4G3OA

Crystal structure of the cue domain of the e3 ubiquitin ligase amfr (gp78)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
RGSENLYFQGQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase AMFR
publication title Crystal structure of the CUE domain of the E3 ubiquitin ligase AMFR (gp78)
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 20
structure length 53
sequence length 53
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4g3oA00
1JR3E 3E46A 2CWBA 1WHCA 1UFZA 1WR1B 4WP2A 2G3QA 2DAMA 1VEJA 1G4AE 2MR9A 2KHHA 3H4JA 1IFYA 4UN2B 1C7YA 1VEKA 2LVAA 2MGWA 2LVNC 1A5TA 3K9OA 1EFUB 1T6OA 2JY5A 2JUJA 2EKFA 2MJ5B 4GEWA 3LCVB 2QNJA 3K9PA 2L4EA 3T6PA 5JI2E 1T43A 2DNAA 2K0BX 2WZJA 5DFLA 2DAEA 3MMPA 2DAIA 1VQ1A 2LVPC 1ZMWA 2ZTCA 1AIPC 3FRIA 2O25A 1WJ7A 1XXHE 1Y8GA 2LBCA 2DENA 1ZMUA 1ZMVA 2JNHA 1QZEA 3IHPA 4Q7JA 1OKSA 1HT1E 2OOBA 2H5XA 3E21A 4HEOA 2JZ1A 3BBZA 1KYIA 3FE3A 2QHOB 3GLFE 1WGNA 1VEGA 2K9DA 2KNAA 3GLIE 1HJPA 2DKLA 4G3OA 2JY6B 1WGLA 3FRHA 1BVSA 2BWEA 1YLAA 1G3IA 1MN3A 4F2LA 2JY8A 2LTUA 2EKKA 2LVOC 1E94E 2OOAA 1IM2A 1P3QQ 1XB2B 2BWBA 1OAIA 3B89A 2KNZA 1HT2E 2DAGA 2EJSA 1DO0A 1TR8A 2L4FA 1TTEA 2DZLA 2ZTDA 1R4GA 1IXSA 1OQYA 3F92A 2QSFX 2JY7A 1V92A 1DO2A 2L2DA 2HAKA 1Q02A 2MROB 1NV8A 4F1IA 1G41A 2DI0A 1OTRA 1F4IA 1SG9A 2CP8A 2DAKA 2B3TA 2OO9A 1WIVA 1HQYE 4DBGB 1CUKA 3GLGE 2HWJA 2R0IA 1NV9A 1VG5A 2JP7A 3GLHE 1GO5A 2KNVA 1VDLA 1ZV1A 2LVQD 2JZ0A 1PGYA 2RRUA 3IECA 1DV0A 4R71A 3LCUA 2DHYA
chains in the Genus database with same CATH superfamily
2CV1A 3C3DA 2YR0A 3E46A 2N35A 4GITA 2CWBA 3I51A 1UFZA 4P16A 4CISA 1QVRA 3J7BA 4JV5M 2AHMA 2LH0A 1G4AE 3WHKA 3U5ZB 3GQ3A 4B3TM 3HHWA 1V34A 2L09A 2KEBA 1VEKA 4MGYE 1N78A 1N75A 1J5EM 4X64M 5EP4A 2R44A 5EP1A 2FS1A 3KOZE 1IBLM 3K9OA 2CE7A 3GQ4A 2R62A 4GEWA 5BR8M 1WXQA 3LCVB 4JI8M 3K9PA 2ZANA 4B3RM 4JN6A 1PJQA 5C1BA 3L28A 1YSYA 4JI7M 3GPPA 3D8LA 3MJ5A 4NRWA 2LNHC 4EIWA 3T1YM 2DAIA 4LG2A 2ZAOA 2HHHM 1KSFX 1G8PA 1N34M 2O25A 4XK8F 4S12A 3SARA 4QNMA 4B7GA 2Y0TA 3KSXA 4HL4A 1WJ7A 3W0FA 2VDBB 3QYBA 7CATA 2V6ZM 3GQ5A 3QAUA 3SYLA 4IBJA 2JNHA 4ITQA 2JXNA 2M5ZA 3TQSA 1HNXM 2KZSA 4HEOA 2JZ1A 2QCUA 1OIPA 3HJSA 2RKOA 3GLFE 3B9PA 4LRTA 2CEAA 1VEGA 2K9DA 1SXJB 2KDLA 2MH8A 3T15A 2F5OA 1GJTA 3LVWA 2YQZA 5BPVA 4GMQA 2WSCF 2DWNA 1G71A 2EUCA 1BVSA 2BWEA 3GPYA 5GKNA 1YLAA 4QHSA 3GPXA 3W0LB 4L4UA 4LJ7A 3SAUA 1OJLA 4BB9A 2EKKA 4KO8A 2FFJA 2GQFA 2Y0QA 2OOAA 4M0WA 2CHQA 1IM2A 4LJ8A 3U61B 1MU5A 1HT2E 4QOSA 4CJ6A 5LMNM 1OAOC 2L7HA 2UU9M 1R4GA 4JI1M 4WW0A 3U6LA 1E32A 1GLNA 2JWSA 4LFAM 2EO2A 4OVZA 2QSFX 2X4AA 1ZAEA 1X37A 5L8RF 4IIWA 2L2DA 4LF6M 4IBDA 4Y28F 5EP2A 1NV8A 5F3WA 3CGWA 8CATA 3KXEC 4F1IA 1JQJC 