1N33M

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n33M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n33M02
3SAWA 4X64M 4ITQA 4DV7M 4PDIA 5ITUA 5ITXE 2VQFM 4PCZA 3SBJA 4DR1M 2UXCM 4PDGA 2UU9M 4B3RM 4B3SM 3A45A 4DR5M 4LF9M 5BR8M 1KFVA 4GKKM 4YHHM 1XMOM 5LMNM 1Q3BA 1TDZA 2HKJA 4DR4M 1XNQM 4JV5M 2UXBM 1K82A 1N32M 1Q3CA 2ZBKB 3TWLA 3U6DA 2F5OA 2UUBM 4JI6M 4JI3M 3GO8A 3C58A 2F5NA 4G4NA 4DR7M 4OX9M 1L1ZA 4LF5M 1MX0A 2Q2EB 3GQ4A 4LF7M 4LF8M 4DR3M 1PM5A 3GPPA 3JR5A 1Z5BA 4JI2M 4LF4M 3SARA 1L2BA 1Z59A 1HR0M 3SATA 2F5PA 4X66M 3U6LA 3GQ5A 2XZFA 4NXMM 3OTOM 4JI7M 1L2CA 1I94M 2F5SA 3U6OA 4DR2M 4NRVA 4JI0M 4JI8M 5IWAM 4NRWA 3GQ3A 4DV4M 1R2YA 5ITXA 5ITQA 1N36M 4DV6M 1Z5AA 2OQ4A 1FJGM 2OPFA 3U6QA 4JI5M 3SAVA 4JYAM 4CISA 4G4QA 3JR4A 4JI1M 1HNXM 4DV1M 4YY3M 5ITRA 3J81S 2VQEM 2F4VM 3U6MA 4AQYM 3J80S 1HNWM 1K3WA 1N34M 4DR6M 2HHHM 3VK8A 1J5EM 1IBMM 3T1HM 1XMQM 4G4OA 4DV2M 2XZUA 4JI4M 3TWKA 1PJIA 3DOAA 3GPXA 1IBKM 3U6EA 4DV0M 5IT9S 4PD2A 5ITTA 2F5QA 3SASA 1PJJA 4GKJM 4LFAM 1Z5CA 3GPYA 5ITYA 3A42A 3U6SA 4DUYM 4G4RA 3T1YM 4B3MM 1XNRM 4NXNM 1HNZM 2UUCM 2EA0A 4LF6M 1NNJA 4MB7A 1K3XA 1XC8A 2UXDM 1MU5A 1TDHA 4B3TM 3GPUA 1L2DA 1Q39A 4X62M 1R2ZA 3SAUA 3J7AS 5LMUM 3JAMS 3VK7A 1N33M 2UUAM 4K0KM 5FLXS 4X65M 4DV5M 4LFCM 4KHPM 2ZM6M 3W0FA 4DUZM 5A2QS 3U6PA 4LFBM 4DV3M 1L1TA 2E5LM 3A46A 1EE8A 3GP1A 1IBLM 3U6CA 3TWMA
chains in the Genus database with same CATH superfamily
