4G3OA

Crystal structure of the cue domain of the e3 ubiquitin ligase amfr (gp78)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
RGSENLYFQGQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the CUE domain of the E3 ubiquitin ligase AMFR (gp78)
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase AMFR
total genus 20
structure length 53
sequence length 53
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4g3oA00
3F92A 3FRIA 2O25A 3K9OA 2DZLA 2KHHA 1HT1E 4R71A 3E46A 2ZTCA 1NV8A 3MMPA 5DFLA 2DENA 4WP2A 2L4EA 1CUKA 2QSFX 2R0IA 3GLFE 1R4GA 1BVSA 3LCUA 3IHPA 1OAIA 2DAIA 1ZV1A 1OQYA 2H5XA 1EFUB 1TTEA 2MROB 2RRUA 1DO2A 2EKFA 1PGYA 2LTUA 1HT2E 1WIVA 2KNZA 2MR9A 1NV9A 2G3QA 2KNAA 1C7YA 1XB2B 3B89A 2JY8A 3FRHA 1WR1B 3E21A 1Q02A 1DO0A 1OTRA 4DBGB 1XXHE 2JUJA 4F2LA 3H4JA 1TR8A 1SG9A 1F4IA 1QZEA 1G4AE 3T6PA 1YLAA 2BWBA 3IECA 4Q7JA 4HEOA 1WGNA 2DNAA 2EKKA 2OOAA 3GLHE 3LCVB 1V92A 2DAGA 3GLGE 1WJ7A 1ZMVA 1JR3E 2DHYA 2DI0A 2LVOC 2JY5A 2JZ0A 2MJ5B 2DKLA 2DAKA 2QNJA 1MN3A 1VEGA 1OKSA 2LBCA 2HAKA 1GO5A 2DAEA 3GLIE 1T43A 1P3QQ 1VQ1A 1ZMWA 2ZTDA 2LVQD 2DAMA 2OOBA 2LVAA 2K0BX 1G3IA 1UFZA 2KNVA 2L4FA 3FE3A 5JI2E 2HWJA 1AIPC 1VG5A 1A5TA 1T6OA 2WZJA 1HJPA 4UN2B 4GEWA 2JNHA 1DV0A 2B3TA 1Y8GA 1VEKA 2L2DA 2JZ1A 2LVNC 2LVPC 2JP7A 1E94E 4G3OA 2MGWA 1IXSA 1WGLA 3BBZA 2JY7A 1VEJA 1HQYE 3K9PA 1G41A 1IFYA 2CP8A 2OO9A 1VDLA 2QHOB 2BWEA 2K9DA 2EJSA 2JY6B 1ZMUA 2CWBA 4F1IA 1IM2A 1WHCA 1KYIA
chains in the Genus database with same CATH superfamily
3K2LA 2UUCM 3K9OA 3HU1A 4R7GA 1R7RA 3T15A 3D8LA 2OQ4A 3MJ5A 1G8PA 1NV8A 2UUBM 4CIZA 2QBYB 2ZANA 1NHWC 1NSFA 2C9OA 1G71A 3MK6A 2R62A 3KOYE 1IBKM 3C9PA 1JQJC 2R0IA 4DV2M 1IY0A 3TPZA 2CV1A 4L8RC 3C58A 3FTEA 1OAIA 5FTKA 4MGYE 3CF0A 2MROB 1TTEA 1OIZA 3AFHA 5FTMA 3VLFB 4DV0M 4NSRA 2XFSA 2LTUA 4KO8A 4NC6A 1NJFA 2VDBB 3LVVA 2QQ8A 5EP4A 4YHHM 8CATA 2R46A 3B74A 4KODA 2R4JA 1D2NA 1IY2A 2KEBA 3SYLA 2G3QA 3UMMA 4LF5M 4GHLA 3UJNA 2Z4RA 1PJQA 1T3TA 1NY6A 2DWNA 4LJ6A 4CISA 4JI6M 1VDDA 3H4JA 4R3DA 1F4IA 3GPPA 3U6PA 1YLAA 5KPZA 3AV0A 5LMUM 1E9SA 1N77A 1OIPA 4DV6M 1XNRM 2L7HA 5ITQA 4HEOA 4IBFA 4HL4A 2E5LM 2Q2EB 3HY5A 2C98A 1PJIA 3FTCA 4G4NA 3SYKA 5FLXS 3GRRA 3GPYA 2HKJA 3UGJA 1PJJA 4DR6M 2XF3A 5KPRA 5ITUA 2KW0A 1IN7A 2QCUA 2JWSA 4MGIE 3RGSA 5DYIA 2L09A 4I81A 1MN3A 4PDIA 1OKSA 3GPUA 3U6SA 1GO5A 1N75A 4LFCM 1GVNA 4IIWA 4RF0A 4DR3M 4OVZA 3K8ZA 3FD9A 3E9SA 2FFJA 1VQ1A 3GRUA 4GITA 4NRVA 3GLHA 5F3WA 3KFUG 2YQZA 1JB0F 2KNVA 2L4FA 4JN6A 5KO3A 5GKNA 2ERCA 3ZH9B 5LMNM 1XHBA 2K47A 3U6EA 3KSXA 3L2AA 3TWKA 1TH2A 1JR3D 3KDSE 4FVMA 1ZQ9A 1EIJA 2Y0TA 2CV2A 4JV5M 1GJTA 3K92A 4DR5M 1VEKA 1L2BA 4B08A 2XZFA 2J7NA 4B3TM 2XGNA 3KS4A 