3FTFA

Crystal structure of a. aeolicus ksga in complex with rna and sah
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
246
Chain Sequence
b'MVRLKKSFGQHLLVSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 60
structure length 246
sequence length 246
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftfA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftfA01
3GU3A 3EVFA 3OZSA 4BP1A 5IKMA 2Q41A 5E2AA 3KQOA 5DSXA 2IBSA 3DH0A 2PV0A 3JWJA 1TW3A 1X1DA 3KR0A 4FT2A 5CVVA 5C1IA 3TFWA 4E2ZA 1NW8A 1XCLA 3JWGA 3MB5A 2LD4A 3BGVA 3EVDA 2P3QA 5C9ZA 3E23A 4A6DA 4ER5A 3UWPA 3P97A 4Y30A 2P3LA 4FGZA 5DM1A 3UJ9A 4DMGA 4M7RA 3FPHA 2VDUE 3BGIA 1N7IA 1VBFA 3LHDA 4OBWA 3TOSA 1G6Q1 3I64A 2C7RA 4WXHA 2ZVJA 3G5LA 4EKIA 3KQTA 2ZCJA 2OO3A 2NXEA 1U2ZA 2BR3A 3HA5A 5E1BA 5ICCA 1N2XA 3K0BA 3B3GA 4Y2HA 5E1OA 5EQJB 3PX2A 3UJ7A 4HG2A 4RYLA 1DUSA 2GS9A 3A25A 4YUVA 3UA3A 3FRHA 2EJUA 5DXJA 2IFTA 1ZKDA 4EK9A 1TPYA 2XYRA 3TR6A 4FSXA 3Q7EA 3KQSA 2NP6A 4GOND 1KYZA 4HSGA 2FK8A 5GINE 5E9JA 4GC5A 4OA8A 4CKCA 3FTCA 1D2HA 3A27A 2JH8A 2GPYA 4DM3A 5ICGA 1X1AA 3ME5A 4AX8A 4RVHA 2OXTA 3NDJA 3NMUF 5BP7A 4GEKA 1RJFA 1EAMA 4RTKA 2OBFA 5CVJA 1NT2A 2P1DA 3IHTA 3LKZA 4GOLD 3TKYA 3RIEA 2BZGA 3BWMA 4PYLA 3FPEA 4E33A 3HCBA 3GRVA 2ZBRA 2G72A 3C3YA 1UWVA 3G2MA 5GWXA 3T0IA 1NKVA 3M6VA 3TLJA 5KQRA 2GB4A 5EEHA 5HEKA 4OQDA 5EEGA 3U81A 3EVBA 4DF3A 4YUWA 2C7OA 4DZRA 1FP2A 2PX2A 4P7KA 5DTRA 4FSDA 1BHJA 2PBFA 4GOMD 3PTAA 1NV8A 1XVAA 2KW5A 1XXLA 3EVAA 3R6TA 4RTLA 3PS9A 3UJDA 4U7PB 2P40A 2AOUA 5EZQA 5GP1A 2CMHA 3OFKA 3FUTA 4C03A 2ERCA 5K0JA 3M6UA 4PINA 4RTMA 3LCCA 5CVUA 2HTEA 5FHQA 4FT4A 2NXCA 2ZLBA 2ZIEA 5EKXA 1ZHFA 4FP9A 4XCXA 3T7RA 2CL5A 4P58A 1JR4A 3K6RA 1BOOA 5LR6A 3LX6A 3FYDA 1NBHA 1F3LA 1UIRA 2BM8A 1O9GA 3HA3A 4DQ0A 4F85A 4PONA 4PYOA 3AWIA 1QYRA 1WG8A 2IH2A 4CXMA 2NYUA 2FPOA 2PWYA 3MAGA 2C7PA 5K0FA 2WK1A 3E05A 1MHTA 1Z3CA 3LDFA 2QYOA 2P41A 2YX1A 3OPNA 4KIGA 4HGYA 1EG2A 1I1NA 2O06A 4GF5A 4EMSA 4PNEA 5BXYA 2EJTA 2IH5A 9MHTA 3REOA 2PX5A 4MHTA 2O05A 3M70A 4POOA 3SMQA 5DSTA 4HGZA 1IM8A 1B42A 1D2CA 3R3HA 1KR5A 1HMYA 2O57A 2PXXA 3L8DA 3UFBA 2BR4A 4CTJA 5F2NA 2JHAA 5JUWA 4GQBA 3ANXA 2CMGA 2ZZMA 3HP7A 4R6XA 1R8YA 2GA9A 4KIFA 3OCJA 4HTFA 2IGTA 3P71T 1XDSA 2O07A 2PJDA 3DMHA 5FUBA 3G2OA 3LECA 2PX4A 3A4TA 4CKBA 3LGAA 3FUVA 3NWEA 4OA5A 3BZBA 4M37A 4Z2YA 5EHGA 2EFJA 3ELYA 5DTMA 3G8AA 4RSRA 4ER6A 3TPZA 5GM2A 2GH1A 5D1NA 3DXZA 3UZUA 3P2EA 2Y1WA 3P2IA 3QV2A 1YFJA 2ZWAA 3LBFA 4MIKA 3THRA 3TM4A 5FA8A 5DM0A 3HNRA 3KR1A 5FTWA 3ERCA 1X1BA 3DTNA 3EGEA 3HCEA 4HC4A 3KR2A 5KQSA 1L3BA 5K0CA 1EJ6A 2BR5A 2HNKA 1VP9A 3B5IA 1SVUA 2IIPA 5CCXA 5FHRA 2PT6A 1RJGA 1O9HA 4OQEA 2I6GA 3R24A 3EEYA 3DXYA 2ONYA 3HCCA 3HVJA 3MTIA 1BC5A 3M6XA 5HOQA 7MHTA 1R74A 4RVFA 2JG3A 2AOVA 5H02A 2VDVE 1AQJA 4BLUA 5DX0A 5CVDA 2E5WA 3TRKA 5CM2Z 2ZFUA 3DOUA 1WY7A 1OR8A 5EVJA 3MGGA 3KQQA 1KPGA 3VYWA 1YZ3A 1RI2A 4F84A 1G38A 5F2OA 3M33A 1H1DA 5FQNA 2Z6AA 3UA4A 4O29A 1P91A 2P8JA 3IEIA 3SSNA 3SR4A 4RTJA 1T43A 1WXXA 1NE2A 2XVAA 3P9IA 1O54A 5BW5A 3FTFA 3DMGA 4ER0A 4QPNA 4KDRA 4PYNA 5K01A 1RI4A 2ORED 2PXAA 2G71A 2YXDA 4P7FA 4RTSA 3HCFA 1RI5A 1M6YA 4LECA 2VDWA 1L3CA 1VQ1A 3MTEA 3GRUA 4PYQA 5M5BA 4X1OA 2PVCA 1JG4A 3ELUA 1NW3A 1INLA 3LDGA 3PB3A 4E30A 3I9FA 3GGDA 2FCAA 2ZWVA 3E7PA 3GRRA 1XDZA 4A6EA 4ER7A 3UJ6A 4P7JA 3FRIA 3ID6C 4DCMA 4RVDA 3P9NA 4LWPA 4YUYA 3GNLA 2JHCA 3MCTA 1KPHA 4C08A 2AN4A 2PY6A 5T6BA 4RTOA 1YB2A 3GDHA 3NWBA 5BW4A 3FUWA 3GRZA 3KPVA 2YQZA 1P1CA 2K4MA 5K0NA 4BY9E 5EIFA 4PCAA 5DLYA 4FZVA 2ZZNA 1N7JA 1KP9A 4MWZA 4YUXA 5DX1A 3KR9A 3EMBA 5K03A 1XCJA 1P39A 4NECA 5IH3A 3PT9A 3PX3A 1JG1A 2A14A 3KQYA 5LQAA 5DXAA 4C04A 1ZQ9A 3GO4A 4RVGA 2UZ4A 5HILA 2AVNA 5DX8A 5K0GA 2OPBA 5HFJA 2N47A 3LL7A 3GIWA 5GIOE 3BXOA 2CWWA 2AOUB 3M6WA 5E8RA 3DULA 3UJAA 3DLCA 2B78A 4QDJA 3Q87B 3BUSA 3O4FA 3TMAA 4LG1A 2DULA 2YR0A 4RTRA 2AOTA 3KQMA 4H0NA 3ER8A 5DRYA 3KPJA 1JSZA 3TQSA 3DP7A 2IDJA 5EMKA 2FK7A 3FPFA 4R8SA 5ERGB 2JHPA 2ZBPA 4OX9Y 3OE4A 4F86A 3SXJA 4KW7A 2XYVA 3FTDA 5CVEA 4KWCA 3OU2A 5F2KA 1ORIA 5EMMA 4AZVA 2XVMA 3AXTA 2YUIA 3HVHA 1ZGJA 2QRVA 5FADA 1R6AA 3GJYA 2IDKA 2UYCA 3HVIA 3E8SA 4OBXA 4YMHA 4GOOD 2BM9A 4ISCA 4QPPA 5EZSA 2GLUA 4R05A 4PYJA 5EHIA 3UJCA 1JQ3A 2VP3A 3LSTA 4X63A 5FQOA 5EOVA 4PWYA 4ATNA 3O31A 1FPQA 2AZTA 1VL5A 5T67A 3GRYA 5LQRA 3CC8A 2NNWB 4ZTBA 3EVCA 2OY0A 3CJRA 4KDCA 5U4XA 4GUAA 3C0KA 4WVLA 5K0EA 3CKKA 4HTFB 2ADMA 1QAOA 2YXEA 1G60A 4PYKA 4XUEA 3R9XB 3V8VA 2EX4A 3MCZA 4RTQA 3EEOA 5DTQA 4YV1A 4IV0A 1ORHA 3ELWA 3NDIA 2P35A 3OZRA 5K09A 3FZGA 4BP3A 4ER3A 1KIAA 5E1MA 3SSOA 1SKMA 4PIPA 2JH9A 2WA1A 2OB2A 3KPWA 1R00A 3EVEA 5FCDA 1X19A 3SGLA 1EQAA 3T7TA 1FBNA 4C07A 1JSXA 4UOEA 1XDUA 3B3FA 3ER9A 3DUWA 1QAMA 3DLIA 5LQKA 2H1RA 4QVKA 3DXXA 4YV2A 1KHHA 3NTVA 3RODA 3TKAA 3FUXA 2R3SA 1EJ0A 5FWDA 3BKXA 3SVZA 2B9EA 1G55A 3BKWA 1QZZA 3LBYA 5DPMA 1NW5A 3X0DA 2Z6UA 2AR0A 3P9CA 1RI1A 5K05A 1YZHA 4EVIA 2AOWA 3GWZA 4QTTB 1QAQA 4CWAA 2VZ9A 1WXWA 5LQNA 3HCAA 2XYQA 2G70A 1SG9A 2I62A 2AN3A 2C7QA 2PKWA 2ZTHA 2G8NA 3HEMA 5CIYA 4AUKA 3LPMA 1X1CA 