1JR3E 3R9XB 1WJ7A 4GIPA 4MGIE 3I51A 1S3SA 2J7OA 4QNMA 4DV7M 4PCZA 4Z8XA 1W5SA 3NBXX 5L8RF 1H6UA 2LTUA 2UU9M 2R45A 2YFQA 4FVMA 3U61A 3A45A 1XMOM 2EKKA 1SXJE 3EIHA 3HWSA 5DFLA 2LHGA 2ZAMA 2LVAA 4LGYA 2R44A 2V1CA 2CFOA 2MROB 2UXBM 1TR8A 2EUCA 5JI2E 4QHSA 1Q3CA 2ZBKB 3TWLA 2CV2A 4TUWA 3U6DA 2UUBM 3HJ8A 3VKHA 2OOAA 4L16A 3HHYA 1V92A 1XXHA 1VDDA 2K6BA 3FTDA 2C5RA 4I8OA 4MGZE 4LF5M 2LH0A 1MX0A 1OFIA 2DWLA 4LJ8A 5EJCA 2JY5A 3AV0A 5BPVA 2C98A 1GVNA 3HJQA 1HQCA 3PVSA 4FD2A 2KNVA 4I81A 3FE3A 3UJNA 1Z59A 1KYIA 2JZ0A 4AW4A 2AHMA 3E21A 3HY5A 2QBYA 4CGYB 4IBGA 1QAMA 2WSCF 2XZFA 4NXMM 1IFYA 1I4WA 2Y21A 4KODA 2L4FA 3LMMA 4AG6A 1L2CA 1IN5A 4FCTA 1DO0A 3U6OA 1P3QQ 4NRVA 5IWAM 1PJSA 2C9CA 3R8FA 2EKFA 1Z5AA 3B9PA 4JI5M 5H37D 2CV0A 2CE7A 5DYGA 2DZNB 3KP1E 4WP2A 2HAKA 4G4QA 3JR4A 4JI1M 3L28A 3VKGA 3GLHE 2VQEM 3FD9A 2O25A 3SYKA 2F4VM 1TF0B 2L2DA 5FTMA 1HNWM 5IZ7D 1ZMVA 2LNHC 3MK6A 4GC5A 1K3WA 2DZOB 2QPAA 2N35A 1G59A 3KSJA 3SC3A 1DGFA 3PXGA 5FSWA 3U60B 1IN8A 2FFJA 4JI4M 2DKLA 2DHYA 4HL4A 3K92A 2OO9A 2D7EA 3J27B 4S12A 4PD2A 2F5QA 5IT9S 5GKNA 4GKJM 2V1UA 2HCBA 1Z5CA 1QANA 3THGA 5ITYA 1SXJC 2EJSA 3T1YM 1DO2A 1G4AE 3K9OA 4NXNM 1HNZM 2XF3A 3CGWA 3J2PB 4IBEA 4GITA 3H4MA 3KFUG 1TH3A 1GO5A 1A5TA 3HU2A 3AOEC 2CRUA 4RF0A 3GLGE 2O5RA 2HWJA 3AJIB 3QAUA 4LJ5A 8CATA 4QHTA 3U5ZA 3J7AS 3SYLA 3VK7A 4NL4H 1TH2A 4RKUF 1MJGM 5FLXS 1F4IA 4DBGB 2DNAA 4R3DA 2KA6B 2YR0A 3HU3A 2ZM6M 4L8RC 4LFBM 2GQFA 1ORYB 4ZPXA 4DV3M 4BLCA 2E5LM 2P5TA 3HU1A 1EE8A 3GP1A 1IXZA 1R4GA 3MMPA 2X49A 4L6V6 2L7IA 2BJWA 2M60A 3SAWA 4X64M 4ITQA 2Z4RA 4L4UA 2LVPC 2Z8YM 4PDIA 5ITXE 3KOXE 4MGYE 3SBJA 2R62A 4UN2B 5KQ8A 4B3SM 2ZTCA 4FW9A 4MM3B 1GLNA 1NV8A 1QYRA 1R7RA 5EQTA 4YHHM 4M9SA 5LMNM 1KFVA 1Q3BA 2XLJA 4IBFA 3ZC7B 4REZA 4AKGA 4DR4M 1XNQM 1JR3A 4JV5M 2BNKA 1K82A 2DENA 1TTEA 1X37A 1N32M 3FRHA 2F5OA 3GO8A 2F5NA 1IY2A 1YE9A 2R6FA 4OX9M 3FUTA 3KDSE 3Q8GA 1IM2A 