1OIZA 2Z4SA 2V1UA 4I81A 1NY5A 2DAKA 3ZCBB 2F5PA 3JR5A 3SMSA 5IT9S 4KHPM 1HQYE 4NRVA 3GLGE 1VG5A 2HKJA 3B7NA 1XHBA 3L26A 1GO5A 1UM8A 2KNVA 5EXTA 2CRUA 3DFZA 4LJ5A 3EIHA 2XH9A 4GH9A 5ITUA 4DUYM 2CV2A 4II7A 1IN5A 3U60A 4LJ4A 2XSZD 3I04M 2L7IA 3GLHB 4IBEA 1D0KA 1C1KA 4G4NA 1L2DA 1Q3BA 1WR1B 2P5TA 2J7OA 4WP2A 2XZFA 4JI4M 1N36M 1VEJA 3SMPA 2BJVA 3TWKA 2R65A 3U6OA 3SAWA 1FJGM 2C9OA 4L78A 2KHHA 3HKPA 4L6V6 1IFYA 4UN2B 3JAMS 1NY6A 3HHZA 1R5LA 1QUTA 1PM5A 2XFTA 2LVAA 4B08A 3FD9A 4GHAA 2LVNC 3HU3A 1A5TA 1IY1A 4QNRA 4R7GA 4AKHA 1EFUB 4LJAA 2VIIA 3AV0A 3LMMA 3GP1A 3GLFA 3KW6A 2R18A 4IBFA 4MGIE 2C98A 4JI0M 3U6MA 1Q3CA 3A98B 3AL0C 1LV7A 1YUBA 2L4EA 4IJEA 2YNMD 1HR0M 4IBGA 5JI2E 4B7HA 1NO1A 1DGGA 1NJFA 2WZJA 5DFLA 3NBIA 4LZJA 3MMPA 4DR7M 1VQ1A 3KOXE 2ZTCA 3NWLA 4D81A 2F5QA 1AIPC 2R6FA 3RFWA 2UUBM 1IN4A 3KS8A 4DR5M 2QBYB 2R46A 2XF3A 5JI3E 1L2CA 3R8FA 3EIEA 3BOSA 3M0EA 1QAMA 1TH2A 4G4RA 1XXHE 3SBJA 4FWHA 4NXMM 4QOZC 3UJNA 2XZUA 1QQWA 1ZMUA 4CIZA 1ZMVA 1VDDA 2OOBA 2H5XA 5E26A 1DGHA 3SHFA 3E21A 3Q8GA 2D7GA 3BBZA 2OQ4A 3FE3A 1AUAA 4DV5M 1L1ZA 2Y20A 1H6UA 1J7KA 3V76A 3T1HM 1K82A 3AKZA 1WGNA 2BJWA 3BXWA 3DA1A 3FTCA 3FTEA 4M9XA 3GLIE 1N77A 1HJPA 3FTDA 2HCBA 5DNYA 4DV6M 3AFHA 4G3OA 1XMQM 3KP0E 1PRBA 3NBXX 2UUCM 3HZJA 2H1RA 1G3IA 5DYIA 4F2LA 4PCZA 3OTOM 2LTUA 4CHTB 3J7AS 2LVOC 1MX0A 4Z8XA 3GLGA 1IY2A 4JI6M 1XB2B 5LMUM 1QZMA 4FD2A 2KNZA 2DAGA 5KPZA 2CFOA 2OPFA 4DV4M 2O5RA 1TTEA 2ZTDA 1IXSA 1OQYA 2JA2A 2XSZA 3F92A 3UMMA 3VKHA 4NSOB 1I94M 3I4YA 4WURA 1V92A 3L27A 2XEPA 1JR3D 2C5RA 5KO3A 1Q02A 3HU2A 4DV3M 1DGFA 3W67A 1IBMM 1GVNA 1G41A 1QYRA 1OTRA 4LY6A 3SATA 2CP8A 3B7QA 2OO9A 3LQQA 5KPTA 3GPUA 2KZUA 3QWLA 4LJ6A 3VFDA 2LHGA 4D80A 1NHGC 2R0IA 2VQEM 1TGUA 1IY0A 4X65M 3VLFB 2E5LM 2KRUA 4BLCA 3K8ZA 3ZH9B 2JZ0A 3PVSA 1PGYA 3AOEA 4FCVA 4GKKM 3TE6A 3SASA 2VF8A 3LCUA 4IJFA 2Z4RA 4B3MM 1K3XA 4LF4M 3R9XB 1RU3A 3C3EA 3UZUA 2QENA 1HNZM 2KRKA 1HQCA 2G3QA 2ZAMA 2DAMA 3KDSE 5FSWA 5KPRA 4X62M 1V33A 2ERCA 4OW0A 1NNJA 4GHLA 4MGHA 1R2YA 2GNOA 2RGHA 1NHWC 1LTMA 2WSFF 1D0LA 1XXHA 2ZM6M 4OVZB 1E9RA 3K2LA 3AOEC 3GO8A 3KFUG 2QZ4A 5EXPA 3LVVA 2UUAM 4YY3M 3UK6A 4LGYA 2JY5A 2JUJA 3L29A 3IG8A 2MJ5B 4A3VB 2QNJA 4LCBA 1PJSA 3KP1E 3GLIA 3T6PA 1ZQ9A 4G4QA 1GKIA 4M9ZA 4GC9A 3SAVA 3HJQA 1T43A 2DNAA 4I4LA 1W5SA 1Z6TA 2DAEA 2DZOB 3ZC7B 3VDPA 4DR2M 4LF9M 2LVPC 2K47A 4R3DA 3FRIA 4G4OA 1QUSA 2YFQA 4XBOA 3U6DA 4GC5A 4PDGA 4JI3M 3U6CA 1SXJE 3U60B 5KQ8A 1IN8A 4ANRA 1SXJD 3FYDA 1IQPA 2LBCA 1KFVA 3MHVC 4Q7JA 3IHPA 1TDZA 2DWLA 1OKSA 3B74A 3DOAA 2C96A 4BBAA 5FTJA 2C9CA 1Z59A 2QHOB 4YHHM 2RGOA 1Q39A 4LF8M 2KNAA 2CHVA 3TPZA 3U6SA 4RF1A 1Z5BA 3JR4A 5C18A 2DKLA 3AOGA 2V1CA 2F4VM 1EIJA 2JY6B 