4G3OA

Crystal structure of the cue domain of the e3 ubiquitin ligase amfr (gp78)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
RGSENLYFQGQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase AMFR
publication title Crystal structure of the CUE domain of the E3 ubiquitin ligase AMFR (gp78)
rcsb
source organism Homo sapiens
total genus 20
structure length 53
sequence length 53
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4g3oA00
2KNVA 3F92A 2O25A 1Q02A 2H5XA 1VQ1A 2CWBA 1OQYA 2DNAA 1VEJA 1G41A 3GLIE 1WR1B 2K9DA 1TTEA 1IFYA 1HT2E 2JZ1A 2QHOB 3B89A 1EFUB 2HWJA 2JY7A 4GEWA 1WIVA 2LBCA 5DFLA 1GO5A 2LVQD 2MROB 2DAMA 1DV0A 4F1IA 2JUJA 2L4FA 3E46A 1SG9A 3FRHA 2JZ0A 2L4EA 3IECA 1VG5A 2CP8A 2DAKA 1WGNA 1WGLA 2OOAA 2DENA 2L2DA 2K0BX 2DI0A 4UN2B 1VDLA 1IM2A 1Y8GA 1G3IA 1BVSA 2KNZA 3FRIA 3E21A 4HEOA 2EKFA 2ZTDA 2MJ5B 1IXSA 2WZJA 2LVAA 2BWEA 1NV8A 1ZMVA 1ZMUA 2LVPC 2EKKA 3FE3A 2MGWA 1VEGA 3K9OA 4G3OA 2DAIA 1XB2B 2B3TA 2KHHA 2LVOC 1OTRA 2DZLA 4Q7JA 3BBZA 1OKSA 2QNJA 2RRUA 1PGYA 2MR9A 2DHYA 1T43A 1F4IA 3LCUA 3IHPA 4R71A 2DAEA 2JNHA 2DKLA 1AIPC 2LTUA 1C7YA 1E94E 1QZEA 2OOBA 1DO2A 4DBGB 1JR3E 1ZMWA 3GLHE 1T6OA 3H4JA 2R0IA 1KYIA 2EJSA 5JI2E 2HAKA 2LVNC 2JP7A 2JY6B 1HT1E 3K9PA 1A5TA 1HQYE 1DO0A 1NV9A 4F2LA 1XXHE 2JY8A 2BWBA 2KNAA 1V92A 1HJPA 1G4AE 1TR8A 2DAGA 3MMPA 3T6PA 3LCVB 4WP2A 1OAIA 2ZTCA 1P3QQ 1WHCA 1CUKA 1VEKA 3GLFE 1MN3A 2JY5A 1ZV1A 2OO9A 1WJ7A 1YLAA 1UFZA 2QSFX 3GLGE 2G3QA 1R4GA
chains in the Genus database with same CATH superfamily
2QENA 1TH4A 3GQ3A 1NY5A 3F92A 3IG5A 4MB7A 4LJ7A 4R7GA 3CGWA 1IBLM 3FTCA 1L2DA 2C9CA 3U6LA 1VEJA 1DGBA 1XXHA 2CEAA 2AHMA 2CRUA 3TWLA 3GLIE 1WR1B 4S12A 1QDTA 2V1UA 4LF4M 2QHOB 4R3DA 5KPRA 3T15A 3MJ5A 1N77A 4AKGA 1WIVA 2LBCA 4MGZE 2LVQD 2MROB 3MHVC 3UMMA 3UJNA 1FNNA 3J7AS 4DR1M 3U6OA 2JUJA 3E46A 3HHXA 1R2ZA 1NSFA 2KRKA 1XMQM 3KOZE 1QZMA 4JI6M 2L6OA 2HHHM 1K3WA 1WGNA 3U6DA 2CV1A 4D81A 3B74A 2L2DA 2DI0A 1NJGA 3W0LB 2NQ8C 5EP2A 4Z6YA 3SARA 3AL0C 1QAMA 2KNZA 3FRIA 4HEOA 4D80A 2O5RA 2HKJA 2Y21A 4DUYM 1PJTA 1Z59A 1D0LA 1GVNA 1XMOM 2EKFA 1L1ZA 2M5ZA 5EP1A 4RF0A 3PXGA 2QQ8A 2BWEA 3EIEA 1HNWM 1ZMUA 4GKKM 3C3EA 3TL4X 4CJ6A 3GPYA 4JI0M 4MGIE 3K92A 3SMPA 3M6AA 3HHZA 4OU7A 3JR4A 3GLFB 3KVWA 5E6JA 5FTLA 5F3WA 2VQEM 1PJJA 3KOWE 3GP1A 4GC9A 3LVWA 1IN4A 1L2BA 1QANA 4AZFA 2R62A 4Q7JA 5FSWA 3BBZA 3QYEA 4LRSA 3J2PB 2KEBA 1R7RA 2LNHC 3TE6A 4FVMA 2DHYA 2OPFA 1T43A 3KS8A 1VDDA 1F4IA 4W5WA 3PVSA 3AOGA 3T1YM 1IN7A 2JNHA 3VDPA 5IZ7D 2LXEA 2VF8A 5KPZA 1C7YA 1I4WA 3L25A 3HHYA 4IBDA 1XC8A 1RU3A 1HQCA 1TH2A 2F5PA 4IBKA 4JI7M 3I04M 3U6QA 1OIPA 2ZAMA 5EJCA 2VQFM 2R18A 3FUVA 3LMMA 4GKJM 1GJSA 2VDBB 2ZBKB 4LRTA 