4G3OA

Crystal structure of the cue domain of the e3 ubiquitin ligase amfr (gp78)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
RGSENLYFQGQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase AMFR
publication title Crystal structure of the CUE domain of the E3 ubiquitin ligase AMFR (gp78)
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 20
structure length 53
sequence length 53
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4g3oA00
2HAKA 2LBCA 1G3IA 2DZLA 1DV0A 2QSFX 1WHCA 1OTRA 1TR8A 2ZTDA 1DO2A 2JY5A 3B89A 3GLIE 1P3QQ 2CP8A 2EKKA 2JY7A 2MGWA 3FE3A 1WIVA 1VQ1A 1Q02A 1VDLA 2G3QA 2ZTCA 1GO5A 1F4IA 2BWEA 1V92A 5JI2E 1JR3E 2RRUA 3K9OA 2JUJA 2DAMA 1ZMVA 1HT1E 2DI0A 2K0BX 2LVQD 2EJSA 2EKFA 1PGYA 2JNHA 1IM2A 1EFUB 3E46A 1OKSA 1VG5A 1BVSA 2KHHA 2LVPC 1ZV1A 1VEJA 2OOBA 4Q7JA 2JY8A 3LCUA 2OO9A 1IFYA 1E94E 2H5XA 2HWJA 3GLFE 4UN2B 1CUKA 4G3OA 3K9PA 2K9DA 2DNAA 3GLGE 3H4JA 2JP7A 3IHPA 4F1IA 1ZMUA 1WGNA 1KYIA 1NV9A 2DHYA 1HJPA 2CWBA 1T6OA 2LVOC 3BBZA 1AIPC 2BWBA 2LTUA 2QHOB 3T6PA 1HT2E 3MMPA 1MN3A 1VEGA 2WZJA 1T43A 1OAIA 3F92A 2JZ1A 2JY6B 2QNJA 1A5TA 2L4EA 2LVNC 1WR1B 3E21A 2KNVA 1SG9A 2DAEA 1QZEA 2L4FA 1DO0A 1UFZA 2DKLA 2KNAA 5DFLA 1C7YA 4HEOA 2B3TA 2DAIA 1TTEA 1Y8GA 1YLAA 4F2LA 4DBGB 2O25A 3FRHA 3GLHE 3LCVB 1NV8A 2LVAA 2DAGA 1XXHE 1G41A 2DAKA 4GEWA 1HQYE 1XB2B 2DENA 2L2DA 1ZMWA 1IXSA 1G4AE 1WJ7A 2JZ0A 4R71A 2MJ5B 1VEKA 2MROB 2KNZA 1OQYA 4WP2A 1WGLA 2R0IA 1R4GA 3IECA 3FRIA 2MR9A 2OOAA
chains in the Genus database with same CATH superfamily
2HAKA 3E4RA 2JWSA 3KXEC 4GHLA 1G3IA 3HJQA 2DZLA 4LFAM 2FH0A 3A45A 4JV5M 2QSFX 3WHKA 3GLFB 1IY2A 1OTRA 2ZTDA 3B89A 2XSZD 4GHAA 3RGPA 2HL7A 3TE6A 3AV0A 2CP8A 1ORYB 2EKKA 4B3SM 1PJQA 3AJIB 4JI3M 2ZM6M 4DV0M 3HKPA 3VK8A 3RGSA 3GRVA 4X65M 1HR0M 4PT5A 3T1YM 2MH8A 4IJFA 3JR5A 4AQYM 1Q02A 2G3QA 1YUBA 3LMMA 3PVSA 1IN8A 4P17A 3HU2A 1F4IA 4MGHA 3PNVA 2XFSA 4B3MM 1SXJE 1JR3A 3A42A 3SBJA 3D8BA 2CHQA 4PD2A 2EKFA 4REZA 5ITQA 4DUZM 1PGYA 3I01M 4LF8M 2L6OA 3VLFB 1VG5A 4NRWA 1BVSA 2VQFM 4W5WA 5BPVA 2LVPC 5FTKA 1VEJA 1PM5A 4MH0E 1D0LA 5DYGA 3GO8A 1XNQM 3W0FA 4TUWA 3GPUA 2VIIA 3HJ8A 2HCBA 1LTMA 4RKUF 5EP2A 2UXBM 2J7OA 4II7A 1VDDA 2RGHA 2CV1A 8CATA 3GLGE 2DNAA 2KDLA 4LJAA 3SHGB 4B7FA 2V1CA 3GP1A 3U61A 1XMOM 2UXCM 2D7HA 4RF0A 3IHPA 4F1IA 2OPFA 4HL4A 5LMNM 3UJNA 1WGNA 4Z6YA 3MK6A 1QAOA 1DGFA 2DHYA 2BJWA 3C3EA 3FYDA 3U6SA 2F5NA 1DGHB 1NHWC 4YHHM 5IWAM 2J7NA 1QANA 3TWKA 4OX9M 2XEPA 2Y0TA 1J09A 2H1RA 1J7KA 3SYLA 3HX3A 4IBFA 4DUYM 3HJSA 3GLFA 2LVNC 1XNRM 1N34M 3GLIB 2KNVA 2DAEA 3CF6E 4NL4H 1NJFA 1GABA 2HHHM 3U6CA 1EE8A 3U6MA 4WW0A 3ZQJA 5DFLA 2X49A 2Y0QA 1IN5A 4OVZB 2UUAM 1Z5BA 2LWXA 3AOEA 1Y8GA 