1SQGA 4RWZA 3T7SA 5DM2A 5EMLA 3A7EA 3G89A 1JTFA 5FULA 3LCUA 1IXKA 3SM3A 3FYCA 2PGXA 2B2CA 3TM5A 2ZIFA 3B7PA 3KHKA 1I9GA 2OZVA 5EKUA 4U7TB 2PSSA 1P1BA 4V0RA 3S68A 4X60A 5LSAA 1TW2A 3JWHA 5GOZA 3EMDA 4IV8A 3R0QA 3LDUA 3EPPA 5ICEA 2QY6A 5CCBA 5T64A 5E8JA 3VC1A 5EC8A 4HRAA 4RV9A 1Y8CA 3SX0A 3QOXA 4KRGA 5E9QA 3OZTA 2WA2A 2EG5A 2JJQA 2UYOA 3G5TA 1NBIA 3HA7A 3ELDA 5DRTA 5E1DA 4AZSA 4E70A 5JR3A 3B3JA 4DA4A 3EVZA 3EVGA 4MTLA 2FRXA 4B17A 3OU6A 1VIDA 2NP7A 3F4KA 4PYMA 1PJZA 2ONZA 4YUZA 4E2WA 5FWAA 10MHA 1RI3A 2OB1A 3FPGA 3JWIA 1R8XA 1BKYA 3PFHA 4HH4A 4E2XA 4X61A 4C06A 3UJ8A 4XUDA 1ZG3A 1WS6A 3NVKI 1FP1D 3NVMB 3SSMA 3IYLW 2H11A 4JXJA 1NW7A 4MQ4A 4IWNA 5HIKA 3FUUA 2VS1A 1VLMA 1I4WA 1KYWA 4K6MA 3RW9A 5CD1A 1PRYA 4PYIA 1YUBA 1G8SA 2XBMA 5G02A 2PXCA 4M38A 3OU7A 1DCTA 3KU1A 3I5UA 5GM1A 5CUQA 3KPUA 3KQPA 5EMJA 5HIIA 4E2YA 5K8VA 1JG3A 5DWQA 2AOTB 1L1EA 3PFGA 1JTEA 4PGHA 2O0LA 5EGSA 3EGVA 5KS2A 5B1SA 1SQFA 2OYRA 2B25A 1FJXA 1JG2A 4EQZA 4RTNA 1HNNA 3B89A 2HV9A 4FS8A 1ZGAA 1MJFA 3CVOA 4BLVA 2ZSUA 5LQCA 8MHTA 5P8WA 3GCZA 1L3IA 3CJQA 3HCDA 1D2GA 2P7IA 3A7DA 2QRVB 3BWBA 2DPMA 3C3PA 2AN5A 1Q0SA 3C6MA 3G8BA 3KQWA 3CCFA 3PVCA 3G2PA 3AXSA 2R6ZA 1RJEA 4QTUB 2IPXA 2ZBQA 5K0LA 3IV6A 4KVZA 4AZTA 4EKGA 2QE6A 3HVKA 2I9KA 2PT9A 2Y1XA 5MHTA 4CTKA 3BGDA 5E9WA 4YMGA 5C0OE 4DCGA 3P9KA 2BH2A 1VE3A 3BWYA 2GAFA 5GIPE 2H00A 2ZULA 3I53A 1UFKA 4QQNA 3O7WA 5D1HA 4PGGA 5EG5A 1NV9A 4V0QA 4RTPA 3I58A 1V39A 2I7CA 3V97A 2AVDA 1XJ5A 2CKDA 4L7VA 4DKJA 3ORHA 1M6EX 1VP3A 2ZZKA 3OE5A 3M4XA 5DT2A 4QQKA 3NJRA 3MQ2A 4M36A 3UJBA 5HIJA 4E32A 5LQJA 3WSTA 3HTXA 4GBED 4R8RA 5FA5A 2P3OA 4CKEA 2YXLA 3FTEA 3BWCA 3C6KA 3DR5A 4QVGA 3EGIA 5HIMA 3AY0A 1M0EA 2AS0A 5KVAA 3A26A 2HWKA 3PLAE 2NXNA 2V74B 3KPYA 2NXJA 3P8ZA 3QOWA 4FR0A 2IH4A 1EIZA 1KPIA 2YVLA 3GXOA 1R18A 4LWOA 3AJDA 1VPTA 5E2BA 2ZW9A 3G88A 4AZWA 2PX8A 2Z6QA 4R6WA 2PWPA 4IKPA 1QANA 4GC9A 3CBGA 2HMYB 3CGGA 2FHPA 1F38A 1DL5A 1YF3A 1SUIA 4X41A 2P7HA 1AF7A 3UBTA 3P2KA 5ICFA 4C4AA 3MERA 5LQUA 2FYTA 3LCVB 4QDKA 2F8LA 3KQVA 5EPEA 2ZIGA 4P7GA 5HZMA 1Q0TA 1YFLA 2HR1A 3LKDA 3OFJA 2IP2A 5DM4A 3MHTA 1JQDA 3BT7A 1AV6A 5K0BA 4E31A 1RJDA 1WZNA 4C05A 3NW9A 3KKZA 1IY9A 2ESRA 4G56A 4BLWA 2IBTA 2YTZA 3VC2A 2B3TA 2OKCA 2V7EA 5EIWA 4YV0A 4PIMA 3HM2A 3G2QA 1L9KA 1XTPA 3G7UA 1KXZA 1NW6A 2QM3A 3THSA 3H2BA 1JQEA 4PCLA 3D2LA 5KYGA 3DMFA 3VSEA 3CJTA 4XUCA 2G1PA 2AOXA 2UYQA 2PLWA 3FPJA 1SUSA 1G8AA 2UYHA 4RX1A 1AQIA
chains in the Genus database with same CATH superfamily
4YK7A 4W9MC 4C4OA 1EUYA 3FSRA 3IKVA 1E3JA 4D0GA 4KUHA 3FPHA 4TV8A 4N5NA 1G6Q1 1QYVA 1KYTA 4QD3A 4HFRA 4EGQA 5CTAA 3SASA 2VXCA 3BCUA 4MHOA 3NHRA 1W1IA 2FSSA 4WN3A 1TF2A 4AIIA 2HX1A 4QYXA 1H6UA 3TO5A 1OXBB 3O8CA 2AE1A 3QFHA 5DBOA 4BNXA 3IUBA 4ZFNA 2H2DA 1OLSA 4CV3A 3Q7TA 2WJHA 2J3LA 3SIXA 3CR7A 1DDOA 2FKAA 4GG1A 3R4CA 4F8EA 1YI1A 3E3AA 4GSYA 2IQ5A 4DEXA 5A5EA 5ERYA 3GAAA 1Z7WA 3ICQB 3ZDXB 1JEYB 3PQ8A 2R2AA 1Q74A 1E3WB 2BGMA 3KYBA 4RF4A 4KFCA 1QQBA 3K0AB 2P6NA 5KWEA 4U7DA 1I4TD 4FQ5A 4ZVTA 2XPCA 5KPDA 1CIVA 4JU9A 1I8TA 2QAJA 3BS4A 5THQA 4PCUA 5I9LA 3BSSA 4JUDX 4NOLA 1QM5A 2GEKA 3L93A 5J5CA 7MHTA 2OENG 4JGBA 1WUTA 2QTNA 1AX9A 1E1DA 2ZFUA 4L9AA 3I1JA 3GFQA 1XKXA 3AEKB 2C7VA 5K3CA 3IJEB 2JIMA 4FIZA 2ZQ5A 2QDXA 2NO4A 2ZS8A 4QPNA 3HC7A 3GLKA 2QCUA 4B7XA 2OOKA 5A6VA 3E7PA 1GPH1 2VT6A 4TSKA 2AFRA 4EL5A 1FRFS 2AUTA 5KSYA 3HCPA 1LXCA 1XEXB 5JNUA 1DG3A 2NUAA 3GO4A 4S1TA 3I8OA 3OUUA 2YW2A 1BS1A 5G1OA 2O0HA 3FPFA 3LYAA 1DGFA 3LL4A 3REGA 3UV7A 1CUHA 3PKJA 3RSHA 5JC1A 4PSCA 2DC1A 1YB1A 4AJ2A 1UC5B 1HE5A 1BCRB 3N2NA 3ZHCA 3CLTD 3DBRB 4UVIA 2FE1A 4PQEA 2ZJ8A 5FCDA 4UDXX 3F90A 4QHTA 4EJSC 4QVKA 2GPTA 2OLKA 3CUTA 4KN9S 1DWPA 3NTVA 4WOJA 2R68A 4AD8A 4ITRC 4WFKA 2VT2A 4GD3Q 3U0VA 4EELA 3TVYA 5B4UA 4JQZA 3JQAB 4NH4A 3OSZA 2PKWA 1HFKA 1ZUNA 4B7FA 3IAFA 2UKDA 2F1IA 3GN2A 4FYMA 3JWHA 3JW8A 2QY6A 5DK6A 1OBFO 2QG4A 1CW2B 2VPYA 4ZI3A 4ZZ1A 4ZRMA 2CDAA 4I3GA 4D5GA 3SJCA 4FMDF 2CB9A 2AZMA 3QKRB 1UC9A 2QAGB 2KZSA 4URVR 5T41A 3AF2A 4HFJA 4HY3A 2R66A 1S0UA 1T6OA 1R6DA 3BVPA 2VQEB 1E3IA 2AD1A 4C5BA 2VK8A 2ZYUX 3G2PA 2AR7A 1FQKA 2GFHA 2YYSA 3WHLA 2RGCA 4DV1M 2EJCA 1FNNA 1K7EB 3BWVA 3FRJA 1X8JA 3B6KA 1QJ4A 3O7MA 3CLUD 3MTAA 1VRWA 2ZRAA 1XYVA 2JJ2A 3C87A 1G7SA 2JIDA 4Y1EA 3EEFA 4D4GA 3AJ9A 2W6ZA 4ZMBA 4PZAA 4FBMA 4UFNA 3GPYA 1WMFA 2H3EA 2X6TA 1U7UA 3S0JA 3NU1A 3CVUA 1NW6A 1F2TA 5CA0B 1ZEMA 5G4KB 2A78A 1GRNA 4CN8A 3TX6A 2HMVA 3PXXA 1I1QB 5HVNA 2CN1A 3HQ4O 4O2AA 1DS6A 2VP2A 1X8KA 4HAYA 3NRCA 4B3JA 1K7XB 4R7TA 5TRTA 4IJEA 3K35A 3DOHA 1CFZA 4H17A 1EK1A 3QXJA 1WF6A 2JD1A 1X7ZB 1PVOA 3KKLA 4DY4A 1BDBA 3F46A 4B0PA 2NG1A 1GA1A 1XAGA 1HZJA 4OG2A 3OWHA 1PDOA 2C54A 2Z1MA 2CMHA 1QR6A 4X62M 1Q7TA 4M9RA 3M4NA 1S3IA 2XYHA 2XR1A 3JRNA 2P69A 1YD7A 4K9LA 2Z1NA 5DHQA 4AUEA 2GA9A 1CS0A 1U63A 2X86A 2PJDA 1P77A 2QTMA 1R0BA 4TQAA 4CNQA 4F3CA 4P4SB 4JQSA 1AK9A 4FGUA 1ZCAA 2CNKA 4NYIQ 2I2DA 3I9V1 2HNKA 1NHWC 3NV9A 1KP2A 2VF8A 1NYTA 1UBNA 5TVGA 1ML4A 2GJAA 1WBBA 4C2AA 3D1VA 4EA9A 2OFFA 1LLCA 1FFEA 3RRNA 3FIJA 3AGQA 2LDBA 3I9JA 4ALMA 3P9IA 1E1CA 