2UUAM 1HQYE 1DO0A 1MX0A 1N34M 4HL4A 2H1RA 1J09A 4L6V6 4LFAM 1IN6A 4B3SM 1DGHA 3THGA 2CV0A 1AUAA 1G4AE 1GKIA 3LQRA 4DV3M 1C1KA 4WURA 1XNRM 3VK7A 3HU1A 3QYBA 3SHFA 3B7NA 2ZTCA 2K6BA 3FUWA 3GQ5A 4BLCA 2X4AA 1CUKA 4DV1M 4PD2A 3GLFE 3C9PA 3U61B 1EE8A 1ZV1A 2QP9X 3KOXE 1WJ7A 3SYLA 3Q8XA 2C99A 1UFZA 2O01F 5ITUA 5KPTA 4LJ6A 4AKHA 2F5SA 2X8AA 2I7PA 3HWSA 4GMQA 5ITRA 4NL4H 2QCUA 3J80S 3LVVA 2FNAA 4B3TM 2KNVA 1Z5BA 2FS1A 3SBJA 2H5XA 2CV2A 4L16A 4MGKE 2DNAA 1IN5A 3GPUA 3UZUA 2C96A 1MJGM 2P5TA 2WSFF 4NSRA 4QNRA 4X66M 1TTEA 5EQTA 1K82A 1ZQ9A 3SFZA 3TPZA 2V1CA 1XXHB 2ERCA 4G4NA 2FE8A 1Q39A 2DXIA 3B89A 1JB0F 1Z5AA 3GRUA 5KQDA 4B08A 4JI8M 2KRUA 1N33M 3FYDA 2UXCM 5IT9S 3D8BA 4TUWA 1GO5A 2R65A 3HJ8A 3L27A 5FTNA 2F4VM 1PM5A 4I81A 3C58A 5EP4A 3GLHA 3JR5A 1SXJC 1SG9A 3GO8A 1PJIA 2F5OA 1HNZM 2L4EA 3AOEA 2DAKA 2XSZA 3KOYE 1QAOA 3I01M 3NBIA 2OOAA 1YE9A 4IIWA 4M0DA 3GLIA 1VDLA 2Z7JA 1IM2A 4JYAM 4LZJA 5ITTA 3A46A 1BVSA 1R2YA 3E21A 3H4MA 4CHTB 3U60A 2DWLA 2Z4RA 1WXQA 4B7HA 1N32M 1SXJA 5EXPA 5BR8M 2WZJA 3KSXA 3ZH9B 1HNXM 3NBXX 4AG5A 3PNVA 3VDUA 1NVMA 4JI4M 2EKKA 1TH3A 1JR3D 2MGWA 2KDLA 1E9RA 3FKEA 3J27B 4IBJA 4G3OA 3GLGA 1T3TA 3FUTA 5BPVA 4OW0A 3Q8GA 4JI3M 3U6PA 4LGYA 2DZNB 3C3DA 3VLFB 1OFIA 1OJLA 4OVZA 2B3TA 2LVOC 2EA0A 1OTRA 2DZLA 3U6CA 3A45A 3A98B 2QNJA 5ITQA 2M60A 4DV0M 3R9XB 4LY6A 4AI6A 3ZC7B 2KW0A 4K0KM 2YR0A 4G6ZA 1S3SA 4LF5M 2XFSA 3LCUA 3KP1E 3WHLA 2CHQA 1Q3BA 3IHPA 2UUBM 2EO2A 4BB9A 1LV7A 4R71A 4JI2M 4LF8M 2DKLA 1OAOC 1AIPC 2G5GX 3HZJA 1QZEA 3SAVA 3L29A 5LMNM 2LWXA 3DZDA 2J5YA 1JR3E 1ZMWA 1IBMM 4QHTA 3GQ4A 1IBKM 5ITXA 3T38A 1KYIA 4MM3B 1MU5A 2R44A 4NRVA 5JI2E 1PRBA 2JP7A 2XH9A 1V33A 3K9PA 1A5TA 3SHGB 1KFVA 1IY2A 3DA1A 1FJGM 1NV9A 5DNYA 2JY8A 2BWBA 4Z8XA 1V92A 1L8QA 1LTMA 2MH8A 3KXEC 4IJFA 1ORYB 4LJ8A 3KP0E 2Z4SA 3KS4A 4LZZA 2RKOA 3K1JA 3T6PA 2APLA 4IBBA 1DGHB 4MGYE 1XWIA 1GLNA 2GQFA 3HJQA 1IY1A 1NJFA 2R4JA 4LJ9A 4NC6A 1TDHA 1WHCA 3RGSA 2DVWB 3M7GA 1YUBA 2CHVA 4PCZA 3T1HM 2Y0TA 2QSFX 1R6BX 2G3QA 3HHWA 1D2NA 2ZAOA 5KO3A 1D0KA 3U6SA 3RFWA 3U6MA 4NXMM 1G59A 1Z5CA 1NHGC 1Q02A 4II7A 1QYRA 2RGHA 4JI5M 4FWHA 1OQYA 4M9XA 2HL7A 3SYKA 2C98A 2K9DA 2YNMD 1IFYA 1HT2E 1OIZA 4QHSA 1IXZA 1GJTA 1K3XA 3NWLA 4FW9A 4M0WA 3U5ZA 2K47A 3UGJA 4I8OA 5E26A 5C18A 3SATA 1E9SA 4LFBM 1IN8A 4KT0F 3HU2A 2YFQA 2HWJA 3LW5F 4RF1A 4IBEA 2A5YB 2JY7A 4AQYM 4L4UA 4LJ5A 4B3MM 2OQ4A 2DAMA 3FUUA 5JI3E 1PJQA 3V76A 5FTKA 1EIJA 4GITA 4F1IA 4KHPM 4WW0A 4KODA 2FOIC 3I4YA 4NOOB 2JZ0A 4KO8A 3IECA 3GLHB 1VG5A 4D82A 4AW4A 4EIWA 3CF6E 1WGLA 5H37D 3L26A 3CF2A 2DENA 2K0BX 5FTMA 5L8RF 2W82A 2C5RA 1NHWC 2WSEF 1Y8GA 1QVRA 2XZUA 4CISA 3EIHA 2F5QA 3FYCA 3GLIB 4GH9A 3BXWA 2Y20A 3KDSE 4DV5M 