1XWIA 1SXJD 2WSFF 3HHWA 3RGPA 3D8BA 2RGOA 4X62M 2RGHA 5EJCA 2ZBKB 1GKIA 3TWMA 1IFYA 1NNUC 3C3DA 1IN8A 1VDLA 1D0LA 4DV7M 1QDRA 2QHOB 3HJ8A 2Z3XA 1D0KA 3J2PB 4MB7A 1IXSB 4KLNA 5EQTA 1WHCA 1KYIA 1Z6TA 1QUTA 3U61B 4LCBA 1L1ZA 1IY1A 4GKJM 1N78A 1J09A 2G5GX 4QHTA 2XFTA 4R71A 5EP3A 1XNQM 1QYRA 4RNAA 3FUXA 5KQ8A 3U60B 2XZUA 1R6BX 2FS1A 4B7FA 3HGIA 3L29A 3VKHA 1SXJC 2X49A 4FD2A 4WP2A 1Z59A 2LXEA 1CUKA 2ZAOA 2JXNA 3GLFE 3GQ4A 4G4OA 3LCUA 3IHPA 3PVSA 3SFZA 1QAQA 4CJ6A 2EUCA 1YE9A 2H5XA 1HNZM 4B3MM 1DO2A 3SHFA 3K1JA 3SMPA 1OJLA 1TH4A 1HT2E 2I7PA 1DGFA 2KNZA 1YSYA 4DV4M 4G4RA 4A3VB 3WHLA 1G59A 3TL4X 2GQFA 3PXGA 4EIWA 2XLJA 3FUTA 2YFQA 3TQSA 4ITQA 1C7YA 3R8FA 1RU3A 2EO2A 3R9XB 2W82A 5C18A 3FRHA 1WR1B 2XSZA 2F5PA 1Q02A 2DWZB 4S12A 3HJQA 3ZQJA 4DUYM 2JUJA 4JI0M 1IXZA 3M7GA 1OFHA 1Q3CA 4G6ZA 2BWBA 3C3EA 5ITXA 3NBXX 1ZAEA 2LHCA 3FUVA 4JI3M 2QENA 2CRUA 2ZM6M 4AKGA 2LWXA 1SXJE 2JA2A 3LVWA 2XEPA 1XMOM 3FYDA 2EKKA 3LQRA 4LZZA 3M0EA 4KT0F 4DR7M 4IBKA 4IBDA 2DHRA 4D80A 2DXIA 2DAGA 3GLGE 1WJ7A 1L8QA 1JR3E 1MU5A 2GNOA 3A45A 3L28A 3Q8GA 4MGKE 5H37D 3L26A 4AI6A 2DI0A 2LVOC 3GLIB 1NO1A 1L2CA 2JZ0A 3GLHB 1WXQA 3HX3A 2DAKA 5IREB 4MM3B 3SHGB 2HL7A 2R18A 2NQ8C 3AOEA 3W67A 2DAEA 3JAMS 3GLIE 4JI2M 4AKHA 2BJVA 1V33A 4BB9A 3OTOM 1XXHB 1P3QQ 1ZMWA 5EXPA 2BNKA 4PCZA 2OOBA 2G8LA 5EXSA 1DGHB 4IBEA 1L2DA 1GJSA 1KSFX 2VQFM 4IJFA 2X4AA 4P16A 2ZAMA 3RFWA 2HWJA 3TWLA 3SAUA 4IBGA 1Z5BA 1HQCA 1LV7A 2UXCM 1DGGA 1N32M 4LJAA 1MJGM 1HNWM 5FTNA 4UN2B 4GEWA 5ITYA 1HR0M 5L8RF 2L2DA 1Y8GA 2LVNC 4IBJA 4B7HA 2CHQA 3GQ3A 2JP7A 1GABA 4M9SA 1PM5A 2MGWA 5KPTA 1IXSA 4Z8XA 3GLGB 3HJSA 4AG6A 1N33M 2JY7A 3K9PA 4PD2A 3SASA 2L6OA 3DA1A 2OPFA 2VQEM 2Z8YM 4W5WA 4XGIA 3DOAA 2V1CA 2F5SA 1GLNA 3AKZA 2O01F 3HZJA 1QDTA 3U60A 2JY6B 2KXEA 3HKPA 3ZC7B 1IM2A 1N36M 1FJGM 4KHPM 2K6BA 4B3SM 4PT5A 3FRIA 2O25A 4M0DA 1HT1E 2L7IA 7CATA 2CFOA 2ZTCA 3A98B 2C9CA 2CV0A 2BJWA 4JYAM 3QWLA 1R2YA 2N35A 3MMPA 1J5EM 1PRBA 2DENA 5DFLA 2F5QA 4JI1M 3U6QA 3J7AS 1V34A 2L4EA 2X8AA 3FTDA 4LFAM 2QSFX 1TF0B 4LJ5A 3U6MA 1BVSA 1AUAA 4P17A 2Y0QA 3KP0E 1ZV1A 1OQYA 1Q39A 1EFUB 3I4VA 4IJEA 5ITRA 3KVWA 2EA0A 3LQQA 3VDPA 1QZMA 4FCTA 4QHSA 1PGYA 3HU3A 4JXJA 2VF8A 4JI8M 2HCBA 1MX0A 4JI4M 1R5LA 5ITTA 4FCVA 4K0KM 2F4VM 1QUSA 3FUUA 3HU2A 3I4YA 3IG8A 2HHHM 3RE8A 4AW4A 2KNAA 2Y21A 4L16A 1XB2B 4QNRA 3E21A 3GRVA 4LRTA 5IZ7D 3KP1E 4LJ9A 1TH3A 4GC9A 3FTFA 1DO0A 1OTRA 3HHXA 2RKOA 4DBGB 1NJGA 4GMQA 1XXHE 1L1TA 4XBOA 2UUAM 2QPAA 4F2LA 1Z5CA 3J7BA 3U6CA 1OAOC 1SG9A 1NNJA 1QZEA 4BLCA 2DZNB 2QZ4A 3DFZA 5FTJA 3L27A 2LHGA 4BBAA 2O5RA 1IN6A 4X65M 3KOWE 4Q7JA 2R45A 4DV3M 1R2ZA 1LTMA 1WGNA 3T38A 3SAVA 3PNVA 4HLQA 2OOAA 1N34M 3FYCA 4LJ7A 1X37A 