2FS1A 1YLAA 3FUTA 4NSOB 3GPPA 3B7ZA 1TH3A 3FRHA 3LCVB 4BLCA 4CIZA 3VDUA 3KOWE 1AUAA 2CRUA 2QBYB 3CGWA 2FNAA 4MGKE 1Z6TA 2RGOA 4ANRA 3NWLA 2Z3XA 4LG2A 2CHGA 5FSWA 1N78A 4G4QA 2A5YB 1ZMWA 2XH9A 4I81A 2MJ5B 4LJ9A 1FJGM 2Y20A 2ZAMA 3W68A 3GRYA 3TWLA 2FFJA 1XHBA 4RNAA 3TPZA 3UMMA 4JI2M 5C1BA 1GVNA 3B74A 3TWMA 3R8FA 2QCUA 2LBCA 3NBIA 4XGIA 1R2YA 3K2LA 4GC9A 4L6V6 4L15A 1V34A 3D8LA 4ZPXA 3E9SA 3GQ4A 1Q39A 2G5GX 1RU3A 1P3QQ 2JA2A 3I51A 5EXXA 3R9XB 1HNWM 3FTFA 2LH0A 5ITXA 4DR4M 2KZSA 2ZAOA 4Y28F 3SHFA 1WIVA 1T3TA 4DV4M 1WXQA 1SXJC 2UU9M 3J80S 4EIWA 3L28A 3T1HM 4AKGA 3FUUA 4IJEA 2G8LA 4LJ5A 3K9OA 2RRUA 3RE8A 1R2ZA 3SMSA 3WHLA 2N35A 5KPZA 2AHMA 1QDRA 3QAUA 5C18A 1HT1E 2DI0A 1DGHA 3U6PA 1IN4A 3FUVA 4FWDA 4DR1M 1NNUC 1KFVA 1IN7A 2JNHA 1MX0A 1TH2A 3K1JA 4AG5A 1IM2A 4QOSA 1EFUB 1S3SA 3E46A 1N77A 1V33A 1JQJC 3SASA 4I5SA 4IBIA 3M6AA 4GIPA 3FUWA 2KHHA 4DR5M 1ZV1A 2KXEA 1I94M 4KO8A 4DR2M 3EIEA 1LV7A 3GLIA 2DVWB 2OO9A 4WURA 4GC5A 3KDSE 3UGJA 2HWJA 3GLFE 2DWMA 2KA6B 2Z8YM 4UN2B 4JI1M 2GNOA 4OVZA 1HNXM 3AOGA 3K9PA 4LJ7A 4MM3B 3EIHA 2RKOA 3SC3A 2QBYA 1XXHB 3A46A 4XBOA 3THGA 4K0KM 1Z5AA 3TQSA 2BJVA 2LVOC 2LHCA 3B9PA 2BWBA 1GKIA 2DZNB 2KEBA 4LJ4A 5EXTA 1H6UA 4GKJM 3LQQA 1J5EM 4LF5M 5FTNA 4NRVA 4B7GA 5E26A 1NHGC 2R18A 4HLQA 4LCBA 1D0MA 5EXSA 2F5PA 4JI5M 4LJ6A 2DWZB 4JI6M 1E9SA 1VEGA 2WZJA 1T43A 1N36M 3IG5A 5EXPA 3I4YA 5JI3E 4M0DA 2XSZA 4G4NA 2JY6B 3U5ZB 1TDHA 3L27A 3U6LA 2C9OA 4LGYA 3B7QA 1WR1B 2D7EA 3QYEA 2C98A 2V1UA 2HKJA 3LVWA 2W82A 4AZFA 2EO2A 2KW0A 3B7NA 2Z4SA 1N75A 2R46A 2VF7A 1TTEA 3CF0A 3DFZA 2O25A 3GLHE 1HNZM 4IBGA 4LF4M 4M9SA 4RF1A 3V76A 3ZC7B 3GLGB 1IXZA 4KLNA 2LVAA 1PRBA 4X66M 2DAGA 3AKZA 1G8PA 4MGIE 5EP4A 3LVVA 5IZ7D 3U60B 1IY1A 1NSFA 1NY5A 1G4AE 2JZ0A 1VEKA 4GKKM 3TL4X 1X37A 1SXJD 4GRIA 4WP2A 2VF8A 2R6FA 1WGLA 1R4GA 3UZUA 3LW5F 2XLJA 5BR8M 2MR9A 2FOIC 3H4MA 3T15A 3VKHA 2ERCA 4IBCA 1ZQ9A 1Q3BA 4GH9A 1QQWA 2M5ZA 2R4JA 4JYAM 2CV0A 2F5SA 4NSRA 3QYBA 4G4RA 1L2DA 3Q8XA 4AKIA 4JN6A 1WHCA 3BOSA 2EA0A 2R65A 4PDGA 4CHTB 1L2CA 2UUBM 1TR8A 1DO2A 2JY5A 3GLIE 2XGNA 1NJGA 4DV3M 3HHWA 3I4VA 2XF3A 4FWGA 4LFBM 3L25A 1NNJA 4JI7M 1XXHA 3Q8GA 3SYKA 4G6ZA 1GJSA 1QUTA 3CF2A 3K8ZA 3DZDA 1IQPA 1IBMM 1GLNA 1V92A 2LHGA 3QWLA 1JR3E 2CE7A 2Z4RA 3K92A 3J81S 3GPYA 2D7GA 4B08A 2CEAA 4JI4M 2DAMA 2I7PA 1OJLA 1IXSB 1ZMVA 5A2QS 4DV2M 2K0BX 5IT9S 4LRSA 4DV1M 1R7RA 1QVRA 2EJSA 2E5LM 3KOZE 5EJCA 3IG8A 2WSFF 5FTMA 1OKSA 3UK6A 3L26A 4LGMA 2KRKA 4NXNM 1L1TA 2CHVA 4AG6A 2QENA 4OW0A 3U5ZA 2DWNA 1OIZA 2XZFA 2NQ8C 2OOBA 4Q7JA 4MB7A 3LCUA 3L29A 1E94E 2DZOB 3KSXA 4BBAA 3U6DA 1K82A 3AOEC 5L8RF 3U6OA 2EUCA 4S12A 4CISA 2O01F 5LMUM 4DV6M 2CUZA 2ZANA 2K9DA 3MHVC 5DYIA 5FTJA 