3C9PA 5FTJA 5C18A 2MJ5B 3PNVA 2RGOA 4F2LA 4LF7M 3LVWA 1OJLA 2M5ZA 2KNZA 3GLIE 3BBZA 2G5GX 1Z5BA 1PGYA 1NJGA 1ZV1A 5KPTA 1JB0F 2A5YB 3L2AA 4KLNA 5KQDA 2KNAA 3H4JA 7CATA 3BOSA 3V76A 2F5SA 4JI8M 3E46A 3B89A 3AKZA 1LTMA 4RF1A 1E9SA 2DAIA 3GQ3A 2CP8A 2DI0A 1NHWC 1D0LA 1WIVA 2OQ4A 1FJGM 2OPFA 3U6QA 2CHVA 1TH4A 3U60A 3SAVA 1IY0A 2GNOA 1JR3D 2YQZA 3T15A 3K9PA 5EP4A 4DV1M 2DAGA 2K9DA 2MGWA 1IXRC 1NO1A 2L7HA 2R4JA 3U6MA 1TGUA 1BVSA 4II7A 4R7GA 3SHGB 4FWGA 2KXEA 5KO3A 4GRIA 2HHHM 1J7KA 1SXJD 1V33A 5KPRA 3IECA 5EP2A 1D0KA 1QQWA 1G71A 2H1RA 4IBCA 4G4OA 4AKIA 2Y20A 3M0EA 3HGIA 4B7FA 2R65A 1SXJB 2JY7A 2C96A 2XFSA 2ZAOA 3VDPA 4DV0M 5ITTA 3B74A 3HHWA 3SASA 3KVWA 4LFAM 4EIWA 3K2LA 4IBIA 3WHKA 1VEJA 3A42A 4DUYM 1L8QA 4B3MM 2JWSA 2JY8A 2UUCM 3RFWA 3FKEA 3FYCA 3FUWA 4MB7A 3MHVC 1XC8A 2UXDM 3HX3A 5KPZA 2QENA 4B3TM 3GPUA 3FYDA 1W5TA 1OQYA 3KXEC 1L2DA 1XXHE 3TE6A 1VDLA 4Z6YA 2LVOC 4LCBA 2MH8A 3E9SA 1OIZA 2H5XA 3W0LB 2JA2A 5LMUM 4FCWA 4ANRA 2UUAM 4LFCM 3I4VA 4HLQA 4NSOB 1NHGC 2NQ8C 2R0IA 2R46A 4LJ7A 5E26A 2KW0A 1IBLM 3U6CA 2LBCA 3TWMA 2QQ8A 2FH0A 3NWLA 1HQYE 1E9RA 1HT1E 3DZDA 5ITUA 2VQFM 1WGLA 4KO8A 1ZMUA 3GLHB 1OAOC 4FWHA 5EP3A 4PDGA 4DR1M 5F3WA 4LRTA 3E4RA 2UXCM 4DR5M 3DFZA 1J09A 2LVQD 1G8PA 1E32A 4LF9M 4QOZC 3TQSA 1EIJA 4LJ6A 5EXSA 3HKPA 1NY5A 1TDZA 3FUUA 2HKJA 2O01F 1NY6A 3KOZE 1Y8GA 4M9ZA 3RGSA 3VLFB 4A3VB 4AZFA 3ILKA 4NC6A 4MH0E 2Z7JA 1IQPA 1VEKA 3HHXA 3ZCBB 1IXSB 2DWMA 4LGMA 1T6OA 2C9OA 4G4NA 1YUBA 2V6ZM 4B7GA 1UM8A 1T3TA 1L1ZA 3LQRA 1R5LA 2HL7A 2ERCA 3DA1A 2Q2EB 3A98B 3C3EA 4IJFA 2JZ1A 3IHPA 4LF8M 1OKSA 4DR3M 1GL6A 1PM5A 3JR5A 4IIWA 3C3DA 4LF4M 3CF6E 1L2BA 1R6BX 5EP1A 1HR0M 1N75A 2R4EA 