1R2ZA 1Z6YA 3Q9LA 3VNAA 2VP4A 1V43A 3CRVA 3RYIA 3RSQA 4R0NA 4HR7A 4FEEA 1OLXA 4FN5A 1KMHA 3UJNA 5D84A 3C7CB 2RMKA 4OCZA 4ZVNA 4HYEA 4F4JA 3P9NA 5JT1A 1JIUA 5AM0A 5ITVA 3UY4A 2B1IA 1ESZA 4C04A 2J7PD 4IGFA 1BA3A 2GPBA 1H0SA 5AQEA 5JTTA 1V9SA 4YASA 5B57C 2FK7A 3LX4A 5MFZA 2ACEA 3SXJA 1PDVA 2FMKA 1KH2A 5CYPA 4JEIA 5TSDA 3AF0A 1TAQA 4OBXA 1N7HA 4FFVA 1YNSA 2CVPA 3K20A 3NRJA 3IGFA 1F4PA 2VT3A 1ZH4A 4J7UA 4N01A 4ENQA 2YXEA 1CF4A 1W36C 3P32A 3KG2A 1JE1A 4V39A 3QBVA 3CCCA 3FZYA 3T1QA 4RPKA 3B36A 2QWXA 5ALQA 3FUXA 3T52A 1FPMA 4KXLA 4LFAB 3GWZA 4GAEA 1D0VA 4F1IA 4ZVKA 3PGLA 4X65M 4ZEVA 2YV1A 5JW6A 5K3FB 2K2QB 1Z0IA 2Q4RA 2BFEB 3H05A 4C7MA 2PYDA 4YRGA 1QHHB 1WV1A 2J3MA 3ZVNA 4EG3A 3ELBA 2ZROA 4R2KA 2LIPA 4U4AA 2YZ2A 5M7EA 2RSLA 1W46A 1QUTA 3BBLA 1H1LA 3I92A 1Z4OA 5K4GA 2OQIA 3A28A 2QQ5A 3VH4A 4N7BA 2V7GA 1ZOLA 4OVZB 4BVAA 4DR7M 4HUTA 2FUG1 4RDIA 3I9MA 2B5VA 4ZV9A 1E98A 5C1BA 5A5FA 3AHHA 4N5MA 2QRNA 3WMRA 4CPDA 1NP6A 1XX6A 3IPRA 4HDMA 3ETHA 4I36A 2FWIA 2A1UA 4BNLA 3ZGXA 3F4BA 4Q3BA 5LQJA 4JGIA 1GRVA 3GZNA 1BDMA 2BTQA 2EFDB 1WXDA 1XN1A 3KYDB 1WCXA 4DDUA 4I5DA 5KVQA 1XMIA 3OJOA 1YF3A 2H9IA 1ECBA 2VHZA 3DGEC 1XCPA 4P3YA 1QHSA 4AZ0B 5EPEA 1STOA 1E2HA 1JQDA 4C2BA 5F7XA 2HTFA 3KJIA 1QCDA 3I0MA 3ZH9B 3WIBA 3CJTA 1DJMA 4KQ9A 4BL5A 1QQ7A 3S2EA 2IDZA 2B1QA 1RYNA 3LX5A 3H7IA 1KFCB 1RADA 1SK9A 2WMOB 1IBLB 3SATA 2FNAA 3T95A 1JIVA 1USIA 3W90A 2EYUA 4M1TA 1Z7YA 3C3MA 5GMOA 1VG1A 1VLZA 1GYRA 3EE6A 3W5BA 3E9MA 4L95C 3UIEA 1CV2A 3N2YA 2KJQA 4OXNA 1R9MA 5LQDA 2ZRFA 3FPEA 4MR8A 1HE1C 4M1OA 4OXKA 5BV8A 4ACBA 5KQRA 5G4LA 2CD7A 1ESEA 1HT3A 3E3NA 3F5MA 2KW5A 3SNKA 3VZCA 5AVUA 3N39C 4X7PA 2C07A 4D56A 1IUPA 2PYZA 1K8RA 4GHWA 5B7PA 1QVVA 2OC9A 3M3DA 1Y4AE 5CW1A 2XGJA 2IH5A 1VL0A 2CMKA 1SOVA 1V6SA 4HGZA 3OA2A 1U9IC 4D0LB 4MKIA 4YJ3B 3ZDBA 4QREA 4ID9A 1K1EA 2XECA 4ZYLA 2NVBA 3ZY6A 2IUSA 2GN0A 5J59A 5I4BA 2JBHA 5AUNB 4BVLA 5GONB 2IXGA 4BFUA 4YAGA 4YROA 4F45A 4KSYA 3I3OA 1BXRB 1B2RA 1RLUA 4AP6A 3U17A 5DI3B 4CT4B 2I80A 5LB2A 5GVSA 3VNBA 5EWJA 3QW4B 4RZ2A 5CRIA 4UHCA 2OGSA 4F60A 4ZEWA 4GMHA 1AGRA 1RKBA 2JFFA 1L5KA 1BWQA 4AUNA 1JVSA 4JEHA 4MQEA 5DLYA 2C2GA 3KAKA 4BATA 1DX9A 1P39A 1Z25A 2RCNA 3WGVA 2P2YA 3H1TA 2QVYX 3VPCA 3SJBA 1DC7A 4I1IA 4JC4A 4TROA 3RFVA 3FTDA 5B1DA 4DR4B 4JOSA 1X38A 4RBNA 3ANSA 4RJJA 1IY0A 5C3UA 5IJ0A 2LXNA 4DE5A 2JKZA 2OE2A 4R5HA 3OJFA 3STVA 1YQGA 1FS4A 3V8VA 3VOTA 4L3WA 3UANA 4G1CA 4YJ3F 2UVPA 2ZREA 5FWYA 5J1SB 2Y0BA 4ZAFA 3D6JA 2HIMA 2YHIA 2NVUA 3WB1A 4UVDA 3DMTA 5GONF 3I2KA 4XJTA 4JP3A 2HSWA 1VXRA 2ODTX 2IPAB 4OV6B 2Q5EA 1SUPA 2GHRA 3ROGA 4NS4A 2NWQA 3U7HB 1QH0A 3GJ5A 1KS2A 1TMKA 3VJMA 2V6GA 1P2BA 4WGGA 1YBAA 3DKIA 4J90A 1MRSA 4MLCA 2IP1A 3FZNA 3VVLA 4WFJA 4Z9BA 1A72A 4GPTA 4IFBA 3SQNA 1KYWA 4N5LA 1Y89A 1QVRA 3NNSA 1JFSA 3AR7A 1JTEA 1F9EA 1L1QA 4PQGA 5TJ9A 1KJQA 5KQGA 2P5SA 1CQJA 3E27A 3G8BA 3B7ZA 1Z73A 4IRMA 5EJFA 4X0EA 2ECOA 1JB1A 3O8OB 5HFNA 5LNK1 2H00A 1H2ZA 1ZM2A 5J2TA 1G7RA 2OGTA 3I52A 2B8EA 4D79A 1ILEA 4BEJA 5KJFA 5IAAA 2DOKA 4A2WA 2V1XA 4YC7A 5L53A 4H4CA 2NXJA 3C5HA 3PHHA 2F3UA 5CFNA 2AHMA 2QOEA 4IM7A 2O7NA 4YRPA 3O3MB 4OYLA 3EQ2A 1UFVA 3CT4A 1TC1A 2IEDA 2G9RA 3NYQA 3B1ZA 3EIWA 4ZOCA 2AFIE 2ZITA 4TTQA 4C6RA 3Q0IA 5KJCA 1U65A 4RZXA 3L2AA 2XNKA 2NTVA 2ZDHA 2PZKA 4OHFA 1M72A 5L3QA 3H1PA 3LH5A 4EM6A 1AQNA 2F9LA 2OM2A 3CF4A 3VDPA 1LDYA 5FOSA 4HDQB 3AFIA 3S8YA 2BWEA 2JH8A 3LQ1A 4GZLA 1VE5A 1C41A 1IAQA 4NJOA 1GU0A 1WBDA 4WGFA 3DAFA 1RWWA 3EIUA 1I1HA 3E2PA 4A8JC 4INZA 2IUEA 1GDHA 4PGAA 1T2NA 3HDJA 1DXOA 3HY6A 3KKNA 3Q3CA 5KCZA 1V9CA 3U6PA 4LDQA 1JR4A 3C7AA 1T35A 3QA3E 5JBNA 4JEUA 3MAGA 5FV4A 1QYCA 4W82A 3U5ZA 5CGZA 2RGEA 1IM8A 5F1PA 1RC0A 4NE2A 4G0WA 4BBZA 3R6GA 4R1LA 2IGTA 3VPFA 2PX4A 4Q1DA 4RYDA 1TVMA 3WMXA 5DTMA 1QBKC 3U6QA 3W78A 4ZZ3A 1YFJA 1FL9A 5L7TA 3UKDA 3FG9A 1M6HA 5DX0A 4LJLA 3ZNPA 1B1CA 4IX9A 4F3TA 3KQQA 3C3XA 1Z5NA 4YY3B 4X24A 4J0QA 4DARA 1U7OA 4Z99A 3NBZC 4EHHA 4B3DA 2Z9CA 5IAGA 1KL7A 3IQEA 1UP4A 4LE2A 1GPWB 4FD3A 3U4CA 2QNJA 3GJ7A 2CHUA 1M8KA 3OCYA 1FDSA 4OHOA 1UT6A 1Y1PA 5KNBD 4P2GA 2Q4BA 2FPGB 4DABA 1GDTA 5FX2A 2GEJA 1RLMA 1JG1A 2O2XA 4OSPA 3NLLA 1Y3AA 3FDJA 4A2CA 2DULA 4TGLA 3L27A 5G2OA 1GKLA 4KUGA 4CM9A 2FMXA 3MWJA 4BV8A 1CZUA 1S8NA 3HVHA 3NFYA 1Z26A 2QRVA 4DGQA 5GAJA 5B1HA 4RIGA 2I4TA 1QFSA 3DVLA 2HDNB 3A1FA 3QI7A 3HGMA 3VK7A 5DTQA 4FFBB 1X19A 4CQLB 2WHYA 3NKLA 2JI7A 2WIFA 1RCFA 2OHFA 2O2EA 3A3NA 2RK4A 3AKZA 1SR8A 1JIKA 2JRCA 3K8OE 3L82B 1CQWA 5JPCA 1JJAA 4G0MA 2BFDB 1VL8A 4IX1A 2VVTA 3CEAA 2VOJA 2VYNA 3LUFA 4C9BA 3KJZA 1IXSB 5F2EA 1SZJG 4M6WA 2ATIA 4ETMA 2MCFA 1GLGA 3SAUA 1JKFA 3NBKA 1EU1A 3DDCA 1UCFA 4LS3A 1XNQB 3FF4A 4M83A 1W8DA 5HQJA 4YYZA 5BNZA 1ZL0A 3NVKI 1CFJA 1DEKA 2YC4C 3QTBA 3OQMA 1W49A 2DJ5A 5IRCD 5JCJD 4RPJA 3PICA 3RVOA 2B36A 3ENVA 4A0RA 1V3VA 1TVKA 3Q6NA 3LO8A 3LUDA 3CMMA 4NYIR 3V4LA 2Y2UA 4P3OA 3W8DA 5AYVA 4KVZA 5KQ8A 3QBJA 1HNXM 2XGSA 3EPHA 3MWEA 1LA2A 4R41A 1QZUA 5CW2A 5FOTA 4BNDB 2J09A 3D0KA 2C97A 1M7BA 1QORA 4BVJA 1A8UA 2FW7A 4NENA 5H1YA 1L5SA 2E4YA 2RHRA 1U94A 3CM0A 2W82A 2Z2YA 2YJ3A 2DR3A 