3ILKA 1NVMA 3GLGA 2K47A 2JP7A 4I8OA 5FLXS 3DA1A 1ZMUA 2Y21A 1D0KA 1KSFX 3U60A 1EIJA 4DV7M 1KYIA 1NV9A 3T38A 4L78A 2CWBA 2BNKA 1OFHA 3SAUA 3HU3A 1AIPC 2LTUA 3FTDA 3HZJA 5EP3A 4KT0F 4DR3M 1N32M 1Q3CA 1Z5CA 4LF9M 1HT2E 1MN3A 4KODA 3JAMS 2QZ4A 1JR3D 4QHTA 2R4EA 2LNHC 2WSEF 3HHYA 1ZAEA 2Q2EB 4LZJA 2JZ1A 3L2AA 3SAVA 2QNJA 2UXDM 1HQCA 2QQ8A 3J7AS 2L4EA 4M9ZA 3KW6A 4XK8F 4QHSA 7CATA 2F5QA 2I7NA 1QZEA 1SG9A 2L4FA 4DR7M 5H37D 5KPRA 4DV5M 2DWLA 1OIPA 2DKLA 2KZUA 3M0EA 1XWIA 1QUSA 2DHRA 5FTLA 5KQDA 1C7YA 3ZCBB 3ZH9B 1K3XA 2B3TA 2XFTA 3KS4A 1QDTA 1TGUA 1DGGA 4I4LA 3KOYE 1I4WA 1NV8A 3FUXA 3GQ3A 2APLA 3SATA 1XXHE 3KVWA 1G41A 4FCVA 1XB2B 1SXJB 3U6QA 3M7GA 1IXSA 3C3DA 5KPTA 3VKGA 1NO1A 5EP1A 2R62A 1MU5A 2KNZA 1OFIA 2MROB 4FCWA 1Z59A 2F5OA 2X8AA 4IIWA 3J2PB 2DXIA 3IECA 3LQRA 3GPXA 4FVMA 1GJTA 3RFWA 1JB0F 3KP0E 4X62M 4G4OA 4IBDA 4LFCM 3HGIA 4LY6A 1DV0A 3FD9A 4AI6A 4L4UA 3C9PA 2VQEM 5EQTA 1GL7A 4QOZC 1FNNA 1L8QA 3BXWA 4B7HA 1D2NA 4L16A 1PJSA 1R6BX 2Z7JA 1YE9A 5ITXE 2O5RA 3HHZA 2MGWA 2JY7A 2ZBKB 4GMQA 3FE3A 2YNMD 4CJ6A 5KQ8A 4X64M 1IXRC 4NXMM 3I04M 1TDZA 2KRUA 2L09A 1VQ1A 1QAMA 1VDLA 1MJGM 2ZTCA 5ITTA 2YFQA 4MGYE 3GLHB 1GO5A 3PXGA 2BWEA 4A3VB 5JI2E 3GQ5A 4B3RM 3HU1A 2JUJA 5F3WA 4QNMA 4CGYB 1G71A 2LVQD 4L8RC 3DOAA 5ITUA 4IBJA 4FW9A 2J5YA 4JI0M 2R45A 1NY6A 3VDPA 1W5SA 3FKEA 1L2BA 1TH4A 3KP1E 2XZUA 3SARA 5GKNA 1IBLM 4JI8M 1IY0A 1E9RA 2X4AA 3KSJA 4MGZE 4PDIA 2GQFA 1E32A 4R7GA 4D80A 2JY8A 2L7IA 1IFYA 2H5XA 4NC6A 1OAOC 3W0LB 3HHXA 5DNYA 2K6BA 4BB9A 4R3DA 3J27B 1CUKA 2C96A 3FTEA 3U6EA 4FWHA 1GL6A 4G3OA 2JXNA 2F4VM 2R44A 3KFUG 4KHPM 1TF0B 3H4JA 1QAQA 1QYRA 2UUCM 3KOXE 1IN6A 3VFDA 3PNYA 1QZMA 4AW4A 1UM8A 3J7BA 3C58A 3CTWB 1SXJA 1K3WA 4DR6M 3HWSA 2LXEA 1PJJA 3KS8A 4AKHA 1HJPA 4P16A 4M0WA 1T6OA 2V6ZM 3BBZA 1C1KA 4M9XA 2QHOB 2VDBB 2CFOA 3JR4A 4FCTA 4NOOB 3T6PA 4IBBA 1PJTA 3MMPA 5E6JA 1L1ZA 4JXJA 3HY5A 4YY3M 1XC8A 4FD2A 1OAIA 4IBKA 3F92A 4GITA 4QNRA 3SAWA 4D81A 1R5LA 1A5TA 3FYCA 2C99A 4B3TM 1IBKM 4LJ8A 3E21A 3MJ5A 4Z8XA 1DO0A 5ITRA 1UFZA 2YR0A 3PFIA 3W67A 2KNAA 2QP9X 2C5RA 5ITYA 4HEOA 4ITQA 4LF6M 3AFHA 2DAIA 2P5TA 5KO3A 4PCZA 4F2LA 3AL0C 1N33M 2YQZA 4DBGB 3U61B 1YSYA 3GRUA 1DGBA 4D82A 3SMPA 3GRRA 3GLHA 2M60A 3A98B 3FTCA 3NBXX 2DAKA 2WSCF 4GEWA 5IREB 1HQYE 1PJIA 4LF7M 2L2DA 2DENA 3VK7A 2OQ4A 4R71A 1WJ7A 4LRTA 2FE8A 3SFZA 1G59A 1OQYA 1XMQM 2C9CA 2CV2A 4OU7A 2QPAA 2R0IA 3OTOM 2L7HA 3FRIA 4LZZA 4IBEA 1W5TA 2OOAA
chains in the Genus database with same CATH topology
