 4YRKA 1AX9A 1WVIA 2NZWA 2EKLA 4QEZA 4DC1A 1Y81A 4BNFA 4EX7A 4ER6A 1YBVA 3OOHA 1KI1A 3O38A 1ACMA 3OLCX 2FR8C 3R3UA 4UUMA 4MUJA 3W79A 3A6HA 2R8YA 4GHAA 3QEKA 1XU7A 4I9NA 5EXSA 3K0CC 2ZYGA 3CUYA 4KDRA 1Y8GA 4D25A 4Y6RA 1ZOIA 2HXYA 1C7JA 5EJEA 1E63A 1TZJA 2Q5LA 2JJ2A 4I6GA 4NU5A 2GLTA 2PH5A 1JNXX 3V4VB 3GJ0A 1B2RA 4NJMB 4YCLA 1YR7A 3ETHA 3NG1A 1JTFA 1W59A 2E4XA 3ZIAA 3NBAA 4M87A 2DWUA 3K94A 3PB3A 2D2VA 4TTPA 4WA8A 5T7BA 4EA6A 2B83A 4HF7A 3FKSD 4GR4A 5FADA 3DL4A 4EMUA 2ZYRA 5JROA 3DO8A 2NU8B 4S2EA 3CUUA 1NW5A 4TV9F 5NLLA 1UZUA 3CLUC 3IVMA 3CZPA 1AMNA 4DB2A 4OQDA 4N5LA 4QLBA 3V1UA 5DCUA 3WJ7A 5C4MA 4PO3X 1LI4A 1CP3A 3ZVNA 3AETB 2GZHA 1XEAA 1IJFA 5G1PA 1QM5A 2JFYA 1U5CA 2VQSA 3BEOA 4XSVA 4BP1A 1SUEA 3A1FA 1C9KA 3LQFA 2ZYWX 3H0CA 1WXIA 1D2HA 4YHHB 2DKLA 4GZLA 1A76A 3T12A 4I55F 4AZ3B 2UYHA 2Z2IA 3VNBA 2O57A 3OWXA 3AEUA 1TLLA 1W8DA 4IR7A 1QP7A 1MPXA 1JJFA 1ECPA 1H1TA 2QMYA 2OCPA 1K3UB 1BWPA 1RM4A 3NH9A 3QU2A 1Z7YA 2PSFA 3B52X 2VAVA 1T13A 3GLRA 5KQGA 3QWLA 1X7GA 4KMMA 5LQJA 3WNQA 1GOTA 4X84A 1HO3A 1Z4QA 1SGWA 3IT3A 4URZR 2YFHA 3L0IB 2NVWA 5AW3A 4REZA 1E4EB 1EAYA 4UHEA 4DFDA 2MTBA 4B1FA 4JENA 3FHTA 3HN2A 2VBFA 3R0QA 1B0PA 4B3MM 5JZVA 5JNLA 1ISSA 4G4RA 1Z83A 3IEPA 5FORA 1HYBA 3D6FA 5AJYA 1J00A 1Q91A 5FQNA 2N75A 2CUNA 1XCOA 1UDXA 3NPMA 4MQEB 1A7AA 4UAGA 5H9VA 3T38A 4MR7A 4NICA 1A8SA 2WWWA 3AILA 3R24A 3JQFC 4ZVUA 1PVDA 1Q83A 2IE8A 4FWDA 4B4VA 5EI5A 3WL4A 1LTHR 3FNRA 3TUIC 3WE7A 5ESDA 1AQLA 2IU3A 4KPYA 1DWPA 1TT5B 4AG6A 1PGOA 1EFUA 4E33A 5K0GA 4C6TA 8ABPA 2DFKB 3C8DA 1LA2A 1G4AE 5JS6A 3FKJA 1I1OA 2JZOA 1E2NA 4C14A 4LCEA 4Q3OA 3V6MA 1KSGA 4RPCA 1UCFA 3QH4A 3T7DA 4DR3B 2QJOA 5TMEA 4EFDA 3F4KA 5DNCA 1NRXA 3DMGA 3EQ9A 1KYZA 5FYDA 4BO0A 4BKPA 2V1UA 2QTVB 3K70D 2NUBA 5KTNA 3K2EA 4ER3A 1CC1S 1KORA 3RJZA 2YQ4A 5IC4A 2RHBA 3HFGA 2TSYB 4PO9A 1SZJG 1JEOA 2LDBA 2MH8A 3WI7A 2XH8A 3ESBA 2DAKA 1M8JA 4MV3A 1YB7A 4X6XA 1P0PA 2DFTA 4CM4A 4DWWA 2BGKA 2WPNA 5LL6P 5EMLA 1G16A 3CZ5A 2HWJA 2JHCA 4H6XA 3HWWA 3PD0A <