4K0KM 4I8OA 4NL4H 1GL7A 3Q8XA 4X66M 4AG5A 4I5SA 3HU1A 3J80S 1MN3A 5EQTA 3KS4A 3GLFB 3RGPA 4AQYM 2FNAA 4AZFA 3IG5A 3FKEA 3TL4X 2X8AA 3CF2A 2DWZB 5FTKA 5H37D 1P3QQ 1D2NA 2UXBM 2X49A 3WHLA 3B89A 1FNNA 4KT0F 5FTLA 1Z5CA 4DUZM 3HX3A 2NQ8C 1DO0A 1TR8A 2L4FA 3U5ZA 1MJGM 4L8RC 2DZLA 2DXIA 1T3TA 3FUUA 2JY7A 4REZA 3U6EA 4MB7A 1E9SA 1DO2A 3PFIA 4FVMA 2HAKA 1TH3A 2WSEF 2DI0A 4JI5M 1F4IA 4L15A 4LFCM 2R45A 1DGHB 1S3SA 2Y21A 2XFSA 1L2BA 5EXSA 2CHGA 3UGJA 3E9SA 3HJ8A 4PDIA 1JB0F 1NNUC 1GL6A 1WIVA 4JI2M 2UXCM 1N33M 1CUKA 1NV9A 5ITXE 2JP7A 3GLHE 2R4JA 4IBCA 3D8BA 4LGMA 3PXGA 1VDLA 3GRRA 1ZV1A 4P17A 2DWMA 3M6AA 1NJGA 4G6ZA 4M0DA 4MGZE 5IZ7D 4AKIA 3GRUA 1IXZA 3T38A 3M7GA 3IECA 2RRUA 4DR1M 5ITYA 1NSFA 3HHXA 3C58A 3H4MA 2BNKA 3K1JA 1OFIA 4R71A 4LJ9A 5A2QS 1TDHA 3FUTA 1JR3E 3GLGB 1L8QA 4IBIA 3FUWA 4AI6A 1J09A 1WHCA 4RF0A 1L1TA 5KQDA 4JYAM 2C99A 3FYCA 4MM3B 1W5TA 4JXJA 2MR9A 1SXJA 2R4EA 3KOYE 4XGIA 1IXSB 4DV2M 4MGKE 2F5SA 3H4JA 4W5WA 1C7YA 1Z5AA 3MK6A 3GRVA 2CV0A 3A42A 2KW0A 4NOOB 4DV7M 1XNQM 2MGWA 3K92A 5EXXA 3L2AA 1XWIA 4AW4A 3J81S 1T6OA 2Z8YM 3C9PA 2VQFM 2EKFA 4AG6A 5IREB 2VF7A 3CTWB 3W68A 3CF6E 3HWSA 2CUZA 4D82A 3ZQJA 1QANA 3TWMA 1R6BX 3VK7A 2A5YB 3I4VA 4RNAA 3LQRA 5FLXS 1IN7A 2ZBKB 1SXJC 2K0BX 3U61A 3PNVA 4HLQA 3PNYA 1ZMWA 2FH0A 4IBBA 3FTFA 1QAQA 3ILKA 1TF0B 3U6QA 2J7NA 3CF0A 1OFHA 2FOIC 3TWLA 2W82A 1G59A 2M60A 3FUVA 2LXEA 1IXRC 2I7NA 1Y8GA 3KSJA 2XLJA 2DENA 3A45A 2XGNA 1XC8A 3SFZA 1QZEA 2K6BA 1N32M 2O01F 1NVMA 1HT1E 4DR6M 1GABA 4FCWA 4QHTA 3KVWA 1QAOA 1QDTA 2HL7A 3AJIB 3B7ZA 1KYIA 4FWDA 4B7FA 3A46A 3FUXA 4GKJM 5ITQA 1IN6A 3SC3A 2UXDM 2DHRA 1XXHB 3E4RA 2KXEA 4GIPA 4KLNA 1DGBA 4L16A 3HGIA 1WGLA 2LHCA 5FTNA 3FRHA 1EE8A 4NXNM 4OX9M 2G8LA 1YE9A 4NSRA 1PJJA 3DZDA 3VKGA 4TUWA 5E6JA 3LW5F 2JY8A 4MH0E 3RGSA 3VDUA 2KA6B 5IWAM 3GLIB 1E94E 5ITXA 5ITRA 1ORYB 3GLHA 4KODA 5EJCA 4DV0M 2BWBA 3VK8A 2LWXA 1OAIA 3J2PB 1GJSA 3THGA 2D7EA 3QYEA 2EJSA 2Q2EB 3RE8A 4FW9A 3U6PA 1K3WA 2I7PA 1D0MA 3I01M 4PT5A 4LZZA 4RKUF 2Z7JA 4FWGA 3KOWE 4GRIA 1JR3A 1PJIA 4ZPXA 4DR3M 4PD2A 2F5NA 1XNRM 2D7HA 2G5GX 4NC6A 2MROB 4M9SA 2J5YA 1XMOM 4FCTA 1I4WA 1TH4A 5FTMA 4Z6YA 4CGYB 4LFBM 4DR4M 4LRSA 2EA0A 3SYKA 4DV1M 1SG9A 3L25A 2B3TA 3J27B 1R7RA 4IBKA 3HHYA 4AKGA 4OU7A 4DBGB 4B3SM 2QP9X 3GRYA 3SHGB 2APLA 1IBKM 2HWJA 2FE8A 1QDRA 2QQ8A 1PJTA 2QPAA 2LVQD 2DVWB 1R2ZA 1HNWM 5EP3A 2DZNB 2Z3XA 2QBYA 3HY5A 1DV0A 4LF7M 2L6OA 4LF5M 5ITTA 2DHYA 5DYGA
chains in the Genus database with same CATH topology