3HBAA 3OOSA 4OHBA 1H5NA 1NQVA 1IB6A 1RJDA 1MKYA 1T9AA 4E31A 4IPTA 2DFVA 3QXSA 3QIVA 2JLSA 2H9YA 1KKLA 3FPJA 4TWZA 3E7DA 4HXYA 3MCAA 2YHSA 6REQB 5ALMA 2HGSA 3UWPA 1IQ0A 3HXPA 3KQNA 3RYHA 4N3GA 1L4LA 2OO3A 1QZMA 3EOAI 4PX5A 4UE6A 4LF6B 3ZK7A 4NY1A 4EW2A 5H16A 1CT9A 4C7OA 3IVGA 1CUSA 4Y9UA 1RHMA 4R54A 4P81A 2YMLA 4IDGA 1T9GR 4XM0A 3DBVO 2GZAA 2M60A 1C7IA 5LLTA 1E0DA 4QZVA 4LC9A 4PO3X 4XQ0A 3JQBA 1E6KA 3RNOA 3IC5A 4P58A 5FYQA 2FF7A 4WLVA 1NW4A 2WYIA 2CF6A 3DPIA 4GOKA 4CW7A 2OO9A 4M8KA 5K0FA 4OLFA 1ZAYA 5BXYA 1PYOA 2EJTA 1A27A 1KBZA 3H11A 2OEPA 4OP1A 4TYWA 3K0EA 4UM8B 4U63A 5HCNA 4DV0B 1ZMVA 1JT2A 5IARA 2R79A 3GEDA 1CCWA 1P1IA 2UXBB 2DH6A 1LTMA 2P2GA 4OB7A 5KPZA 4NU8X 5KTYA 3JASA 1QIJA 3ZX5A 4Q34A 4KK3A 3FTPA 1L4HA 1Z4QA 3OHMA 4I6EA 3HLKA 5KYUA 2Q1YA 2F9MA 4B7ZA 4FHDA 1G21A 5DYGA 5MFPA 2RHJA 4S04A 3M1YA 5TEWA 1S9HA 3R7DA 1PG5A 1L3CA 3IEKA 1F48A 1J2TA 1FRQA 2VK4A 3VPDA 1N5JA 3EQ6A 4MB2A 1RACA 2DMRA 5CD9A 1UOQA 4PZPA 2MIIA 2VBCA 1H2BA 2KDLA 3KXLA 5H4HA 4R7GA 1GJTA 3DE6X 2GMWA 3HDTA 3ANLA 3WGOA 4BVGA 3X2FA 2YY7A 1C30B 3RBZA 2GCEA 3ZCUA 1DFHA 1MOPA 3A46A 3ZLUA 4IILA 1CF9A 5DIFA 2IODA 3HUDA 3DP7A 3TSZA 1ORIA 1TTHA 4K9KA 2HA5A 1U8UA 1CR4A 5ALPA 1SQSA 4L15A 3IB3A 2ZUTA 3B38A 4X63A 2WTNA 2H4JA 1R12A 3GPPA 3GFTA 1DAOA 2NNWB 3ND8A 4HWSA 1IBCA 5FV7A 1BH6A 3PEFA 8OHMA 1BIFA 5I7WA 1MRNA 1EA7A 3LWDA 4DBGB 1BNCA 1DJPA 5FNZA 3ER9A 3I5YA 4KWIA 2PPLA 2BHSA 1NTRA 2BTOA 2RC5A 3HCAA 4NEHB 3LQ2A 1UWKA 3VA7A 3L5OA 2F1RA 4QG7A 4ALIA 5CDTA 4YONB 3EY9A 1ZINA 1DG9A 3MD0A 1NVMB 1TMOA 3AT1A 3RFWA 3IUSA 1S01A 1U5CA 2P9HA 3WGMA 4KQCA 4PG8A 2C3PA 1NJ8A 4WMLA 4CG3A 4YJHB 1P1RA 3N8KA 2OCBA 1I4WA 2I4OA 2WBLC 2HT1A 2JDID 5C5CA 4G5OA 3K94A 1C50A 3NORA 1RRVA 3QYFA 3BULA 3I3SR 3C6MA 1PHPA 1WW8A 5JVDA 1WEHA 4F5YA 3FVVA 4OM7A 3DL2A 4B71A 3BTSA 4OJYA 5HE9A 3WIUA 3VAYA 2OTCA 5JS6A 1RTKA 5DHTA 2PXHA 1SVKA 2W4IA 4R81A 3CBQA 4UASA 4NU5A 4REQA 3BERA 1EKXA 2VHXA 4X6XA 2B6HA 2OZLB 3DL0A 5ITRA 2HY7A 3DNMA 2VLBA 4CF5A 1U02A 3AFOA 2ZRGA 1TU4A 5K8CA 5CJJA 5BW8A 3DD5A 4KPUA 4WNAA 3NUGA 3QGMA 2P6RA 4GKKB 4TKUB 3TVDA 3OE7A 1QMGA 2VAXA 3T5PA 1GPBA 3KLNA 1N34B 3TXXA 3PJGA 5KNLA 2I91A 5K8LA 2BP7B 1OIZA 1CUGA 4IBFA 4FFOA 4GC5A 2GCGA 4O2BB 2J41A 1Z0JA 5AUPB 3RNLA 1ETUA 4Y2YA 5JXGA 1ENOA 1JLLA 1T6ZA 4IBJA 3MHPA 4FNOA 4JUIA 3WIOA 4DUZM 3FAKA 2FWPA 3HXMA 5IZ7D 4PNHA 3BZUA 2VRWA 4HLUC 2YRXA 3SLKA 1JZTA 4KFTA 3BBZA 3WGUA 2WV7A 4YRMA 4UZFA 3LGAA 1QYXA 1EJBA 4CQMA 3VYTB 3QM1A 3T9EA 1U2TA 2DHYA 3ESQA 3B5IA 3KZKA 3HMQA 1E2GA 4XAQA 3A2MA 1BC5A 4YAJA 2AOVA 1ND5A 4CMCA 1KHTA 5BYBA 2C5BA 4S1OA 3SR4A 1BX0A 1P44A 2WILA 1ZCFA 3SPXA 1N2SA 5AJTA 4IVPA 1GQQA 2FSVA 4DSUA 1QQTA 5E3HA 4US0R 3DFIA 1J6UA 4MDFA 3IUEA 2XMZA 4QXPA 1FYFA 5E95A 3CWQA 1XMXA 3RHFA 5EJAA 5JQGA 4M55A 4O2BF 3ONDA 3BIFA 2IBMA 4CM7A 1TQ6A 2VHVA 1NQXA 4L6CA 1CIJA 2G4VA 3ER8A 2MTBA 4F93B 3FR8A 1UMCA 2IF0A 3STYA 5ED0A 1JJ7A 4D4JA 4MGZR 3TW8B 3O31A 4IXNA 1E89A 3HB4X 4OLJA 3ZDAA 3OD5A 4YV1A 1WKCA 2NO6A 3CF4G 5IANA 4JC8A 2FZ4A 1QDRA 5AHOA 2WDZA 3AF3A 1E1KA 1GSIA 4CR7A 1KFJB 3LBYA 4E4TA 4KPGA 2XNDA 1QRSA 3NVDA 5DGDA 1SO8A 3C2QA 4XYGA 3OMLA 1JWLA 5DYNA 4OU7A 1B2LA 5DI9A 4ZGBA 4MS3A 3M2PA 2FPXA 3BMCB 3X43A 2HK9A 4MMZB 5HKLA 5FOVA 2QYSA 4LE1A 4MPJA 2CSXA 4HZIA 3PPVA 1TDZA 1G8SA 4A36A 1ZNXA 2OQVA 3ZN2A 2NZ2A 1F7UA 5B3LA 2X8WA 1VLLA 1JB9A 1ZMRA 4KXMA 3DKVA 1PYGA 1QG2A 1U9JA 2QPTA 1Z6TA 1T15A 1WW3A 2ZBQA 1R37A 3GK3A 1VE3A 4AICA 2ORYA 3ILXA 4ENRA 4Y9RA 1OF1A 3HTXA 1HG0A 1Q84A 1L5QA 3AEUA 1E69A 3A26A 2D2VA 1BN7A 1N77A 1E3QA 3HRKA 4KNYA 3T3EA 1N36M 1QFXA 3HXLA 3AERB 1MNAA 4F2GA 2BMWA 1F2UB 2X8LA 1HLGA 3SX2A 2E4ZA 2HBQA 2EFHB 4XASA 3FE3A 1Z6XA 2ENWA 4PLYA 1TB4A 4YV7A 5G40A 4GP9A 3KQTA 1U2ZA 3KVOA 1QRAA 3ESYA 4DMKA 3UA3A 3GVIA 5AOBA 1OX6A 2WD9A 2PGIA 3HP1A 2GF9A 1DP4A 2P91A 4GMXA 3LKZA 4OK3A 5C8YF 4UEQA 3RBVA 3VC3A 4ZYUA 4CIXA 4GT1A 1G20B 3HWWA 3TEMA 1C1YA 5BQ5A 2RHBA 3C6ZA 2F3TA 1KJYA 2RHWA 3E9QA 1TPZA 1O4VA 5JSFA 3H6HA 2AC2A 1QWOA 3K30A 2QORA 4DR1M 4YAEA 2ZXEA 2GAIA 3EZLA 1K8ZB 2AI1A 3QHQA 1VDMA 2PXXA 5C4IA 4D9KA 3NIFB 4TV9A 1NY6A 2PD3A 1E2QA 2IWHA 2PG3A 4EIWA 1RKVA 3RVKA 3TPFA 3AF6A 1YXMA 4LOAA 1T3TA 4YP9A 4GOJA 1J56A 1RRFA 2CRUA 3EGDB 3H17A 4Z6YA 3ROKA 4MCJA 3DXYA 5I5EA 1YDHA 3N8HA 4M1ZA 2P27A 2PANA 4YTEA 2SBTA 2I2CA 4IUYA 5AKHA 2P8JA 2Q6OA 1X7GA 3TWLA 2BEUB 5AI8A 4N9WA 4KQWA 1YVEI 1K3UB 4MGHA 2B8NA 4F72A 4E30A 2QT9A 5JSUA 1PGPA 3EPRA 4YUYA 1OI3A 4GM4A 3RLIA 3BGWA 1C0PA 5J5AA 3AB7A 2HBZA 5DN6D 1D9ZA 5IKEA 1WNTA 4RVGA 1C0IA 3ADPA 3M7IA 1U0JA 4PAMA 3M4ZA 4FDAA 3OJCA 3WGYA 4BO0A 3OQOA 5A4IS 4PX9A 5DGHA 3T12A 1T0UA 2II6A 1XZAA 1J7KA 1H93A 4EDHA 4RSMA 4KFRA 3TTSA 4FXOA 2RAFA 3QUSA 4XVUA 2VWPA 5FRDA 4ZALA 3EOBI 4EEKA 4K2AA 4S24A 3HWX1 4HVAA 4LOJA 2Y20A 3EEQA 3FZGA 1WSWA 5E1MA 4WE3A 2BFCB 2TYSB 1AN9A 3KUUA 1Z4KA 4P08A 3BM5A 1JUDA 4P54A 4EY8A 4YRRA 4G1BA 3WQBA 2C04A 3IHKA 4J1SA 1P2DA 2J3KA 4Z6KA 5EJ9A 4WERA 3VNSA 1YCFA 3K0CC 1TZKA 3ZBPA 3IG8A 3GEMA 4MP8A 1LBEA 1GCUA 2Z04A 3O95A 4AZSA 1HURA 4F04A 1TZ2A 5BSWA 4UBKA 3J81k 4HGRA 3GFBA 5EIXA 3BXEA 