3LCVB 4NL4H 4LRSA 3GQ5A 4XK8F 2DWLA 3GLFB 2KZSA 2KZUA 3CGWA 4QOSA 4CHTB 4LF8M 4OU7A 2DHYA 1K3XA 1XXHA 3SAWA 1QVRA 3FUWA 3EIHA 4FWHA 2UXBM 5DYGA 2DKLA 4I5SA 4D82A 2QNJA 3NWLA 2DVWB 4D81A 1SXJB 4QNMA 4QOZC 1VEGA 2LH0A 2LBCA 1TDZA 3GP1A 4DR1M 4LGYA 2APLA 4AKIA 1JR3A 4GH9A 1T43A 2Z7JA 2XH9A 2M5ZA 4NSOB 2UXDM 3H4MA 1QQWA 1K3WA 3LMMA 5FTLA 3ZCBB 1QAOA 1S3SA 3Q8XA 2K0BX 2A5YB 2KDLA 3KSJA 1G3IA 4X66M 2VF7A 2V6ZM 3FE3A 2KRKA 4MGHA 3FKEA 4PDGA 2C99A 5JI2E 1IQPA 3B9PA 5IWAM 4MGZE 4OVZB 2WSCF 3THGA 1A5TA 3IG5A 2FNAA 4JI7M 3GO8A 1T6OA 2C5RA 1HJPA 4NOOB 3NBIA 5DNYA 2FH0A 3B7NA 2F5OA 2CHVA 2JNHA 1DGBA 1W5TA 2B3TA 4FWDA 4LG2A 1DV0A 3M6AA 4IBCA 1E94E 1I4WA 4G3OA 3U5ZA 1YUBA 3QYBA 1WGLA 3SC3A 3BBZA 4G4QA 1NHGC 4FWGA 3PNYA 3QAUA 1E9RA 2R4EA 2DZOB 2CP8A 2OO9A 4L4UA 3I51A 5EXXA 3GRYA 2CEAA 4LF7M 4DUZM 3T1YM 3VDUA 2K9DA 2EJSA 3SMSA 4RF1A 4WW0A 3SATA 1TDHA 3HHYA 2LVQD 1IN5A 5C1BA 4LF4M 3F92A 5EP2A 1GL7A 4GHAA 2DZLA 2KHHA 3HHZA 3E46A 1KFVA 3MHVC 4X64M 4FCWA 3W68A 4LY6A 4AZFA 2Y20A 3U61A 1R4GA 1UM8A 3QYEA 4L78A 2DAIA 3EIEA 2UU9M 2RRUA 1I94M 5KQDA 1IBMM 3VK7A 2QBYA 3AJIB 2EKFA 3WHKA 3I01M 4LF6M 4ZPXA 1WIVA 2WSEF 2AHMA 2MR9A 3AOEC 3GPXA 1C1KA 5A2QS 1QANA 4FW9A 1NV9A 2CUZA 3UZUA 1Q3BA 2XSZD 1IN4A 2QP9X 3B89A 4B3RM 2JY8A 4B7GA 1GL6A 4ANRA 4DV5M 4M0WA 3A46A 2H1RA 1TGUA 4LJ8A 1XMQM 4TUWA 1TR8A 3CTWB 4M9ZA 3GLFA 1G4AE 3T6PA 2DWMA 5JI3E 3VK8A 2KRUA 4DR4M 2MH8A 3IECA 4I8OA 3AOGA 3J80S 3B7ZA 4REZA 2LNHC 3HWSA 2DNAA 2YNMD 1SXJA 3GLHE 1D0MA 2R65A 3VFDA 2R6FA 1V92A 2F5NA 4Z6YA 3L25A 3SARA 1ZMVA 4RKUF 5FSWA 1OFIA 1Z5AA 2Z4SA 2D7GA 3TE6A 2VIIA 4IBBA 2JY5A 4L15A 3T1HM 2I7NA 1IBLM 2MJ5B 5E26A 5EP1A 4L6V6 1NY5A 2KA6B 1QAMA 1E32A 3B7QA 3A42A 5EXTA 4AQYM 3J27B 3VKGA 2HAKA 3KW6A 4M9XA 4LGMA 3ILKA 4JI5M 2P5TA 3LW5F 3KS8A 3BOSA 4MH0E 5IT9S 2YR0A 1PJTA 3GLIA 2M60A 1FNNA 2ZTDA 2J5YA 2DAMA 1H6UA 2LVAA 3JR5A 3I04M 3E4RA 4OW0A 1ORYB 1UFZA 3BXWA 2CHGA 5BPVA 3JR4A 2V1UA 1AIPC 4II7A 2FE8A 1VG5A 3U5ZB 4GRIA 4LZJA 3U6OA 3GLGA 4LJ4A 5E6JA 4CGYB 3J81S 2WZJA 4NRWA 3V76A 2C96A 1DGHA 3KOZE 4LFBM 2LVPC 2JZ1A 3KOXE 4I4LA 2CE7A 4IBIA 4WURA 4LF9M 4GKKM 4DV1M 3CF6E 1NVMA 2R44A 3CF2A 1IXRC 3W0FA 3KXEC 5ITXE 3SBJA 5BR8M 4GC5A 4AG5A 1K82A 3AL0C 3U6LA 1J7KA 1HQYE 1VEJA 3DZDA 4GIPA 1EE8A 4NXNM 1G41A 3PFIA 2D7EA 4OX9M 4NXMM 4Y28F 1W5SA 2FOIC 3UK6A 3U6DA 1XC8A 4DR2M 2BWEA 2D7HA 1HNXM 1PJSA 4YY3M 1ZMUA 2CWBA 2J7OA 3W0LB 4F1IA
chains in the Genus database with same CATH topology