1JR3E 3E46A 2CWBA 1WHCA 1UFZA 1WR1B 4WP2A 2G3QA 2DAMA 1VEJA 1G4AE 2MR9A 2KHHA 3H4JA 1IFYA 4UN2B 1C7YA 1VEKA 2LVAA 2MGWA 2LVNC 1A5TA 3K9OA 1EFUB 1T6OA 2JY5A 2JUJA 2EKFA 2MJ5B 4GEWA 3LCVB 2QNJA 3K9PA 2L4EA 3T6PA 5JI2E 1T43A 2DNAA 2K0BX 2WZJA 5DFLA 2DAEA 3MMPA 2DAIA 1VQ1A 2LVPC 1ZMWA 2ZTCA 1AIPC 3FRIA 2O25A 1WJ7A 1XXHE 1Y8GA 2LBCA 2DENA 1ZMUA 1ZMVA 2JNHA 1QZEA 3IHPA 4Q7JA 1OKSA 1HT1E 2OOBA 2H5XA 3E21A 4HEOA 2JZ1A 3BBZA 1KYIA 3FE3A 2QHOB 3GLFE 1WGNA 1VEGA 2K9DA 2KNAA 3GLIE 1HJPA 2DKLA 4G3OA 2JY6B 1WGLA 3FRHA 1BVSA 2BWEA 1YLAA 1G3IA 1MN3A 4F2LA 2JY8A 2LTUA 2EKKA 2LVOC 1E94E 2OOAA 1IM2A 1P3QQ 1XB2B 2BWBA 1OAIA 3B89A 2KNZA 1HT2E 2DAGA 2EJSA 1DO0A 1TR8A 2L4FA 1TTEA 2DZLA 2ZTDA 1R4GA 1IXSA 1OQYA 3F92A 2QSFX 2JY7A 1V92A 1DO2A 2L2DA 2HAKA 1Q02A 2MROB 1NV8A 4F1IA 1G41A 2DI0A 1OTRA 1F4IA 1SG9A 2CP8A 2DAKA 2B3TA 2OO9A 1WIVA 1HQYE 4DBGB 1CUKA 3GLGE 2HWJA 2R0IA 1NV9A 1VG5A 2JP7A 3GLHE 1GO5A 2KNVA 1VDLA 1ZV1A 2LVQD 2JZ0A 1PGYA 2RRUA 3IECA 1DV0A 4R71A 3LCUA 2DHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR3 E;  3E46 A;  2CWB A;  1WHC A;  1UFZ A;  1WR1 B;  4WP2 A;  2G3Q A;  2DAM A;  1VEJ A;  1G4A E;  2MR9 A;  2KHH A;  3H4J A;  1IFY A;  4UN2 B;  1C7Y A;  1VEK A;  2LVA A;  2MGW A;  2LVN C;  1A5T A;  3K9O A;  1EFU B;  1T6O A;  2JY5 A;  2JUJ A;  2EKF A;  2MJ5 B;  4GEW A;  3LCV B;  2QNJ A;  3K9P A;  2L4E A;  3T6P A;  5JI2 E;  1T43 A;  2DNA A;  2K0B X;  2WZJ A;  5DFL A;  2DAE A;  3MMP A;  2DAI A;  1VQ1 A;  2LVP C;  1ZMW A;  2ZTC A;  1AIP C;  3FRI A;  2O25 A;  1WJ7 A;  1XXH E;  1Y8G A;  2LBC A;  2DEN A;  1ZMU A;  1ZMV A;  2JNH A;  1QZE A;  3IHP A;  4Q7J A;  1OKS A;  1HT1 E;  2OOB A;  2H5X A;  3E21 A;  4HEO A;  2JZ1 A;  3BBZ A;  1KYI A;  3FE3 A;  2QHO B;  3GLF E;  1WGN A;  1VEG A;  2K9D A;  2KNA A;  3GLI E;  1HJP A;  2DKL A;  4G3O A;  2JY6 B;  1WGL A;  3FRH A;  1BVS A;  2BWE A;  1YLA A;  1G3I A;  1MN3 A;  4F2L A;  2JY8 A;  2LTU A;  2EKK A;  2LVO C;  1E94 E;  2OOA A;  1IM2 A;  1P3Q Q;  1XB2 B;  2BWB A;  1OAI A;  3B89 A;  2KNZ A;  1HT2 E;  2DAG A;  2EJS A;  1DO0 A;  1TR8 A;  2L4F A;  1TTE A;  2DZL A;  2ZTD A;  1R4G A;  1IXS A;  1OQY A;  3F92 A;  2QSF X;  2JY7 A;  1V92 A;  1DO2 A;  2L2D A;  2HAK A;  1Q02 A;  2MRO B;  1NV8 A;  4F1I A;  1G41 A;  2DI0 A;  1OTR A;  1F4I A;  1SG9 A;  2CP8 A;  2DAK A;  2B3T A;  2OO9 A;  1WIV A;  1HQY E;  4DBG B;  1CUK A;  3GLG E;  2HWJ A;  2R0I A;  1NV9 A;  1VG5 A;  2JP7 A;  3GLH E;  1GO5 A;  2KNV A;  1VDL A;  1ZV1 A;  2LVQ D;  2JZ0 A;  1PGY A;  2RRU A;  3IEC A;  1DV0 A;  4R71 A;  3LCU A;  2DHY A; 
#chains in the Genus database with same CATH topology