1IXSA 1G71A 3U60B 1N36M 4X64M 1W5TA 1ZMVA 2R6FA 1SXJB 2N35A 4LGMA 3AKZA 3SAWA 2LVPC 3GRVA 1VEGA 3K2LA 3WHKA 4DR7M 1GL6A 5EXXA 3HY5A 5KQ8A 1QDRA 2VIIA 1NNUC 1PJSA 2DAIA 2ZM6M 2XSZD 3GLGB 3B7QA 4GIPA 3GPXA 1Q3CA 1OKSA 2UU9M 1TGUA 3LQQA 1G8PA 1PGYA 2CUZA 4OVZB 4B7FA 3FTFA 2XEPA 2GNOA 8CATA 1XHBA 4JV5M 5DYGA 4RKUF 3HU3A 2EUCA 4DV7M 4L15A 2WSCF 3RE8A 4OX9M 1E94E 2DWNA 2OOBA 4P17A 1ZAEA 1DO2A 2L7HA 3VKGA 4G4QA 3GLHE 3PNYA 4FWDA 2R45A 2R0IA 3B9PA 3FD9A 2J7OA 3H4JA 3IG8A 4IJEA 4GHLA 1GABA 3J7BA 2KZSA 4GC5A 4I4LA 2D7HA 2LVNC 3GRRA 3GRYA 1QAQA 2Y0QA 4IBCA 2QBYA 4NSOB 1DGGA 3HJSA 4DR5M 2KZUA 3GPPA 1XXHE 3HGIA 4YHHM 3AFHA 2Z8YM 1HJPA 4DV2M 1TR8A 4Y28F 4X62M 4ZPXA 3D8LA 3BOSA 3AJIB 7CATA 4XBOA 1SXJE 2JWSA 1NY6A 1E32A 1P3QQ 1QUSA 2R4EA 1L2CA 4LJAA 4M9ZA 3KFUG 4PDIA 4G4RA 2JY5A 2BJVA 2FFJA 3KSJA 4PDGA 4G4OA 3U6EA 3RGPA 3B7ZA 5C1BA 5IREB 1JR3A 3K8ZA 2CE7A 3GLGE 2J7NA 2E5LM 4HLQA 2F5NA 1R4GA 3FTEA 2ZANA 3OTOM 3SC3A 2YQZA 2O25A 3TWMA 1VQ1A 5FTJA 2CWBA 1XNQM 5ITYA 4I5SA 1G41A 1JQJC 2JA2A 1HR0M 4DR6M 3QWLA 4LCBA 2XF3A 3M0EA 3SMSA 2JZ1A 3JAMS 4DV6M 1IXRC 2DZOB 2Q2EB 5EXTA 3W0FA 1EFUB 1UM8A 3W68A 3CF0A 3U5ZB 5DFLA 4GEWA 4MH0E 3SASA 2D7EA 2LH0A 3QAUA 5FLXS 1TDZA 1DV0A 2L09A 5DYIA 5ITXE 1KSFX 1V34A 1N75A 4DR4M 2LHCA 1J7KA 2UXDM 4IBGA 2L4FA 4L78A 1TF0B 4QOZC 3FRHA 2XFTA 3AV0A 2BJWA 4A3VB 5LMUM 3MK6A 2CP8A 1IQPA 3J81S 3CTWB 4UN2B 3I51A 4PT5A 3TQSA 4LF7M 1GL7A 4B3RM 3SAUA 2KXEA 4MGHA 1G3IA 4CGYB 4AG6A 4ANRA 4X65M 1J5EM 4REZA 1NO1A 1L1TA 2RGOA 3L2AA 4LJ4A 4B7GA 5EP3A 2ZTDA 2MJ5B 4NXNM 2LVAA 3ZQJA 4GRIA 1NV8A 3A42A 1QQWA 3TWKA 3GLFA 1IXSB 3FE3A 1NNJA 2L7IA 3K9OA 3ILKA 3VKHA 4RNAA 4ITQA 3VK8A 4AKIA 4JN6A 4M9SA 1Z6TA 1XB2B 2KHHA 3E9SA 4CIZA 2KA6B 3FTDA 2X49A 4FCVA 4P16A 2RRUA 2XGNA 2MR9A 3I4VA 4NRWA 4FCTA 4KLNA 4XK8F 2UUCM 2UXBM 1I94M 2DAEA 1IY0A 4IBFA 2BNKA 2DWZB 2V6ZM 2D7GA 2LTUA 4DV4M 1H6UA 4YY3M 4QOSA 3FUXA 4FD2A 1QUTA 3VFDA 4DBGB 2C9OA 2DWMA 4LG2A 1T6OA 2CHGA 4XGIA 4QNMA 2VF7A 2EJSA 2HAKA 2JY6B 1HT1E 2CFOA 4LFCM 2G8LA 3PFIA 2Z3XA 2LHGA 2R46A 3UK6A 4DR2M 1W5SA 4F2LA 4JI1M 3HX3A 2QPAA 2KNAA 4BBAA 2I7NA 1D0MA 2DAGA 3MMPA 3L28A 2QBYB 2QZ4A 3HKPA 1N78A 3LCVB 2DHRA 4WP2A 5GKNA 5EXSA 3AOEC 1OAIA 1R5LA 1OFHA 1YSYA 3U61A 4FWGA 1SXJD 4GHAA 4FCWA 5IWAM 4LF6M 2FH0A 1VEKA 3ZCBB 3DOAA 3R8FA 1MN3A 2HCBA 4JXJA 3KW6A 2OO9A 3E4RA 4L8RC 2JXNA 3DFZA 4DUZM 1YLAA 3W67A 5A2QS 4IBIA 4LF9M 4DR3M 2XLJA 2XZFA 1DGFA 1X37A
chains in the Genus database with same CATH topology