5FTKA 2F5PA 4AKHA 1ZQ9A 3CF0A 2FS1A 3LVVA 3L25A 3GLGB 3J7BA 3OTOM 2LWXA 1FNNA 4HEOA 3K8ZA 2BJVA 2J5YA 4DR2M 4JI0M 3PNYA 1QVRA 2QZ4A 2JY6B 3D8LA 5FTLA 1QAOA 5ITQA 4DV6M 2D7HA 1N36M 1DGHB 1OFHA 1Q02A 2RGHA 2B3TA 1YLAA 3HHZA 4JYAM 2L6OA 2LHCA 3T38A 1HNXM 2KZSA 1SXJA 5DNYA 2XEPA 3AFHA 1WXQA 2MR9A 3KW6A 4QOSA 1XWIA 2KRKA 4M0DA 3ZH9B 3KP0E 3KS4A 3BXWA 3LW5F 3J80S 4AQYM 1N77A 1N34M 3PFIA 4NOOB 1XHBA 1QAQA 2WSFF 4RNAA 3QYBA 3VK8A 4NSRA 3AOEA 3CF2A 2XH9A 1IBMM 3T1HM 4QNRA 3I04M 1JQJC 4CIZA 4LJAA 3TWKA 1PJIA 3M6AA 2KDLA 3GPXA 1IBKM 4I4LA 2CWBA 2L09A 3FTCA 3GLFE 1ZMWA 2FOIC 3U6SA 2DWNA 1GKIA 4G4RA 1XNRM 1Z6TA 3KS8A 4FWDA 3F92A 3FUXA 2APLA 2R18A 2ZTDA 3VFDA 4LJ4A 2LVNC 2DHRA 1MU5A 4IBKA 3LCVB 2L4EA 1HJPA 3GRVA 1IN7A 3UGJA 2QCUA 4MGKE 2D7GA 2CEAA 3SMPA 1IY1A 4X62M 1LV7A 3GLIB 1R2ZA 1C1KA 4G6ZA 3SAUA 4BBAA 1KSFX 4XGIA 4R71A 4LRSA 3GRRA 3HJSA 3JAMS 3WHLA 1DGGA 2JNHA 2FNAA 3IG8A 4X65M 4KHPM 3U6PA 2DAKA 3B7NA 2I7PA 2G8LA 2QSFX 3GLHA 1L1TA 1OAIA 3SMSA 4GMQA 3TPZA 3FTEA 4IBBA 4WURA 2I7NA 2JXNA 1NV9A 5DYIA 3GLFB 2QHOB 3B7QA 3B7ZA 2CHQA 4OW0A 4P17A 4B08A 4Y28F 2VF8A 5EXTA 3ZQJA 4G3OA 1IXSA 1XB2B 1PJQA 2X4AA 3KOWE 4OVZB 4B3RM 1AUAA 4M9XA 4D80A 4Q7JA 1QZMA 2G3QA 4M0WA 5BR8M 4OU7A 2DAEA 3KSXA 4GKKM 2X8AA 4LZZA 2YNMD 4AG5A 2FE8A 2W82A 4CJ6A 4IJEA 3UMMA 2KRUA 1D0MA 4JI6M 2Y0TA 1WGNA 3VDUA 1OTRA 4JI3M 3C58A 3Q8XA 3GLGA 3W68A 2RKOA 3U61B 2CV1A 3QWLA 4FCVA 4DR7M 1G41A 2DWZB 1HT2E 2EO2A 1QZEA 5FTNA 1QDTA 1E94E 2BWEA 3GQ4A 2WSEF 1N78A 1NVMA 1D2NA 2JUJA 4JN6A 2Z3XA 1DGHA 4AI6A 3GPPA 4B7HA 4JI2M 3SARA 3EIEA 2JP7A 3MJ5A 4L78A 1G3IA 4GC9A 3SATA 3I01M 4X66M 3U6LA 2CHGA 3GQ5A 3AOGA 1XXHB 1SG9A 4GEWA 