 2CV1 A;  3C3D A;  2YR0 A;  3E46 A;  2N35 A;  4GIT A;  2CWB A;  3I51 A;  1UFZ A;  4P16 A;  4CIS A;  1QVR A;  3J7B A;  4JV5 M;  2AHM A;  2LH0 A;  1G4A E;  3WHK A;  3U5Z B;  3GQ3 A;  4B3T M;  3HHW A;  1V34 A;  2L09 A;  2KEB A;  1VEK A;  4MGY E;  1N78 A;  1N75 A;  1J5E M;  4X64 M;  5EP4 A;  2R44 A;  5EP1 A;  2FS1 A;  3KOZ E;  1IBL M;  3K9O A;  2CE7 A;  3GQ4 A;  2R62 A;  4GEW A;  5BR8 M;  1WXQ A;  3LCV B;  4JI8 M;  3K9P A;  2ZAN A;  4B3R M;  4JN6 A;  1PJQ A;  5C1B A;  3L28 A;  1YSY A;  4JI7 M;  3GPP A;  3D8L A;  3MJ5 A;  4NRW A;  2LNH C;  4EIW A;  3T1Y M;  2DAI A;  4LG2 A;  2ZAO A;  2HHH M;  1KSF X;  1G8P A;  1N34 M;  2O25 A;  4XK8 F;  4S12 A;  3SAR A;  4QNM A;  4B7G A;  2Y0T A;  3KSX A;  4HL4 A;  1WJ7 A;  3W0F A;  2VDB B;  3QYB A;  7CAT A;  2V6Z M;  3GQ5 A;  3QAU A;  3SYL A;  4IBJ A;  2JNH A;  4ITQ A;  2JXN A;  2M5Z A;  3TQS A;  1HNX M;  2KZS A;  4HEO A;  2JZ1 A;  2QCU A;  1OIP A;  3HJS A;  2RKO A;  3GLF E;  3B9P A;  4LRT A;  2CEA A;  1VEG A;  2K9D A;  1SXJ B;  2KDL A;  2MH8 A;  3T15 A;  2F5O A;  1GJT A;  3LVW A;  2YQZ A;  5BPV A;  4GMQ A;  2WSC F;  2DWN A;  1G71 A;  2EUC A;  1BVS A;  2BWE A;  3GPY A;  5GKN A;  1YLA A;  4QHS A;  3GPX A;  3W0L B;  4L4U A;  4LJ7 A;  3SAU A;  1OJL A;  4BB9 A;  2EKK A;  4KO8 A;  2FFJ A;  2GQF A;  2Y0Q A;  2OOA A;  4M0W A;  2CHQ A;  1IM2 A;  4LJ8 A;  3U61 B;  1MU5 A;  1HT2 E;  4QOS A;  4CJ6 A;  5LMN M;  1OAO C;  2L7H A;  2UU9 M;  1R4G A;  4JI1 M;  4WW0 A;  3U6L A;  1E32 A;  1GLN A;  2JWS A;  4LFA M;  2EO2 A;  4OVZ A;  2QSF X;  2X4A A;  1ZAE A;  1X37 A;  5L8R F;  4IIW A;  2L2D A;  4LF6 M;  4IBD A;  4Y28 F;  5EP2 A;  1NV8 A;  5F3W A;  3CGW A;  8CAT A;  3KXE C;  4F1I A;  1JQJ C;  1OIZ A;  2Z4S A;  2V1U A;  4I81 A;  1NY5 A;  2DAK A;  3ZCB B;  2F5P A;  3JR5 A;  3SMS A;  5IT9 S;  4KHP M;  1HQY E;  4NRV A;  3GLG E;  1VG5 A;  2HKJ A;  3B7N A;  1XHB A;  3L26 A;  1GO5 A;  1UM8 A;  2KNV A;  5EXT A;  2CRU A;  3DFZ A;  4LJ5 A;  3EIH A;  2XH9 A;  4GH9 A;  5ITU A;  4DUY M;  2CV2 A;  4II7 A;  1IN5 A;  3U60 A;  4LJ4 A;  2XSZ D;  3I04 M;  2L7I A;  3GLH B;  4IBE A;  1D0K A;  1C1K A;  4G4N A;  1L2D A;  1Q3B A;  1WR1 B;  2P5T A;  2J7O A;  4WP2 A;  2XZF A;  4JI4 M;  1N36 M;  1VEJ A;  3SMP A;  2BJV A;  3TWK A;  2R65 A;  3U6O A;  3SAW A;  1FJG M;  2C9O A;  4L78 A;  2KHH A;  3HKP A;  4L6V 6;  1IFY A;  4UN2 B;  3JAM S;  1NY6 A;  3HHZ A;  1R5L A;  1QUT A;  1PM5 A;  2XFT A;  2LVA A;  4B08 A;  3FD9 A;  4GHA A;  2LVN C;  3HU3 A;  1A5T A;  1IY1 A;  4QNR A;  4R7G A;  4AKH A;  1EFU B;  4LJA A;  2VII A;  3AV0 A;  3LMM A;  3GP1 A;  3GLF A;  3KW6 A;  2R18 A;  4IBF A;  4MGI E;  2C98 A;  4JI0 M;  3U6M A;  1Q3C A;  3A98 B;  3AL0 C;  1LV7 A;  1YUB A;  2L4E A;  4IJE A;  2YNM D;  1HR0 M;  4IBG A;  5JI2 E;  4B7H A;  1NO1 A;  1DGG A;  1NJF A;  2WZJ A;  5DFL A;  3NBI A;  4LZJ A;  3MMP A;  4DR7 M;  1VQ1 A;  3KOX E;  2ZTC A;  3NWL A;  4D81 A;  2F5Q A;  1AIP C;  2R6F A;  3RFW