3FTFA

Crystal structure of a. aeolicus ksga in complex with rna and sah
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
246
Chain Sequence
MVRLKKSFGQHLLVSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 60
structure length 246
sequence length 246
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftfA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftfA01
2PX5A 2BR4A 3FUXA 1NE2A 4Y30A 3V8VA 1WG8A 2I62A 4PYJA 3CCFA 5K0LA 5EIFA 5T64A 3P9NA 3TRKA 1JG2A 3MB5A 1G60A 3HEMA 3O7WA 4FGZA 3LDFA 1QAMA 4ER3A 2EX4A 3JWGA 1DUSA 3RW9A 1SQGA 2G8NA 4F86A 4YUYA 1QZZA 4KDCA 4GC5A 3DULA 4RVGA 5EEHA 4P7FA 4ZTBA 5K0JA 4M7RA 5LQJA 3IV6A 3FUUA 5GWXA 5LQRA 5JR3A 2IGTA 3CKKA 2IDKA 5EQJB 2OY0A 2C7PA 3R24A 3FUWA 4PNEA 3KKZA 4YUZA 5EG5A 2JH9A 1JTFA 3R9XB 3TKAA 2HNKA 3KQPA 4XUEA 3PS9A 3T7RA 2IBSA 5GOZA 2O05A 4HTFB 3DMGA 1YFLA 2B2CA 3OU2A 4BLWA 3SSNA 4GOOD 2IDJA 3AWIA 5EC8A 4U7PB 1XDUA 3MGGA 3FRIA 3I5UA 2GH1A 2VDUE 5LR6A 3HP7A 3KQOA 1YUBA 3EVBA 1IM8A 3ME5A 3LKZA 3U81A 4P7GA 3UFBA 4EKGA 2ZTHA 1AF7A 3GNLA 3P9CA 4K6MA 3VC2A 4AX8A 2JH8A 3BUSA 5EZSA 3PTAA 2FRXA 2ZBRA 1T43A 2NNWB 3CGGA 3DUWA 2PT6A 5EIWA 1ZG3A 2B25A 2YR0A 2YTZA 4PGHA 5T67A 4A6EA 4GC9A 1NV9A 3NWEA 2ZW9A 5B1SA 3SVZA 4HGZA 2OZVA 1NKVA 3HA7A 2R3SA 3CJQA 3M6WA 3BKWA 1L1EA 4O29A 5IH3A 2O57A 2V74B 3Q7EA 3I9FA 4F84A 1JG1A 5K0NA 2AOUA 3TFWA 2JG3A 3EMBA 1JG4A 1MHTA 1TW3A 3BKXA 5K03A 1VP9A 1FBNA 3BGVA 3DLIA 3P8ZA 2P8JA 2ZIGA 3KR1A 2OYRA 4MHTA 3GRRA 3WSTA 2UYOA 4GOMD 3FPHA 4R8RA 2EG5A 1IXKA 1R74A 1UFKA 4RTLA 3NMUF 2PKWA 3LSTA 4CTJA 4CWAA 5K01A 1JSXA 5G02A 3LCCA 4G56A 4GOLD 4DF3A 3HVJA 3IYLW 1G38A 1G8SA 4PYIA 5DT2A 1R8XA 3UA4A 4RTPA 4PWYA 3DMFA 4UOEA 1NBHA 1YZ3A 2B9EA 5K05A 5DXJA 2AN3A 2QRVA 1TPYA 2ONZA 4QTTB 2PV0A 3MCTA 2AOXA 3OZSA 2P3OA 5LQUA 3BGDA 4B17A 3MQ2A 2B78A 2CL5A 1KR5A 4GUAA 3NW9A 4CXMA 3A7EA 3G88A 3EGVA 2H11A 5GM2A 5FA8A 4QVGA 4BP3A 3IEIA 3KR0A 5FADA 5ICGA 1QYRA 1NV8A 1RI3A 4PYOA 3ELYA 3PFGA 1I4WA 3KPVA 3M6XA 1QAOA 3LHDA 1RI5A 5ICFA 2ZZNA 4LECA 1KPHA 1BHJA 1KP9A 2QM3A 1L3IA 3JWIA 5FTWA 2OB2A 4YMHA 3JWHA 4XUCA 2G1PA 3NVMB 2N47A 5FCDA 4P7KA 4RSRA 2NP6A 2PX4A 4CTKA 4EVIA 5DM2A 3UJAA 5C9ZA 1FP2A 1WY7A 2ZIFA 5F2KA 1XTPA 3QV2A 5DXAA 1P91A 2O0LA 1VIDA 2PT9A 2AZTA 2PBFA 2VZ9A 2LD4A 5BXYA 3T7TA 3VYWA 4BLVA 2QRVB 4X41A 3TKYA 5CCXA 4E70A 2P3LA 3MTIA 5F2OA 4GF5A 4ER0A 1KPGA 4L7VA 4YV2A 5CIYA 4ISCA 3FPFA 1D2HA 2JHCA 3NDIA 5EZQA 1N7JA 2OB1A 1G8AA 5E2BA 2CKDA 5E8JA 2FK8A 3CC8A 3LGAA 4HTFA 3NTVA 3G2OA 3KHKA 2P7IA 2BR5A 4IKPA 1KIAA 2G72A 5GINE 3LBFA 4RYLA 3EGIA 1L9KA 2E5WA 3OZRA 5K8VA 2YXLA 3P9KA 2G70A 3QOXA 2UYQA 3EMDA 3GWZA 1B42A 1BC5A 4FR0A 3SM3A 5LQNA 5EHIA 4DA4A 4P7JA 5DSTA 1JTEA 3OCJA 1NW5A 3T7SA 2IBTA 1XXLA 4ER7A 2ADMA 3I58A 1EIZA 1X1BA 3HCCA 3C0KA 4FS8A 5DPMA 2YXDA 5E1BA 5EMLA 1I1NA 3JWJA 3PB3A 4RX1A 3OPNA 3KU1A 2P3QA 4GQBA 5LQAA 3EVDA 3TM5A 1NW3A 4RTNA 3K6RA 5HIJA 4RTJA 4PCAA 4FSDA 2C7RA 3E7PA 1KHHA 2WA1A 1U2ZA 4JXJA 1F38A 1ZQ9A 3R0QA 4OA5A 5CVEA 3ERCA 3C3PA 1Z3CA 2PX8A 2Y1WA 1IY9A 3KPWA 3FYDA 3MTEA 1XDZA 3I53A 10MHA 5DRYA 3PVCA 2HTEA 4DCMA 2ESRA 2ZWAA 1YB2A 2Q41A 3G2QA 3G8AA 4OA8A 3E23A 4QDJA 3TPZA 5F2NA 5DM0A 5D1HA 1BOOA 1KYZA 1R00A 4AZSA 3LDGA 1JSZA 4C06A 3B3FA 3NVKI 2NYUA 3FUVA 3SSMA 4KDRA 3G7UA 4F85A 4P58A 1RI4A 2NP7A 2IH4A 1X1DA 3RIEA 1RJFA 5FUBA 3E05A 4MIKA 5CCBA 1VE3A 3EEYA 1NW7A 4IWNA 2ZWVA 4CKBA 2GLUA 2C7OA 1EQAA 3ELUA 2JJQA 3LKDA 2P7HA 3OU7A 1WS6A 3VSEA 1DCTA 2P40A 2DULA 2PXXA 2XYVA 1G6Q1 3AY0A 5BP7A 5HOQA 3FTCA 3FPGA 2GB4A 3KQWA 2GAFA 3HCEA 1RI1A 4PIMA 1D2CA 5DM1A 5LSAA 1NW6A 5DWQA 4Z2YA 4XCXA 1SUSA 3LL7A 4HGYA 3KQQA 2YQZA 5HILA 5T6BA 2UYCA 4E2WA 1OR8A 2ZZKA 2PWPA 4Y2HA 2I7CA 3MAGA 4FP9A 4MWZA 2OXTA 3TM4A 1UIRA 3FTFA 4WXHA 3P97A 3EVFA 3M33A 3B5IA 4FSXA 3GDHA 5HIMA 3FTEA 1H1DA 3A7DA 2P1DA 4RTQA 4ER6A 1O54A 2AOWA 1N2XA 1JQEA 2XVMA 2ZULA 3AXSA 1AQIA 4QPNA 1SKMA 2YVLA 2IIPA 5E1MA 5E2AA 5E9WA 2FK7A 3P71T 2ORED 1X19A 5CVJA 3G89A 5FULA 3X0DA 4C07A 5E1DA 5FWAA 3B3JA 4R05A 3UJ9A 5GIPE 3HNRA 3EVCA 1JQ3A 3C6KA 5EGSA 5K09A 3CVOA 3A25A 3SGLA 5KVAA 1PJZA 2IH5A 3EVAA 3OFJA 2AS0A 3P9IA 1M6YA 3UJCA 4YV0A 2PXCA 4PYKA 2V7EA 3EVGA 3GO4A 3LDUA 5C0OE 5FQOA 2I6GA 2ZBQA 4LG1A 2GPYA 3BWMA 3FPJA 4KWCA 3M4XA 1L3BA 4OQEA 4YUVA 2I9KA 2Z6UA 4KVZA 5FA5A 2BM9A 5CVVA 5CD1A 3TR6A 1ZGAA 1AV6A 3BWYA 3VC1A 1JR4A 5HIIA 5FWDA 5K0GA 4C4AA 1R18A 1I9GA 3NDJA 2NXNA 1JQDA 1Y8CA 4FZVA 2O07A 3ORHA 4QPPA 3M70A 3PLAE 1D2GA 3DXYA 4DCGA 2XYQA 5D1NA 1XJ5A 2CMHA 1RI2A 2ZLBA 3C6MA 3Q87B 4V0RA 1YF3A 4LWPA 4EKIA 3HA3A 5EVJA 2XYRA 2ZFUA 5BW4A 5GIOE 2HWKA 3UBTA 2OKCA 4HRAA 3TOSA 3UWPA 3EEOA 4AZVA 3DP7A 3AJDA 3B3GA 1L3CA 1O9HA 2OBFA 3FRHA 4E32A 4U7TB 2BZGA 3NWBA 4E33A 3LPMA 2VDVE 5DRTA 2BH2A 2AN5A 1HNNA 3DH0A 2K4MA 5LQKA 1RJEA 5MHTA 4HSGA 2ERCA 3B89A 2ZBPA 2PX2A 1BKYA 3KQTA 3BWBA 2YXEA 3KPUA 5DTRA 3UA3A 5E9QA 3R3HA 1AQJA 2HMYB 2CMGA 5DTMA 1X1AA 3P2IA 4RTSA 4FT2A 5EMKA 1VPTA 1WXXA 1KYWA 2JHAA 2F8LA 2R6ZA 3D2LA 5EKUA 5HEKA 4DMGA 4PYLA 5KYGA 2PSSA 3DR5A 4E2ZA 4E31A 4ATNA 3THRA 1N7IA 3HCFA 5CVDA 2Y1XA 5DSXA 1VP3A 