3F92A 3FRIA 2O25A 3K9OA 2DZLA 2KHHA 1HT1E 4R71A 3E46A 2ZTCA 1NV8A 3MMPA 5DFLA 2DENA 4WP2A 2L4EA 1CUKA 2QSFX 2R0IA 3GLFE 1R4GA 1BVSA 3LCUA 3IHPA 1OAIA 2DAIA 1ZV1A 1OQYA 2H5XA 1EFUB 1TTEA 2MROB 2RRUA 1DO2A 2EKFA 1PGYA 2LTUA 1HT2E 1WIVA 2KNZA 2MR9A 1NV9A 2G3QA 2KNAA 1C7YA 1XB2B 3B89A 2JY8A 3FRHA 1WR1B 3E21A 1Q02A 1DO0A 1OTRA 4DBGB 1XXHE 2JUJA 4F2LA 3H4JA 1TR8A 1SG9A 1F4IA 1QZEA 1G4AE 3T6PA 1YLAA 2BWBA 3IECA 4Q7JA 4HEOA 1WGNA 2DNAA 2EKKA 2OOAA 3GLHE 3LCVB 1V92A 2DAGA 3GLGE 1WJ7A 1ZMVA 1JR3E 2DHYA 2DI0A 2LVOC 2JY5A 2JZ0A 2MJ5B 2DKLA 2DAKA 2QNJA 1MN3A 1VEGA 1OKSA 2LBCA 2HAKA 1GO5A 2DAEA 3GLIE 1T43A 1P3QQ 1VQ1A 1ZMWA 2ZTDA 2LVQD 2DAMA 2OOBA 2LVAA 2K0BX 1G3IA 1UFZA 2KNVA 2L4FA 3FE3A 5JI2E 2HWJA 1AIPC 1VG5A 1A5TA 1T6OA 2WZJA 1HJPA 4UN2B 4GEWA 2JNHA 1DV0A 2B3TA 1Y8GA 1VEKA 2L2DA 2JZ1A 2LVNC 2LVPC 2JP7A 1E94E 4G3OA 2MGWA 1IXSA 1WGLA 3BBZA 2JY7A 1VEJA 1HQYE 3K9PA 1G41A 1IFYA 2CP8A 2OO9A 1VDLA 2QHOB 2BWEA 2K9DA 2EJSA 2JY6B 1ZMUA 2CWBA 4F1IA 1IM2A 1WHCA 1KYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F92 A;  3FRI A;  2O25 A;  3K9O A;  2DZL A;  2KHH A;  1HT1 E;  4R71 A;  3E46 A;  2ZTC A;  1NV8 A;  3MMP A;  5DFL A;  2DEN A;  4WP2 A;  2L4E A;  1CUK A;  2QSF X;  2R0I A;  3GLF E;  1R4G A;  1BVS A;  3LCU A;  3IHP A;  1OAI A;  2DAI A;  1ZV1 A;  1OQY A;  2H5X A;  1EFU B;  1TTE A;  2MRO B;  2RRU A;  1DO2 A;  2EKF A;  1PGY A;  2LTU A;  1HT2 E;  1WIV A;  2KNZ A;  2MR9 A;  1NV9 A;  2G3Q A;  2KNA A;  1C7Y A;  1XB2 B;  3B89 A;  2JY8 A;  3FRH A;  1WR1 B;  3E21 A;  1Q02 A;  1DO0 A;  1OTR A;  4DBG B;  1XXH E;  2JUJ A;  4F2L A;  3H4J A;  1TR8 A;  1SG9 A;  1F4I A;  1QZE A;  1G4A E;  3T6P A;  1YLA A;  2BWB A;  3IEC A;  4Q7J A;  4HEO A;  1WGN A;  2DNA A;  2EKK A;  2OOA A;  3GLH E;  3LCV B;  1V92 A;  2DAG A;  3GLG E;  1WJ7 A;  1ZMV A;  1JR3 E;  2DHY A;  2DI0 A;  2LVO C;  2JY5 A;  2JZ0 A;  2MJ5 B;  2DKL A;  2DAK A;  2QNJ A;  1MN3 A;  1VEG A;  1OKS A;  2LBC A;  2HAK A;  1GO5 A;  2DAE A;  3GLI E;  1T43 A;  1P3Q Q;  1VQ1 A;  1ZMW A;  2ZTD A;  2LVQ D;  2DAM A;  2OOB A;  2LVA A;  2K0B X;  1G3I A;  1UFZ A;  2KNV A;  2L4F A;  3FE3 A;  5JI2 E;  2HWJ A;  1AIP C;  1VG5 A;  1A5T A;  1T6O A;  2WZJ A;  1HJP A;  4UN2 B;  4GEW A;  2JNH A;  1DV0 A;  2B3T A;  1Y8G A;  1VEK A;  2L2D A;  2JZ1 A;  2LVN C;  2LVP C;  2JP7 A;  1E94 E;  4G3O A;  2MGW A;  1IXS A;  1WGL A;  3BBZ A;  2JY7 A;  1VEJ A;  1HQY E;  3K9P A;  1G41 A;  1IFY A;  2CP8 A;  2OO9 A;  1VDL A;  2QHO B;  2BWE A;  2K9D A;  2EJS A;  2JY6 B;  1ZMU A;  2CWB A;  4F1I A;  1IM2 A;  1WHC A;  1KYI A; 
#chains in the Genus database with same CATH topology