A;  2UUB M;  1IN4 A;  3KS8 A;  4DR5 M;  2QBY B;  2R46 A;  2XF3 A;  5JI3 E;  1L2C A;  3R8F A;  3EIE A;  3BOS A;  3M0E A;  1QAM A;  1TH2 A;  4G4R A;  1XXH E;  3SBJ A;  4FWH A;  4NXM M;  4QOZ C;  3UJN A;  2XZU A;  1QQW A;  1ZMU A;  4CIZ A;  1ZMV A;  1VDD A;  2OOB A;  2H5X A;  5E26 A;  1DGH A;  3SHF A;  3E21 A;  3Q8G A;  2D7G A;  3BBZ A;  2OQ4 A;  3FE3 A;  1AUA A;  4DV5 M;  1L1Z A;  2Y20 A;  1H6U A;  1J7K A;  3V76 A;  3T1H M;  1K82 A;  3AKZ A;  1WGN A;  2BJW A;  3BXW A;  3DA1 A;  3FTC A;  3FTE A;  4M9X A;  3GLI E;  1N77 A;  1HJP A;  3FTD A;  2HCB A;  5DNY A;  4DV6 M;  3AFH A;  4G3O A;  1XMQ M;  3KP0 E;  1PRB A;  3NBX X;  2UUC M;  3HZJ A;  2H1R A;  1G3I A;  5DYI A;  4F2L A;  4PCZ A;  3OTO M;  2LTU A;  4CHT B;  3J7A S;  2LVO C;  1MX0 A;  4Z8X A;  3GLG A;  1IY2 A;  4JI6 M;  1XB2 B;  5LMU M;  1QZM A;  4FD2 A;  2KNZ A;  2DAG A;  5KPZ A;  2CFO A;  2OPF A;  4DV4 M;  2O5R A;  1TTE A;  2ZTD A;  1IXS A;  1OQY A;  2JA2 A;  2XSZ A;  3F92 A;  3UMM A;  3VKH A;  4NSO B;  1I94 M;  3I4Y A;  4WUR A;  1V92 A;  3L27 A;  2XEP A;  1JR3 D;  2C5R A;  5KO3 A;  1Q02 A;  3HU2 A;  4DV3 M;  1DGF A;  3W67 A;  1IBM M;  1GVN A;  1G41 A;  1QYR A;  1OTR A;  4LY6 A;  3SAT A;  2CP8 A;  3B7Q A;  2OO9 A;  3LQQ A;  5KPT A;  3GPU A;  2KZU A;  3QWL A;  4LJ6 A;  3VFD A;  2LHG A;  4D80 A;  1NHG C;  2R0I A;  2VQE M;  1TGU A;  1IY0 A;  4X65 M;  3VLF B;  2E5L M;  2KRU A;  4BLC A;  3K8Z A;  3ZH9 B;  2JZ0 A;  3PVS A;  1PGY A;  3AOE A;  4FCV A;  4GKK M;  3TE6 A;  3SAS A;  2VF8 A;  3LCU A;  4IJF A;  2Z4R A;  4B3M M;  1K3X A;  4LF4 M;  3R9X B;  1RU3 A;  3C3E A;  3UZU A;  2QEN A;  1HNZ M;  2KRK A;  1HQC A;  2G3Q A;  2ZAM A;  2DAM A;  3KDS E;  5FSW A;  5KPR A;  4X62 M;  1V33 A;  2ERC A;  4OW0 A;  1NNJ A;  4GHL A;  4MGH A;  1R2Y A;  2GNO A;  2RGH A;  1NHW C;  1LTM A;  2WSF F;  1D0L A;  1XXH A;  2ZM6 M;  4OVZ B;  1E9R A;  3K2L A;  3AOE C;  3GO8 A;  3KFU G;  2QZ4 A;  5EXP A;  3LVV A;  2UUA M;  4YY3 M;  3UK6 A;  4LGY A;  2JY5 A;  2JUJ A;  3L29 A;  3IG8 A;  2MJ5 B;  4A3V B;  2QNJ A;  4LCB A;  1PJS A;  3KP1 E;  3GLI A;  3T6P A;  1ZQ9 A;  4G4Q A;  1GKI A;  4M9Z A;  4GC9 A;  3SAV A;  3HJQ A;  1T43 A;  2DNA A;  4I4L A;  1W5S A;  1Z6T A;  2DAE A;  2DZO B;  3ZC7 B;  3VDP A;  4DR2 M;  4LF9 M;  2LVP C;  2K47 A;  4R3D A;  3FRI A;  4G4O A;  1QUS A;  2YFQ A;  4XBO A;  3U6D A;  4GC5 A;  4PDG A;  4JI3 M;  3U6C A;  1SXJ E;  3U60 B;  5KQ8 A;  1IN8 A;  4ANR A;  1SXJ D;  3FYD A;  1IQP A;  2LBC A;  1KFV A;  3MHV C;  4Q7J A;  3IHP A;  1TDZ A;  2DWL A;  1OKS A;  3B74 A;  3DOA A;  2C96 A;  4BBA A;  5FTJ A;  2C9C A;  1Z59 A;  2QHO B;  4YHH M;  2RGO A;  1Q39 A;  4LF8 M;  2KNA A;  2CHV A;  3TPZ A;  