2HAKA 2LBCA 1G3IA 2DZLA 1DV0A 2QSFX 1WHCA 1OTRA 1TR8A 2ZTDA 1DO2A 2JY5A 3B89A 3GLIE 1P3QQ 2CP8A 2EKKA 2JY7A 2MGWA 3FE3A 1WIVA 1VQ1A 1Q02A 1VDLA 2G3QA 2ZTCA 1GO5A 1F4IA 2BWEA 1V92A 5JI2E 1JR3E 2RRUA 3K9OA 2JUJA 2DAMA 1ZMVA 1HT1E 2DI0A 2K0BX 2LVQD 2EJSA 2EKFA 1PGYA 2JNHA 1IM2A 1EFUB 3E46A 1OKSA 1VG5A 1BVSA 2KHHA 2LVPC 1ZV1A 1VEJA 2OOBA 4Q7JA 2JY8A 3LCUA 2OO9A 1IFYA 1E94E 2H5XA 2HWJA 3GLFE 4UN2B 1CUKA 4G3OA 3K9PA 2K9DA 2DNAA 3GLGE 3H4JA 2JP7A 3IHPA 4F1IA 1ZMUA 1WGNA 1KYIA 1NV9A 2DHYA 1HJPA 2CWBA 1T6OA 2LVOC 3BBZA 1AIPC 2BWBA 2LTUA 2QHOB 3T6PA 1HT2E 3MMPA 1MN3A 1VEGA 2WZJA 1T43A 1OAIA 3F92A 2JZ1A 2JY6B 2QNJA 1A5TA 2L4EA 2LVNC 1WR1B 3E21A 2KNVA 1SG9A 2DAEA 1QZEA 2L4FA 1DO0A 1UFZA 2DKLA 2KNAA 5DFLA 1C7YA 4HEOA 2B3TA 2DAIA 1TTEA 1Y8GA 1YLAA 4F2LA 4DBGB 2O25A 3FRHA 3GLHE 3LCVB 1NV8A 2LVAA 2DAGA 1XXHE 1G41A 2DAKA 4GEWA 1HQYE 1XB2B 2DENA 2L2DA 1ZMWA 1IXSA 1G4AE 1WJ7A 2JZ0A 4R71A 2MJ5B 1VEKA 2MROB 2KNZA 1OQYA 4WP2A 1WGLA 2R0IA 1R4GA 3IECA 3FRIA 2MR9A 2OOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HAK A;  2LBC A;  1G3I A;  2DZL A;  1DV0 A;  2QSF X;  1WHC A;  1OTR A;  1TR8 A;  2ZTD A;  1DO2 A;  2JY5 A;  3B89 A;  3GLI E;  1P3Q Q;  2CP8 A;  2EKK A;  2JY7 A;  2MGW A;  3FE3 A;  1WIV A;  1VQ1 A;  1Q02 A;  1VDL A;  2G3Q A;  2ZTC A;  1GO5 A;  1F4I A;  2BWE A;  1V92 A;  5JI2 E;  1JR3 E;  2RRU A;  3K9O A;  2JUJ A;  2DAM A;  1ZMV A;  1HT1 E;  2DI0 A;  2K0B X;  2LVQ D;  2EJS A;  2EKF A;  1PGY A;  2JNH A;  1IM2 A;  1EFU B;  3E46 A;  1OKS A;  1VG5 A;  1BVS A;  2KHH A;  2LVP C;  1ZV1 A;  1VEJ A;  2OOB A;  4Q7J A;  2JY8 A;  3LCU A;  2OO9 A;  1IFY A;  1E94 E;  2H5X A;  2HWJ A;  3GLF E;  4UN2 B;  1CUK A;  4G3O A;  3K9P A;  2K9D A;  2DNA A;  3GLG E;  3H4J A;  2JP7 A;  3IHP A;  4F1I A;  1ZMU A;  1WGN A;  1KYI A;  1NV9 A;  2DHY A;  1HJP A;  2CWB A;  1T6O A;  2LVO C;  3BBZ A;  1AIP C;  2BWB A;  2LTU A;  2QHO B;  3T6P A;  1HT2 E;  3MMP A;  1MN3 A;  1VEG A;  2WZJ A;  1T43 A;  1OAI A;  3F92 A;  2JZ1 A;  2JY6 B;  2QNJ A;  1A5T A;  2L4E A;  2LVN C;  1WR1 B;  3E21 A;  2KNV A;  1SG9 A;  2DAE A;  1QZE A;  2L4F A;  1DO0 A;  1UFZ A;  2DKL A;  2KNA A;  5DFL A;  1C7Y A;  4HEO A;  2B3T A;  2DAI A;  1TTE A;  1Y8G A;  1YLA A;  4F2L A;  4DBG B;  2O25 A;  3FRH A;  3GLH E;  3LCV B;  1NV8 A;  2LVA A;  2DAG A;  1XXH E;  1G41 A;  2DAK A;  4GEW A;  1HQY E;  1XB2 B;  2DEN A;  2L2D A;  1ZMW A;  1IXS A;  1G4A E;  1WJ7 A;  2JZ0 A;  4R71 A;  2MJ5 B;  1VEK A;  2MRO B;  2KNZ A;  1OQY A;  4WP2 A;  1WGL A;  2R0I A;  1R4G A;  3IEC A;  3FRI A;  2MR9 A;  2OOA A; 
#chains in the Genus database with same CATH topology