3LCUA 3BT7A 5ERGB 5LQCA 4RWZA 4H0NA 1XDSA 2H1RA 2KW5A 3GU3A 5DX1A 5FQNA 1RJDA 3M6VA 4CKEA 4GBED 5M5BA 2OO3A 3PFHA 3QOWA 4CKCA 2IFTA 4IV0A 2VP3A 5GP1A 3UJ6A 3EVZA 3KQMA 3LX6A 2NXCA 3G5LA 4HH4A 2EFJA 5EMMA 3HTXA 2G71A 2QY6A 4WVLA 4C08A 2FCAA 2JHPA 3TQSA 2P35A 3GIWA 3P2KA 3ELWA 4YV1A 5E8RA 1FP1D 3HVIA 1VLMA 3LECA 1KXZA 1VL5A 2OPBA 3TLJA 3OE4A 3DXZA 1Q0SA 4QQKA 3MHTA 1P1CA 3KPJA 5EKXA 1M0EA 2FPOA 2ZCJA 1O9GA 3SMQA 3L8DA 3SSOA 1TW2A 4R6WA 4NECA 2AN4A 1FPQA 2PWYA 2VS1A 5E1OA 3SXJA 3FUTA 4PINA 5CVUA 5ICEA 4BY9E 4M38A 1JG3A 3GGDA 3EGEA 3BGIA 5DTQA 5DX0A 3LBYA 4POOA 3KQYA 3GRVA 3R6TA 4HG2A 5BW5A 5KS2A 1RJGA 2VDWA 2EJTA 2Z6QA 4A6DA 4QTUB 3G8BA 3CBGA 4V0QA 2FHPA 3HVKA 2UYHA 1ZGJA 2ZVJA 1SQFA 4R6XA 1P1BA 2NXJA 3ANXA 3ID6C 2CWWA 5CUQA 4RTOA 2ZZMA 4M36A 5ICCA 3E8SA 4PYQA 3A4TA 2UZ4A 2FYTA 1EG2A 4E30A 3UJDA 8MHTA 3DTNA 3EVEA 4PONA 2HV9A 5H02A 1R8YA 1NBIA 1INLA 1YZHA 1SG9A 3GXOA 4PYNA 2H00A 5EPEA 3G2MA 4MTLA 4AZWA 4E2YA 1VQ1A 5C1IA 3THSA 1X1CA 4PCLA 2ZSUA 4GOND 2NXEA 1SVUA 4C03A 2IP2A 1KPIA 2AOVA 5EHGA 4RTKA 4YMGA 4GEKA 3PT9A 2AVDA 4IV8A 4RTRA 2YUIA 4X60A 1ORIA 1XCLA 4R8SA 4RVHA 3HM2A 5FHRA 3TMAA 4YUWA 2B3TA 1YFJA 3KQSA 4X61A 3UJ8A 1ORHA 9MHTA 3DXXA 3IHTA 3KR9A 3HA5A 5KQRA 2ONYA 3F4KA 1QAQA 2AVNA 3PX2A 1P39A 2PVCA 3GRUA 5DLYA 5GM1A 4X63A 3DLCA 3FYCA 3DMHA 4DM3A 1WXWA 4EK9A 1HMYA 2DPMA 2XVAA 2GA9A 1SUIA 5E9JA 5EEGA 3A27A 4E2XA 4OBXA 5CM2Z 4QVKA 1PRYA 5HZMA 1WZNA 3PX3A 5P8WA 3G2PA 1EJ0A 1UWVA 3ER8A 3KQVA 3SR4A 3ELDA 3UJ7A 2AOTA 4FT4A 4KIGA 3UJBA 3O31A 4C05A 3EPPA 3GRYA 3AXTA 3CJTA 2GS9A 3MERA 2YX1A 1NT2A 2BM8A 4KW7A 3KPYA 2WA2A 3T0IA 4RTMA 5DX8A 3S68A 2Z6AA 4EQZA 1XVAA 3K0BA 1VBFA 3HVHA 1Q0TA 3DOUA 3MCZA 4BP1A 5EMJA 1ZKDA 1NW8A 2A14A 5HFJA 3KR2A 4QDKA 1XCJA 3A26A 5K0BA 3GRZA 4HC4A 1G55A 2C7QA 4EMSA 4ER5A 1EAMA 3HCAA 3FPEA 2AOUB 3REOA 4KRGA 2XBMA 5DM4A 2HR1A 4M37A 4QQNA 2PXAA 1V39A 2ZIEA 5EOVA 3OFKA 4AZTA 4DZRA 5KQSA 4PIPA 2PLWA 3P2EA 3BZBA 5K0EA 1EJ6A 4X1OA 2PGXA 2PJDA 3O4FA 4PYMA 4OBWA 3GJYA 3HCDA 7MHTA 3V97A 3CJRA 1MJFA 4PGGA 3FTDA 4KIFA 2QYOA 2P41A 5FHQA 2AOTB 4BLUA 5HIKA 4OX9Y 4XUDA 4DQ0A 3NJRA 4DKJA 4YUXA 4C04A 5U4XA 3C3YA 3ER9A 2O06A 3BWCA 3UZUA 5K0CA 2IPXA 1F3LA 3LCVB 3M6UA 3FZGA 4MQ4A 2AR0A 3OU6A 4RVFA 2WK1A 2PY6A 3G5TA 2IH2A 2QE6A 2EJUA 4OQDA 1R6AA 2BR3A 1M6EX 4RV9A 3RODA 1DL5A 1ZHFA 3SX0A 3H2BA 1QANA 1FJXA 3B7PA 3GCZA 5JUWA 3HCBA 3BXOA 3I64A 5K0FA 5IKMA 4RVDA 3OE5A 3OZTA 4LWOA 4AUKA
chains in the Genus database with same CATH superfamily
2NTEA 1HE2A 1SIWA 4JLSA 1F14A 1YCDA 1NSYA 2VHUA 5K3SA 3AFGA 3HKDA 5K0JA 5LQJA 2P6OA 2XB2A 4MPPA 3KUKA 1F2TA 2D2VA 2HHJA 5KPTA 1ENYA 1S6YA 3ABRB 2XUIA 1NP6A 5LC1A 3W6OA 3KQOA 1EAYA 2DWCA 4B5KA 5AI5A 4QLOA 2LCIA 3N7UA 5FJIA 3FKSD 1FSPA 4E11A 2H7CA 4Q6WA 2HZ7A 3K7EA 3NLLA 5HE9A 5BVGA 4CHTB 1MDBA 4LY3A 4XQGA 1H5NA 5K03A 3WYEA 5J40A 5EHQA 3CPHA 2Z8YM 3QZUA 5E3JA 3JQFC 3N6VA 2GSWA 4AJ9A 1HQCA 1QWOA 1FZQA 5H81A 4BRWA 5HTOA 4F1JA 2ZYAA 3UJNA 4LCBA 4LGVA 4KK3A 3HLTA 1WABA 1XT6A 3GPLA 3OZVA 3VFDA 3CEHA 4A26A 1P8AA 3WLPA 4E12A 1KAQA 1E3TA 3ZKWB 2PX4A 2HPAA 1HNWM 2RIRA 2IOYA 1HZZC 4LQ4A 4NL4H 4JH0A 1W88B 2P3LA 2YVQA 4GZLA 5FOVA 1ZUNA 4K6FA 4JASB 4F4CA 3LGAA 1JW9B 4KZKA 4EVSA 4RYLA 1KI8A 3ZJYA 1DO8A 4KQXA 3IUJA 3HGQA 2EG9A 1YLAA 1PE0A 2OV8A 3UMGA 1FYEA 5EMLA 4CM3A 1C8VB 3FTPA 1TZJA 4GKKM 4IGAA 3NVDA 1L5GB 3EIEA 1U2GC 5C37A 4RD2A 3PF8A 3IOMA 1YQEA 3GGOA 1MUUA 1DTSA 4KDRA 3HYSA 2P5YA 1VMEA 4H6VA 3CRZA 2NAFA 1I3MA 3HWX1 3T3HA 1OFVA 4IG4A 5DBGA 2HF8A 2XIQA 1N7HA 3LPCA 1KJJA 1KP2A 4H15A 4W1QA 1CQIA 2C3UA 4ZJYA 3BYZA 3LL7A 1PQWA 3G59A 1M5RA 2FH0A 3TSZA 4JSTA 2H5IA 2I9PA 3J80S 5I7UA 4I14A 1YE5A 3ITKA 4HMQA 3EYAA 4OLHA 2VLBA 3WADA 1ZLXA 4JODA 1Z6GA 3OPYI 5JBIA 1E79A 4W5TA 4YQFA 1GZDA 4Q05A 2UAGA 5JAZA 4B3MB 2NU9B 3I62A 2W6NA 1CRPA 2VYFA 3VU8A 4B3TM 3DFIA 3OHPA 4HSGA 2PUHA 1RAEA 5FUYA 4IDQA 2WJVA 3CINA 2UUCB 4HNSA 4IDNA 4HDNA 4OJKA 3CW8X 1R12A 2FSUA 1URPA 4ZI3A 5FF9A 2P6MA 3HZRA 4OJNA 2PS9A 4K2HA 2GDJA 4X00A 1CQZA 3DQPA 1WCIA 2ZCJA 1M2NA 2QYHA 3GFQA 3WDLA 1DDOA 1F8GA 2YY7A 5CITA 1H2ZA 3WIVA 1XXHA 3QM1A 5KDOA 2D7CA 3GJ4A 1FTGA 3EOAI 4UUBA 5FSWA 1EGAA 2OV3A 4WCDA 4A1OA 2NQTA 1L6IA 3AG5A 2DMRA 4UFNA 4D9GA 1LK0A 3KT0A 1MVOA 1L8XA 1UM9B 3LRTA 1U63A 4IYRA 3CF4G 3TXAA 4MUEA 2C2WA 4MWBA 2C9OA 1YZFA 3HYLA 4M0FA 1XQ1A 4DDWA 3CEJA 1CY4A 2I1WA 4B85A 1Z8HA 2EP7A 3JRWA 2QZZA 1E6MA 1TO6A 2HMTA 3EODA 2OXFA 4ALLA 3PUYA 5F23A 1QOQB 5D8DA 4EFKA 3DUFA 3OIWA 3EUWA 4W5HA 1JEOA 4H1UA 1FZTA 2RHOA 2EKFA 2HYDA 3RKUA 3KJXA 1UJ2A 3BMXA 2EHDA 3O74A 3I76A 1Y6FA 4YIKA 1VPDA 2JCGA 3OUZA 2DZDA 4DYVA 3NDBB 1TZCA 4L3WA 5EIXA 3HGTA 4OLBA 3OJCA 2X9QA 4NC6A 4AYXA 1Z35A 1X7WA 4F1IA 1VZ3A 1NF3A 5ALWA 3K31A 1YS6A 5LR6A 1WL8A 2VHEA 3K0CA 4IF4A 4AW4A 3I2FA 4R3UC 2Y6UA 1YDHA 4NU0A 3HA7A 1I2MA 2VDQB 4ZANA 4J1TA 2X8JB 4ZJZA 2ATVA 5HQTA 1BD4A 3Q3GE 3GLUA 3R75A 1K27A 5K01A 3K0EA 3C4VA 4PAOA 3DMDA 2VHWA 4BFYA 3QITA 2GM9A 3V55A 4K28A 4MUMA 1ID8A 5BNTA 3GMDA 2ZU0C 1G8PA 5JQGA 2EYUA 1KPHA 2C77A 3QI2A 5JDCA 3QLUC 4X54A 1R27A 2NO0A 4NZNA 1KORA 1VEJA 2JZOA 