3U6S A;  4RF1 A;  1Z5B A;  3JR4 A;  5C18 A;  2DKL A;  3AOG A;  2V1C A;  2F4V M;  1EIJ A;  2JY6 B;  4K0K M;  4I8O A;  4NL4 H;  1GL7 A;  3Q8X A;  4X66 M;  4AG5 A;  4I5S A;  3HU1 A;  3J80 S;  1MN3 A;  5EQT A;  3KS4 A;  3GLF B;  3RGP A;  4AQY M;  2FNA A;  4AZF A;  3IG5 A;  3FKE A;  3TL4 X;  2X8A A;  3CF2 A;  2DWZ B;  5FTK A;  5H37 D;  1P3Q Q;  1D2N A;  2UXB M;  2X49 A;  3WHL A;  3B89 A;  1FNN A;  4KT0 F;  5FTL A;  1Z5C A;  4DUZ M;  3HX3 A;  2NQ8 C;  1DO0 A;  1TR8 A;  2L4F A;  3U5Z A;  1MJG M;  4L8R C;  2DZL A;  2DXI A;  1T3T A;  3FUU A;  2JY7 A;  4REZ A;  3U6E A;  4MB7 A;  1E9S A;  1DO2 A;  3PFI A;  4FVM A;  2HAK A;  1TH3 A;  2WSE F;  2DI0 A;  4JI5 M;  1F4I A;  4L15 A;  4LFC M;  2R45 A;  1DGH B;  1S3S A;  2Y21 A;  2XFS A;  1L2B A;  5EXS A;  2CHG A;  3UGJ A;  3E9S A;  3HJ8 A;  4PDI A;  1JB0 F;  1NNU C;  1GL6 A;  1WIV A;  4JI2 M;  2UXC M;  1N33 M;  1CUK A;  1NV9 A;  5ITX E;  2JP7 A;  3GLH E;  2R4J A;  4IBC A;  3D8B A;  4LGM A;  3PXG A;  1VDL A;  3GRR A;  1ZV1 A;  4P17 A;  2DWM A;  3M6A A;  1NJG A;  4G6Z A;  4M0D A;  4MGZ E;  5IZ7 D;  4AKI A;  3GRU A;  1IXZ A;  3T38 A;  3M7G A;  3IEC A;  2RRU A;  4DR1 M;  5ITY A;  1NSF A;  3HHX A;  3C58 A;  3H4M A;  2BNK A;  3K1J A;  1OFI A;  4R71 A;  4LJ9 A;  5A2Q S;  1TDH A;  3FUT A;  1JR3 E;  3GLG B;  1L8Q A;  4IBI A;  3FUW A;  4AI6 A;  1J09 A;  1WHC A;  4RF0 A;  1L1T A;  5KQD A;  4JYA M;  2C99 A;  3FYC A;  4MM3 B;  1W5T A;  4JXJ A;  2MR9 A;  1SXJ A;  2R4E A;  3KOY E;  4XGI A;  1IXS B;  4DV2 M;  4MGK E;  2F5S A;  3H4J A;  4W5W A;  1C7Y A;  1Z5A A;  3MK6 A;  3GRV A;  2CV0 A;  3A42 A;  2KW0 A;  4NOO B;  4DV7 M;  1XNQ M;  2MGW A;  3K92 A;  5EXX A;  3L2A A;  1XWI A;  4AW4 A;  3J81 S;  1T6O A;  2Z8Y M;  3C9P A;  2VQF M;  2EKF A;  4AG6 A;  5IRE B;  2VF7 A;  3CTW B;  3W68 A;  3CF6 E;  3HWS A;  2CUZ A;  4D82 A;  3ZQJ A;  1QAN A;  3TWM A;  1R6B X;  3VK7 A;  2A5Y B;  3I4V A;  4RNA A;  3LQR A;  5FLX S;  1IN7 A;  2ZBK B;  1SXJ C;  2K0B X;  3U61 A;  3PNV A;  4HLQ A;  3PNY A;  1ZMW A;  2FH0 A;  4IBB A;  3FTF A;  1QAQ A;  3ILK A;  1TF0 B;  3U6Q A;  2J7N A;  3CF0 A;  1OFH A;  2FOI C;  3TWL A;  2W82 A;  1G59 A;  2M60 A;  3FUV A;  2LXE A;  1IXR C;  2I7N A;  1Y8G A;  3KSJ A;  2XLJ A;  2DEN A;  3A45 A;  2XGN A;  1XC8 A;  3SFZ A;  1QZE A;  2K6B A;  1N32 M;  2O01 F;  1NVM A;  1HT1 E;  4DR6 M;  1GAB A;  4FCW A;  4QHT A;  3KVW A;  1QAO A;  1QDT A;  2HL7 A;  3AJI B;  3B7Z A;  1KYI A;  4FWD A;  4B7F A;  3A46 A;  3FUX A;  4GKJ M;  5ITQ A;  1IN6 A;  3SC3 A;  2UXD M;  2DHR A;  1XXH B;  3E4R A;  2KXE A;  4GIP A;  4KLN A;  1DGB A;  4L16 A;  3HGI A;  1WGL A;  2LHC A;  5FTN A;  3FRH A;  1EE8 A;  4NXN M;  4OX9 M;  2G8L