 3K2L A;  2UUC M;  3K9O A;  3HU1 A;  4R7G A;  1R7R A;  3T15 A;  3D8L A;  2OQ4 A;  3MJ5 A;  1G8P A;  1NV8 A;  2UUB M;  4CIZ A;  2QBY B;  2ZAN A;  1NHW C;  1NSF A;  2C9O A;  1G71 A;  3MK6 A;  2R62 A;  3KOY E;  1IBK M;  3C9P A;  1JQJ C;  2R0I A;  4DV2 M;  1IY0 A;  3TPZ A;  2CV1 A;  4L8R C;  3C58 A;  3FTE A;  1OAI A;  5FTK A;  4MGY E;  3CF0 A;  2MRO B;  1TTE A;  1OIZ A;  3AFH A;  5FTM A;  3VLF B;  4DV0 M;  4NSR A;  2XFS A;  2LTU A;  4KO8 A;  4NC6 A;  1NJF A;  2VDB B;  3LVV A;  2QQ8 A;  5EP4 A;  4YHH M;  8CAT A;  2R46 A;  3B74 A;  4KOD A;  2R4J A;  1D2N A;  1IY2 A;  2KEB A;  3SYL A;  2G3Q A;  3UMM A;  4LF5 M;  4GHL A;  3UJN A;  2Z4R A;  1PJQ A;  1T3T A;  1NY6 A;  2DWN A;  4LJ6 A;  4CIS A;  4JI6 M;  1VDD A;  3H4J A;  4R3D A;  1F4I A;  3GPP A;  3U6P A;  1YLA A;  5KPZ A;  3AV0 A;  5LMU M;  1E9S A;  1N77 A;  1OIP A;  4DV6 M;  1XNR M;  2L7H A;  5ITQ A;  4HEO A;  4IBF A;  4HL4 A;  2E5L M;  2Q2E B;  3HY5 A;  2C98 A;  1PJI A;  3FTC A;  4G4N A;  3SYK A;  5FLX S;  3GRR A;  3GPY A;  2HKJ A;  3UGJ A;  1PJJ A;  4DR6 M;  2XF3 A;  5KPR A;  5ITU A;  2KW0 A;  1IN7 A;  2QCU A;  2JWS A;  4MGI E;  3RGS A;  5DYI A;  2L09 A;  4I81 A;  1MN3 A;  4PDI A;  1OKS A;  3GPU A;  3U6S A;  1GO5 A;  1N75 A;  4LFC M;  1GVN A;  4IIW A;  4RF0 A;  4DR3 M;  4OVZ A;  3K8Z A;  3FD9 A;  3E9S A;  2FFJ A;  1VQ1 A;  3GRU A;  4GIT A;  4NRV A;  3GLH A;  5F3W A;  3KFU G;  2YQZ A;  1JB0 F;  2KNV A;  2L4F A;  4JN6 A;  5KO3 A;  5GKN A;  2ERC A;  3ZH9 B;  5LMN M;  1XHB A;  2K47 A;  3U6E A;  3KSX A;  3L2A A;  3TWK A;  1TH2 A;  1JR3 D;  3KDS E;  4FVM A;  1ZQ9 A;  1EIJ A;  2Y0T A;  2CV2 A;  4JV5 M;  1GJT A;  3K92 A;  4DR5 M;  1VEK A;  1L2B A;  4B08 A;  2XZF A;  2J7N A;  4B3T M;  2XGN A;  3KS4 A;  1XWI A;  1SXJ D;  2WSF F;  3HHW A;  3RGP A;  3D8B A;  2RGO A;  4X62 M;  2RGH A;  5EJC A;  2ZBK B;  1GKI A;  3TWM A;  1IFY A;  1NNU C;  3C3D A;  1IN8 A;  1VDL A;  1D0L A;  4DV7 M;  1QDR A;  2QHO B;  3HJ8 A;  2Z3X A;  1D0K A;  3J2P B;  4MB7 A;  1IXS B;  4KLN A;  5EQT A;  1WHC A;  1KYI A;  1Z6T A;  1QUT A;  3U61 B;  4LCB A;  1L1Z A;  1IY1 A;  4GKJ M;  1N78 A;  1J09 A;  2G5G X;  4QHT A;  2XFT A;  4R71 A;  5EP3 A;  1XNQ M;  1QYR A;  4RNA A;  3FUX A;  5KQ8 A;  3U60 B;  2XZU A;  1R6B X;  2FS1 A;  4B7F A;  3HGI A;  3L29 A;  3VKH A;  1SXJ C;  2X49 A;  4FD2 A;  4WP2 A;  1Z59 A;  2LXE A;  1CUK A;  2ZAO A;  2JXN A;  3GLF E;  3GQ4 A;  4G4O A;  3LCU A;  3IHP A;  3PVS A;  3SFZ A;  1QAQ A;  4CJ6 A;  2EUC A;  1YE9 A;  2H5X A;  1HNZ M;  4B3M M;  1DO2 A;  3SHF A;  3K1J A;  3SMP A;  1OJL A;  1TH4 A;  1HT2 E;  2I7P A;  1DGF A;  2KNZ A;  1YSY A;  4DV4 M;  4G4R A;  4A3V B;  3WHL A;  1G59 A;  3TL4 X;  2GQF A;  3PXG A;  4EIW A;  2XLJ A;  3FUT A;  2YFQ A;  3TQS A;  4ITQ A;  1C7Y A;  3R8F A;  1RU3 A;  2EO2 A;  3R9X B;  2W82 A;  5C18 A;  3FRH A;  1WR1 B;  2XSZ A;  2F5P A;  1Q02 A;  2DWZ B;  4S12 A;  3HJQ A;  3ZQJ A;  4DUY M;  2JUJ A;  4JI0 M;  1IXZ A;  3M7G A;  