 2HAK A;  3E4R A;  2JWS A;  3KXE C;  4GHL A;  1G3I A;  3HJQ A;  2DZL A;  4LFA M;  2FH0 A;  3A45 A;  4JV5 M;  2QSF X;  3WHK A;  3GLF B;  1IY2 A;  1OTR A;  2ZTD A;  3B89 A;  2XSZ D;  4GHA A;  3RGP A;  2HL7 A;  3TE6 A;  3AV0 A;  2CP8 A;  1ORY B;  2EKK A;  4B3S M;  1PJQ A;  3AJI B;  4JI3 M;  2ZM6 M;  4DV0 M;  3HKP A;  3VK8 A;  3RGS A;  3GRV A;  4X65 M;  1HR0 M;  4PT5 A;  3T1Y M;  2MH8 A;  4IJF A;  3JR5 A;  4AQY M;  1Q02 A;  2G3Q A;  1YUB A;  3LMM A;  3PVS A;  1IN8 A;  4P17 A;  3HU2 A;  1F4I A;  4MGH A;  3PNV A;  2XFS A;  4B3M M;  1SXJ E;  1JR3 A;  3A42 A;  3SBJ A;  3D8B A;  2CHQ A;  4PD2 A;  2EKF A;  4REZ A;  5ITQ A;  4DUZ M;  1PGY A;  3I01 M;  4LF8 M;  2L6O A;  3VLF B;  1VG5 A;  4NRW A;  1BVS A;  2VQF M;  4W5W A;  5BPV A;  2LVP C;  5FTK A;  1VEJ A;  1PM5 A;  4MH0 E;  1D0L A;  5DYG A;  3GO8 A;  1XNQ M;  3W0F A;  4TUW A;  3GPU A;  2VII A;  3HJ8 A;  2HCB A;  1LTM A;  4RKU F;  5EP2 A;  2UXB M;  2J7O A;  4II7 A;  1VDD A;  2RGH A;  2CV1 A;  8CAT A;  3GLG E;  2DNA A;  2KDL A;  4LJA A;  3SHG B;  4B7F A;  2V1C A;  3GP1 A;  3U61 A;  1XMO M;  2UXC M;  2D7H A;  4RF0 A;  3IHP A;  4F1I A;  2OPF A;  4HL4 A;  5LMN M;  3UJN A;  1WGN A;  4Z6Y A;  3MK6 A;  1QAO A;  1DGF A;  2DHY A;  2BJW A;  3C3E A;  3FYD A;  3U6S A;  2F5N A;  1DGH B;  1NHW C;  4YHH M;  5IWA M;  2J7N A;  1QAN A;  3TWK A;  4OX9 M;  2XEP A;  2Y0T A;  1J09 A;  2H1R A;  1J7K A;  3SYL A;  3HX3 A;  4IBF A;  4DUY M;  3HJS A;  3GLF A;  2LVN C;  1XNR M;  1N34 M;  3GLI B;  2KNV A;  2DAE A;  3CF6 E;  4NL4 H;  1NJF A;  1GAB A;  2HHH M;  3U6C A;  1EE8 A;  3U6M A;  4WW0 A;  3ZQJ A;  5DFL A;  2X49 A;  2Y0Q A;  1IN5 A;  4OVZ B;  2UUA M;  1Z5B A;  2LWX A;  3AOE A;  1Y8G A;  2FS1 A;  1YLA A;  3FUT A;  4NSO B;  3GPP A;  3B7Z A;  1TH3 A;  3FRH A;  3LCV B;  4BLC A;  4CIZ A;  3VDU A;  3KOW E;  1AUA A;  2CRU A;  2QBY B;  3CGW A;  2FNA A;  4MGK E;  1Z6T A;  2RGO A;  4ANR A;  3NWL A;  2Z3X A;  4LG2 A;  2CHG A;  5FSW A;  1N78 A;  4G4Q A;  2A5Y B;  1ZMW A;  2XH9 A;  4I81 A;  2MJ5 B;  4LJ9 A;  1FJG M;  2Y20 A;  2ZAM A;  3W68 A;  3GRY A;  3TWL A;  2FFJ A;  1XHB A;  4RNA A;  3TPZ A;  3UMM A;  4JI2 M;  5C1B A;  1GVN A;  3B74 A;  3TWM A;  3R8F A;  2QCU A;  2LBC A;  3NBI A;  4XGI A;  1R2Y A;  3K2L A;  4GC9 A;  4L6V 6;  4L15 A;  1V34 A;  3D8L A;  4ZPX A;  3E9S A;  3GQ4 A;  1Q39 A;  2G5G X;  1RU3 A;  1P3Q Q;  2JA2 A;  3I51 A;  5EXX A;  3R9X B;  1HNW M;  3FTF A;  2LH0 A;  5ITX A;  4DR4 M;  2KZS A;  2ZAO A;  4Y28 F;  3SHF A;  1WIV A;  1T3T A;  4DV4 M;  1WXQ A;  1SXJ C;  2UU9 M;  3J80 S;  4EIW A;  3L28 A;  3T1H M;  4AKG A;  3FUU A;  4IJE A;  2G8L A;  4LJ5 A;  3K9O A;  2RRU A;  3RE8 A;  1R2Z A;  3SMS A;  3WHL A;  2N35 A;  5KPZ A;  2AHM A;  1QDR A;  3QAU A;  5C18 A;  1HT1 E;  2DI0 A;  1DGH A;  3U6P A;  1IN4 A;  3FUV A;  4FWD A;  4DR1 M;  1NNU C;  1KFV A;  1IN7 A;  2JNH A;  1MX0 A;  1TH2 A;  3K1J A;  4AG5 A;  1IM2 A;  4QOS A;  1EFU B;  1S3S A;  3E46 