2KNVA 3F92A 2O25A 1Q02A 2H5XA 1VQ1A 2CWBA 1OQYA 2DNAA 1VEJA 1G41A 3GLIE 1WR1B 2K9DA 1TTEA 1IFYA 1HT2E 2JZ1A 2QHOB 3B89A 1EFUB 2HWJA 2JY7A 4GEWA 1WIVA 2LBCA 5DFLA 1GO5A 2LVQD 2MROB 2DAMA 1DV0A 4F1IA 2JUJA 2L4FA 3E46A 1SG9A 3FRHA 2JZ0A 2L4EA 3IECA 1VG5A 2CP8A 2DAKA 1WGNA 1WGLA 2OOAA 2DENA 2L2DA 2K0BX 2DI0A 4UN2B 1VDLA 1IM2A 1Y8GA 1G3IA 1BVSA 2KNZA 3FRIA 3E21A 4HEOA 2EKFA 2ZTDA 2MJ5B 1IXSA 2WZJA 2LVAA 2BWEA 1NV8A 1ZMVA 1ZMUA 2LVPC 2EKKA 3FE3A 2MGWA 1VEGA 3K9OA 4G3OA 2DAIA 1XB2B 2B3TA 2KHHA 2LVOC 1OTRA 2DZLA 4Q7JA 3BBZA 1OKSA 2QNJA 2RRUA 1PGYA 2MR9A 2DHYA 1T43A 1F4IA 3LCUA 3IHPA 4R71A 2DAEA 2JNHA 2DKLA 1AIPC 2LTUA 1C7YA 1E94E 1QZEA 2OOBA 1DO2A 4DBGB 1JR3E 1ZMWA 3GLHE 1T6OA 3H4JA 2R0IA 1KYIA 2EJSA 5JI2E 2HAKA 2LVNC 2JP7A 2JY6B 1HT1E 3K9PA 1A5TA 1HQYE 1DO0A 1NV9A 4F2LA 1XXHE 2JY8A 2BWBA 2KNAA 1V92A 1HJPA 1G4AE 1TR8A 2DAGA 3MMPA 3T6PA 3LCVB 4WP2A 1OAIA 2ZTCA 1P3QQ 1WHCA 1CUKA 1VEKA 3GLFE 1MN3A 2JY5A 1ZV1A 2OO9A 1WJ7A 1YLAA 1UFZA 2QSFX 3GLGE 2G3QA 1R4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNV A;  3F92 A;  2O25 A;  1Q02 A;  2H5X A;  1VQ1 A;  2CWB A;  1OQY A;  2DNA A;  1VEJ A;  1G41 A;  3GLI E;  1WR1 B;  2K9D A;  1TTE A;  1IFY A;  1HT2 E;  2JZ1 A;  2QHO B;  3B89 A;  1EFU B;  2HWJ A;  2JY7 A;  4GEW A;  1WIV A;  2LBC A;  5DFL A;  1GO5 A;  2LVQ D;  2MRO B;  2DAM A;  1DV0 A;  4F1I A;  2JUJ A;  2L4F A;  3E46 A;  1SG9 A;  3FRH A;  2JZ0 A;  2L4E A;  3IEC A;  1VG5 A;  2CP8 A;  2DAK A;  1WGN A;  1WGL A;  2OOA A;  2DEN A;  2L2D A;  2K0B X;  2DI0 A;  4UN2 B;  1VDL A;  1IM2 A;  1Y8G A;  1G3I A;  1BVS A;  2KNZ A;  3FRI A;  3E21 A;  4HEO A;  2EKF A;  2ZTD A;  2MJ5 B;  1IXS A;  2WZJ A;  2LVA A;  2BWE A;  1NV8 A;  1ZMV A;  1ZMU A;  2LVP C;  2EKK A;  3FE3 A;  2MGW A;  1VEG A;  3K9O A;  4G3O A;  2DAI A;  1XB2 B;  2B3T A;  2KHH A;  2LVO C;  1OTR A;  2DZL A;  4Q7J A;  3BBZ A;  1OKS A;  2QNJ A;  2RRU A;  1PGY A;  2MR9 A;  2DHY A;  1T43 A;  1F4I A;  3LCU A;  3IHP A;  4R71 A;  2DAE A;  2JNH A;  2DKL A;  1AIP C;  2LTU A;  1C7Y A;  1E94 E;  1QZE A;  2OOB A;  1DO2 A;  4DBG B;  1JR3 E;  1ZMW A;  3GLH E;  1T6O A;  3H4J A;  2R0I A;  1KYI A;  2EJS A;  5JI2 E;  2HAK A;  2LVN C;  2JP7 A;  2JY6 B;  1HT1 E;  3K9P A;  1A5T A;  1HQY E;  1DO0 A;  1NV9 A;  4F2L A;  1XXH E;  2JY8 A;  2BWB A;  2KNA A;  1V92 A;  1HJP A;  1G4A E;  1TR8 A;  2DAG A;  3MMP A;  3T6P A;  3LCV B;  4WP2 A;  1OAI A;  2ZTC A;  1P3Q Q;  1WHC A;  1CUK A;  1VEK A;  3GLF E;  1MN3 A;  2JY5 A;  1ZV1 A;  2OO9 A;  1WJ7 A;  1YLA A;  1UFZ A;  2QSF X;  3GLG E;  2G3Q A;  1R4G A; 
#chains in the Genus database with same CATH topology