1OFH A;  1Q3C A;  4G6Z A;  2BWB A;  3C3E A;  5ITX A;  3NBX X;  1ZAE A;  2LHC A;  3FUV A;  4JI3 M;  2QEN A;  2CRU A;  2ZM6 M;  4AKG A;  2LWX A;  1SXJ E;  2JA2 A;  3LVW A;  2XEP A;  1XMO M;  3FYD A;  2EKK A;  3LQR A;  4LZZ A;  3M0E A;  4KT0 F;  4DR7 M;  4IBK A;  4IBD A;  2DHR A;  4D80 A;  2DXI A;  2DAG A;  3GLG E;  1WJ7 A;  1L8Q A;  1JR3 E;  1MU5 A;  2GNO A;  3A45 A;  3L28 A;  3Q8G A;  4MGK E;  5H37 D;  3L26 A;  4AI6 A;  2DI0 A;  2LVO C;  3GLI B;  1NO1 A;  1L2C A;  2JZ0 A;  3GLH B;  1WXQ A;  3HX3 A;  2DAK A;  5IRE B;  4MM3 B;  3SHG B;  2HL7 A;  2R18 A;  2NQ8 C;  3AOE A;  3W67 A;  2DAE A;  3JAM S;  3GLI E;  4JI2 M;  4AKH A;  2BJV A;  1V33 A;  4BB9 A;  3OTO M;  1XXH B;  1P3Q Q;  1ZMW A;  5EXP A;  2BNK A;  4PCZ A;  2OOB A;  2G8L A;  5EXS A;  1DGH B;  4IBE A;  1L2D A;  1GJS A;  1KSF X;  2VQF M;  4IJF A;  2X4A A;  4P16 A;  2ZAM A;  3RFW A;  2HWJ A;  3TWL A;  3SAU A;  4IBG A;  1Z5B A;  1HQC A;  1LV7 A;  2UXC M;  1DGG A;  1N32 M;  4LJA A;  1MJG M;  1HNW M;  5FTN A;  4UN2 B;  4GEW A;  5ITY A;  1HR0 M;  5L8R F;  2L2D A;  1Y8G A;  2LVN C;  4IBJ A;  4B7H A;  2CHQ A;  3GQ3 A;  2JP7 A;  1GAB A;  4M9S A;  1PM5 A;  2MGW A;  5KPT A;  1IXS A;  4Z8X A;  3GLG B;  3HJS A;  4AG6 A;  1N33 M;  2JY7 A;  3K9P A;  4PD2 A;  3SAS A;  2L6O A;  3DA1 A;  2OPF A;  2VQE M;  2Z8Y M;  4W5W A;  4XGI A;  3DOA A;  2V1C A;  2F5S A;  1GLN A;  3AKZ A;  2O01 F;  3HZJ A;  1QDT A;  3U60 A;  2JY6 B;  2KXE A;  3HKP A;  3ZC7 B;  1IM2 A;  1N36 M;  1FJG M;  4KHP M;  2K6B A;  4B3S M;  4PT5 A;  3FRI A;  2O25 A;  4M0D A;  1HT1 E;  2L7I A;  7CAT A;  2CFO A;  2ZTC A;  3A98 B;  2C9C A;  2CV0 A;  2BJW A;  4JYA M;  3QWL A;  1R2Y A;  2N35 A;  3MMP A;  1J5E M;  1PRB A;  2DEN A;  5DFL A;  2F5Q A;  4JI1 M;  3U6Q A;  3J7A S;  1V34 A;  2L4E A;  2X8A A;  3FTD A;  4LFA M;  2QSF X;  1TF0 B;  4LJ5 A;  3U6M A;  1BVS A;  1AUA A;  4P17 A;  2Y0Q A;  3KP0 E;  1ZV1 A;  1OQY A;  1Q39 A;  1EFU B;  3I4V A;  4IJE A;  5ITR A;  3KVW A;  2EA0 A;  3LQQ A;  3VDP A;  1QZM A;  4FCT A;  4QHS A;  1PGY A;  3HU3 A;  4JXJ A;  2VF8 A;  4JI8 M;  2HCB A;  1MX0 A;  4JI4 M;  1R5L A;  5ITT A;  4FCV A;  4K0K M;  2F4V M;  1QUS A;  3FUU A;  3HU2 A;  3I4Y A;  3IG8 A;  2HHH M;  3RE8 A;  4AW4 A;  2KNA A;  2Y21 A;  4L16 A;  1XB2 B;  4QNR A;  3E21 A;  3GRV A;  4LRT A;  5IZ7 D;  3KP1 E;  4LJ9 A;  1TH3 A;  4GC9 A;  3FTF A;  1DO0 A;  1OTR A;  3HHX A;  2RKO A;  4DBG B;  1NJG A;  4GMQ A;  1XXH E;  1L1T A;  4XBO A;  2UUA M;  2QPA A;  4F2L A;  1Z5C A;  3J7B A;  3U6C A;  1OAO C;  1SG9 A;  1NNJ A;  1QZE A;  4BLC A;  2DZN B;  2QZ4 A;  3DFZ A;  5FTJ A;  3L27 A;  2LHG A;  4BBA A;  2O5R A;  1IN6 A;  4X65 M;  3KOW E;  4Q7J A;  