A;  1N77 A;  1V33 A;  1JQJ C;  3SAS A;  4I5S A;  4IBI A;  3M6A A;  4GIP A;  3FUW A;  2KHH A;  4DR5 M;  1ZV1 A;  2KXE A;  1I94 M;  4KO8 A;  4DR2 M;  3EIE A;  1LV7 A;  3GLI A;  2DVW B;  2OO9 A;  4WUR A;  4GC5 A;  3KDS E;  3UGJ A;  2HWJ A;  3GLF E;  2DWM A;  2KA6 B;  2Z8Y M;  4UN2 B;  4JI1 M;  2GNO A;  4OVZ A;  1HNX M;  3AOG A;  3K9P A;  4LJ7 A;  4MM3 B;  3EIH A;  2RKO A;  3SC3 A;  2QBY A;  1XXH B;  3A46 A;  4XBO A;  3THG A;  4K0K M;  1Z5A A;  3TQS A;  2BJV A;  2LVO C;  2LHC A;  3B9P A;  2BWB A;  1GKI A;  2DZN B;  2KEB A;  4LJ4 A;  5EXT A;  1H6U A;  4GKJ M;  3LQQ A;  1J5E M;  4LF5 M;  5FTN A;  4NRV A;  4B7G A;  5E26 A;  1NHG C;  2R18 A;  4HLQ A;  4LCB A;  1D0M A;  5EXS A;  2F5P A;  4JI5 M;  4LJ6 A;  2DWZ B;  4JI6 M;  1E9S A;  1VEG A;  2WZJ A;  1T43 A;  1N36 M;  3IG5 A;  5EXP A;  3I4Y A;  5JI3 E;  4M0D A;  2XSZ A;  4G4N A;  2JY6 B;  3U5Z B;  1TDH A;  3L27 A;  3U6L A;  2C9O A;  4LGY A;  3B7Q A;  1WR1 B;  2D7E A;  3QYE A;  2C98 A;  2V1U A;  2HKJ A;  3LVW A;  2W82 A;  4AZF A;  2EO2 A;  2KW0 A;  3B7N A;  2Z4S A;  1N75 A;  2R46 A;  2VF7 A;  1TTE A;  3CF0 A;  3DFZ A;  2O25 A;  3GLH E;  1HNZ M;  4IBG A;  4LF4 M;  4M9S A;  4RF1 A;  3V76 A;  3ZC7 B;  3GLG B;  1IXZ A;  4KLN A;  2LVA A;  1PRB A;  4X66 M;  2DAG A;  3AKZ A;  1G8P A;  4MGI E;  5EP4 A;  3LVV A;  5IZ7 D;  3U60 B;  1IY1 A;  1NSF A;  1NY5 A;  1G4A E;  2JZ0 A;  1VEK A;  4GKK M;  3TL4 X;  1X37 A;  1SXJ D;  4GRI A;  4WP2 A;  2VF8 A;  2R6F A;  1WGL A;  1R4G A;  3UZU A;  3LW5 F;  2XLJ A;  5BR8 M;  2MR9 A;  2FOI C;  3H4M A;  3T15 A;  3VKH A;  2ERC A;  4IBC A;  1ZQ9 A;  1Q3B A;  4GH9 A;  1QQW A;  2M5Z A;  2R4J A;  4JYA M;  2CV0 A;  2F5S A;  4NSR A;  3QYB A;  4G4R A;  1L2D A;  3Q8X A;  4AKI A;  4JN6 A;  1WHC A;  3BOS A;  2EA0 A;  2R65 A;  4PDG A;  4CHT B;  1L2C A;  2UUB M;  1TR8 A;  1DO2 A;  2JY5 A;  3GLI E;  2XGN A;  1NJG A;  4DV3 M;  3HHW A;  3I4V A;  2XF3 A;  4FWG A;  4LFB M;  3L25 A;  1NNJ A;  4JI7 M;  1XXH A;  3Q8G A;  3SYK A;  4G6Z A;  1GJS A;  1QUT A;  3CF2 A;  3K8Z A;  3DZD A;  1IQP A;  1IBM M;  1GLN A;  1V92 A;  2LHG A;  3QWL A;  1JR3 E;  2CE7 A;  2Z4R A;  3K92 A;  3J81 S;  3GPY A;  2D7G A;  4B08 A;  2CEA A;  4JI4 M;  2DAM A;  2I7P A;  1OJL A;  1IXS B;  1ZMV A;  5A2Q S;  4DV2 M;  2K0B X;  5IT9 S;  4LRS A;  4DV1 M;  1R7R A;  1QVR A;  2EJS A;  2E5L M;  3KOZ E;  5EJC A;  3IG8 A;  2WSF F;  5FTM A;  1OKS A;  3UK6 A;  3L26 A;  4LGM A;  2KRK A;  4NXN M;  1L1T A;  2CHV A;  4AG6 A;  2QEN A;  4OW0 A;  3U5Z A;  2DWN A;  1OIZ A;  2XZF A;  2NQ8 C;  2OOB A;  4Q7J A;  4MB7 A;  3LCU A;  3L29 A;  1E94 E;  2DZO B;  3KSX A;  4BBA A;  3U6D A;  1K82 A;  3AOE C;  5L8R F;  3U6O A;  2EUC A;  