 2QEN A;  1TH4 A;  3GQ3 A;  1NY5 A;  3F92 A;  3IG5 A;  4MB7 A;  4LJ7 A;  4R7G A;  3CGW A;  1IBL M;  3FTC A;  1L2D A;  2C9C A;  3U6L A;  1VEJ A;  1DGB A;  1XXH A;  2CEA A;  2AHM A;  2CRU A;  3TWL A;  3GLI E;  1WR1 B;  4S12 A;  1QDT A;  2V1U A;  4LF4 M;  2QHO B;  4R3D A;  5KPR A;  3T15 A;  3MJ5 A;  1N77 A;  4AKG A;  1WIV A;  2LBC A;  4MGZ E;  2LVQ D;  2MRO B;  3MHV C;  3UMM A;  3UJN A;  1FNN A;  3J7A S;  4DR1 M;  3U6O A;  2JUJ A;  3E46 A;  3HHX A;  1R2Z A;  1NSF A;  2KRK A;  1XMQ M;  3KOZ E;  1QZM A;  4JI6 M;  2L6O A;  2HHH M;  1K3W A;  1WGN A;  3U6D A;  2CV1 A;  4D81 A;  3B74 A;  2L2D A;  2DI0 A;  1NJG A;  3W0L B;  2NQ8 C;  5EP2 A;  4Z6Y A;  3SAR A;  3AL0 C;  1QAM A;  2KNZ A;  3FRI A;  4HEO A;  4D80 A;  2O5R A;  2HKJ A;  2Y21 A;  4DUY M;  1PJT A;  1Z59 A;  1D0L A;  1GVN A;  1XMO M;  2EKF A;  1L1Z A;  2M5Z A;  5EP1 A;  4RF0 A;  3PXG A;  2QQ8 A;  2BWE A;  3EIE A;  1HNW M;  1ZMU A;  4GKK M;  3C3E A;  3TL4 X;  4CJ6 A;  3GPY A;  4JI0 M;  4MGI E;  3K92 A;  3SMP A;  3M6A A;  3HHZ A;  4OU7 A;  3JR4 A;  3GLF B;  3KVW A;  5E6J A;  5FTL A;  5F3W A;  2VQE M;  1PJJ A;  3KOW E;  3GP1 A;  4GC9 A;  3LVW A;  1IN4 A;  1L2B A;  1QAN A;  4AZF A;  2R62 A;  4Q7J A;  5FSW A;  3BBZ A;  3QYE A;  4LRS A;  3J2P B;  2KEB A;  1R7R A;  2LNH C;  3TE6 A;  4FVM A;  2DHY A;  2OPF A;  1T43 A;  3KS8 A;  1VDD A;  1F4I A;  4W5W A;  3PVS A;  3AOG A;  3T1Y M;  1IN7 A;  2JNH A;  3VDP A;  5IZ7 D;  2LXE A;  2VF8 A;  5KPZ A;  1C7Y A;  1I4W A;  3L25 A;  3HHY A;  4IBD A;  1XC8 A;  1RU3 A;  1HQC A;  1TH2 A;  2F5P A;  4IBK A;  4JI7 M;  3I04 M;  3U6Q A;  1OIP A;  2ZAM A;  5EJC A;  2VQF M;  2R18 A;  3FUV A;  3LMM A;  4GKJ M;  1GJS A;  2VDB B;  2ZBK B;  4LRT A;  2UUA M;  1HQY E;  1DO0 A;  1MX0 A;  1N34 M;  4HL4 A;  2H1R A;  1J09 A;  4L6V 6;  4LFA M;  1IN6 A;  4B3S M;  1DGH A;  3THG A;  2CV0 A;  1AUA A;  1G4A E;  1GKI A;  3LQR A;  4DV3 M;  1C1K A;  4WUR A;  1XNR M;  3VK7 A;  3HU1 A;  3QYB A;  3SHF A;  3B7N A;  2ZTC A;  2K6B A;  3FUW A;  3GQ5 A;  4BLC A;  2X4A A;  1CUK A;  4DV1 M;  4PD2 A;  3GLF E;  3C9P A;  3U61 B;  1EE8 A;  1ZV1 A;  2QP9 X;  3KOX E;  1WJ7 A;  3SYL A;  3Q8X A;  2C99 A;  1UFZ A;  2O01 F;  5ITU A;  5KPT A;  4LJ6 A;  4AKH A;  2F5S A;  2X8A A;  2I7P A;  3HWS A;  4GMQ A;  5ITR A;  4NL4 H;  2QCU A;  3J80 S;  3LVV A;  2FNA A;  4B3T M;  2KNV A;  1Z5B A;  2FS1 A;  3SBJ A;  2H5X A;  2CV2 A;  4L16 A;  4MGK E;  2DNA A;  1IN5 A;  3GPU A;  3UZU A;  2C96 A;  1MJG M;  2P5T A;  2WSF F;  4NSR A;  4QNR A;  4X66 M;  1TTE A;  5EQT A;  1K82 A;  1ZQ9 A;  3SFZ A;  3TPZ A;  2V1C A;  1XXH B;  2ERC A;  4G4N A;  2FE8 A;  1Q39 A;  2DXI A;  3B89 A;  1JB0 F;  1Z5A A;  3GRU A;  5KQD A;  4B08 A;  4JI8 M;  2KRU A;  1N33 M;  3FYD A;  2UXC M;  5IT9 S;  3D8B A;  4TUW A;  1GO5 A;  2R65 A;  3HJ8 A;  3L27 A;  5FTN A;  2F4V M;  1PM5 A;  4I81 A;  3C58 A;  5EP4 A;  3GLH A;  3JR5 A;  1SXJ C;  1SG9 A;  3GO8 A;  1PJI A;  2F5O A;  1HNZ M;  