2DQYA 7MDHA 3H65A 4XIGS 3GRFA 5A4FS 1E3LA 1LSOA 4Q01A 2I3DA 4GO1A 3K31A 1GILA 4XVCA 1AGPA 2VJMA 1T9ZA 1SC6A 3AETB 4LRUA 1E1LA 4R1NA 4OFWA 2FWBA 2RGXA 3W9YA 3LX8A 3TVTA 4NRWA 1MN3A 2V6FA 1RPTA 1G18A 3WX0A 4MWGA 2WSMA 3TLGA 1NRJB 2MJLA 4LVCA 3RTCA 4LVOA 5GIPE 4NSOB 4ZQFA 4DUYB 3I58A 3WVNA 3I83A 5K3SA 1A8SA 4JYMA 2FPPA 3GUZA 5HIMA 3ND6A 4Y28F 2Z43A 4BWVA 4ND8B 2OXEA 1V16B 3R5HA 1SC1A 4ON9A 4XSVA 4GC9A 5D3ZA 2XB4A 1M2WA 1AD2A 4XFDA 3WKCA 4X90A 1YASA 5A7FA 5I4KA 2KZUA 2CZCA 1U2GC 1IN4A 4O0MA 3D6VA 1WHTA 4YREA 4C05A 2I3GA 5HM8A 1LVHA 3K4HA 4DTIA 3EIHA 3DCNA 3BIXA 2SNIE 4DVJA 3HZRA 4B35A 3DS8A 2UV8A 2O6HA 2P3QA 2XUQA 4ER5A 4Y30A 1X39A 4YP1A 2F43B 4FE4A 5IMBA 2QW0X 1DAIA 2AEJA 4H7JA 1OZ0A 3K7EA 1EFUA 2XEPA 3QY0A 4NH0A 1APBA 3K8ZA 3MTDA 2AEFA 1FCJA 2PX0A 3LG2A 2IIBA 4UUNA 1THZA 3C39A 3U4MA 1WNFA 2HA7A 2VNIA 2J0EA 1SZCA 3CO0S 1CRPA 2DAEA 4IQ4A 1V8FA 4MR7B 1FVHA 1WVGA 1JR3D 2I2FA 3FTQA 3AB8A 5T8KA 2AFIA 1C9JA 4JBYA 1ELOA 3CF2A 4G97A 1SY7A 4OYHA 4D4HA 1Z2NX 3QP9A 3AWIA 2LZ0A 3R5XA 3ZCQA 3BH0A 4YAFA 5I7VA 4LE0A 3UMFA 3IAXA 5AK5A 2OECA 4O4IB 1HQCA 1ONPA 2C4WA 2Q1TA 2GPAA 3RRZA 5JU6A 4LHVA 1HUQA 1O08A 4GNRA 3O8RA 1ZC4A 5A1JA 1TECE 4A2PA 4PAWA 1ISSA 4WCFC 3CIOA 1LKZA 4X1IA 3H9BA 2OP1A 4D5EA 3DAYA 4OMFG 2KBFA 4WEOA 1ZR2A 3ESRA 1K8XB 1ZOSA 1OPXA 1Z5OA 2NT4A 4N3BA 1Z37A 2C3MA 4LECA 1NSYA 3AG5A 3BL5A 4HUJA 4CIYA 4D25A 3RKUA 3KPVA 2XDQA 2OXFA 1E9AA 2BHNA 3N53A 1Y7PA 3PQEA 3UJAA 3LT4A 2Y0TA 3ZBQA 4NDNE 1XNGA 1DCFA 3R4VA 3ZWMA 1BMDA 3FOZA 4QPZA 4QGGA 3TTXA 1VMIA 5J4VA 4CL0A 2QRUA 3BH7A 2WVAA 3F92A 2XFTA 1R0RE 2YHAA 4KIUA 2V0CA 4ZOEA 1WB9A 3PP8A 2EZ9A 2XI4A 5BQOA 5PGMA 3D6MA 1UBGA 5CK4A 4C07A 1JQKA 4XBOA 4O4IF 1IVYA 2IOQA 1QP7A 3AHCA 4Q9HA 2QUAA 4QGFA 1H8EA 2Y76A 4DWOA 4K7JA 3DFFA 1WJ7A 1ZZGA 4PC2A 2Z2ZA 3LPLA 1LF5A 5LU9A 4U7TB 4EG8A 3LU1A 2I76A 5FPYA 5F9FA 3H4VA 5IEBA 4MDHA 1HEIA 3I32A 5FD8A 4FW8A 4B17A 3D3EA 2ZRMA 1JPJA 2VAMA 3KQLA 4J7XA 1JQ5A 2ZATA 1RRGA 5GY7A 1NVXQ 4EPVA 3AYZB 1UM8A 1WVIA 3CB2A 3GUYA 1NURA 1ZP6A 1S2LA 3IOMA 2J59A 2UXCM 3EWAA 2WM9B 4YQEA 3KP1A 3C8DA 1L3IA 2QE7D 1GSHA 2PZGA 1DGQA 4X6YA 4GHAA 4ND7A 2JZ0A 2X9VA 5EG5A 2OCIA 1L7PA 1JU3A 2PJRA 1CDDA 1DQZA 3BH6A 1Z9BA 2PGAA 1EIZA 4WASA 2BMAA 2QYTA 3NP9A 3CN7A 3VNUA 3CBGA 4ESEA 3ONFA 4IDCA 5LMCA 3I30X 2JFOA 4KMMA 5JAHA 2ODEA 2FZLA 1ZOPA 3G1UA 2ZRDA 2NO1A 1UT5A 3U60A 4GM0A 4ZGGA 4B6FA 4W6QA 2IYXA 4LKOA 3S81A 1FVXA 4XR4A 5IBPA 3K0FB 1LDMA 4U7JA 4P4TA 5HQ3B 5CA0F 3Q3IA 1N7IA 1W6RA 4O02B 4HG2A 3NALA 3GLQA 2QVLA 1T9DA 5DLDA 4BDSA 2WF5A 2PMDA 4CKCA 3A1VA 1NC1A 4OLAA 1UXJA 2PBZA 2Z2XA 5CVJA 2XA2A 5EPOA 3V1TC 1F5NA 3K2IA 5CEEA 5EWMA 2A5FA 1QQWA 3FH0A 3R0IA 1EFPB 4JLVA 1H2XA 4KYIB 1Q7RA 3OO0A 4H7EA 4J1TA 4E6PA 3I9KA 1DRVA 1SA0B 1PVDA 4JXZA 4KRFA 1RIIA 2AB0A 4YDHB 4YBZA 2JRLA 3T7JA 1W0KD 1I7SB 2KE5A 1N2CE 3LVQE 4RE6A 2GJSA 3LY8A 2WT8A 3ZHXA 4KAFA 3PC8C 1SHKA 4CMIB 3KL2A 4OQXA 1JV2B 2POCA 1GTG1 3PNQA 3K70B 3OIFA 2W42A 1R7RA 4X71A 4JOCA 3JQAD 2H5JA 2FPSA 1Q3HA 1P91A 4B3XA 4BJ6A 1J0AA 4X9XA 1PZHA 1YAHA 3DV0A 3SYNA 3SICE 2YNMD 3B1JA 2C4HA 1JG4A 2B0JA 3PR2B 2ZE7A 1XDZA 3FCCA 1RE0A 4I4TA 2HWJA 4UD2A 4BJ3A 5JS2A 1UMBA 4G4SP 3RSLA 3COJA 4DCUA 4YUXA 1P29A 3TQHA 4I4LA 1JB0F 3KQYA 3UK0A 3NO4A 4HWGA 1O95A 3MG9A 4AMUA 3RF7A 2AJTA 2WFMA 2XWQA 1WGNA 2QDKA 4MGIR 3UBMA 1PJCA 4I5GA 3FMIA 2ZKIA 2ACKA 2Z8YA 2ALJA 4CLEA 3AFHA 3QEMA 3GRYA 2HQRA 3DD1A 4N9QA 4UCQA 3HJBA 2GJ9A 2QRJA 5F5NA 5L95A 1J0CA 4GXQA 2RBGA 4P34A 4GQIA 1QIIA 4LXXA 2NU7B 2O8BB 5IABA 4NMXB 4YV2A 5TDHA 5BMOA 4C2UA 4DPMA 3NM5A 4GW3A 1T2VA 3WWYA 2BEWB 1NXXA 2I4LA 7ADHA 2ZTHA 3MJ5A 2JLCA 1NN3A 2QBYA 5HR5A 4FOPA 4N54A 3W3AH 4HN2A 5CLQA 4U39A 4WLNA 2DFLA 1X1TA 4EI7A 2FW0A 1I14A 1CY2A 4QECA 1U04A 5BNFA 4BKRA 3EZ7A 4ZQBA 2EZTA 4MTLA 1QE5A 5FF9A 4ZU1X 1YS1X 3IDAA 2Y1KA 1PU2A 4HDRB 1PR6A 1H5UA 3YASA 4LRYA 2ZRCA 1TEXA 5KHOC 2XWBF 4HDSB 2J8ZA 4B3SM 1L7OA 1UBUS 4E2YA 1DJLA 4FPXA 2W6PA 3OOYA 1GJRA 1P9OA 1MAUA 4G5SA 2AJLI 3RYTC 5C4MA 2WD7A 1CUJA 4UCFA 4B3RM 3NP7A 4AZTA 1WHSA 3V1UA 3CNEA 1Z4LA 3ZWVA 1J2JA 4IJVA 3QFTA 1XCGB 3W0LB 2DAKA 1Y82A 3CPEA 3K71B 3P0JA 4U1RA 4JMLA 5EPUA 1Z2CA 1VIAA 2FGJA 3W5SA 3MGBA 4QBKA 1G3IA 3T5AA 3JY6A 1LU9A 5C7IO 1H9BA 1TUIA 1Z12A 5ICFA 3P9SA 4IQ8A 4WJZA 3PQCA 4K9NA 1AV6A 2CLOB 2JFPA 3GQ5A 1XHEA 2DR2A 4PIMA 4H1VA 2CP8A 2VYVD 1BMFD 1P9NA 5B6JA 3IUJA 4L5CA 1MEEA 3UUGA 2B6NA 4GMKA 4FHGA 3HJGA 5MGNA 1F5SA 1UANA 4ZZ2A 2QUIA 4EPWA 2HLHA 1NWCA 2LV8A 1XLTC 3WYNA 1HFEL 4I1OA 3SARA 1XNRB 1E3EA 1ZIOA 2YWFA 4X95A 2JI4A 4IJFA 4DRYA 3TR6A 5H4GA 1Q0ZA 3PIIA 4AZ3B 3ZWQA 2WAAA 1L5HA 3NTXA 2XQKA 4PPNA 3UAGA 3DFUA 1NKSA 4IZHA 5TPZA 3H8WA 1ZGGA 2BSAA 2PH7A 1ZIPA 3L8CA 4LRTB 4PVDA 1PW7A 5DF1A 1RJWA 4RY2A 2WF7A 1XVAA 4DV1B 3V7YA 5HS4A 2DHRA 1BSVA 4LRXA 2WSLA 3HFSA 4NSRA 2V97A 3NHUA 3K9HA 1BEEA 4G0OA 4UQPA 1PD1A 3A1DA 3U6CA 2G5PA 3IEPA 3WAGA 3LDFA 2C83A 1U7TA 3QYEA 2FKNA 2PX5A 2QLMA 3W3AA 5KYXB 3GT7A 2R6GA 4D4LA 1CBUA 4NDAA 3KLOA 3UC9A 2F1OA 2FMFA 3G85A 3BTOA 2IT1A 1JR3E 3CGWA 4B85A 3DZGA 1AQJA 1B8PA 2G5CA 1WXFA 4PHFA 1S2NA 1CR2A 4JI7B 3VPXA 