5SYNA 2J6BA 4D6YA 2O7NA 4EB0A 1XC7A 1GCUA 2WG0A 1NA5A 3PZRA 1JEJA 1M0SA 5EGNA 3QTTA 2V1UA 3KOZE 2R87A 3L8EA 5EIBD 2I71A 3LY8A 2B21A 4L78A 4N5NA 4EBBA 1JR2A 2FW6A 3BK2A 1O87A 1E9FA 1LC3A 1BOOA 4O5OA 1JDSA 4YRGA 5B64A 4X3CA 4J9VA 1UJBA 1E3JA 3BMQB 3TW0A 2VN8A 3DVQX 4C0LA 3HU1A 3WFZA 1EQAA 4ZOLB 4OG2A 4J4HA 2VBIA 3AR5A 3FPGA 2C8KA 3NBYC 3PFCA 3A11A 3CF0A 1PWZA 1CV2A 2QQEA 3RYIA 4BGIA 2OHJA 4NOJA 4A92A 4MKXA 2C00A 5JHHB 1AURA 4Y9DA 4UPEA 4D0LB 2D7GA 1R0KA 1N78A 3MINA 4R1UA 1D4FA 2WHQA 8OHMA 3BWDD 1XNHA 5HJ7A 4TSFD 2UUAM 5A4JA 3HBMA 3L7YA 1OSNA 1R64A 1YA6A 1DWPA 1TO2E 4Q4AA 1XD9A 3CNQS 1I3OA 1KYWA 4B3RB 3DOIA 4P3YA 3EIXA 2Z8ZA 2XZOA 3PUWA 1YAHA 3VYVA 2RRUA 2P78A 3RRFA 3RWBA 5JS8A 1W87A 3WL4A 1IXSA 3N2ZB 1DKOA 2OYCA 1MW8X 1N6LA 3WX0A 3N70A 3KQYA 3GRVA 1ZMBA 1EESA 3E8SA 1W52X 3RBXA 2Z4TA 4HX5A 3UJDA 3RC7A 1X9GA 3P52A 2C8VA 1GNSA 4WLVA 1IN7A 3IAEA 5FV7A 1S3GA 4RDHA 4Z5XA 4A2CA 4DCOA 3Q2OA 3KR9A 3C3DA 2PUJA 1Z2OX 2FU5C 1YZLA 4MWGA 4WZ6A 1V96A 1NKSA 1W0CA 4UMFA 3N2YA 2GJKA 2D0IA 3AG6A 3NYRA 4XEUA 2FUNB 4P33A 4FVMA 4BVGA 1N5DA 2YJZA 1WUTA 4A2QA 3AR4A 3TLZA 4A0SA 2Q5QA 3K1AB 3B1KA 1OXMA 2BI7A 1II8B 3O4FA 2VUSA 2H3EA 3S81A 4CJXA 2AOTB 1ZKMA 5A4AA 3DMPA 3C5EA 5K0CA 1PF7E 1PI3A 3NCTA 1DRUA 4IWYA 3AF0A 4L76A 3I61A 2VRWA 4YRJA 3NHPA 4R7ZA 1M34B 5BSMA 2BR4A 1WG8A 1TT5A 5CJPA 2JLZA 3RRMA 4PHHA 2JLSA 4NONA 2E5FA 4YUYA 4NF2A 1Q2UA 2FQ1A 4PAGA 1H0KA 3FA2A 5JD5A 3EFOA 3LSYA 4IZ6A 1Z36A 2QUJA 1U2EA 3JTMA 4B35A 4FW8A 4CF3A 2JZCA 2COUA 2A0FA 2UUPA 5BMOA 3DO6A 1PJAA 4YMTA 1AF7A 5HCUA 2A88A 2FQYA 1PUIA 5BSGA 3I9JA 4P4SB 5IU6A 1QP4A 3RYCB 2YRFA 2Z2KA 3P2JA 4EJ0A 1GFWA 2GXAA 1E4EA 1EM6A 3EGDB 3HBFA 1WBDA 4JB3A 1XVIA 3E8MA 4IF6A 4EWLA 1SNYA 4HNVA 3M34A 2VXCA 2D3WA 3C3AA 1AX9A 5B3JA 4O1IA 4BQPA 3CRMA 1RLIA 3AUSA 1NRIA 1UM8A 5LCXA 3KEMA 2B78A 1N8NA 2OVFA 2OPHA 4CMCA 3ND9A 3M6XA 1LVUA 2H4HA 4B87A 1DRKA 1DEKA 2XNKA 1OGIA 2PBFA 3QHPA 1LDGA 3PZBA 4MLDA 2G36A 2ZT7A 4ASUA 5G1OA 2PJRA 1ZZEA 1GJTA 2B0CA 1BN6A 2QT0A 6YASA 3NTRA 4X1KB 1KMNA 1JTEA 1U5BB 1FP6A 3UMRA 2FZGA 3SZGA 5JECA 2KM1A 4LPSA 2O2HA 3II6X 3PDIA 3WLNA 5AI8A 5C5CA 1U0BB 2ZR8A 2MSCB 4JL5A 3EZFA 4W99A 1ULUA 3UAYA 2R751 3PVZA 2ZBFA 1XA3A 1ACJA 1YUMA 5AKKA 3DVLA 5CCBA 2RGAA 1N33B 1IUOA 5D3MA 5CX1A 4OO3A 5DISB 3VO1A 1OAOA 2VI5A 2QAIA 2P27A 4NJMA 1MP0A 2A8YA 4OIFA 4AJIA 4MO2A 5GQSA 1O54A 4JB0A 2W4IA 3WL8A 1Y0BA 2AYZA 5ISMA 1L5LA 3JQDA 2EFCB 1P2FA 2J7OA 4ZOEA 1CJVC 2Z0MA 2N9UA 3OMWA 3MS2A 1TVKB 3IEXA 1NGSA 3AJAA 4D9IA 4JBIA 3CH7A 2BONA 1WETA 1SHLA 3I23A 4CMIA 5GTDA 3QRWA 3AIMA 1VPEA 2K4MA 2H9IA 2A94A 1MVLA 1K89A 4EMBA 4P22A 1DV2A 3V4VB 3GX1A 3UMMA 1OI7A 4DILA 4DR6B 2Q0SA 2VHVA 2LVOC 2YIMA 1U7OA 3N8IA 1RHQA 1RQRA 1DRVA 1RKVA 1M8KA 3ELWA 1YVDA 1WLSA 5BORA 1SC6A 2O4UX 4Y2XA 4FU0A 2MR5A 3E5MA 2E87A 1RXEA 1FRNA 2OMEA 4KN5A 5HRCA 4QTZA 5GAJA 1GP2A 4BZZA 4L4UA 2NZUG 5G3YA 2EL9A 1WULS 4D9CA 4EPYA 3SC2B 3G6KA 3MA0A 2FUEA 2XXAB 1Z0SA 1SVUA 2I6UA 3WXBA 3MOSA 3V32A 2QS9A 1J1IA 4JB2A 1T1EA 4C7OB 2ZCVA 1O4VA 3LZDA 3U9LA 3W2HA 3GP3A 5EQDA 4HMPA 2OGWA 4R2KA 1GQRA 4EEKA 2Z43A 1TLFA 4LSWA 3GEGA 2JIBA 3I4YA 2OL4A 4CMHA 3UGJA 1KJNA 2QSYA 4MWTA 4YBZA 1P2UA 3A9TA 1UINA 4TN5A 2WFZA 4HF7A 1VM6A 4UTVA 1M7BA 4C0BA 1P3Y1 1BDJA 1NXOA 4S0ZA 1GZHB 3OSUA 1HNZM 2LCFA 1ISJA 1TMKA 1NLFA 4EJMA 1ZHFA 4Y1RA 1IULA 3ZNOA 2PX5A 1IPFA 1E5TA 2GZ2A 1NY5A 3JWGA 4Q21A 3MMXA 4UHHA 2IX3A 3EBLA 2HCFA 1PAUA 3DE7X 4PR3A 2OFWA 4UM5A 2DFTA 4LFBB 2D5AA 1P2VA 4NZZA 1WMBA 1QUTA 4O0MA 3IUPA 2ZE5A 3LQ4A 1KEEB 3AJ9A 3OP1A 4C7JA 2HMUA 4GPTA 2BKAA 2QLBA 2AC7A 4ITVA 4K6HA 3KAQA 4IDDA 3EC2A 4XIIA 1UT6A 2GEDA 1GUZA 4EG8A 3MS4A 4KYTA 3BE6A 1IBKB 2LDXA 2C5HA 2AMYA 2WM8A 4ZO4A 3U7RA 1HE1C 4YJFA 1TDZA 2P65A 2ZT6A 4CL0A 4AKIA 3EUAA 2ZANA 1FTQA 3NP9A 5G3ZA 2J9ZB 1DQSA 2ZETA 2J3KA 3FPLA 3TD6A 3PNPA 4JA0A 4LK2A 4B75A 1RJ9B 4WCFC 1HNWB 4CL2A 5KOHB 4EZBA 3UUFA 2WYIA 4FEYA 1VKRA 4DV7M 3LZCA 3NDIA 1PFUA 3FGZA 3OM0A 3NHWA 3PR3A 5EFOA 4W9RA 2G70A 4YR9A 1XDDA 1SELA 1XZ8A 1X1BA 4Q9DA 3TW8B 3TDNA 1EVLA 1PTJA 2I2BA 3LLMA 5FB3A 1P44A 1AKYA 1Z0AA 1MO5A 2WQ6A 3KSBC 4P53A 4OQLA 1E99A 3IDOA 4J16C 1NKTA 5LU8A 1K5PA 1YQTA 4NNPA 1A27A 2VAMA 4TL8A 2DTDA 1EFHA 5JCXA 1YGPA 3J7AC 4WX2B 2GAFA 2FZ5A 4H7KA 3R1IA 1SC1A 3C39A 4QTYA 4B2IA 3BSYA 3WWOA 4QOZC 2EDCA 5K7SA 4IM7A 1MZPA 5FLXS 5MGBA 2WWTA 2EFGA 3AM4A 5KYYB 3IPCA 2IYSA 2ENWA 3TR6A 3F74A 5AI9A 1GZ5A 1QO7A 2D4HA 2VYQA 4IHQA 1P31A 4UHFA 3DAFA 1TA4A 1RC8A 2YL2A 5M04A 3L2OB 2XRYA 2WJ6A 3TXYA 5FBVB 2R0IA 1D3AA 4TS1A 2Q5JA 2WVHA 4DIDA 5H8WA 4GXNA 2XDQA 2RC6A 1KVQA 1NPDA 4F96A 5CW2A 2HRBA 4R7GA 4NG5A 4BVJA 1QV9A 1EE1A 4REQB 4H9GA 4QBHA 3EX7C 3R74A 2VJBA 1PR3A 1PW7A 3SMQA 1NI4A 5ILOA 1O95C 2PWYA 3H0KA 4BVKA 5ALVA 2IYVA 4WBSA 1I24A 1H0SA 4AG5A 1AMOA 2EHJA 2JGIA 3WNBA 3KYDA 1XHFA 5H59A 3CPJB 2KYRA 3I73A 1HFWA 5CB8A 4RTKA 1TTQB 3IHPA 3S70A 3AW9A 3S2SA 3L7IA 1YKSA 2XQKA 3DBRA 1V9LA 2VUHB 1EFTA 3M81A 5JJCA 5I7FA 1P1FA 4U7FA 2YJ5A 2PS3A 1I33A 1XLTA 4YAWA 2QD4A 1KK3A 3PT5A 5AM2A 3LDHA 2PR7A 1Z45A 4LUCA 2VL7A 3UJ3X 2HB6A 4CI9A 4G5HA 1IY0A 3SNHA 