2L4E A;  3AOE A;  2DAK A;  2XSZ A;  3KOY E;  1QAO A;  3I01 M;  3NBI A;  2OOA A;  1YE9 A;  4IIW A;  4M0D A;  3GLI A;  1VDL A;  2Z7J A;  1IM2 A;  4JYA M;  4LZJ A;  5ITT A;  3A46 A;  1BVS A;  1R2Y A;  3E21 A;  3H4M A;  4CHT B;  3U60 A;  2DWL A;  2Z4R A;  1WXQ A;  4B7H A;  1N32 M;  1SXJ A;  5EXP A;  5BR8 M;  2WZJ A;  3KSX A;  3ZH9 B;  1HNX M;  3NBX X;  4AG5 A;  3PNV A;  3VDU A;  1NVM A;  4JI4 M;  2EKK A;  1TH3 A;  1JR3 D;  2MGW A;  2KDL A;  1E9R A;  3FKE A;  3J27 B;  4IBJ A;  4G3O A;  3GLG A;  1T3T A;  3FUT A;  5BPV A;  4OW0 A;  3Q8G A;  4JI3 M;  3U6P A;  4LGY A;  2DZN B;  3C3D A;  3VLF B;  1OFI A;  1OJL A;  4OVZ A;  2B3T A;  2LVO C;  2EA0 A;  1OTR A;  2DZL A;  3U6C A;  3A45 A;  3A98 B;  2QNJ A;  5ITQ A;  2M60 A;  4DV0 M;  3R9X B;  4LY6 A;  4AI6 A;  3ZC7 B;  2KW0 A;  4K0K M;  2YR0 A;  4G6Z A;  1S3S A;  4LF5 M;  2XFS A;  3LCU A;  3KP1 E;  3WHL A;  2CHQ A;  1Q3B A;  3IHP A;  2UUB M;  2EO2 A;  4BB9 A;  1LV7 A;  4R71 A;  4JI2 M;  4LF8 M;  2DKL A;  1OAO C;  1AIP C;  2G5G X;  3HZJ A;  1QZE A;  3SAV A;  3L29 A;  5LMN M;  2LWX A;  3DZD A;  2J5Y A;  1JR3 E;  1ZMW A;  1IBM M;  4QHT A;  3GQ4 A;  1IBK M;  5ITX A;  3T38 A;  1KYI A;  4MM3 B;  1MU5 A;  2R44 A;  4NRV A;  5JI2 E;  1PRB A;  2JP7 A;  2XH9 A;  1V33 A;  3K9P A;  1A5T A;  3SHG B;  1KFV A;  1IY2 A;  3DA1 A;  1FJG M;  1NV9 A;  5DNY A;  2JY8 A;  2BWB A;  4Z8X A;  1V92 A;  1L8Q A;  1LTM A;  2MH8 A;  3KXE C;  4IJF A;  1ORY B;  4LJ8 A;  3KP0 E;  2Z4S A;  3KS4 A;  4LZZ A;  2RKO A;  3K1J A;  3T6P A;  2APL A;  4IBB A;  1DGH B;  4MGY E;  1XWI A;  1GLN A;  2GQF A;  3HJQ A;  1IY1 A;  1NJF A;  2R4J A;  4LJ9 A;  4NC6 A;  1TDH A;  1WHC A;  3RGS A;  2DVW B;  3M7G A;  1YUB A;  2CHV A;  4PCZ A;  3T1H M;  2Y0T A;  2QSF X;  1R6B X;  2G3Q A;  3HHW A;  1D2N A;  2ZAO A;  5KO3 A;  1D0K A;  3U6S A;  3RFW A;  3U6M A;  4NXM M;  1G59 A;  1Z5C A;  1NHG C;  1Q02 A;  4II7 A;  1QYR A;  2RGH A;  4JI5 M;  4FWH A;  1OQY A;  4M9X A;  2HL7 A;  3SYK A;  2C98 A;  2K9D A;  2YNM D;  1IFY A;  1HT2 E;  1OIZ A;  4QHS A;  1IXZ A;  1GJT A;  1K3X A;  3NWL A;  4FW9 A;  4M0W A;  3U5Z A;  2K47 A;  3UGJ A;  4I8O A;  5E26 A;  5C18 A;  3SAT A;  1E9S A;  4LFB M;  1IN8 A;  4KT0 F;  3HU2 A;  2YFQ A;  2HWJ A;  3LW5 F;  4RF1 A;  4IBE A;  2A5Y B;  2JY7 A;  4AQY M;  4L4U A;  4LJ5 A;  4B3M M;  2OQ4 A;  2DAM A;  3FUU A;  5JI3 E;  1PJQ A;  3V76 A;  5FTK A;  1EIJ A;  4GIT A;  4F1I A;  4KHP M;  4WW0 A;  4KOD A;  2FOI C;  3I4Y A;  4NOO B;  2JZ0 A;  4KO8 A;  3IEC A;  3GLH B;  1VG5 A;  4D82 A;  4AW4 A;  4EIW A;  3CF6 E;  1WGL A;  5H37 D;  3L26 A;  3CF2 A;  2DEN A;  2K0B X;  5FTM A;  5L8R F;  2W82 A;  2C5R A;  1NHW C;  2WSE F;  1Y8G A;  