4S12 A;  4CIS A;  2O01 F;  5LMU M;  4DV6 M;  2CUZ A;  2ZAN A;  2K9D A;  3MHV C;  5DYI A;  5FTJ A;  3ILK A;  1NVM A;  3GLG A;  2K47 A;  2JP7 A;  4I8O A;  5FLX S;  3DA1 A;  1ZMU A;  2Y21 A;  1D0K A;  1KSF X;  3U60 A;  1EIJ A;  4DV7 M;  1KYI A;  1NV9 A;  3T38 A;  4L78 A;  2CWB A;  2BNK A;  1OFH A;  3SAU A;  3HU3 A;  1AIP C;  2LTU A;  3FTD A;  3HZJ A;  5EP3 A;  4KT0 F;  4DR3 M;  1N32 M;  1Q3C A;  1Z5C A;  4LF9 M;  1HT2 E;  1MN3 A;  4KOD A;  3JAM S;  2QZ4 A;  1JR3 D;  4QHT A;  2R4E A;  2LNH C;  2WSE F;  3HHY A;  1ZAE A;  2Q2E B;  4LZJ A;  2JZ1 A;  3L2A A;  3SAV A;  2QNJ A;  2UXD M;  1HQC A;  2QQ8 A;  3J7A S;  2L4E A;  4M9Z A;  3KW6 A;  4XK8 F;  4QHS A;  7CAT A;  2F5Q A;  2I7N A;  1QZE A;  1SG9 A;  2L4F A;  4DR7 M;  5H37 D;  5KPR A;  4DV5 M;  2DWL A;  1OIP A;  2DKL A;  2KZU A;  3M0E A;  1XWI A;  1QUS A;  2DHR A;  5FTL A;  5KQD A;  1C7Y A;  3ZCB B;  3ZH9 B;  1K3X A;  2B3T A;  2XFT A;  3KS4 A;  1QDT A;  1TGU A;  1DGG A;  4I4L A;  3KOY E;  1I4W A;  1NV8 A;  3FUX A;  3GQ3 A;  2APL A;  3SAT A;  1XXH E;  3KVW A;  1G41 A;  4FCV A;  1XB2 B;  1SXJ B;  3U6Q A;  3M7G A;  1IXS A;  3C3D A;  5KPT A;  3VKG A;  1NO1 A;  5EP1 A;  2R62 A;  1MU5 A;  2KNZ A;  1OFI A;  2MRO B;  4FCW A;  1Z59 A;  2F5O A;  2X8A A;  4IIW A;  3J2P B;  2DXI A;  3IEC A;  3LQR A;  3GPX A;  4FVM A;  1GJT A;  3RFW A;  1JB0 F;  3KP0 E;  4X62 M;  4G4O A;  4IBD A;  4LFC M;  3HGI A;  4LY6 A;  1DV0 A;  3FD9 A;  4AI6 A;  4L4U A;  3C9P A;  2VQE M;  5EQT A;  1GL7 A;  4QOZ C;  1FNN A;  1L8Q A;  3BXW A;  4B7H A;  1D2N A;  4L16 A;  1PJS A;  1R6B X;  2Z7J A;  1YE9 A;  5ITX E;  2O5R A;  3HHZ A;  2MGW A;  2JY7 A;  2ZBK B;  4GMQ A;  3FE3 A;  2YNM D;  4CJ6 A;  5KQ8 A;  4X64 M;  1IXR C;  4NXM M;  3I04 M;  1TDZ A;  2KRU A;  2L09 A;  1VQ1 A;  1QAM A;  1VDL A;  1MJG M;  2ZTC A;  5ITT A;  2YFQ A;  4MGY E;  3GLH B;  1GO5 A;  3PXG A;  2BWE A;  4A3V B;  5JI2 E;  3GQ5 A;  4B3R M;  3HU1 A;  2JUJ A;  5F3W A;  4QNM A;  4CGY B;  1G71 A;  2LVQ D;  4L8R C;  3DOA A;  5ITU A;  4IBJ A;  4FW9 A;  2J5Y A;  4JI0 M;  2R45 A;  1NY6 A;  3VDP A;  1W5S A;  3FKE A;  1L2B A;  1TH4 A;  3KP1 E;  2XZU A;  3SAR A;  5GKN A;  1IBL M;  4JI8 M;  1IY0 A;  1E9R A;  2X4A A;  3KSJ A;  4MGZ E;  4PDI A;  2GQF A;  1E32 A;  4R7G A;  4D80 A;  2JY8 A;  2L7I A;  1IFY A;  2H5X A;  4NC6 A;  1OAO C;  3W0L B;  3HHX A;  5DNY A;  2K6B A;  4BB9 A;  4R3D A;  3J27 B;  1CUK A;  2C96 A;  3FTE A;  3U6E A;  4FWH A;  1GL6 A;  4G3O A;  2JXN A;  2F4V M;  2R44 A;  3KFU G;  4KHP M;  1TF0 B;  3H4J A;  1QAQ A;  1QYR A;  2UUC M;  3KOX E;  1IN6 A;  3VFD A;  3PNY A;  1QZM A;  4AW4 A;  1UM8 A;  3J7B A;  3C58 A;  3CTW B;  1SXJ A;  1K3W A;  4DR6 M;  3HWS