4C4PA 5GY7A 2HQOA 5DM4A 4IOJA 1DFHA 3OQNA 1WUKS 4ZAFA 4BLUA 2P41A 1EFUB 3ESBA 1FU4A 5AUPB 1XMIA 2P9HA 2FN4A 2IPXA 2WK1A 1V48A 3NBUA 1RPTA 4FWHA 3WGNA 4RVDA 3JX9A 5AJHA 4YRFA 4NBKA 1ZD9A 3H84A 2JP7A 2B2NA 3AERA 2ZJ4A 1EG7A 4QJ4A 4B7ZA 4YWJA 1TAHA 2CUNA 1EUYA 4LF5M 3BXHA 4RZ3A 2P1RA 4DANA 1ZH2A 4U2DA 1AGRA 5EG5A 2DWPA 3MIZA 1OGJA 3Q8XB 3GW8A 1XX6A 521PA 2WIKA 3HDJA 4RY2A 2WVGA 5TQ0A 4KGDA 1N34B 5EC8A 5FAKA 3B6JA 2JZ1A 3EBPA 1E66A 2JAUA 1B43A 1FFHA 1EXWA 5ALEA 3ZH2A 5BN1A 3MHPA 4AJJA 4L8YA 2CL0X 2NIPA 3KEGA 4GO1A 2UZ3A 4EKEA 3OT1B 1NDQA 1VL2A 1NOIA 5LLSA 1X9IA 3DOJA 2H48A 3CF6E 4B40A 1J39A 4UVIA 2UUBM 5LOVA 3UB3A 3WHKA 3D6UA 1YI0A 3F5MA 3DONA 4I5SA 1KSFX 4HQ0A 2ZPTX 3DFMA 3V1YA 5BSFA 1W19A 1YQUA 4HHEA 3N59A 1M5UA 4KQMA 2XF8A 1WB5A 3REQB 4GGPA 2XH8A 2XE7A 5KYWB 4UUQA 2WAXA 4KSYA 1SCJA 3LX4A 3QOXA 1UBKS 2QNBA 4OHZA 4DA4A 3S44A 5JYDA 3PK0A 3K0SA 5DPMA 5ITTA 2RHJA 4NNJA 3AQ4A 5CAEB 1CF4A 4PPGA 1KY4A 2ROQA 1JBEA 3O4RA 1XXHE 1LSJA 1ISGA 4RDIA 2XQVA 4BNJA 1JJFA 5LP6C 4CIVA 2ZYHA 1GRNA 2OGUA 1I7PA 3NIWA 1R9NA 2Y71A 3B38A 1W85B 1Z28A 2N1BA 5H3CA 4KT0F 1K6JA 2SECE 4IIUA 4RH3A 1PLKA 1LDEA 4MLPA 1YGYA 3X44A 2FEOA 3QLEA 2QZJA 2RK3A 1DP4A 1CD5A 1NUPA 3COZA 3BH0A 1TTTA 3PUVA 3EGXB 3QKSA 3D02A 2JLYA 1YSYA 1V7QA 1E5DA 3KWLA 4D74A 4A8PA 4H0FA 5AI0A 1N32M 3OY2A 2CNLA 3U3MA 4RY8A 4FFNA 4JK3A 1EKXA 1JDVA 2VT2A 2G80A 3D4OA 2ZLBA 2WP8J 4Z3OA 4I6EA 3PNVA 4G1BA 3BIWA 4FGLA 4OK5A 2OO5C 2E4UA 2EGHA 3PDCA 5I48A 1MF7A 4IBBA 2PGDA 4YMWA 4D3FA 3THRA 4YLYA 3KELA 4MQFB 4YDSA 3MS7A 3E5RA 4DARA 2FHSA 2CVQA 4J49A 2C54A 4AUMA 2D00A 4P84A 1MU0A 5LJIA 1ZN8A 2DRIA 4ZZ0A 2C31A 2Q2QA 4H6XA 1DO0A 2IA5A 1E1DA 4Z51A 4PYQA 4I4TA 3SHGB 4AKHA 1T2DA 4YAJA 5DFAA 1T4MA 3O91A 1E7SA 3KC2A 2PMWB 2BGIA 4J0CA 3RF6A 3LL4A 4B6RA 2FP3A 1P7PA 3I2IA 5HZKA 1HMYA 3DEYX 4KE7A 4A8JA 1Z6ZA 3PNSA 3F7TA 1Y3HA 4CU5A 2AEMA 3HO1A 3EPPA 1Y34E 4X91A 4BE4A 5BN5A 1YQWA 3EF0A 1Z7WA 3DDNA 3KFLA 3UWSA 5EWLA 3N74A 3TTSA 1Z6AA 4B4DA 1TJ3A 5K0BA 2HKJA 3EVNA 5C8VA 1EAMA 2F1IA 1VRWA 1T0JB 4PIPA 4LHXA 3E35A 2GN1A 1AUXA 1CQJA 4EAQA 4D9HA 5HKOA 2WLTA 4CQJA 2FJUA 5FTKA 2IXEA 4ESVA 2AIRA 3QE9Y 4BX9A 2GK4A 3ZJ5A 4UW9A 2JKZA 2IV7A 1US8A 5EE1A 2AKEA 4FKMA 1SVSA 3SHTA 1QPZA 4QRDA 4LKOA 5ELMA 4NKRA 3D0KA 1S01A 3B1FA 2ZQZA 5TE9A 1WVGA 5KNDH 3GLHB 4KK4A 4U5XA 4YUZA 3LTNC 4ZI7B 1HUQA 2CE2X 2IYNA 3K6KA 4JSRA 1QE3A 5DCWA 5BUCA 5LP6B 4DR4M 2YR0A 1Q11A 1B8UA 3AHIA 4WERA 4B3FX 4JI4M 1Z5ZA 4KFCA 3CLRD 2B4YA 3A1EA 1GNLA 5GJBA 4CWAA 2R97A 1GABA 3LCCA 3MRVA 1GNTA 3QUQA 4G41A 1FJ2A 4RKWA 5K99A 2ZRIA 3AUAA 1H2RS 3I42A 1DAHA 2WOJA 3RTCA 4J7UA 3HMKA 4MKRA 3T5CA 5A1JA 3KPVA 4P9NA 1QAOA 4MICA 1DSSG 3BXGA 3DCIA 3SDZA 3OQMA 1M2FA 4EVIA 3HL4A 2Y1FA 1VIDA 1GEEA 3WGGA 1N5MA 1Z3IX 1H85A 5JATA 2ASEA 4CG2A 1G3UA 4D4KA 3AILA 5E8JA 3K05A 4G0NA 1BU5A 5EHIA 3WWDA 2O0HA 2HGZA 3F90A 5BWNA 4ETNA 2C07A 4AY4A 3LFTA 2UZ1A 3VISA 5C5EA 1V3TA 4RHCA 4GMHA 1U2ZA 2NM0A 4QJ3A 2GCIA 2DAIA 4MQMA 4DCMA 2ESRA 3D6TB 2CZGA 5DLEA 5JANA 1PFKA 4HYTA 4HR7A 5BQOA 2A33A 3IX7A 4OGGA 2XCLA 3GPXA 2ZS7A 2X5KO 1B74A 4DCJA 5HILA 1JXOA 4Y2YA 3KXLA 4NBUA 4DV3M 3E81A 2Q1XA 2C97A 3K1YA 2WTNA 4MDYA 3VTFA 4KR3A 4C4ZA 1E3DA 5CJJA 1TYDE 4DM7A 3M7IA 2C3OA 5C0OE 3DGEC 4HRYA 3SIXA 5FWDA 3KOXA 1F5SA 3A6HA 1Q7CA 5GIOE 2VEOA 4IL5A 1ANKA 1YC2A 3HXLA 4E15A 1NNLA 2ZBPA 5DTRA 5EXXA 2Q2VA 1E3LA 2JHAA 4PYLA 5H3LA 2ZI7A 4TYWA 4PGMA 1FTNA 3IURA 3JARB 1GTSA 3QOWA 4UMDA 5PNTA 5H0IA 1QFYA 1AF4A 1UFOA 3HTXA 3KDSE 2Q3FA 4P31A 4LOIA 2HQSA 3U6SA 4NECA 2VS1A 3DNPA 1CQWA 3RG2A 4OKNA 5L6MB 3MCAA 4WJZA 2P0YA 5CUQA 2NTNA 4PZCA 2RGUA 4WK6A 1YJ5A 4RV4A 4G0WA 4QRIA 4H4EA 1G1MA 5MN4A 5IBQA 4XSVA 2UU9B 5JSYA 1VG1A 4BNFA 3RJMA 2VF4X 3UPDA 2CHVA 4C4OA 3IHTA 4NDNE 1QV6A 4DQUA 2OECA 2XVAA 1VRCA 3A27A 5HZMA 4EECA 2GA8A 3D2AA 4WZZA 2ZVDA 2BFEA 4HN2A 1YO6A 1MAAA 4RJKA 4OI1A 2XUPA 1MB0A 1KJIA 1EI9A 2XMPA 3VR3D 4FNOA 2RGYA 2ENUA 1E4OA 1PT6A 4PFKA 3C7AA 3EDMA 2ZI6A 5ALZA 2QE6A 1Z4PX 4JC5A 2JGJA 5K45A 1E0DA 3HR7A 4TX1A 1EBBA 1QZXA 4N5LA 2OCAA 3LF1A 3OZTA 3GQ3A 4GKJM 1OVMA 1FDIA 4BTLA 4L8LA 4TTAA 4V2IA 1V9CA 2RJNA 4BRUA 2LHGA 5HFAA 3VI3B 4O08A 1RTTA 3LT2A 5IJZA 1OA0A 3T3NA 4QPDA 2QSFX 2B2CA 3ZGOA 4EPVA 3O9ZA 4IXNA 1EPUA 3FTQA 2GZRA 3D8TA 4OP3A 1RWXA 1SCKA 3NALA 5KX5A 3MJSA 2R86A 2E18A 1WE2A 4K2AA 4OATA 1MB9A 1T25A 3L6RA 4MM3B 2VYND 1ODJA 2LGJA 1Q7TA 4XASA 1TF2A 4OCZA 3KR1A 2Z2YA 1TJNA 1R74A 4UNSA 3QMWA 1R8XA 4YGXB 2IBMA 4CKBB 3UAVA 4O02B 3TQTA 2IC5A 4O1HA 3NKLA 5DNDA 5ITWA 4LOLA 3CEMA 2HUNA 4ND8B 1VCMA 2BGRA 1YHNA 4G9GA 1TC2A 5BR1A 4B7GA 4AQ7A 1Z59A 5B30A 4NOMA 4R8MA 2LD4A 3VYWA 3R2JA 4LXXA 4YRQA 1H4VB 2A5LA 2X4AA 4IQ4A 3FVWA 2H17A 4RVUA 2LIVA 4MGHA 2BCEA 2XXJA 3IV9A 5K8VA 3GJ7A 2DAPA 2CF5A 3V2HA 1ZIPA 1W1IA 2AJBA 2PUFA 2OM2A 2VRCA 2WYWA 3E7PA 4IJ6A 1PM5A 2ONCA 1RHRA 3R3YA 5DHFA 2ZRAA 5DRYA 1U9IC 4PSKA 1AKVA 4D0SA 3GLTA 3EIWA 1SQSA 3JD2A 3W8EA 3B1YA 5HGJA 1X1RA 2C2BA 3FR8A 2EF1A 2PT5A 3QYAA 2DP4E 4AWXA 2ACVA 4C5BA 4NDAA 5CH3A 4OQPA 2FW0A 2GDZA 2OBLA 3FD8A 3PI7A 3ZZ0A 4BUCA 2X23A 1L5FA 3ZU5A 1T8RA 1N1EA 4GECA 