3K6JA 4IKEA 1JFFB 2EF0A 2G88A 1RXYA 2WPDA 4DIFA 5BT9A 1POWA 3V2HA 2Q0SA 2A5LA 2ZWIA 3ADBA 4H2DA 1OXSC 2GZ3A 1BG6A 3OCCA 1ECLA 5I9IA 4IQGA 1Q20A 3NBQA 4MRRA 2GZ2A 2ZIUB 3ZZMA 3AZQA 4EW6A 4HWOA 4X62B 4BMSA 4PPYA 4RTRA 3TZ6A 2DFDA 1P5JA 4L8RC 3W9BA 3OE4A 2GZSA 4WECA 4GXTA 2YZGA 4AZVA 1D2AA 1EQUA 4X5OA 4ZI7A 3RIMA 5EMHA 1FZTA 5A0FA 1S2OA 1E2MA 2E5LM 4FM9A 2AG8A 4BX0A 5K9ZA 4JWTA 1UQTA 4ZDKA 2XA9A 5LA6A 1OVMA 2WAYA 1YFZA 1B6SA 5FTKA 3LXXA 4V2IA 4JENA 4M1MA 4ER3A 4NXNM 5F9HA 3SBDA 4XSHA 1P3QQ 3CEHA 4DLYA 1W4AA 1TC2A 1OH8A 4PTYA 3RK0A 1MR3F 2RAVA 3K1AB 2VKQA 1F60A 1NBWB 5K4HA 3QLUA 1XJ0A 4BVBA 2G8NA 3KFVA 1SQGA 5LZ7A 2Y1GA 3SM3A 3UT5A 3QFCA 3ONNA 1J2RA 1QH9A 3N76A 1M9NA 2JL1A 2PZLA 2YOFA 1V1MA 4LKRA 1GUYA 1A77A 4Z7JA 2LCFA 5IBRA 4LPKA 5IKOA 2WWVD 3LRXA 2X9NA 2F5SA 2D2XA 2DZLA 3OEHA 2YZ7A 1NM5C 4OAOA 4RGQA 4BBAA 1J0EA 5DP1A 2XDYA 1ZH0A 3LYLA 4OYRA 1G6KA 2WYUA 1RZ3A 4Z4CA 4DNXA 3JR3A 1T5TA 1XWWA 2J9RA 2BGRA 3I72A 2QTAA 4ZQGA 4NOMA 4UXHA 1AO3A 1QRTA 4IBKA 3O4IA 4PGGA 2NSHA 5TQJA 2ZI7A 4D3XA 1M6EX 4U3JB 4RIHA 1RWNA 5K8TA 5DFLA 3CZQA 1QB8A 3N9IA 3WGQA 4B6OA 5A4DA 4F4IA 4Q3AA 3B2NA 2AQKA 5SV2A 3IE1A 4X65B 4LI0A 1R88A 4P7GA 2Q8QA 1GAXA 4RETA 5KAPA 3EQ7A 3ZOZA 2YL2A 5CFQA 3R9WA 4XOUA 4ZK6A 5IJZA 1E3SA 2FPIA 3UMJA 3OEWA 1OU0A 5IKMA 3NKVA 1E61A 4HEOA 3TFWA 2FE4A 3PXUA 4FGZA 3SQXA 3DG9A 5GOTA 2ZAGA 1A2BA 4HJXA 3PX2A 3O73A 3LQQA 4PXYA 2IFTA 1LVGA 5AM3A 3H5AA 1PIWA 3P94A 4IHJA 1D2HA 5C1OA 3OJLA 4UFPA 4DR7B 3ACBA 1P7CA 3AVQA 2G72A 4ZAVA 2QVGA 1BXGA 4EYQA 5A0VA 5JD6A 3KX2A 3PS9A 3WR5A 3IAM1 4M1EA 3OFKA 1U9ZA 2ZJAA 2CE2X 1ODSA 1UOPA 4B84A 2G82A 2QUJA 4ZVUA 1B8VA 3I04A 5ESXA 2LKCA 2PS3A 1R6TA 2B8JA 3IJRA 1CQIB 1Z39A 4OMCA 4Q7JA 3II6X 3J2PB 5BQXA 4HNTA 2ZZMA 4WIAA 721PA 1XDSA 4MO2A 4BGEA 4R2LA 3VDQA 3IJPA 1E4EB 1WBJB 1ZD4A 2PS9A 2Y1WA 4G2NA 3THRA 4IWYA 2C9MA 1B4DA 2HA2A 5ECGC 4AO6A 1K2WA 1F0PA 2BR5A 1DTSA 3L7DA 1XGKA 1PN3A 1YKFA 2OWEA 2PAAA 4PE5B 2J0UB 3GI1A 3UYKA 1T2UA 2JC3A 2P65A 1R1DA 2XGGA 3IVAA 2XMQA 2ZB8A 1E96A 1QVWA 1ZJYA 1U3CA 5CMLA 1Z34A 2PL1A 2WU0A 5AKLA 4EMBA 2G28A 4URHA 2PY6A 2GCOA 1PGJA 4GMGA 2IZOA 4JIMA 3OZXA 3DWIA 2F62A 1EUCB 2DXIA 3PK0A 2G6TA 2UZ4A 3U61A 2FEXA 1UIMA 3CEJA 1GZVA 1Y8AA 3VJRA 2O4CA 2D59A 3SJAA 4B2LA 1Z33A 2JKVA 3L8YA 1VGVA 4FR2A 5L6LB 2C2KA 2GTHA 2YUIA 3NTUA 3GMDA 2O8CB 4Y2SA 2P9GA 1YOVB 1VM6A 4BNKA 3GAMA 5BNWA 3IB6A 3BFVA 2AMJA 1I2BA 1F20A 1U0EA 4JNCA 2CHFA 3OWXA 3R1IA 2I65A 1UBTS 1NNUC 2NU6B 1C0KA 3FPKA 1VPLA 3KLMX 4NG4A 5TF0A 1DJOA 1IN8A 4X1KB 1L2TA 5AXAA 4PGMA 4F6RB 2GN8A 5BVGA 3NTLA 1DIOB 1YS4A 1TIPA 2B98A 1QOPB 2WIAA 3DNPA 4JA2A 3H5NA 2G36A 3URMA 3LCUA 4X6LA 3U7JA 5ADWA 1GCOA 3V4ZA 4TL9A 3CY6A 1UK7A 5CCBA 1AG9A 5AOVA 4MAMA 1XMQM 4QJ3A 5CBPA 4NATA 5E4FA 4A1OA 2I8LA 4OIMA 1M5RA 3NATA 3PRYA 1CRZA 1UEJA 2XT6A 2Q9UA 4C4SA 1Y8GA 1H4TA 1M3SA 3JD2A 1LH0A 3DCJA 5DJ5A 2W83A 1I7QB 1SB9A 4X1YB 4MI3A 4WURA 1ZRHA 3BHJA 4CCYA 4DQLA 1V25A 1XRRA 3VO8A 3EOZA 4BFXA 3L7IA 3X3HA 2BFPA 3OTGA 2WFLB 4G1VA 1KKMA 1XMOM 1MO2A 3ACDA 5I01A 2CK3A 4BTLA 2V74B 2R1UA 3W79A 1AXGA 4WY2A 3OTWA 2ZS7A 1JSRA 3ETCA 4PRZA 2ZOSA 4D0NA 2WSEF 2FH0A 2P5UA 3OSUA 4HB4A 1LDBA 3SY8A 1FDUA 2WOOA 4XWTA 1RAAA 5EJ8A 2UUOA 1E0SA 4ZO7A 1OB5A 3FA2A 1JDSA 1FB5A 1OFUX 3UWDA 2QD3A 2E18A 3IQXA 3HU1A 2X2PA 3WL3A 4WXHA 3AJAA 2V7BA 5E1OA 2F5QA 3OTOM 1ZKDA 3LF2A 2Q50A 1R6UA 4MDEA 4A10A 1GY8A 4D8YA 3WLAA 1QX4A 4UTNA 2VDQB 4DNFA 2L2QA 2BZGA 4LY9A 5E0KB 1ITZA 3VZQA 4HDOB 3F3MA 3IH5A 1GIAA 4M49A 2B69A 3A36A 3LY5A 3OEEA 4FMCB 5JSHA 4F7DA 2H2FA 3TLMA 4D80A 5JDIC 4J1NA 3ZWOA 2J3QA 3L0ZA 3PPIA 4FDMA 2GXSA 3VX4A 5TIIA 1W0JD 3NDRA 3UEOA 2ZJ5A 1N6PA 1X92A 2PGDA 4A92A 3SZ3A 4EB6A 2HOQA 3BFKA 4IJ6A 4KPEC 3KKQA 4CFYA 2DAGA 3S2GA 5I8WA 2W6IA 3Q2OA 3R9XA 2CJFA 1L8OA 1P2VA 4UVHA 5DGIA 3AC0A 1PNVA 2DZOB 1MVLA 3J7TA 2NVOA 3FVRA 1M2VA 2JLYA 5CH8A 1L7AA 2Q1XA 2JZ1A 4MWOA 2P77A 1CERA 4BCDA 3HY4A 4BQSA 3M6XA 1IMOA 4TSFA 5B1YA 3MTGA 4MKZA 1ULUA 3MJ4A 4G0NA 3LMMA 1U2RA 4RTJA 4LJRA 4HBZA 3WOVA 2P9TA 1IPFA 3LFHA 4Z1MA 1ABBA 3L8HA 3GP1A 4BB0A 3ZHBA 5JRDS 2JCYA 2J9ZB 2B37A 3GPXA 4YXWD 2FN3A 1JEQB 2XW6A 3GRZA 4EYSA 1G59A 4PD2A 1AHNA 4PCAA 1Z0AA 3ICWA 3DTYA 4DM7A 2B8WA 5DX1A 3CLRC 2YJ6A 3FDZA 4UTXA 1EVYA 3DULA 2OR3A 1KORA 2R751 4JBGA 5JS8A 3S1AB 4J0KA 1TMYA 3WGKA 1YDGA 5H9VA 5K2MA 4FMCF 5EMMA 3ROEA 2XB9A 4G4IA 2NSLA 1VKNA 4ACAA 5IHPA 2CEKA 4G0XA 4M1YA 3W8EA 2OGUA 1I1OA 4KLNA 2WF9A 1J9ZA 3NS7A 2TMYA 4UMFA 4KITB 4G36A 4WD3A 2XTZA 3EJWA 3LW7A 1WJGA 1CY6A 3B52X 4UNRA 4Q02A 3EW7A 1K82A 3TLXA 4PN3A 1U8YA 1TZJA 5ETJA 3E22A 1YZFA 4NMLA 3E9NA 2BD0A 3OJEA 3VDMA 1KVQA 1C3OB 1U2SA 1IRIA 2ANBA 3R0QA 3WYCA 2P75A 3UMRA 5T64A 1V9LA 3ZJ4A 1LDNA 3KVYA 3VU3A 5EZYA 4NZMA 2CKMA 4GFDA 4W7IA 5ES4B 5EKDA 3VR4D 3Q7SA 4KPYA 4DIBA 1DU4A 1XXHB 3E53A 3JSXA 1KDVA 1E6UA 4DZTA 3W1EA 4NULA 1HQYE 4YMWA 4BNIA 2VEOA 3QY9A 4N0MA 1FIUA 1QPGA 3T38A 3PE6A 2Q1UA 3CVOA 2EQBA 3GCZA 2HK6A 4UM7A 4XSGA 4Z3OA 1NNSA 5AW9A 4Y18A 4YFVA 5FBHA 1NRXA 3WK6A 2VHEA 4CTKA 4YMGA 4DCPA 3ZTTA 4DMMA 1YONA 3JTMA 3FN4A 2OXRA 3IIIA 2GK3A 3FPCA 1XJ5A 2KEBA 