2R45 A;  4DV3 M;  1R2Z A;  1LTM A;  1WGN A;  3T38 A;  3SAV A;  3PNV A;  4HLQ A;  2OOA A;  1N34 M;  3FYC A;  4LJ7 A;  1X37 A;  3LCV B;  4NL4 H;  4LRS A;  3GQ5 A;  4XK8 F;  2DWL A;  3GLF B;  2KZS A;  2KZU A;  3CGW A;  4QOS A;  4CHT B;  4LF8 M;  4OU7 A;  2DHY A;  1K3X A;  1XXH A;  3SAW A;  1QVR A;  3FUW A;  3EIH A;  4FWH A;  2UXB M;  5DYG A;  2DKL A;  4I5S A;  4D82 A;  2QNJ A;  3NWL A;  2DVW B;  4D81 A;  1SXJ B;  4QNM A;  4QOZ C;  1VEG A;  2LH0 A;  2LBC A;  1TDZ A;  3GP1 A;  4DR1 M;  4LGY A;  2APL A;  4AKI A;  1JR3 A;  4GH9 A;  1T43 A;  2Z7J A;  2XH9 A;  2M5Z A;  4NSO B;  2UXD M;  3H4M A;  1QQW A;  1K3W A;  3LMM A;  5FTL A;  3ZCB B;  1QAO A;  1S3S A;  3Q8X A;  2K0B X;  2A5Y B;  2KDL A;  3KSJ A;  1G3I A;  4X66 M;  2VF7 A;  2V6Z M;  3FE3 A;  2KRK A;  4MGH A;  3FKE A;  4PDG A;  2C99 A;  5JI2 E;  1IQP A;  3B9P A;  5IWA M;  4MGZ E;  4OVZ B;  2WSC F;  3THG A;  1A5T A;  3IG5 A;  2FNA A;  4JI7 M;  3GO8 A;  1T6O A;  2C5R A;  1HJP A;  4NOO B;  3NBI A;  5DNY A;  2FH0 A;  3B7N A;  2F5O A;  2CHV A;  2JNH A;  1DGB A;  1W5T A;  2B3T A;  4FWD A;  4LG2 A;  1DV0 A;  3M6A A;  4IBC A;  1E94 E;  1I4W A;  4G3O A;  3U5Z A;  1YUB A;  3QYB A;  1WGL A;  3SC3 A;  3BBZ A;  4G4Q A;  1NHG C;  4FWG A;  3PNY A;  3QAU A;  1E9R A;  2R4E A;  2DZO B;  2CP8 A;  2OO9 A;  4L4U A;  3I51 A;  5EXX A;  3GRY A;  2CEA A;  4LF7 M;  4DUZ M;  3T1Y M;  3VDU A;  2K9D A;  2EJS A;  3SMS A;  4RF1 A;  4WW0 A;  3SAT A;  1TDH A;  3HHY A;  2LVQ D;  1IN5 A;  5C1B A;  4LF4 M;  3F92 A;  5EP2 A;  1GL7 A;  4GHA A;  2DZL A;  2KHH A;  3HHZ A;  3E46 A;  1KFV A;  3MHV C;  4X64 M;  4FCW A;  3W68 A;  4LY6 A;  4AZF A;  2Y20 A;  3U61 A;  1R4G A;  1UM8 A;  3QYE A;  4L78 A;  2DAI A;  3EIE A;  2UU9 M;  2RRU A;  1I94 M;  5KQD A;  1IBM M;  3VK7 A;  2QBY A;  3AJI B;  2EKF A;  3WHK A;  3I01 M;  4LF6 M;  4ZPX A;  1WIV A;  2WSE F;  2AHM A;  2MR9 A;  3AOE C;  3GPX A;  1C1K A;  5A2Q S;  1QAN A;  4FW9 A;  1NV9 A;  2CUZ A;  3UZU A;  1Q3B A;  2XSZ D;  1IN4 A;  2QP9 X;  3B89 A;  4B3R M;  2JY8 A;  4B7G A;  1GL6 A;  4ANR A;  4DV5 M;  4M0W A;  3A46 A;  2H1R A;  1TGU A;  4LJ8 A;  1XMQ M;  4TUW A;  1TR8 A;  3CTW B;  4M9Z A;  3GLF A;  1G4A E;  3T6P A;  2DWM A;  5JI3 E;  3VK8 A;  2KRU A;  4DR4 M;  2MH8 A;  3IEC A;  4I8O A;  3AOG A;  3J80 S;  3B7Z A;  4REZ A;  2LNH C;  3HWS A;  2DNA A;  2YNM D;  1SXJ A;  3GLH E;  1D0M A;  2R65 A;  3VFD A;  2R6F A;  1V92 A;  2F5N A;  4Z6Y A;  3L25 A;  3SAR A;  1ZMV A;  4RKU F;  5FSW A;  1OFI A;  1Z5A A;  2Z4S A;  2D7G A;  3TE6 A;  2VII A;  4IBB A;  2JY5 A;  4L15 A;  3T1H M;  2I7N A;  1IBL M;  2MJ5 B;  5E26 A;  5EP1 A;  4L6V 6;  1NY5 A;  2KA6 B;  1QAM A;  1E32 A;  3B7Q