4LZJA 2RRUA 4PT5A 4JI7M 4D81A 4W5WA 1I94M 1MN3A 1NJFA 4WW0A 2DZLA 2KZUA 4GHLA 1DGBA 4NRWA 5EXXA 4GHAA 4DV4M 4D82A 1R2YA 5ITXA 1DV0A 2ZANA 2XSZA 3M7GA 5E6JA 1T43A 3GRUA 4IBDA 4XK8F 3L26A 2QBYB 3LQQA 4CISA 1NNUC 4KT0F 2DXIA 2QP9X 2VDBB 3RE8A 4YY3M 5ITRA 3J81S 5EXPA 3GRYA 2K0BX 3AL0C 2XGNA 2CUZA 4DR6M 3UK6A 1C7YA 1GJSA 2Y0QA 1J5EM 5IREB 3NBIA 2DAMA 1RU3A 2LXEA 1EFUB 1XMQM 2J7NA 4DV2M 2XZUA 1GJTA 3DOAA 2KEBA 2XFTA 3U6EA 1IN4A 2Z4SA 3RGPA 1PRBA 1PJJA 2BWBA 3GLIA 1YSYA 4JXJA 1GABA 1VG5A 1GL7A 4IBJA 3GPYA 1IN6A 3LCUA 4BB9A 2VF7A 2KHHA 3QYEA 3K1JA 4I5SA 4GH9A 4CHTB 1VQ1A 4LG2A 3TL4X 3SFZA 2EA0A 3FUVA 4L15A 4LF6M 1QDRA 2K47A 3HZJA 1VEGA 3L27A 1NNJA 1K3XA 1UFZA 1WHCA 3CTWB 5JI3E 2C99A 4F1IA 2XSZD 3FTFA 1TDHA 1V34A 3D8BA 4XBOA 1Q39A 4LY6A 1NSFA 2DVWB 3L29A 3GLFA 1OIPA 1WR1B 3UZUA 1CUKA 1ZAEA 3FRIA 4LJ9A 3T6PA 1N33M 4K0KM 3I4YA 2OOBA 3W67A 4DV5M 5C1BA 3W0FA 5A2QS 2WZJA 4DUZM 4OVZA 3SHFA 4MGHA 1PJTA 3A46A 2QNJA 1QUSA 2VIIA 3KOYE 3IG5A 1AIPC 1QUTA 4P16A 3U5ZB
chains in the Genus database with same CATH topology
3R9XB 4DV7M 4GIPA 4MGIE 3I51A 1S3SA 2J7OA 4QNMA 4PCZA 4Z8XA 1W5SA 1H6UA 2UU9M 2R45A 2YFQA 4FVMA 3U61A 3A45A 1XMOM 3EIHA 1SXJE 3HWSA 2ZAMA 4LGYA 2V1CA 2CFOA 2UXBM 2EUCA 5JI2E 4QHSA 1Q3CA 2ZBKB 3TWLA 2CV2A 4TUWA 3U6DA 2UUBM 3HJ8A 3VKHA 4L16A 3HHYA 1XXHA 1VDDA 3FTDA 2C5RA 4I8OA 4MGZE 4LF5M 2LH0A 1MX0A 1OFIA 2DWLA 4LJ8A 5EJCA 3AV0A 5BPVA 2C98A 1GVNA 3HJQA 1HQCA 3PVSA 4FD2A 3UJNA 4I81A 1Z59A 1KYIA 4AW4A 2AHMA 2QBYA 4CGYB 4IBGA 1QAMA 2XZFA 4NXMM 1I4WA 2Y21A 4KODA 4AG6A 3LMMA 1L2CA 1IN5A 4FCTA 1DO0A 3U6OA 4NRVA 5IWAM 2C9CA 3R8FA 3B9PA 1Z5AA 4JI5M 5H37D 2CV0A 2CE7A 5DYGA 2DZNB 3KP1E 