1E94E 3FTFA 4TV9B 5A0TA 4ZV9A 3MWFA 5CBPB 4R68A 4NXMB 2FZ4A 1YMVA 2W2XA 1VZ2A 4TZKA 2QZ4A 2O2XA 3OOEA 1XPJA 1TK9A 3B6KA 1LBTA 1UR5A 4KVZA 4BQOA 4HUQA 2P2GA 2G9QA 1RWOA 3Q87B 1EZZA 2HWKA 3STXA 4LBYA 5LP1A 4JFAA 5JU6A 5DNUA 1N8TA 4TKUB 2EZ8A 3B89A 1CVLA 2PX2A 2ZTSA 4YJ3A 3EJWA 1NX6A 1IL0A 4NPCA 3WJAA 3ZTWA 3CN9A 5HEKA 4WTOA 1IZ7A 1O03A 1GRQA 1XZJA 4X66B 3GLSA 4L4XA 2PQ6A 1MKYA 3WGMA 3EAFA 3G5LA 3L8MA 3AUFA 1F60A 2JZ0A 1ACLA 2CJXA 1F06A 1T9GR 2ZDHA 4Q9JA 3PDWA 5EKXA 4FHZA 4I1YA 3TECE 1QRRA 1AHHA 2OBBA 3A4TA 3TQFA 4RKYA 1A50B 4NBRA 4PAQA 3O4HA 2P9EA 5LIPA 4FOOA 4GEKA 4OUDB 3GIDA 2XRFA 4DYDA 5ECYA 1ISFA 1WDLA 5GM1A 3L8HA 1A5SB 1T2EA 2IHYA 2OGSA 1XD2A 4Q4JB 5BSEA 1NN1A 1HY3A 3MQ4A 2L42A 4JJAA 3U09A 4FHCA 4ZPJA 2VPZA 4XM1A 4Y0NA 1DIAA 3PJEA 2X4LA 1KOJA 2ZT5A 1TNDA 1AKQA 5EN4A 3OCUA 2PSFA 4JYPA 2B4KA 2WWYA 1PDWA 3RODA 2O20A 4RW0A 4EPRA 1PR1A 3QK7A 3K94A 1K9VF 2A5JA 4ZTBA 3LMKA 3ZJVA 1P7VA 3HUEA 1VG8A 5A7HA 2QNRA 1AZTA 3I2HA 3U5ZA 4Q7JB 4NYJR 2Q62A 3NWJA 2JGRA 2PKEA 4C20A 3OEYA 1LPMA 2GRAA 4FPXA 5JAUA 4CM6A 4DKXA 4BNUA 1XQ9A 2C4NA 5EZSA 3F9RA 3DBIA 4X3OA 5H82A 1DAFA 5C5DA 4URHA 5ALXA 2E4VA 4E5UA 1A7KA 4JJ4A 2A1TR 4S1PA 2CEKA 1GUFA 4CQMD 4AN4A 3RFWA 2UUBB 1HK7A 1G8SA 3N2KB 4V1CA 5HJ5A 4UEKA 3B7WA 1L4UA 2J6IA 1JLSA 5TMDA 3HBLA 5EIOA 2O50A 1ZOPA 5TEVA 2O8DB 3D3QA 3WBBA 2NP6A 4CTKA 2E4XA 4M53A 3WLSA 2OKGA 1DHRA 3QGMA 1U0TA 4W5WA 2QRNA 1V3VA 4OP2A 3TD9A 1Q6ZA 4LDZA 4QWWA 5AKJA 3QUSA 3TE6A 1R3UA 4JX9A 1TFRA 5YASA 2WIJA 2R18A 1PNOA 3AV0A 4PTZA 3DYBA 4K6KA 1CY0A 4R3WA 1EA7A 4D42A 1IY9A 4XGQA 3U7FB 3ZK9A 3FFBA 2GI4A 3F73A 3L07A 5CW1A 1FYDA 5L3QA 1KU6A 4OGKA 4JP1A 1J23A 5F5NA 1L8OA 1KVUA 4JP5A 3ZXSA 1R0XA 4LJ5A 2Y8EA 4L1KA 3RV4A 2HT1A 1PGQA 4C3ZA 2KB0A 2XPCA 4AI6A 4HDRA 3Q5EA 5LDGA 3DBHB 2OK7A 3AEUA 3B6EA 3G9UA 5JY6A 1TKBA 3E5NA 2W71A 1L5NA 1LFAA 3P19A 3DAYA 4IH4A 2OLJA 3FVQA 3P9IA 3QKRB 2X41A 3ZVRA 1YRYE 2BYTA 3HO8A 2FPWA 2CZCA 3PD7A 1QG6A 4P08A 3AVWA 1LVHA 1TADA 1RI2A 5ADUS 1WB6A 3ZHXA 4X5OA 4ND7A 4HVTA 3N0XA 3L0DA 4N5MA 3HJSA 3DV0A 3RRZA 4C1NA 1A9PA 4UJ3A 4S12A 2CMGA 1GPNA 3H2KA 3UMBA 2UYGA 2YCBA 4MQ6A 3EXHA 3B60A 3ANYB 3AUJB 1T2FA 3RQIA 2D5IA 2KW5A 1BFUA 3HZJA 4OYRA 4FBMA 4LSGA 1GO5A 1Z34A 1XZPA 1CB0A 2NPFA 1TMGE 5CTJA 1TTHA 1P4AA 4MYUA 3KW6A 4U5QA 3RVMA 3R3ZA 1ABBA 1TA9A 5K3OA 3HN6A 4CIZA 4UAVA 1AC5A 1W48A 4L8VA 5BQ3A 3A14A 3QEBZ 2G09A 3DTVA 1X77A 5IBCA 1V95A 2HV9A 1RRFA 1OZAA 4MNTA 5JAQA 4MUYA 2ANCA 4LBWA 4PAWA 1BA3A 3LUGA 2ORIA 1PT9A 3JZFA 3Q11A 2O3SA 1DLIA 1PFGA 1KKUA 4CMBA 1L4FA 1FFXB 4IUCS 1DQPA 4DM3A 1GSHA 4L0QA 2FLVA 2Y77A 4WW0A 4KMMA 5J2TA 4TL7A 1WZNA 2CK3A 2LVAA 2GO7A 2ZBGA 4LDAA 1YHZA 2FF7A 1V8OA 4G3OA 3T9BA 1T10A 2AL7A 2GEFA 4HQLA 3U37A 1B0PA 2Z5LA 3P96A 1NR7A 4M1ZA 1MJFA 1YZVA 4Q00A 1T1GA 4EYEA 3X1MA 4G5OA 1J2EA 2D1SA 2AI2A 3H1BA 1ATZA 5AESA 4TSRA 3BTSA 5K0FA 3QHQA 3U61B 4ZT2A 1EIWA 1A9XA 1T26A 1H94A 4OKIA 1DNPA 1FNBA 1HYQA 5LUBA 5DBHX 2JFGA 1B15A 2FDCA 4GD3Q 2LTAA 4QNNA 4PHGA 2I2CA 4EB6A 3OM1A 2A4KA 4NLLA 4AZ0B 1KO4A 4XOUA 4LXHA 2I55A 3A4IA 4B71A 5CIQA 4S05A 1RTKA 3CEPB 4NK5A 4HGZA 4JI4B 1SU6A 5A7GA 3K9CA 4PX5A 2C57A 3W6UA 3ZV4A 3SBXA 3CNOA 4A15A 2QN1A 3C3KA 1UFKA 2QMZA 3H6KA 4N0MA 5F7JA 3LFHA 1FX0A 2BE7A 2V7VA 2OZEA 3QFFA 3WLKX 4RACA 2A58A 3O3NB 1ORYB 2AOXA 1NXWA 3ZXXA 4LJKA 6REQB 1XGKA 2OAEA 3OOJA 3U40A 5HHTA 4LZAA 1YB6A 5ICFA 3SASA 2CLDX 4V0KA 4ZQGA 4B4UA 1ZA1A 2Q49A 4XYGA 3CZQA 3ZUPA 2ZRPA 2VF5X 3T3IA 4MJLA 3LZ6A 2RB5A 3IQWA 5I6DA 2XZPA 3O8OA 1MBZA 2FEWB 3CX4A 1WCYA 5CB4A 5ICSA 4KE6A 4E4RA 5AKIA 2FSIA 1M7HA 3JWJA 3BWXA 5IDXA 5A3QA 5UKDA 5TDHA 4FSDA 1CYEA 3FYDA 3OE7A 4KI0A 4CLEA 3QKTA 4WZAB 3P9QA 3C74A 3IPAA 1OUMA 3KXPA 5IC5A 3V7UA 1YDWA 1JA1A 5DGTA 3RRBA 1KBZA 4Z9BA 3VOSA 1BX0A 3D4LA 2ECOA 3TB4A 3QFRA 3LKDA 5CFZA 1GU1A 1K63A 2RAPA 2ZWOA 3CM0A 1TLTA 4AVYA 4ZALA 3FKSA 2GJ4A 2VDNB 3WGYA 4ZTZB 4XDGA 2RHCA 1UKVY 4ARZA 1MNAA 1C41A 2FN3A 2ZRQA 5E2AA 3A06A 4CTMA 2CB0A 2I7VA 3CVOA 4GQAA 4RPHA 1SXJB 2AS0A 2QMQA 4QDOA 3BWMA 1E61A 1QIKA 4RF0A 2HGSA 4K8RB 4RK4A 1OT5A 4I9GA 4EKIA 1W2WB 2JFUA 2JAXA 1YTLA 4Y6GB 3NWBA 1TCBA 3BIOA 1EM8A 4Q1EA 1AUVA 2OWDA 1ODKA 3JASA 4ZHSA 4Q5IA 2B36A 4BZXA 1VDLA 1AXEA 5JJLA 1XPOA 2W8BB 1L5OA 2PMBA 3TR0A 1D6MA 1G18A 4QQKA 4KMRA 2P9JA 8ABPA 1JS1X 1MHPA 3CUKA 4AMBA 3T1NA 1M54A 2XV1A 1K8QA 3R6TA 2DKFA 4IQ8A 1HTBA 3CZ5A 1Z06A 2HMAA 4DDHA 4M98A 1CVRA 2YWEA 5DO9A 4UCQA 3AUXA 1IN5A 1V4NA 3MAAC 5EPEA 4BN4A 2QYSA 3S2IA 2JI4A 1XK7A 5E6JA 4JYZA 2VO1A 4QGGA 3HO6A 5ALRA 4UEQA 2DC1A 5B6IA 3MWKA 1T3HA 1R7RA 3HFRA 3B7QA 1WWKA 3O31A 3FFWA 3F7OA 2WA2A 4C6TB 2DAKA 1Y9JA 4WN3A 1X80B 1SVOA 3AM3A 2QMUA 3UOGA 1E9RA 2ZBKB 1U8FO 1SC4A 2ZUVA 3D8BA 2PGXA 4PO9A 1R50A 4N5IX 4L9WA 1HDOA 4P4TA 5AM3A 1FNSA 4N41A 3HR8A 1U0SY 1ZK1A 2QN3A 2VCYA 1JAZA 1NP3A 2OVBA 1J06A 1GARA 1WMEA 4M89A 4AZ3A 1P7WA 4XA8A 4O2AB 4F8YA 2HWUA 2QD2A 3CKKA 1QDRA 1V34A 4HTFB 2IUSA 4FIZA 2AFVA 1E5XA 3VKFA 2PAAA 2GYUA 3CHYA 5AHWA 4D4IA 1XTKA 4PSCA 2XF3A 4K9OA 3IQHX 1UBMS 4B8WA 1M1YE 1ZEMA 2D06A 3QKWA 4FHEA 4M46A 4OM8A 3MNFA 3PQCA 2V6ZM 3MJDA 5EUMA 3KSDO 