A;  1YE9 A;  4NSR A;  1PJJ A;  3DZD A;  3VKG A;  4TUW A;  5E6J A;  3LW5 F;  2JY8 A;  4MH0 E;  3RGS A;  3VDU A;  2KA6 B;  5IWA M;  3GLI B;  1E94 E;  5ITX A;  5ITR A;  1ORY B;  3GLH A;  4KOD A;  5EJC A;  4DV0 M;  2BWB A;  3VK8 A;  2LWX A;  1OAI A;  3J2P B;  1GJS A;  3THG A;  2D7E A;  3QYE A;  2EJS A;  2Q2E B;  3RE8 A;  4FW9 A;  3U6P A;  1K3W A;  2I7P A;  1D0M A;  3I01 M;  4PT5 A;  4LZZ A;  4RKU F;  2Z7J A;  4FWG A;  3KOW E;  4GRI A;  1JR3 A;  1PJI A;  4ZPX A;  4DR3 M;  4PD2 A;  2F5N A;  1XNR M;  2D7H A;  2G5G X;  4NC6 A;  2MRO B;  4M9S A;  2J5Y A;  1XMO M;  4FCT A;  1I4W A;  1TH4 A;  5FTM A;  4Z6Y A;  4CGY B;  4LFB M;  4DR4 M;  4LRS A;  2EA0 A;  3SYK A;  4DV1 M;  1SG9 A;  3L25 A;  2B3T A;  3J27 B;  1R7R A;  4IBK A;  3HHY A;  4AKG A;  4OU7 A;  4DBG B;  4B3S M;  2QP9 X;  3GRY A;  3SHG B;  2APL A;  1IBK M;  2HWJ A;  2FE8 A;  1QDR A;  2QQ8 A;  1PJT A;  2QPA A;  2LVQ D;  2DVW B;  1R2Z A;  1HNW M;  5EP3 A;  2DZN B;  2Z3X A;  2QBY A;  3HY5 A;  1DV0 A;  4LF7 M;  2L6O A;  4LF5 M;  5ITT A;  2DHY A;  5DYG A; 
#chains in the Genus database with same CATH homology
 1JR3 E;  3E46 A;  2CWB A;  1WHC A;  1UFZ A;  1WR1 B;  4WP2 A;  2G3Q A;  2DAM A;  1VEJ A;  1G4A E;  2MR9 A;  2KHH A;  3H4J A;  1IFY A;  4UN2 B;  1C7Y A;  1VEK A;  2LVA A;  2MGW A;  2LVN C;  1A5T A;  3K9O A;  1EFU B;  1T6O A;  2JY5 A;  2JUJ A;  2EKF A;  2MJ5 B;  4GEW A;  3LCV B;  2QNJ A;  3K9P A;  2L4E A;  3T6P A;  5JI2 E;  1T43 A;  2DNA A;  2K0B X;  2WZJ A;  5DFL A;  2DAE A;  3MMP A;  2DAI A;  1VQ1 A;  2LVP C;  1ZMW A;  2ZTC A;  1AIP C;  3FRI A;  2O25 A;  1WJ7 A;  1XXH E;  1Y8G A;  2LBC A;  2DEN A;  1ZMU A;  1ZMV A;  2JNH A;  1QZE A;  3IHP A;  4Q7J A;  1OKS A;  1HT1 E;  2OOB A;  2H5X A;  3E21 A;  4HEO A;  2JZ1 A;  3BBZ A;  1KYI A;  3FE3 A;  2QHO B;  3GLF E;  1WGN A;  1VEG A;  2K9D A;  2KNA A;  3GLI E;  1HJP A;  2DKL A;  4G3O A;  2JY6 B;  1WGL A;  3FRH A;  1BVS A;  2BWE A;  1YLA A;  1G3I A;  1MN3 A;  4F2L A;  2JY8 A;  2LTU A;  2EKK A;  2LVO C;  1E94 E;  2OOA A;  1IM2 A;  1P3Q Q;  1XB2 B;  2BWB A;  1OAI A;  3B89 A;  2KNZ A;  1HT2 E;  2DAG A;  2EJS A;  1DO0 A;  1TR8 A;  2L4F A;  1TTE A;  2DZL A;  2ZTD A;  1R4G A;  1IXS A;  1OQY A;  3F92 A;  2QSF X;  2JY7 A;  1V92 A;  1DO2 A;  2L2D A;  2HAK A;  1Q02 A;  2MRO B;  1NV8 A;  4F1I A;  1G41 A;  2DI0 A;  1OTR A;  1F4I A;  1SG9 A;  2CP8 A;  2DAK A;  2B3T A;  2OO9 A;  1WIV A;  1HQY E;  4DBG B;  1CUK A;  3GLG E;  2HWJ A;  2R0I A;  1NV9 A;  1VG5 A;  2JP7 A;  3GLH E;  1GO5 A;  2KNV A;  1VDL A;  1ZV1 A;  2LVQ D;  2JZ0 A;  1PGY A;  2RRU A;  3IEC A;  1DV0 A;  4R71 A;  3LCU A;  2DHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...