4G4QA 3JR4A 4JI1M 3L28A 3VKGA 2VQEM 3FD9A 3SYKA 2F4VM 5FTMA 1HNWM 5IZ7D 2LNHC 3MK6A 1K3WA 4GC5A 2DZOB 2QPAA 1G59A 3KSJA 3SC3A 1DGFA 3PXGA 5FSWA 3U60B 1IN8A 2FFJA 4JI4M 4HL4A 3K92A 5IT9S 2D7EA 3J27B 4S12A 4PD2A 2F5QA 5GKNA 4GKJM 2V1UA 2HCBA 1Z5CA 1QANA 3THGA 5ITYA 1SXJC 3T1YM 1DO2A 1G4AE 4NXNM 1HNZM 2XF3A 3J2PB 4IBEA 4GITA 3H4MA 3KFUG 1TH3A 3HU2A 3AOEC 4RF0A 2O5RA 3AJIB 3QAUA 4LJ5A 8CATA 4QHTA 3U5ZA 3J7AS 3SYLA 3VK7A 4NL4H 1TH2A 5FLXS 4R3DA 2KA6B 2YR0A 3HU3A 2ZM6M 4L8RC 4LFBM 1ORYB 4ZPXA 4DV3M 4BLCA 2E5LM 2P5TA 3HU1A 1EE8A 3GP1A 1IXZA 2X49A 2L7IA 2BJWA 2M60A 3SAWA 4X64M 4ITQA 2Z4RA 4L4UA 4PDIA 5ITXE 3KOXE 4MGYE 3SBJA 2R62A 5KQ8A 4B3SM 4FW9A 4MM3B 5EQTA 1GLNA 1QYRA 1R7RA 4YHHM 1KFVA 5LMNM 4M9SA 1Q3BA 2XLJA 4IBFA 3ZC7B 4REZA 4AKGA 4DR4M 1XNQM 1JR3A 4JV5M 2BNKA 1K82A 1N32M 1X37A 2F5OA 3GO8A 2F5NA 1IY2A 1YE9A 4OX9M 3FUTA 3KDSE 5FTJA 1IM2A 5C18A 3PNVA 2RGOA 4LF7M 3LVWA 1OJLA 2M5ZA 2G5GX 1Z5BA 1NJGA 5KPTA 2A5YB 3L2AA 4KLNA 5KQDA 7CATA 3BOSA 2F5SA 4JI8M 3AKZA 4RF1A 1E9SA 3GQ3A 1NHWC 2OQ4A 1FJGM 2OPFA 3U6QA 2CHVA 1TH4A 3U60A 3SAVA 1IY0A 1JR3D 2YQZA 3T15A 5EP4A 4DV1M 1IXRC 2L7HA 2R4JA 3U6MA 1TGUA 4II7A 4R7GA 3SHGB 4FWGA 2KXEA 5KO3A 4GRIA 2HHHM 1J7KA 1SXJD 5KPRA 5EP2A 1QQWA 2H1RA 4IBCA 4G4OA 4AKIA 2Y20A 3M0EA 3HGIA 4B7FA 2R65A 1SXJB 2XFSA 2C96A 2ZAOA 3VDPA 4DV0M 5ITTA 3HHWA 3SASA 3KVWA 4LFAM 4EIWA 3K2LA 4IBIA 3WHKA 3A42A 4DUYM 1L8QA 4B3MM 2UUCM 3RFWA 3FKEA 3FYCA 3FUWA 4MB7A 3MHVC 1XC8A 2UXDM 5KPZA 2QENA 4B3TM 3GPUA 3FYDA 1W5TA 3KXEC 1L2DA 3TE6A 4Z6YA 4LCBA 3E9SA 3W0LB 2JA2A 5LMUM 4FCWA 2UUAM 4LFCM 3I4VA 4HLQA 4NSOB 1NHGC 2NQ8C 2R46A 4LJ7A 5E26A 2KW0A 1IBLM 3U6CA 3TWMA 3NWLA 1HQYE 1E9RA 1HT1E 3DZDA 5ITUA 2VQFM 4KO8A 3GLHB 4FWHA 4DR1M 5EP3A 4PDGA 5F3WA 2UXCM 4LRTA 3E4RA 4DR5M 3DFZA 1J09A 4LF9M 1G8PA 1E32A 4QOZC 3TQSA 4LJ6A 5EXSA 3HKPA 1NY5A 1TDZA 3FUUA 2HKJA 1NY6A 3KOZE 3RGSA 4M9ZA 3VLFB 4A3VB 4AZFA 3ILKA 4MH0E 2Z7JA 1IQPA 3HHXA 3ZCBB 1IXSB 2DWMA 4LGMA 2C9OA 4G4NA 1YUBA 2V6ZM 4B7GA 1UM8A 1T3TA 1L1ZA 3LQRA 2HL7A 2ERCA 3DA1A 2Q2EB 3A98B 4IJFA 4LF8M 4DR3M 1GL6A 1PM5A 3JR5A 4IIWA 4LF4M 3CF6E 1L2BA 1R6BX 5EP1A 1HR0M 1N75A 2R4EA 5FTKA 2F5PA 4AKHA 1ZQ9A 3CF0A 3LVVA 3L25A 3GLGB 3J7BA 3OTOM 2LWXA 1FNNA 3K8ZA 2BJVA 4DR2M 4JI0M 3PNYA 1QVRA 2QZ4A 3D8LA 5FTLA 1QAOA 5ITQA 4DV6M 2D7HA 1N36M 1DGHB 1OFHA 2RGHA 3HHZA 4JYAM 2L6OA 3T38A 1HNXM 2KZSA 1SXJA 5DNYA 2XEPA 3AFHA 1WXQA 4QOSA 3KW6A 1XWIA 2KRKA 4M0DA 3ZH9B 3KP0E 3KS4A 1N77A 4AQYM 3J80S 1N34M 3PFIA 4NOOB 1XHBA 1QAQA 4RNAA 3VK8A 4NSRA 3AOEA 3CF2A 2XH9A 1IBMM 3T1HM 4QNRA 1JQJC 4LJAA 3TWKA 1PJIA 3M6AA 3GPXA 1IBKM 4I4LA 2L09A 3FTCA 2FOIC 3U6SA 2DWNA 1GKIA 4G4RA 1XNRM 1Z6TA 3KS8A 4FWDA 3FUXA 2R18A 3VFDA 4LJ4A 2DHRA 1MU5A 4IBKA 3GRVA 1IN7A 3UGJA 2QCUA 4MGKE 2D7GA 2CEAA 3SMPA 1IY1A 4X62M 1LV7A 3GLIB 1R2ZA 1C1KA 4G6ZA 3SAUA 4BBAA 1KSFX 4XGIA 4LRSA 3GRRA 3HJSA 3JAMS 3WHLA 1DGGA 2FNAA 3IG8A 4X65M 4KHPM 3U6PA 3GLHA 2I7PA 2G8LA 1L1TA 3SMSA 4GMQA 3TPZA 3FTEA 4IBBA 4WURA 2I7NA 5DYIA 3GLFB 2CHQA 4OW0A 4B08A 5EXTA 4OVZB 2X4AA 3KOWE 4B3RM 4M9XA 4D80A 5BR8M 1QZMA 4M0WA 4OU7A 4GKKM 3KSXA 2X8AA 4LZZA 2YNMD 4AG5A 2FE8A 2W82A 4IJEA 3UMMA 2KRUA 4JI6M 2Y0TA 3VDUA 4JI3M 3C58A 3Q8XA 3GLGA 2RKOA 3U61B 2CV1A 3QWLA 4FCVA 4DR7M 1G41A 2DWZB 1HT2E 2EO2A 5FTNA 1E94E 1N78A 3GQ4A 1NVMA 1D2NA 4JN6A 2Z3XA 1DGHA 4AI6A 3GPPA 4B7HA 4JI2M 3SARA 3EIEA 