3V8EA 2ZZKA 4IJQA 1VIMA 5DT2A 1QMPA 5LP6C 1H9CA 2Q4EA 3MINB 3JATB 3HRHA 1UK6A 3TAXA 3T3PB 2G1KA 4MB6A 3EX7C 1DEAA 4ZDWA 3KDAA 3TW0A 4F3RA 4A3VB 1V33A 4J16A 5ADHA 2K5UA 5HF8A 4M98A 4ZOLB 1JFLA 2VP5A 3BXXA 3LCVB 2Y0QA 3FCYA 3SHTA 3W6UA 3CR3C 3NTOA 2E49A 3G2QA 2WF6A 1T5IA 2QZ9A 3ZCXA 3COZA 4INJA 3T9CA 1NUPA 1QV6A 2OC4A 1PBNA 5DP2A 5KQLA 2XUZA 3DTVB 5KHAA 5HHTA 4DCJA 4TM7A 3ZZNA 4DLRA 2BSQA 1Z62A 2GOYA 3MUOA 1LJ8A 5BQFA 5C34B 1QV9A 3GVHA 2H7YA 3Q1KA 2DT5A 1TK3A 3AESB 1BVRA 1JF8A 1D07A 4DDHA 2KW0A 3AOGA 3RS7A 5KB3A 4PYLA 1N3IA 4BYMA 2QUZA 3H5RA 4U2CA 1HNXB 4P4GA 4NHEA 1Y8RA 1J5XA 2YHUA 3I4VA 1K4YA 3GROA 4E12A 5D5PA 1TT5A 2PT5A 3WGGA 1Y7LA 1SHTX 5LOVB 5AHWA 4JUCA 5FI3A 3HJAA 1Q7EA 4AJLA 4XDGA 4GL4A 1LFDB 1MG0A 1DCKA 2WKQA 2WW8A 3RUCA 4X7BA 5AT1A 4KQJA 3RS9A 3PJFA 5BO5A 4DNOA 5F2NA 4I4NA 5KVCA 1TXGA 4BXOA 4TWIA 5JO9A 3KB8A 3DOJA 1OFUA 1IY1A 3L1IA 4K6HA 4WHMA 3LP8A 3PNLA 4ZOLF 1QNFA 3U6LA 4GGOA 2FDCA 1V11A 2J85A 4MUXA 4X7RA 1L1FA 4G25A 2HRQA 3OFND 1IXRC 4AUMA 2KA6B 2WSSD 2C4TA 4UQOA 4L9WA 1ACLA 4UAVA 2PDAA 2QROA 3SEZA 3QF7A 4GLBA 4DB4A 1E1QD 3LT1A 3EODA 1C7QA 5JD3A 1XC7A 4WW0A 1Z74A 4GRDA 2WWHA 5KSWB 2CJWB 2DWUA 3HJTA 3NWBA 1N2CA 2W2XA 1LLUA 2RIPA 1TA0A 1K08A 5IWAM 4TXNA 3RAGA 5E8RA 5DHRA 4LF4M 4FS3A 5CG1A 1TH2A 5ERGB 5I3CA 3GDOA 4INAA 1M67A 5F2KA 3L6OO 1P1FA 1WQ3A 4I2NA 2DETA 4ZCRA 4YMHA 4YJKA 4J3FA 4ZTUB 1K4MA 1S6YA 1VXOA 5LOVF 4O4LB 2R18A 1WP4A 3TSCA 1N5DA 2VATA 2WJJA 3GRCA 3S27A 3JARA 3U19A 4IV0A 1E5VA 4TT8A 2ATCA 4KV7A 3KD3A 4OHCA 3GLGB 5FAKA 1H8HA 3NH9A 1U80A 2JBAA 4DVGA 1T1EA 3GP3A 4INPA 4R2JA 4JBLA 4G3XA 1H4VB 2R84A 3CUSA 1IN1A 1R9GA 3BK1A 2I2WA 5BPVA 1R64A 1M2JA 1EQ2A 1Z6AA 1EFVB 5IAKA 5A3JA 3W5VA 4V0OA 3G89A 4Z49A 1ZXBA 3GYGA 3THYA 2RFLA 1VB3A 1MP0A 4A0FA 4MIOA 1LBHA 3D4NA 3HEAA 1R8SA 1II8B 4MK4A 1D4OA 2CLIB 3BIJA 4TYQA 3EVGA 2E2WA 2X49A 5LWQA 4EL0A 4N8DA 5EERA 4JKYA 5F3DA 4GRAA 4TL6A 2HYDA 2BMJA 1VSQA 2IPMA 3ILYA 4GEWA 1SRRA 2OESA 2OV4A 5EE9A 3LT2A 5KUTA 2AWOA 1SWVA 4FYXA 1MIOA 2PFGA 4MQFA 1BCSB 4PSDA 4J0CA 5NULA 3C3PA 1V95A 1H2RS 1TU0A 4OP3A 3JU3A 3IEUA 3OURA 3QUQA 3WLTA 3JR7A 4IMRA 4IIJB 1UMDA 1XAIA 4FE7A 4RTPA 2LWIA 4O4LF 2JCBA 3QEJA 1GTVA 2MYUA 3WNVA 5LWHA 3OG9A 2Z3ZA 4KX3A 2N1BA 5AM4A 2C3OA 3ABZA 1RQXA 4ZK2A 4ND4A 3WFJA 3DVRX 3HJNA 1N2ZA 2B83A 3DM9B 4XIIA 4GE3A 1H3FA 2IS2A 2Z5VA 1JTVA 4Z1OA 1UADA 1OZFA 1NI4A 1ZCJA 2PQ2A 3LC7O 2V58A 2QV0A 4JI8M 2YUTA 2ZBDA 4XGNA 2HA0A 2BEVA 5JHGB 4EK9A 4O3FA 1PAUA 3PPWA 2BFFA 4JB3A 3KOWE 4AQYM 3A27A 1U5BB 1YL6A 2DKOA 4DG5A 2XCSB 1QDTA 1I5EA 1JIXA 2VKTA 5JI2E 3EXHC 2GF0A 2EZUA 3AI3A 4M8LA 4CF3A 1LBTA 2XUJA 1DXYA 4ZYZA 3ZZTA 2Z2IA 2H2HA 5C51B 2X9QA 5EXSA 4XB6B 4BFVA 3PFBA 4MWDA 5CDSA 3N8GA 4IIJF 2NADA 1E5TA 5KMGA 3AU8A 2P41A 1P6UA 1O6BA 3IUPA 3M70A 3NONA 1ZI6A 3M5PA 4JU8A 1W7AA 2JHAA 1GUFA 3HBNA 4KC0A 4KCGA 2R0IA 1OJLA 4YRDA 3PUZA 2NTYC 2WUDA 2BGNA 3M6FA 3QMWA 4TSRA 1G17A 4DLBA 1JDTA 2PQ0A 5JI3E 3TNYA 1YZ3A 3G2HA 3GRKA 5M2QA 3DBHA 4H6VA 2BBWA 1SCIA 1JXQA 1NE2A 3LP5A 3MJVA 4H18A 4UE3S 3KXEC 1B16A 1RWQA 1F2DA 2ACVA 5ECYA 1ZM9A 4F3YA 2YWGA 4H16A 3L77A 1LGYA 2EV9A 3OT1B 5K3DA 4OLBA 4NVRA 3L7OA 4J7AA 2XUHA 5IH3A 3SDZA 2JLRA 3D3NA 2CWWA 4L5BA 4CUZA 3GCDA 4JYCA 4DUZB 3O4FA 3TWOA 4EG0A 2ZGVA 1G19A 3QE4A 3GN1A 2Q6IA 3IQZA 1U8EA 3AW8A 3G9XA 1X70A 3U80A 1YB5A 2NU9A 4PYJA 1FA9A 3CXRA 3UENA 4DR3M 4LOLA 4MGYE 4H08A 3DBLB 2FETA 4FHCA 2M32A 3JRXA 5F7ZA 3PF9A 2HUPA 4U02A 1NFRA 3NRBA 4EEXA 3GUUA 2EDCA 3GDWA 1ADFA 4DWVA 1LRLA 1W36B 4BCBA 1EFHA 1R5NA 4LRWA 3SSAA 3MW8A 3VPSA 4WUTA 5KDOA 4L51A 3S68A 4E88A 5LCXA 4TYYA 2NZYA 2VHCA 1ZK3A 2PKQP 3ZW7A 2A0XA 1RNLA 1HE4A 5LLSA 2J32A 3X1MA 3KJXA 1M75A 1UP6A 1P0CA 4M9QA 3FYUB 1PRYA 1M34B 2HDOA 2GNAA 5DWQA 1P0PA 4UEJA 4U00A 4RD0A 1FJGM 3QJGA 3VHXB 3SF8A 3LK7A 2ZYTX 1UBSB 3FOWA 4ZYYA 3SIRA 2Y4OA 2F1JA 2QE6A 4JZKA 4BO5A 3NHWA 1DMSA 3CZ4A 5B4TA 3W8NA 1QO7A 1M0SA 5KOYA 4L7VA 3U7FB 2V7XA 1I2ZA 1FX0A 3T1NA 5IJXA 2AT1A 4EVRA 1VZ2A 4CIZA 3QG5A 5F78A 3HHWA 2DWZB 3U4QB 2YW9A 5CXSA 2XSZA 2FTKE 1QANA 421PA 4FIDA 4PZLA 1TH3A 2IPNA 1NF3A 3N3BC 3LPNA 1QHYA 3AHDA 4DILA 1B15A 3ROZA 1O5IA 5D00A 3GJQA 1ID8A 3L4JA 1ORYB 1U0NA 4M87A 1OTRA 4QYTA 1E3MA 3WMWA 5CH3A 3TL4X 1XRPA 1K9VF 3CYFA 4I1YA 1QS0B 4RSGA 1NU8A 5DM1A 1D0IA 2PUDA 3PGJA 1ZO8A 4JROA 3AB3A 5CDYA 4DAOA 2OHIA 1XHFA 2GS9A 2EJUA 1IJBA 3H2SA 3IP5A 3M1IA 4ZVVA 3ZV5A 4AO8A 2OBFA 5LM3A 1A2OA 4RH3A 4JJFA 4HV4A 4C0WA 4UAUA 1G291 2NZ8A 4MJ3A 5KREA 2UZIR 2V1CA 1BHJA 2PBFA 5ISMA 2G4CA 4LC0A 3J81S 1NN0A 4LZJA 4LF9M 2P62A 4KR7A 1P0MA 5FHQA 4RIIA 3VU0A 2X77A 5GVRA 3SZOA 5LR6A 3ZC7B 4BE4A 3PXAA 2D13A 3G0GA 4M0FA 5AXCA 5BSUA 4LHZA 2W0MA 1T2FA 3H18A 1EG2A 3GO8A 1N36B 4NMHA 3V2IA 2DWNA 4GOXA 1MV8A 5BR7A 4E14A 2N9UA 4JLOA 1E4VA 3ASUA 1MOQA 2GTIA 2JLQA 2JGDA 3P2EA 1QFYA 1V2HE 1CD5A 1XZLA 3F73A 3GGCA 1FS5A 1K89A 3C6BA 2C00A 2XHZA 4QTXA 2OCLA 1TL7C 2A8YA 2IU0A 2O8EB 4E3WA 3Q8XB 1PBTA 4OF4A 3KCNA 4PFSA 1RI4A 1YRYE 1YI8A 3HCFA 1NW3A 4QO7A 3PQ3A 1EP3B 1PEDA 4E1BA 3V76A 4D0SA 1RQRA 3TIFA 2IHUA 4TLBA 3KTAB 4LYAA 1Z6PA 2XMPA 1RZRD 3PX3A 