3TTTA 4GOMD 4HZUB 4YPFA 5CXUA 2JDID 1FXUA 3KOXE 3BGDA 2GTHA 3T0GA 3KSJA 1ONOA 1XZDA 1RACA 4LECA 1IBMM 4HX2A 5LD2B 3AHDA 4V1CI 1R8SA 1ZH6A 3STUA 4Y6PA 3WQSB 2NG1A 2CUKA 3FB1A 4G0OA 1LTHR 3OIGA 4UATA 1RR6A 3HJUA 4E3ZA 2QRGA 2JVIA 1CRLA 2NSHA 3L4BA 1T5BA 2ZWIA 2FV8A 4B31A 3AWDA 3VR4A 1BWSA 2IW3A 1H66A 4G8CA 5EZ5A 1DMRA 3C0KA 1GFZA 4GZMA 4PX3A 5JNSA 5DLPA 2V96A 3NZEA 2XUFA 4Y2SA 3HI4A 4ZCQA 5FWXA 1BDMA 3PEUA 4BC0A 1YTUA 4JOQA 3Q7QA 2BKUA 3DMTA 5KQ8A 3VH4A 2X6QA 3EXIB 1XU4A 1GUDA 3SDBA 1JRLA 2GJ8A 1U7XA 3DD1A 4HY3A 5FBLB 1EUZA 1K8ZB 4DWVA 3L7NA 2F17A 2ZZKA 1U0FA 2JLAA 1OU4A 4JWKA 3M33A 3UN1A 4IBDA 1W4RA 1JV2B 1UFVA 4QXRA 2PUBA 2PRKA 3LE8A 3WWCA 3UGKA 3IIEA 2PKCA 5HR5A 2GN0A 4WLOA 3KKKA 1COWD 4WKBA 5K0GA 5JDIA 4PC3A 3A2KA 1F4LA 2P2YA 3CG4A 1NMEA 4H2DA 1FQWA 5BW4A 1QDTA 3UWPA 4EHBA 4NMWA 1UDBA 4YGYA 3GQBB 3KYIB 1TUGA 2FZVA 3UT0A 4ODIA 2G9NA 2V7QD 1GCOA 4G01B 2FQXA 2DT8A 2Y76A 2HLHA 3VPXA 1S89A 4QGFA 3IILA 3BBZA 2GCNA 2FCAA 1ETHA 4J3FA 1XTTA 3C3EA 1VBNA 3NO4A 5SZIA 1BXRA 3QXJA 4H18A 3A70A 4I50B 2BRUC 1E0JA 2QV7A 2PL1A 2ZB8A 2IV3A 1E9BA 2W4MA 4FD3A 4CHGA 1D2RA 4M54A 4O0LA 3NVAA 2FCRA 4R1OA 3L04A 3DMYA 4ILEA 1XZIA 3FYUB 5FEMA 4BKUA 3I1IA 1XRSB 1XB2B 2HJVA 2Y0CA 3ER8A 4QUEA 5BQ5A 1NBMD 2AI1A 3ZVLA 3GRCA 1MOSA 4Q4LA 4FFBA 3BD9A 1WXGA 4ENVA 3ASZA 4BP1A 1EA5A 4A0RA 2QW0X 2BTQA 4LE2A 2CWBA 1OIPA 1A96A 3SC6A 1TEZA 1RYEA 1ZRNA 2C3PA 2IXDA 2BMWA 4BGVA 4LHVA 3UV3A 3W6PA 3ER9A 2Q2OA 3M5PA 2IDZA 3CLTC 1UPBA 1GITA 2JIRA 4MWEA 4JC8A 3A4YA 2UVQA 3SK0A 2DHCA 4O6VA 2Z1NA 3JYHA 3GUCA 5DYWA 3K9WA 4US1R 1RYDA 4NZMA 1T0IA 4M0LA 4KDCA 3ZWCA 1GSIA 4R2WA 1RRGA 5BWLA 2I6XA 3PQ2A 3IKMB 3I4FA 4GKKB 4BV8A 1SM4A 5A6SA 1KDZA 1XZNA 1IAVA 4KPUA 1TQHA 1T0HB 3V5NA 3ONFA 1QUEA 2TMGA 3T0FA 3GRKA 5F51A 1QGUA 4M49A 5CDGA 3E58A 2XE8A 4ECEA 1Z68A 2XITA 3HXQA 4ANRA 4KC0A 1Z8FA 5AW9A 1L5VA 4LJ9A 4TRMA 3B6ZA 4OB7A 2QP3A 2AOUA 4YAGA 1IMJA 3RAFC 4A4DA 1FRZA 3NOVA 1JKFA 1O97D 4BEWA 3A28A 4DLSA 3TQRA 3HDYA 3HVJA 3HXOA 1R88A 1XYVA 2O7SA 4HMOA 5BVGB 4UUNA 3IQGX 1M67A 2QTTA 1QNFA 3J81S 2ZZNA 4B6JA 4EGCB 4QHSA 2VK2A 5DTEA 3UHFA 5TR9A 3V2GA 1BA2A 3NTQA 4DA0A 1E59A 2OSVA 1UT5A 4YRBA 5F5LA 2KRUA 2VNHA 4X93A 4KYVA 4EATA 5CNIA 2P4QA 4B3TB 5BW6B 2AHRA 2C61A 2CL6X 1D8TA 3GWGA 1XTSA 2F90A 4OHXA 3N87A 3JQGB 1TZBA 4DREA 221PA 4ZQCB 1XXLA 4B3CA 3ML1A 3HSKA 3O38A 5BNZA 1HKHA 2O7VA 4LHZA 4YT2A 2C4UA 2H8KA 4RTNA 2RGEA 5G4KB 3W5SA 3U3KA 2CC2A 3LVFO 2NOAA 5IYZB 2PGAA 3FUCA 1K7XB 10MHA 4CEIA 3E1SA 5HRAA 2C95A 3GFTA 4LXTA 4HB4A 2QORA 2FRDA 1OJLA 3UKDA 3V1UA 2FN9A 1XRLA 1NURA 4KGVA 1JGTA 1OAKA 1K3XA 5HOQA 2WJPA 2WUFA 4ZU1X 4JC0A 3T06B 1J97A 1Y1SA 5L9AA 3G2IA 4XDHA 2PWPA 1NYQA 1P33A 3AF1A 2BTOA 4PFJA 4W6ZA 3EB9A 2ORED 1JTVA 1UK8A 4XSHA 3ASYA 3AVXA 5SY6A 3NB0A 1BFDA 4GPBA 4U2CA 4C0XA 2JFVA 4IJVA 3U3XA 3E3MA 5CD1A 3K9PA 2FUCA 5JD3A 4TWRA 3RUDA 1TF5A 2PUEA 3U6LA 1XAGA 4UCFA 1T3LA 1ST2A 2D2FA 2WWIA 3AESA 4PXYA 4AZVA 4DCSA 4WNYA 3CRVA 5AXDA 3R8FA 3DZKA 3L18A 1A82A 4W7HA 1NX9A 2Q5CA 4RM2A 4DJDC 4GBED 4B5LA 1VGQA 4F2LA 3GFBA 4RD4A 3N2LA 4UE6A 2NTVA 3HMQA 2WYVA 1N6NA 3ENKA 1QO0A 1YCHA 2XMBA 1Y8QB 4KYUA 3LT1A 1Y7PA 3I37X 3U7QB 5ELLA 3CB4A 4POOA 4EY8A 3NXSA 4ZCTA 5KB3A 4RF1A 1PR0A 4HLQA 3BSFA 1L7DA 1XWIA 4LGMA 1SOAA 4MGZR 4DCPA 5IJAA 3FI0A 1WCIB 3WGOA 4EJSA 4Y2UA 4FKBA 2PBRA 2NZJA 1YDFA 3PT9A 3DKKA 4WA8A 4CMEA 3I6ZA 2VQ6A 4MCHA 1GFSA 3UMCA 4PLCA 2D2XA 2Q3CA 5C81A 3A04A 5CM2Z 4LHYA 5CXQA 2B0JA 2H7XA 1ZI9A 4WDQA 5JMPA 3UB2A 2CCJA 3T0IA 2DETA 1UWKA 4QPZA 4DQVA 4F2HA 1NNI1 3GARA 2VSNA 1GVNB 1GOTA 3M5WA 1V8ZA 3VTZA 2WMYA 4OBWA 4QQRA 3V97A 3TWKA 1QYVA 3DGFC 1JP7A 1QHFA 2D54A 1QB7A 2I1LA 3NUZA 4M8SA 3HKEA 2Z04A 4WJLA 4A2WA 1HOTA 1YVUA 1UJNA 3LOUA 2ZPAA 4HGNA 4BJ6A 1G3IA 2GARA 4UASA 2N35A 2B1RA 4G97A 4MTCA 1RZ3A 5KJ1A 3H2YA 2J6CA 3IRVA 1UMCB 3HJRA 1VL8A 1PGNA 3WO0A 5K4HA 2HM7A 2HRRA 2PWAA 4D99A 3B2EA 4GHLA 1PSZA 3DDSA 1NXSA 2H31A 5CH8A 4C2UA 2VCEA 2QE7D 3LC0A 2YQ5A 1ZDMA 4YXWD 2XGGA 3CKLA 5JCZA 2MSLA 5EP1A 3UFXB 1CJBA 1FMFA 2ZRCA 2B98A 1YB1A 2RCYA 3E9EA 5AM1A 3WGIA 1DPFA 5CM9C 2QVCA 2QP9X 2BHRA 3H5OA 2CHEA 3GHHA 3BFXA 2I1VB 2RGGA 4D43A 2GN8A 4MV0A 4GOLD 4FEEA 4I1OA 5LZ5A 2W2TA 4HB3A 2X40A 2B9EA 3E15A 2GXUA 2ONZA 2Y66A 2AMFA 4UTZA 1OJ7A 3KR0A 5CYPA 3ZDXB 4ZEVA 2PH5A 3DOCA 3IMCA 2DPXA 4DG9A 3KKQA 3BBLA 1YDEA 2GXQA 4L3VA 3HCOA 1GTZA 1FU7A 2GN9A 3LYLA 3RGGA 3ZDYB 1Y8RB 2XEXA 3N28A 4Q48A 4A0FA 2UUAB 4NOKA 4OH7A 4X6LA 4WMLA 2V3VA 2ZVQX 1G8FA 1KIAA 3Q7IA 4RM3A 3AB7A 4BX0A 4LRSA 4UMVA 1I6MA 3J2PB 3J7AS 3E7FA 5ALYA 3FCUB 3AHJA 4M8NE 1Z0IA 2WJYA 4RYDA 5EJ8A 3UT6A 3MTGA 4HDKB 3ZGYA 2HTEA 3DSRA 3QVMA 5FT9A 4ITUA 5FJJA 5AVZA 1L7VC 3ANNA 4NMLA 4GWGA 3UIEA 3CH4B 3SVLA 4Z4IA 3VA7A 4G65A 4MV4A 3IP7A 5K51A 1XKXA 2OCXA 1CP2A 5BP7A 2ETVA 1H42A 4YY3M 1AS3A 2CCKA 4PG4A 3USES 1I1OA 2FR8A 2VATA 3K0HA 2O8FB 1CC1S 1MOZA 3ROPA 3W3AH 1AGXA 4YK7A 4C5AA 3ZS9A 4BFLA 3FHTA 4OSPA 2WF8A 1MAUA 2GUGA 1I6WA 2OG2A 2IS6A 1CZNA 3QH4A 3QEKA 1MR3F 3EPRA 3H1AA 4L8GA 1XZGA 3JQBC 4DQDA 2OCYC 2QMOA 1Y1PA 2BH2A 1XLWA 2ZB4A 4K0RA 3DZHA 3P20A 4QYIB 