A;  2LXE A;  1PJJ A;  3KS8 A;  4AKH A;  1HJP A;  4P16 A;  4M0W A;  1T6O A;  2V6Z M;  3BBZ A;  1C1K A;  4M9X A;  2QHO B;  2VDB B;  2CFO A;  3JR4 A;  4FCT A;  4NOO B;  3T6P A;  4IBB A;  1PJT A;  3MMP A;  5E6J A;  1L1Z A;  4JXJ A;  3HY5 A;  4YY3 M;  1XC8 A;  4FD2 A;  1OAI A;  4IBK A;  3F92 A;  4GIT A;  4QNR A;  3SAW A;  4D81 A;  1R5L A;  1A5T A;  3FYC A;  2C99 A;  4B3T M;  1IBK M;  4LJ8 A;  3E21 A;  3MJ5 A;  4Z8X A;  1DO0 A;  5ITR A;  1UFZ A;  2YR0 A;  3PFI A;  3W67 A;  2KNA A;  2QP9 X;  2C5R A;  5ITY A;  4HEO A;  4ITQ A;  4LF6 M;  3AFH A;  2DAI A;  2P5T A;  5KO3 A;  4PCZ A;  4F2L A;  3AL0 C;  1N33 M;  2YQZ A;  4DBG B;  3U61 B;  1YSY A;  3GRU A;  1DGB A;  4D82 A;  3SMP A;  3GRR A;  3GLH A;  2M60 A;  3A98 B;  3FTC A;  3NBX X;  2DAK A;  2WSC F;  4GEW A;  5IRE B;  1HQY E;  1PJI A;  4LF7 M;  2L2D A;  2DEN A;  3VK7 A;  2OQ4 A;  4R71 A;  1WJ7 A;  4LRT A;  2FE8 A;  3SFZ A;  1G59 A;  1OQY A;  1XMQ M;  2C9C A;  2CV2 A;  4OU7 A;  2QPA A;  2R0I A;  3OTO M;  2L7H A;  3FRI A;  4LZZ A;  4IBE A;  1W5T A;  2OOA A; 
#chains in the Genus database with same CATH homology
 2HAK A;  2LBC A;  1G3I A;  2DZL A;  1DV0 A;  2QSF X;  1WHC A;  1OTR A;  1TR8 A;  2ZTD A;  1DO2 A;  2JY5 A;  3B89 A;  3GLI E;  1P3Q Q;  2CP8 A;  2EKK A;  2JY7 A;  2MGW A;  3FE3 A;  1WIV A;  1VQ1 A;  1Q02 A;  1VDL A;  2G3Q A;  2ZTC A;  1GO5 A;  1F4I A;  2BWE A;  1V92 A;  5JI2 E;  1JR3 E;  2RRU A;  3K9O A;  2JUJ A;  2DAM A;  1ZMV A;  1HT1 E;  2DI0 A;  2K0B X;  2LVQ D;  2EJS A;  2EKF A;  1PGY A;  2JNH A;  1IM2 A;  1EFU B;  3E46 A;  1OKS A;  1VG5 A;  1BVS A;  2KHH A;  2LVP C;  1ZV1 A;  1VEJ A;  2OOB A;  4Q7J A;  2JY8 A;  3LCU A;  2OO9 A;  1IFY A;  1E94 E;  2H5X A;  2HWJ A;  3GLF E;  4UN2 B;  1CUK A;  4G3O A;  3K9P A;  2K9D A;  2DNA A;  3GLG E;  3H4J A;  2JP7 A;  3IHP A;  4F1I A;  1ZMU A;  1WGN A;  1KYI A;  1NV9 A;  2DHY A;  1HJP A;  2CWB A;  1T6O A;  2LVO C;  3BBZ A;  1AIP C;  2BWB A;  2LTU A;  2QHO B;  3T6P A;  1HT2 E;  3MMP A;  1MN3 A;  1VEG A;  2WZJ A;  1T43 A;  1OAI A;  3F92 A;  2JZ1 A;  2JY6 B;  2QNJ A;  1A5T A;  2L4E A;  2LVN C;  1WR1 B;  3E21 A;  2KNV A;  1SG9 A;  2DAE A;  1QZE A;  2L4F A;  1DO0 A;  1UFZ A;  2DKL A;  2KNA A;  5DFL A;  1C7Y A;  4HEO A;  2B3T A;  2DAI A;  1TTE A;  1Y8G A;  1YLA A;  4F2L A;  4DBG B;  2O25 A;  3FRH A;  3GLH E;  3LCV B;  1NV8 A;  2LVA A;  2DAG A;  1XXH E;  1G41 A;  2DAK A;  4GEW A;  1HQY E;  1XB2 B;  2DEN A;  2L2D A;  1ZMW A;  1IXS A;  1G4A E;  1WJ7 A;  2JZ0 A;  4R71 A;  2MJ5 B;  1VEK A;  2MRO B;  2KNZ A;  1OQY A;  4WP2 A;  1WGL A;  2R0I A;  1R4G A;  3IEC A;  3FRI A;  2MR9 A;  2OOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...