1QVR A;  2XZU A;  4CIS A;  3EIH A;  2F5Q A;  3FYC A;  3GLI B;  4GH9 A;  3BXW A;  2Y20 A;  3KDS E;  4DV5 M;  1IXS A;  1G71 A;  3U60 B;  1N36 M;  4X64 M;  1W5T A;  1ZMV A;  2R6F A;  1SXJ B;  2N35 A;  4LGM A;  3AKZ A;  3SAW A;  2LVP C;  3GRV A;  1VEG A;  3K2L A;  3WHK A;  4DR7 M;  1GL6 A;  5EXX A;  3HY5 A;  5KQ8 A;  1QDR A;  2VII A;  1NNU C;  1PJS A;  2DAI A;  2ZM6 M;  2XSZ D;  3GLG B;  3B7Q A;  4GIP A;  3GPX A;  1Q3C A;  1OKS A;  2UU9 M;  1TGU A;  3LQQ A;  1G8P A;  1PGY A;  2CUZ A;  4OVZ B;  4B7F A;  3FTF A;  2XEP A;  2GNO A;  8CAT A;  1XHB A;  4JV5 M;  5DYG A;  4RKU F;  3HU3 A;  2EUC A;  4DV7 M;  4L15 A;  2WSC F;  3RE8 A;  4OX9 M;  1E94 E;  2DWN A;  2OOB A;  4P17 A;  1ZAE A;  1DO2 A;  2L7H A;  3VKG A;  4G4Q A;  3GLH E;  3PNY A;  4FWD A;  2R45 A;  2R0I A;  3B9P A;  3FD9 A;  2J7O A;  3H4J A;  3IG8 A;  4IJE A;  4GHL A;  1GAB A;  3J7B A;  2KZS A;  4GC5 A;  4I4L A;  2D7H A;  2LVN C;  3GRR A;  3GRY A;  1QAQ A;  2Y0Q A;  4IBC A;  2QBY A;  4NSO B;  1DGG A;  3HJS A;  4DR5 M;  2KZU A;  3GPP A;  1XXH E;  3HGI A;  4YHH M;  3AFH A;  2Z8Y M;  1HJP A;  4DV2 M;  1TR8 A;  4Y28 F;  4X62 M;  4ZPX A;  3D8L A;  3BOS A;  3AJI B;  7CAT A;  4XBO A;  1SXJ E;  2JWS A;  1NY6 A;  1E32 A;  1P3Q Q;  1QUS A;  2R4E A;  1L2C A;  4LJA A;  4M9Z A;  3KFU G;  4PDI A;  4G4R A;  2JY5 A;  2BJV A;  2FFJ A;  3KSJ A;  4PDG A;  4G4O A;  3U6E A;  3RGP A;  3B7Z A;  5C1B A;  5IRE B;  1JR3 A;  3K8Z A;  2CE7 A;  3GLG E;  2J7N A;  2E5L M;  4HLQ A;  2F5N A;  1R4G A;  3FTE A;  2ZAN A;  3OTO M;  3SC3 A;  2YQZ A;  2O25 A;  3TWM A;  1VQ1 A;  5FTJ A;  2CWB A;  1XNQ M;  5ITY A;  4I5S A;  1G41 A;  1JQJ C;  2JA2 A;  1HR0 M;  4DR6 M;  3QWL A;  4LCB A;  2XF3 A;  3M0E A;  3SMS A;  2JZ1 A;  3JAM S;  4DV6 M;  1IXR C;  2DZO B;  2Q2E B;  5EXT A;  3W0F A;  1EFU B;  1UM8 A;  3W68 A;  3CF0 A;  3U5Z B;  5DFL A;  4GEW A;  4MH0 E;  3SAS A;  2D7E A;  2LH0 A;  3QAU A;  5FLX S;  1TDZ A;  1DV0 A;  2L09 A;  5DYI A;  5ITX E;  1KSF X;  1V34 A;  1N75 A;  4DR4 M;  2LHC A;  1J7K A;  2UXD M;  4IBG A;  2L4F A;  4L78 A;  1TF0 B;  4QOZ C;  3FRH A;  2XFT A;  3AV0 A;  2BJW A;  4A3V B;  5LMU M;  3MK6 A;  2CP8 A;  1IQP A;  3J81 S;  3CTW B;  4UN2 B;  3I51 A;  4PT5 A;  3TQS A;  4LF7 M;  1GL7 A;  4B3R M;  3SAU A;  2KXE A;  4MGH A;  1G3I A;  4CGY B;  4AG6 A;  4ANR A;  4X65 M;  1J5E M;  4REZ A;  1NO1 A;  1L1T A;  2RGO A;  3L2A A;  4LJ4 A;  4B7G A;  5EP3 A;  2ZTD A;  2MJ5 B;  4NXN M;  2LVA A;  3ZQJ A;  4GRI A;  1NV8 A;  3A42 A;  1QQW A;  3TWK A;  3GLF A;  1IXS B;  3FE3 A;  1NNJ A;  2L7I A;  3K9O A;  3ILK A;  3VKH A;  4RNA A;  4ITQ A;  3VK8 A;  4AKI A;  4JN6 A;  4M9S A;  1Z6T A;  1XB2 B;  2KHH A;  3E9S A;  4CIZ A;  2KA6 B;  3FTD A;  2X49 A;  4FCV A;  4P16 A;  2RRU A;  2XGN A;  2MR9 A;  3I4V A;  4NRW A;  4FCT A;  4KLN A;  4XK8 F;  2UUC M;  2UXB M;  1I94 M;  2DAE A;  1IY0 A;  4IBF A;  2BNK A;  2DWZ B;  2V6Z M;  2D7G A;  2LTU A;  4DV4 M;  1H6U A;  4YY3 M;  4QOS A;  3FUX A;  4FD2 A;  1QUT A;  3VFD A;  4DBG B;  2C9O A;  2DWM A;  4LG2 A;  1T6O A;  2CHG A;  4XGI A;  4QNM A;  2VF7 A;  2EJS A;  2HAK A;  2JY6 B;  1HT1 E;  2CFO A;  4LFC M;  2G8L A;  3PFI A;  2Z3X A;  2LHG A;  2R46 A;  3UK6 A;  4DR2 M;  1W5S A;  4F2L A;  4JI1 M;  3HX3 A;  2QPA A;  2KNA A;  4BBA A;  2I7N A;  1D0M A;  2DAG A;  3MMP A;  3L28 A;  2QBY B;  2QZ4 A;  3HKP A;  1N78 A;  3LCV B;  2DHR A;  4WP2 A;  5GKN A;  5EXS A;  3AOE C;  1OAI A;  1R5L A;  1OFH A;  1YSY A;  3U61 A;  4FWG A;  1SXJ D;  4GHA A;  4FCW A;  5IWA M;  4LF6 M;  2FH0 A;  1VEK A;  3ZCB B;  3DOA A;  3R8F A;  1MN3 A;  2HCB A;  4JXJ A;  3KW6 A;  2OO9 A;  3E4R A;  4L8R C;  2JXN A;  3DFZ A;  4DUZ M;  1YLA A;  3W67 A;  5A2Q S;  4IBI A;  4LF9 M;  4DR3 M;  2XLJ A;  2XZF A;  1DGF A;  1X37 A; 
#chains in the Genus database with same CATH homology
 2KNV A;  3F92 A;  2O25 A;  1Q02 A;  2H5X A;  1VQ1 A;  2CWB A;  1OQY A;  2DNA A;  1VEJ A;  1G41 A;  3GLI E;  1WR1 B;  2K9D A;  1TTE A;  1IFY A;  1HT2 E;  2JZ1 A;  2QHO B;  3B89 A;  1EFU B;  2HWJ A;  2JY7 A;  4GEW A;  1WIV A;  2LBC A;  5DFL A;  1GO5 A;  2LVQ D;  2MRO B;  2DAM A;  1DV0 A;  4F1I A;  2JUJ A;  2L4F A;  3E46 A;  1SG9 A;  3FRH A;  2JZ0 A;  2L4E A;  3IEC A;  1VG5 A;  2CP8 A;  2DAK A;  1WGN A;  1WGL A;  2OOA A;  2DEN A;  2L2D A;  2K0B X;  2DI0 A;  4UN2 B;  1VDL A;  1IM2 A;  1Y8G A;  1G3I A;  1BVS A;  2KNZ A;  3FRI A;  3E21 A;  4HEO A;  2EKF A;  2ZTD A;  2MJ5 B;  1IXS A;  2WZJ A;  2LVA A;  2BWE A;  1NV8 A;  1ZMV A;  1ZMU A;  2LVP C;  2EKK A;  3FE3 A;  2MGW A;  1VEG A;  3K9O A;  4G3O A;  2DAI A;  1XB2 B;  2B3T A;  2KHH A;  2LVO C;  1OTR A;  2DZL A;  4Q7J A;  3BBZ A;  1OKS A;  2QNJ A;  2RRU A;  1PGY A;  2MR9 A;  2DHY A;  1T43 A;  1F4I A;  3LCU A;  3IHP A;  4R71 A;  2DAE A;  2JNH A;  2DKL A;  1AIP C;  2LTU A;  1C7Y A;  1E94 E;  1QZE A;  2OOB A;  1DO2 A;  4DBG B;  1JR3 E;  1ZMW A;  3GLH E;  1T6O A;  3H4J A;  2R0I A;  1KYI A;  2EJS A;  5JI2 E;  2HAK A;  2LVN C;  2JP7 A;  2JY6 B;  1HT1 E;  3K9P A;  1A5T A;  1HQY E;  1DO0 A;  1NV9 A;  4F2L A;  1XXH E;  2JY8 A;  2BWB A;  2KNA A;  1V92 A;  1HJP A;  1G4A E;  1TR8 A;  2DAG A;  3MMP A;  3T6P A;  3LCV B;  4WP2 A;  1OAI A;  2ZTC A;  1P3Q Q;  1WHC A;  1CUK A;  1VEK A;  3GLF E;  1MN3 A;  2JY5 A;  1ZV1 A;  2OO9 A;  1WJ7 A;  1YLA A;  1UFZ A;  2QSF X;  3GLG E;  2G3Q A;  1R4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...