1SQ5A 2VTVA 4EHIA 2G40A 2QQFA 3TIIA 1E3EA 1MIHA 1XTRA 3Q1KA 4QBTA 1PZXA 1QIGA 4AY3A 3I6YA 5L8RF 1QZ3A 2DEUA 2V7WA 3CR3C 4TS4A 1LV8A 1PG2A 2DJIA 1UDCA 2ZRJA 5EMMA 1N6KA 1CUGA 3N8HA 2HFKA 4OREX 1EDBA 3VHLB 1RPAA 4NPHA 4IINA 3BD8A 1IEQA 5CT4A 1UKAA 3KHTA 3OTHA 5KQDA 4OV6B 5L6LB 1LK5A 3EGWA 5JRZA 3NU1A 4Z1MA 1CUVA 2IYOA 2A86A 5A2QS 2BP7A 4U9HS 2JZNA 4QFDA 3NYIA 1WCV1 4B2YA 2ZXEA 5JCOC 1IBRA 2XOKA 2QR5A 4GYYA 3BH6A 2O2CA 4IFBA 5DVZA 2P0AA 2ZSDA 3N58A 2DF8A 4E2XA 3RUCA 3DOAA 4YB8A 1BKSB 3DWGA 5DMHA 2H0AA 3UC9A 4J2TA 1BDBA 4QDZA 2WIGA 1TYEB 1IHYA 1YU6A 4TT8A 2A14A 1FFDA 1RIIA 1J00A 3KVOA 2K6BA 2YBEA 2XT6A 2FS1A 5K6AA 3NDRA 1CPYA 1J1ZA 2PUAA 3OOSA 4FX5A 1C4WA 1PV4A 3DZFA 1GSOA 1RWNA 2OFFA 4ZREA 1XI2A 5IULC 2ZBDA 3HP1A 3PPVA 4PN7A 4GKAA 2I62A 5ESRA 2HJWA 3TRKA 3V1TC 3A9WA 1O94C 4O5AA 3TVYA 1ODIA 4B6FA 2PJZA 5H83A 1F2VA 1MH9A 1KNQA 2R11A 4CIYA 4HQFA 5LUAA 1CUWA 4KNYA 1LD3A 1KH3A 1TT5B 1QDLB 2NTJA 5G4LA 2XNCA 3B48A 4A8TA 1GN9A 4E07A 2HHHM 1B26A 1TJ4A 1T43A 2C4KA 2P4SA 1GA6A 1WGLA 1EE9A 2WPDD 2XJ9A 1NV9A 5H80A 3FAZA 3RASA 1PLJA 2O57A 3OCYA 4YRAA 1OXVA 2Q4OA 3W67A 1MQ8B 2CHQA 1FBNA 3DLIA 2ERYA 2WTAA 1GILA 3C7DB 3FPHA 4Y2TA 1M1YA 3ANSA 2WY2D 1QFJA 1NTRA 4ZAWA 3HCNA 3LKBA 1KR5A 3DDOA 3KSMA 5A4IS 2ODQA 5ICGA 3V80A 2X1MA 3TUIC 2OB2A 3QEOA 2RHGB 1RIFA 4TLCA 3TEFA 4J8PA 1PYDA 2PMFA 4FOSA 3WK9A 1DC5A 3T9AA 3WV5A 4G0UA 1EX9A 5LZ7A 1R4ZA 2DUUA 3P0FA 2AJCA 4I6JA 4IIFA 4RD1A 1Q44A 1UQRA 5CT6A 1PNTA 3R5FA 4L8RC 3QWBA 2X8LA 3VR1A 2IEYA 1WF6A 3IIMA 1X15A 5D00A 2G5CA 1CFZA 5EZYA 4EA6A 1HQDA 2V6JA 3PG5A 1Q0PA 4ZMRA 1HLFA 4Q4CA 4FN4A 3L7CA 4MIKA 2XQGA 5E4TA 2VVTA 4CM1A 3ELUA 1UBTS 4CEJA 1JJBA 2WTBA 4QOIA 3ZLJA 1NW6A 2YS6A 1OXBB 1N4AA 1BWQA 5JNTA 2RIPA 4MWZA 1PX2A 3UICA 2XNDD 1QIEA 5J1SB 3SN6A 4KIWA 1BZYA 2BM1A 2O23A 2SKEA 1XTUA 2ADFA 5D3MB 5CX1B 1FFAA 4QREA 4ZD6A 4NFYA 3JR5A 1L5HB 3NT4A 3WWZA 3MPUA 3O8LA 5B58T 2IUFA 1JPJA 5L51A 1GPJA 3R0JA 5CPBA 2PYIA 5EYPA 4ZVKA 5ALKA 2VBFA 1V1MB 4BGUA 4E14A 2JIQA 2YS7A 4CCWA 5BRNA 3K0FA 4WE3A 2W6QA 1OBCA 3L0PA 2YOFA 1X8KA 4DLYA 3BDVA 3L4JA 2AXNA 1HORA 1U28A 5A0FA 4F8EA 4BMPB 4XFDA 3V1NA 2YVKA 4WVFA 2F2TA 2D1YA 3S2UA 1HNZB 1I3LA 4RGYA 2NUAA 3R9WA 3QHAA 1N7IA 5LQCA 4G25A 4OJTA 1EMDA 1USVA 3LXRA 2WTEA 3CCCA 3G1WA 1KEPA 4WOCA 3OOHA 2EJBA 1RBMA 4R3NA 4GBMA 4AMGA 1IY2A 3KFVA 4YQEA 3U26A 1ZD4A 4R6XA 1F8UA 2ZJ1A 3CWQA 4WINA 1GGMA 2QIPA 1ETUA 1UMKA 4FFDA 4D44A 2X9GA 4AWBA 5IBPA 3HM2A 1YACA 1DVRA 4YT8A 2CV0A 4DC0A 1EE2A 4QYMA 3V6LA 4WLNA 1LV7A 1K3UB 1T3GA 4KW7A 2C7BA 1FJGM 1BJTA 3STWA 1VKOA 2Y93A 4B08A 8CATA 1P62B 5LP6F 1CY6A 4B7UA 2J5YA 4I5DA 5LIRA 1PR2A 2GFHA 1W35A 4LG2A 1NVDA 1HDCA 4RAQA 4WKOA 1EJ2A 3K4PA 4G2NA 2REQB 4QATA 4DV7B 2V7XA 3F6CA 1OT3A 4E0BA 3ILXA 2Z9BA 5HKBA 4IS2A 5U9CA 2NQ8A 2FETA 4LVOA 4WDRA 1TVCA 1LLFA 1JTFA 4ARUA 5AVOA 4Y1RB 2FW8A 1TE2A 3QEJA 3IMEA 1WGNA 1JU3A 5AW4A 2P5UA 1E3WA 3KNZA 1JAYA 3DPUA 1UXOA 3BUSA 3U80A 1EWYA 2VT7A 1OHHD 4ZCSA 4G0ZA 5A03A 2IKSA 3QIAA 3KOWE 2Q5LA 5DFLA 3N07A 4LVNA 4II2A 5IVKA 4R1LA 1JG4A 1FYXA 2XB4A 4O4IA 3R40A 4DR3M 5M2QA 3PRYA 1DJPA 1F20A 5HA5A 2HA7A 2AN3A 1K98A 4HWSA 3I0NA 2M32A 4KFUA 4Y9SA 5CHYA 1QR2A 4DMCA 4PO3X 3NVMB 1GGHA 4P38A 1WY7A 5IT9S 4IRXA 1KZ4A 4JGGA 3P4YA 2NZXA 3PHHA 4L85A 2P67A 1NQ5A 3CT6A 4IUYA 1RYMA 5JZSA 1E1MA 2B7BA 1QE5A 3Q3JB 5JS1A 1EFRD 1TECE 3LHSA 2OORC 1ECCA 2WYOA 3O21A 2WJWA 1YL5A 3HKBA 3SAVA 2OP0A 1ZH8A 5HM8A 3GD7A 4ZJPA 2HQ1A 3ND6A 1YR9A 1DGGA 1T5SA 1C3EA 3MPOA 4FMDB 4OGLA 4ERXA 2V5UA 1CW2B 4IJQA 3DM5A 1FSSA 5IANA 3ZGLA 5A3VA 5JH7A 3IEUA 1RI4A 1ZSYA 3AF6A 3BHJA 4G4RA 4CKEB 7ABPA 5BV1A 3BCRA 2C7OA 1OTRA 2YYAA 2FR1A 1PQPA 3E0XA 5DB4A 4JJKA 2P40A 1VE6A 2VWQA 5KQLA 1XZQA 1S5PA 1S8FA 1RKQA 3EZ7A 1Z75A 2O1SA 2XYGA 3A1CA 1W36B 1R0BA 4NMHA 2EZ9A 3O8DA 1TJYA 3D4IA 4H1WA 2FMHA 3TQQA 1W5BA 3V48A 1TKCA 3CSDA 4D46A 2EKZA 3LDUA 2GPYA 5A4DA 1ZRSA 2IP4A 2YDXA 5IJ9A 3VC1A 3W5CA 2LBCA 3EXEB 5K9ZA 1PLLA 1XU7A 5AO9A 4C0AC 1WDMA 2WWGA 2JLXA 1EWTA 4K6OA 3SEFA 1SUBA 1JDNA 4NU8X 3SJAA 1ZOLA 5K8TA 2WJGA 4HH1A 2CYBA 3PNLA 2C2KA 1VOTA 4I4CA 4NOOB 1QCCA 1N6HA 4E2ZA 2B94A 1U6KA 3LCUA 5ERGB 4TM8A 2H1OA 9LDBA 3AC0A 1P3JA 4ZGGA 1T6NA 4GGOA 4LF5B 3KPJA 1ZW1A 4KAXA 3ONDA 3VU1A 2WJZB 5TEWA 4MW6A 4WXYB 3VR6D 4M38A 3DA8A 4F2WA 1L7NA 2WMOB 5IARA 1SUAA 3MBOA 3WQBA 5D2CA 4D25A 1N0IA 4DRXA 2QG6A 5L7YA 4FE3A 1RS0A 5DT9A 4PONA 3VVLA 4HAYA 5LYJA 3JR4A 1QBKC 2R7AA 4KR9A 2JGMA 1FTYA 3L1JA 3OQPA 1S3FA 2F5PA 3D7NA 4Q3AA 4K9LA 4MMYB 4N5HX 5AVSA 2I29A 5TGDA 3ZGZA 4G4IA 1NHGA 4BMZA 4FFWA 3N7TA 3WS7A 3NBKA 5IG2A 1R5OA 1EP1B 1M2OB 2EWMA 4GR5A 2NU6A 4LYFA 3JD1A 1JQJC 1NJ6A 2XDYA 4BB0A 2O1WA 1F3LA 2CSUA 1TH2A 1KAMA 4J7XA 4XXHA 1NVGA 5KSOA 3H2BA 4BLSA 5EJGA 1X7HA 4HBGA 2IYRA 2JY7A 3PJFA 3L49A 1KY5A 2LUOA 1QC5A 3ED1A 4AL4A 1VKHA 3WIEA 2BGKA 4BB6A 1W0KD 4XWGA 1BYUA 5D01A 1Y6RA 1H9BA 1MGPA 2JGDB 5JWRA 3O4GA 1TD9A 4ZOBA 2QDKA 3HPRA 2A30A 2GKSA 2XX3A 1KZHA 2I4OA 2PZAA 4CKYA 3HUFA 3PC7A 2IITA 2OBXA 3H1GA 2QTGA 1V5IA 3GJRA 3F6BX 4F84A 1OXTA 3RVBA 1T1IA 3S8MA 3ZHRA 2PS1A 3GRRA 4ZU6X 1U7DA 2K0BX 4XGRA 