A;  3A42 A;  5EXT A;  4AQY M;  3J27 B;  3VKG A;  2HAK A;  3KW6 A;  4M9X A;  4LGM A;  3ILK A;  4JI5 M;  2P5T A;  3LW5 F;  3KS8 A;  3BOS A;  4MH0 E;  5IT9 S;  2YR0 A;  1PJT A;  3GLI A;  2M60 A;  1FNN A;  2ZTD A;  2J5Y A;  2DAM A;  1H6U A;  2LVA A;  3JR5 A;  3I04 M;  3E4R A;  4OW0 A;  1ORY B;  1UFZ A;  3BXW A;  2CHG A;  5BPV A;  3JR4 A;  2V1U A;  1AIP C;  4II7 A;  2FE8 A;  1VG5 A;  3U5Z B;  4GRI A;  4LZJ A;  3U6O A;  3GLG A;  4LJ4 A;  5E6J A;  4CGY B;  3J81 S;  2WZJ A;  4NRW A;  3V76 A;  2C96 A;  1DGH A;  3KOZ E;  4LFB M;  2LVP C;  2JZ1 A;  3KOX E;  4I4L A;  2CE7 A;  4IBI A;  4WUR A;  4LF9 M;  4GKK M;  4DV1 M;  3CF6 E;  1NVM A;  2R44 A;  3CF2 A;  1IXR C;  3W0F A;  3KXE C;  5ITX E;  3SBJ A;  5BR8 M;  4GC5 A;  4AG5 A;  1K82 A;  3AL0 C;  3U6L A;  1J7K A;  1HQY E;  1VEJ A;  3DZD A;  4GIP A;  1EE8 A;  4NXN M;  1G41 A;  3PFI A;  2D7E A;  4OX9 M;  4NXM M;  4Y28 F;  1W5S A;  2FOI C;  3UK6 A;  3U6D A;  1XC8 A;  4DR2 M;  2BWE A;  2D7H A;  1HNX M;  1PJS A;  4YY3 M;  1ZMU A;  2CWB A;  2J7O A;  3W0L B;  4F1I A; 
#chains in the Genus database with same CATH homology
 3F92 A;  3FRI A;  2O25 A;  3K9O A;  2DZL A;  2KHH A;  1HT1 E;  4R71 A;  3E46 A;  2ZTC A;  1NV8 A;  3MMP A;  5DFL A;  2DEN A;  4WP2 A;  2L4E A;  1CUK A;  2QSF X;  2R0I A;  3GLF E;  1R4G A;  1BVS A;  3LCU A;  3IHP A;  1OAI A;  2DAI A;  1ZV1 A;  1OQY A;  2H5X A;  1EFU B;  1TTE A;  2MRO B;  2RRU A;  1DO2 A;  2EKF A;  1PGY A;  2LTU A;  1HT2 E;  1WIV A;  2KNZ A;  2MR9 A;  1NV9 A;  2G3Q A;  2KNA A;  1C7Y A;  1XB2 B;  3B89 A;  2JY8 A;  3FRH A;  1WR1 B;  3E21 A;  1Q02 A;  1DO0 A;  1OTR A;  4DBG B;  1XXH E;  2JUJ A;  4F2L A;  3H4J A;  1TR8 A;  1SG9 A;  1F4I A;  1QZE A;  1G4A E;  3T6P A;  1YLA A;  2BWB A;  3IEC A;  4Q7J A;  4HEO A;  1WGN A;  2DNA A;  2EKK A;  2OOA A;  3GLH E;  3LCV B;  1V92 A;  2DAG A;  3GLG E;  1WJ7 A;  1ZMV A;  1JR3 E;  2DHY A;  2DI0 A;  2LVO C;  2JY5 A;  2JZ0 A;  2MJ5 B;  2DKL A;  2DAK A;  2QNJ A;  1MN3 A;  1VEG A;  1OKS A;  2LBC A;  2HAK A;  1GO5 A;  2DAE A;  3GLI E;  1T43 A;  1P3Q Q;  1VQ1 A;  1ZMW A;  2ZTD A;  2LVQ D;  2DAM A;  2OOB A;  2LVA A;  2K0B X;  1G3I A;  1UFZ A;  2KNV A;  2L4F A;  3FE3 A;  5JI2 E;  2HWJ A;  1AIP C;  1VG5 A;  1A5T A;  1T6O A;  2WZJ A;  1HJP A;  4UN2 B;  4GEW A;  2JNH A;  1DV0 A;  2B3T A;  1Y8G A;  1VEK A;  2L2D A;  2JZ1 A;  2LVN C;  2LVP C;  2JP7 A;  1E94 E;  4G3O A;  2MGW A;  1IXS A;  1WGL A;  3BBZ A;  2JY7 A;  1VEJ A;  1HQY E;  3K9P A;  1G41 A;  1IFY A;  2CP8 A;  2OO9 A;  1VDL A;  2QHO B;  2BWE A;  2K9D A;  2EJS A;  2JY6 B;  1ZMU A;  2CWB A;  4F1I A;  1IM2 A;  1WHC A;  1KYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...