1N9ZA 1G3MA 2YDXA 3CRZA 3LL7A 3MWKA 1U3VA 2C0PA 3HY3A 5F33A 3CO5A 1P6XA 1L7DA 4R1PA 4FLMA 1Z22A 3MA0A 3WBBA 4DR1B 3ICPA 1IG3A 2IDKA 3FNFA 1SXQA 2P2DA 1FRNA 5SY9A 4LMRA 1CE8A 3D8BA 5SY4A 1RFGE 3DBRA 1L7NA 4IH1A 1EWRA 3OKAA 4TKVA 3RS3A 1W4LA 2C77A 5CA1B 4WBNB 2V55B 3BKXA 3WMFA 3V4RA 3D59A 3VPGA 3LLCA 3GFSA 2G9VA 4FQ8A 5DXFA 1T2EA 4WBXC 5ALLA 4REMA 5DIZA 1OX5A 3H9UA 4XUGB 4CLOA 1I9GA 2FW8A 2PD4A 2B2XA 1P1BA 3ORRA 2OWDA 3NR2A 4JDPA 3L5KA 5ABPA 1FUIA 4E08A 3GJSA 1Z4MA 2LVPC 4WNCA 1D4FA 1QO9A 3JX9A 2X0JA 1U31A 3VTZA 2WWYA 2CCJA 2XBUA 3ET5A 4LQ4A 1M54A 2OBXA 2I67A 3EGXB 3RO7A 3M83A 2AOTB 1NHGA 1QHXA 4US2R 1SCUA 1LK0A 1SU8A 4NPHA 3SBEA 3TWMA 4AS1A 4E4RA 2IYYA 5K0LA 3MWDB 4QXQA 4JA0A 4JCCA 1W59A 4D3DA 3DOIA 4UU8A 2L18A 1T9CA 4JBIA 4V0QA 3N7TA 1VL6A 3Q7RA 2AI3A 1IOLA 3QOYA 2JAUA 2V5AA 3SXUA 4IL5A 2YVLA 1R18A 1U2QA 1QHEA 3RVNA 1P7WA 4YQYA 2ZUCA 3ZU3A 5JEDA 1M8FA 5KIAA 1EJ2A 2FMUA 5CA1F 4G01B 1ADBA 1JI0A 4TN1A 3WGZA 4RX1A 2VXOA 4JYZA 1AUQA 2OBLA 4TYPA 1SQ6A 5CPBA 2CXXA 2MR9A 5EY5B 1QCYA 1XR3A 4X84A 4HDCA 1AOXA 4G26A 2FZVA 1XTUA 4KSCA 4BPBA 3X1DA 2NXEA 5ICCA 1FSZA 4K8RB 1P2TA 2QXUA 5FJJA 5HIAA 3GARA 5DHAA 1M0WA 4FFMA 4PLWA 3EXG2 2NQ2C 4XD7A 1X8XA 2R65A 5KVVA 3LPAA 3ESXA 2Q2NA 1NR1A 3A9TA 1XCMA 1XXLA 3O91A 2SKEA 2B5OA 4LY0A 4UMDA 5LPNA 5C8XA 4UNNA 4A8JB 5CIWA 2JAXA 1IWPB 2R85A 2CNLA 4F5EA 1ISIA 4CXMA 4QYWA 4OXXA 4ENSA 1A04A 3OOEA 1VI2A 2DR0A 2X8JA 1LLDA 4HVTA 3P9ZA 3LUAA 4FFSA 5CYGA 1JPVA 4D4IA 5AKXA 4B80A 1WU8A 4F4DA 3HKBB 2GH1A 3FKEA 1LTQA 4ARBA 3AEZA 3EGEA 5I9NA 1S2IA 1TAHA 1JSCA 2CDBA 2WVJA 4Z4IA 3L25A 1H2HA 1FDOA 5EVJA 3OHPA 1VIVA 1LRJA 4NBVA 4EG6A 4JN6B 3VRHA 1U6IA 2F9FA 2JFWA 4RCZA 2H06A 1O94C 1QO0D 4RTOA 5BW4A 2QZSA 1N7JA 5FJIA 3TBHA 3RSFA 2P11A 5AJUA 1Q7GA 1QHFA 1E2LA 3HBLA 5DX8A 3ILKA 3V1LA 4EA6A 1L8QA 1JXMA 3OC6A 1B00A 4JGGA 1F1JA 4OI2A 2GN2A 3KPJA 1GGMA 4G65A 1CU1A 3F7NA 5A6SA 3IPLA 3I5MA 1X80B 5CVEA 1MA0A 4HWPA 3SF0A 4HDKA 2CNNA 1REQB 2H52A 3OQPA 1BWRA 5IT5A 1R8QA 1RMTA 5IXSA 3NIGB 3V8BA 1FPQA 1VL5A 1PGOA 1Y6FA 3VUFA 1H22A 1KJWA 5TVKA 1DC5A 2PPVA 3QITA 4NNOA 4O63O 4JOBA 3KPWA 4B3CA 3B78A 4Z9AA 3RODA 4NBKA 1JU9A 2CVQA 2PMFA 4R84A 4B73A 1TD1A 3W34A 3F47A 2AOWA 3RPEA 1QAQA 1IHDA 5TC4A 2OAEA 4XXHA 2G0TA 3A2KA 1Y6QA 4BGUA 3LPMA 4EPTA 3OLCX 4FE3A 4RL6A 5EMNA 1PG2A 3HKCB 3DVAA 4DDTA 1U7XA 4YMSA 3PHBE 2DRIA 1A7UA 1LJUA 3KUDA 3I42A 4ZVOA 2CNWD 3RC3A 2XVXA 1OXXK 4W5QA 5CT5A 3IVRA 1RRPA 3IAEA 1RWPA 4TZKA 3OT5A 3PDCA 4EYOA 2GKSA 4UHEA 3SE0A 2FG5A 5JLJA 2J31A 2DLCX 1H94A 3WS7A 2A9QA 3AEXA 2JB9A 4IG4A 1PSWA 2D1QA 3QMMA 5LU8A 3CQ9A 3EIQA 4MQLA 3ZW8A 2CL7X 4G5QA 4IOLA 4Q6WA 5JAUA 1XWFA 1TCCA 2K47A 1PFQA 3OLZA 2CFCA 3HH8A 4FR0A 4WOPA 2PAFA 1KBQA 3ZDZB 1TZBA 3UMCA 4RPCA 1TM4E 2W6NA 2NQ8C 1OXUA 4F8YA 3EC2A 2BWJA 1W85B 2A94A 1QGED 4MRAA 1G20E 4EHLA 5BN3B 3D1LA 5JNVA 3TXYA 1CNMA 1JIJA 1JFVA 4AO7A 3K70D 4BKQA 4EY6A 1L4NA 4DA8A 5AXDA 4JP2A 2OAP1 3MBKA 3L8ZA 4V3CA 3TOZA 4FJ2A 1YL7A 3I64A 3CG4A 3SKVA 4B3MM 2QEQA 1FQWA 3LXUX 2C8LA 4Z86A 1N92A 2E4XA 5DXJA 2O8FB 4U5QA 3LYUA 2IF2A 3MCUA 1K4KA 2UXCB 2J0QA 2RGDA 4BMOB 2GXUA 1N3YA 2LCIA 3L7BA 4W8HA 1L8XA 4G4QA 1JHAA 1M66A 4OQDA 3UN1A 3VO2A 1HE3A 4GICA 3B82A 4U7PB 2OHXA 2L4EA 5JD4A 1KGDA 3WI7A 4Q48A 2ZUDA 4HAOA 2LW7A 3I4CA 1OREA 2QHOB 4Q3LA 3LUJA 4Q1BA 3CLSC 5DNYB 1EFCA 3JYLA 5FL7D 1UZLA 3CEPB 4YDRA 1PTJC 2E37A 2R6HA 1YB7A 4ZV4A 3LECA 3NWEA 1Z0SA 1FVFA 1UC8A 3QKTA 4R2IA 1J9EA 1ZPDA 2PO7A 3K8YA 3KVWA 3UAOA 1AIPA 3OJWA 1SVUA 3RAPR 1O9HA 5GJWC 1JDBC 5JFTA 3PDIA 4H0FA 1WMDA 4N6GA 4PG7A 4IDDA 3U26A 3SSNA 1ODLA 1W5EA 3SXPA 5IHXA 3NHSA 2FRDA 4LPSA 1VMDA 3BB4A 1BHO1 2R44A 5GQSA 3K2LA 4P80A 4O33A 2BJHA 4NV3A 1WXHA 2IZ5A 4B5LA 2ZR7A 1NXVA 1ODTC 4KQIA 1G7TA 3ZE0B 3UATA 4I19A 3SAVA 5DNUA 4WQMA 1YZQA 1YQWA 3CUVA 1GGJA 1ZESA 7YASA 1YA6A 3VR3D 5CFRA 2GILA 4ATNA 1GXSB 2DQZA 4JLMA 2VJAA 4CNBA 5HM6A 5LZ4A 1K7SN 1HC7A 3LQFA 1ZNYA 2PRJA 1IBKM 2C78A 4EKDA 3R41A 1GQ2A 5EIBD 3ZIAA 1GNVA 5BR8M 1NC3A 3AY6A 1WWKA 4NKRA 3R0JA 3UG6A 4XB1A 1P75A 3RC8A 3L02A 3DT8A 3A1EA 3ZIUA 4Q7KA 4CI0B 2I6XA 1YU6A 1YVUA 4P22A 2K7ZA 4BFYA 3J81A 4YCJA 4HEA6 2ID4A 1VJCA 2F3PA 1GEEA 2QZJA 1YA8A 3AINA 1DKPA 3SX0A 2WA2A 3B12A 1D8AA 4KI0A 1YHNA 2OAGA 3GJTA 1N8KA 1A8PA 2X3UA 3CTPA 4D9NA 3FHTA 3NVMB 1BOFA 3BAZA 3BMOB 3JQ7B 3EG5A 5EVCA 5DNVA 1RPZA 4CT0A 3KU1A 1ZSVA 5JCJA 2W70A 4BB6A 1VG8A 3OPMA 3K15A 3HY5A 4N65A 3I6QA 3JQRA 1PR9A 1FE8A 1T25A 3O93A 3FF1A 1ZKMA 3GVCA 2O5RA 3WL8A 4QSMA 1E9RA 2GAFA 1C0LA 5ITUA 1LWNA 3L4KA 4CM1A 2P9JA 1TO2E 1W5FA 4DJFC 3E82A 4QOIA 2AXEA 1MEJA 1XL1A 1U0TA 5L8RF 2EHJA 1OZAA 2Z2KA 5E0OA 1V37A 1GLVA 1AKQA 1I51A 1DL5A 1ZBDA 1KEEA 3I4FA 1YWGO 4KFSA 4QWWA 1P31A 2XQFA 1JAXA 1U1FA 1N9GB 1XQXA 2GHTA 4PCLA 3EXAA 1E20A 4HFMA 5C3MA 5E2AA 1K0UA 2HMAA 4NJMA 4EY4A 2J67A 5CVVA 5EIOA 3GLFB 2BE7A 4A6XA 2OHOA 3M9WA 1DAMA 3JQGB 1B8NA 4ZVQA 2M2IA 5ALNA 5JCXA 3U4IA 1KETA 1PVVA 4RQTA 1P5HA 3S99A 1BEUB 4B3SB 3GEEA 4P83A 1LSJA 3T5GA 2Q8PA 2D3TA 2DPLA 3GW8A 5BQ3A 4HLQA 4LYYA 4AWAA 3ZHOA 3F5FA 4I9GA 5F3WA 1ZV1A 3WQSB 2HJHA 1NBAA 2FSIA 4WH0A