1YASA 4PYIA 4YRRA 4ID9A 2CJPA 4S0XA 3G82C 2FN7A 4C7KA 2Q1WA 4A0GA 1ZD5A 4GHWA 5LZ9A 1KVRA 1D4AA 1N32B 4OW0A 1XO1A 4FGKA 4PSAA 2XCSB 5C1PA 2D7DA 3O5AA 3SKYA 4ZP1A 2XA1A 3H13A 1EX7A 3C5VA 3LOQA 2NUPB 2QTLA 1H9AA 4LJ4A 1CIPA 4M1MA 3MTJA 5CIYA 2CGEA 2UYYA 4HEOA 1BDHA 3UWOA 1RHMA 4KVFA 2FEKA 2AMJA 1Z33A 3LBFA 1W76A 2FDRA 2XCOA 1WV1A 3S28A 3TL4X 4ZAXA 2JI8A 3UC5A 1CS0A 1K82A 3MTBA 3ZBPA 3U60B 3IVRA 3JR3A 1ZSNA 3TIGA 3HDTA 5FIUA 2Y1WA 2JC3A 3PGVA 2QSJA 3VC3A 4Y6QA 3GLIE 5DKFA 1JLLA 1NUTA 4IHJA 5MFPA 2PSJA 3R7WA 5FUBA 4XGNA 1UMDA 2QZSA 4HDSB 2WQZA 2NVBA 3QXGA 2CKMA 2O8NA 2WU3A 5JSZB 4TLBA 2P7HA 3SYTA 4YY3B 5EHXA 2YNMD 1SZPA 4L4SA 1AU9A 4L08A 1QYCA 3NS7A 3DCYA 4J0HA 3ASUA 4M0EA 2V7GA 1CVIA 4HZIA 3AFMA 1W7AA 3OJWA 4MZXA 3STYA 2XI4A 2EATA 2BFNA 1SXJC 5E9WA 1YI1A 3D0OA 4KUHA 1F2DA 1K7EB 2VP5A 4B82A 2R6R1 3AYXB 3LLUA 3FPJA 4Z49A 4JGIA 4ZIRB 2WG1A 1T4DA 4TWIA 2XQFA 3HWRA 4KI7A 3NEAA 1FYVA 3HX3A 4EG3A 4E32A 4DCVA 2QVXX 1CUEA 4PR0A 5EXEA 4DQKA 2ERCA 1UMBA 3IE2A 4P7BA 1Q19A 5FPTA 1ARZA 3B3QA 3QVTA 1R0CA 2B4RO 4DHEA 3FDXA 3UUWA 2IU3A 1TTEA 2PO7A 2CXQA 4U02A 1ZSVA 3SM9A 5KKAA 5DASA 1JALA 3K6SB 4V3CA 1XTVA 2ETXA 3KETA 1K4KA 3U7JA 3WJ1A 2VPWA 4QUDA 5EVCA 1WPGA 1C3XA 1UPCA 1H0RA 1G5HA 2A9OA 1THGA 4QU8A 2VUTA 3X1DA 1X1CA 4DR4B 1V11A 5KZMB 3KXIA 2MSNA 5FI5A 2J9RA 2QBYB 1DCFA 1JT9A 3P9XA 1ORHA 3SMVA 5H16A 4Z4CA 5EEGA 1SUWA 2YMPA 3E0QA 2O2ZA 2H59A 2O3JA 2O59A 1WHTA 3KP1A 1E2EA 1VJCA 1IWPB 1EGVB 1MB2A 2RH5A 3DLTA 4H1HA 1JYFA 4YROA 2ZGVA 1R6BX 4PHTA 4A8JB 1HDYA 4M9ZA 1BS9A 5EUQB 5JOQA 2A9FA 1ISRA 4EG7A 2QAGA 2AFIE 4DY6A 2DKNA 2X9VA 5EWLB 4UBJA 2DENA 1KJQA 4NCBA 1QPBA 1YR8A 3ZDBA 3QIVA 1E8NA 4JBYA 4MDFA 1ZO8A 5CYFA 4IOLA 3AI2A 1YZTA 3B6MA 2WKSA 4C14A 5K4AA 4M1QA 2V65A 2Z5GA 3REFA 3B52X 3DBLA 1PQUA 4R41A 1CZRA 2RGRA 1Z12A 1VIVA 1P0FA 1JMVA 2GTIA 3FRIA 4XE5A 3UTDA 621PA 1OPXA 2HHHB 3RG8A 1JPNA 5AOCA 3F9CA 5HBGA 4LZPA 2PLRA 3EC7A 3PQFA 3L6EA 3DM9B 4OQYA 4PG8A 5J43A 3HB9A 1VB5A 3MD0A 3U44A 2R4UA 1NM5C 4FWIB 3BGVA 3ZCRA 4DV3B 1DG1G 2OOKA 3W5IA 4ENPA 3GGJA 3K2LA 2AZMA 4YALA 3B5EA 4E7PA 5LD2C 4TUYB 1KRWA 3B7ZA 4ZDKA 4IDOA 4NYIR 2XODA 4G0PA 4RVOA 3F47A 3BXXA 1ML4A 4LCEA 4QBFA 4PTLA 4BB5A 4JBLA 4LOJA 1KI2A 4HLDA 3T54A 3OPYB 1DWUA 1W8DA 2WUVA 3MTIA 2QHOB 3CV3A 4C4RA 3BGSA 1L1RA 2YIDA 4MP6A 2X4IA 2LTUA 3GUVA 3UPTA 4PZYA 5EPUA 3W0FA 4YYEA 4MR8A 1FVFA 3QF4B 1QIMA 4Q4DA 2N75A 3KU1A 4RTJA 1F38A 2PX8A 3TNDA 4P3PA 4RF5A 3IUMA 2RG1A 3GHYA 1X0XA 5IVHA 2Z8XA 3U3ZA 3FROA 2P4EA 1H2XA 1UANA 2QM0A 3LQKA 3RIEA 4G6ZA 1FVHA 4BO6A 2QN8A 1R6XA 1J9GA 2VNJA 5ITRA 3QX7A 4YRCA 4MS3B 5LSAA 2X22A 3BHIA 5HBRA 3NBAA 2OXTA 1H6BA 3CLHA 2GWRA 3K73O 3ZGXA 1QQ5A 1NXPA 3AXSA 2YVLA 1LY1A 3U13A 4D0NA 4X20A 3C3JA 4DLRA 2IUUA 3TCKA 4BFVA 5GONB 4Y2JA 3GGPA 3NV7A 4ZDWA 4DNXA 3ESRA 2XCIA 2W2KB 2XB8A 1YJXA 2G3QA 3ZV3A 3DO8A 3ROQA 4AJNA 3HR4A 1OXXK 4B4KA 3FDZB 5JS7A 3EEFA 1HYBA 1G20A 2I87A 1TCUA 5EE0A 5EI5A 3BTUA 1OI2A 2GZMA 5LN1A 4EMTA 4GKJB 1WVMA 3KB8A 3ZVNA 3ON5A 2A5GA 1FQJA 1UBOS 4OMFG 3KP0E 1LKZA 3TLJA 3JALB 5K3FA 1HBJA 4WBNA 4N4AA 2H92A 4KR0A 1MORA 2JFOA 2M6SA 5DX0A 4CCYA 2VDWA 4JI2M 2YXNA 1C81A 3UBMA 1GZ3A 3C3CA 3NIDB 2AJTA 4DEYA 4II7A 2DTXA 1A76A 5D3QA 2BFPA 2XMRA 1HOXA 4NENA 1EBUA 4BAZA 4YCLA 1FW6A 3WBKA 3LYAA 3FYUC 2KRKA 2W4QA 1SKYE 1VEKA 3SE0A 2XXBA 1A77A 3LQQA 2F1JA 3A98B 1USUA 1OAIA 4EY6A 1FYWA 2OC4A 4BECA 4QGHA 1Z7YA 2FUG6 1PEYA 2Q7OE 5EKDA 3FPBA 4CF4A 1N2ZA 3JRNA 1VI2A 5AM0A 3U7HB 4ZOLF 4UHJA 1NBAA 3STVA 2PJDA 4LZZA 2VAVA 4ZYZA 1ZVJA 1NUUA 4BP8A 2GN6A 1XJ0A 1S96A 3AX6A 3V8BA 2BFEB 1JHXA 3IA2A 2GERA 3DHEA 2VDMB 5H70A 4FHFA 4PHFA 3HEMA 1L5WA 4RK1A 1D8AA 4YRLA 4KACA 1QK3A 3IV6A 2XZTA 4DA7A 4YAIA 1DJOA 4JN6A 2NLOA 3KVNA 2QIOA 3BQNB 5AKXA 3SJ7A 1Z37A 2VH5R 4HB0A 1EFAA 5JD6A 1N7GA 3S2GA 4A3VB 4BPRA 3MJTA 1YHYA 5IKEA 3UFBA 4BASA 5WRFA 3FNHA 1B16A 3UQZA 4Z54A 2NO4A 3GJ3A 4X0EA 1SHKA 4TXLA 3KQLA 4AICA 2V45A 4K0KM 3CF2A 2FP4A 5IX8A 1Q20A 3NR2A 5B7NA 1WA5A 3MD9A 1XTJA 4QUIA 4DR3B 5EE3A 1AN9A 3KOWA 1CB7A 3A9RA 4BFTA 1GSAA 5KX5B 1EUQA 3PYLA 1IFYA 1LWNA 1R6UA 2ZIZA 2V8OA 2GAJA 1T9HA 2R7MA 3NW9A 1HT3A 1R4GA 5J5CA 2CWDA 3IUNA 2GPBA 2XUQA 1JH9A 4YP6A 5I9MA 4Q39A 9GPBA 2OHIA 1HEIA 3GEMA 5I3ZA 3RS8A 3AINA 1K3WA 1O6ZA 3N8GA 5L3SA 4KPEC 3UAXA 4GDFA 2JFFA 1Z4NA 3IOBA 3CW2A 2QW8A 1HG0A 2X86A 2OHGA 2R1VB 3HWWA 1AHNA 1FNCA 1ODSA 2WIDA 3VSBA 4ZVRA 1O0BA 1ICIA 2QNJA 1NNUA 1VJ0A 3I8SA 5CU7A 4GPD1 2PFSA 2C0CA 3DEHA 1PHRA 2IXTA 1Z0ZA 1MN3A 1R5LA 1SBTA 3TPZA 1Z2NX 2KDLA 2OOBA 2XNHA 3PLNA 4DL9A 4E5SA 5EJ5A 4N0QA 2XMZA 3GGCA 2G7ZA 4AJHA 5I9LA 3QPCA 4ROTA 2YBDA 4H1TA 1T8YA 1LRLA 4Z9XA 2DULA 1SAYA 2XYVA 3O75A 3I8OA 2FE8A 1OFUA 1N3YA 2DY1A 3FZQA 4BZWA 3KQQA 3S29A 4LRWA 1CEXA 3Q10A 4GBJA 1RLMA 4Y2HA 1I14A 3CURA 4J2OA 4ZYYA 4B0PA 2G1AA 3QJ5A 4Z9FA 4DBVO 1Y48E 1I7SB 4LF4M 2FK7A 4DT1B 4L6V6 1FNNA 3A42A 1BRMA 4LYAA 4YUVA 1SQ0A 3FMPB 5EUBA 1Z0DA 3KZMA 2P9CA 3ODPA 2I7DA 3GVIA 4J6EA 2R00A 2W5UA 2P5TB 2ZFUA 1RWWA 3SVTA 4R9RA 4CT0A 2F3SA 5H37D 3FPSA 2G28A 1EXDA 4HUQB 3MGBA 2X2PA 4G81A 4TSFA 2FEAA 2E5LM 1B41A 4CKCA