3MJ5A 4L78A 1G3IA 4GC9A 3SATA 4X66M 3U6LA 2CHGA 3GQ5A 3AOGA 1XXHB 4LZJA 4PT5A 4JI7M 4D81A 4W5WA 1I94M 1NJFA 4WW0A 2KZUA 4GHLA 1DGBA 4NRWA 5EXXA 4GHAA 4DV4M 4D82A 1R2YA 5ITXA 2ZANA 2XSZA 3M7GA 5E6JA 3GRUA 4IBDA 3L26A 2QBYB 3LQQA 4CISA 1NNUC 2DXIA 2QP9X 3RE8A 4YY3M 5ITRA 3J81S 5EXPA 3GRYA 3AL0C 2XGNA 2CUZA 4DR6M 3UK6A 2Y0QA 1J5EM 5IREB 3NBIA 2LXEA 1XMQM 2J7NA 4DV2M 2XZUA 3DOAA 2KEBA 2XFTA 3U6EA 1IN4A 2Z4SA 3RGPA 1PJJA 3GLIA 1YSYA 4JXJA 3GPYA 1GL7A 4IBJA 1IN6A 4BB9A 4I5SA 3K1JA 4CHTB 4GH9A 4LG2A 3TL4X 3SFZA 2EA0A 3FUVA 4L15A 4LF6M 2K47A 1NNJA 3L27A 1K3XA 5JI3E 3CTWB 2C99A 3FTFA 2XSZD 1TDHA 3D8BA 4XBOA 1Q39A 4LY6A 1NSFA 2DVWB 3L29A 3GLFA 3UZUA 4LJ9A 1ZAEA 1N33M 4K0KM 3I4YA 4DV5M 5C1BA 3W0FA 5A2QS 4DUZM 4OVZA 3SHFA 4MGHA 3A46A 3KOYE 2VIIA 3IG5A 4P16A 3U5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAW A;  4X64 M;  4ITQ A;  4DV7 M;  4PDI A;  5ITU A;  5ITX E;  2VQF M;  4PCZ A;  3SBJ A;  4DR1 M;  2UXC M;  4PDG A;  2UU9 M;  4B3R M;  4B3S M;  3A45 A;  4DR5 M;  4LF9 M;  5BR8 M;  1KFV A;  4GKK M;  4YHH M;  1XMO M;  5LMN M;  1Q3B A;  1TDZ A;  2HKJ A;  4DR4 M;  1XNQ M;  4JV5 M;  2UXB M;  1K82 A;  1N32 M;  1Q3C A;  2ZBK B;  3TWL A;  3U6D A;  2F5O A;  2UUB M;  4JI6 M;  4JI3 M;  3GO8 A;  3C58 A;  2F5N A;  4G4N A;  4DR7 M;  4OX9 M;  1L1Z A;  4LF5 M;  1MX0 A;  2Q2E B;  3GQ4 A;  4LF7 M;  4LF8 M;  4DR3 M;  1PM5 A;  3GPP A;  3JR5 A;  1Z5B A;  4JI2 M;  4LF4 M;  3SAR A;  1L2B A;  1Z59 A;  1HR0 M;  3SAT A;  2F5P A;  4X66 M;  3U6L A;  3GQ5 A;  2XZF A;  4NXM M;  3OTO M;  4JI7 M;  1L2C A;  1I94 M;  2F5S A;  3U6O A;  4DR2 M;  4NRV A;  4JI0 M;  4JI8 M;  5IWA M;  4NRW A;  3GQ3 A;  4DV4 M;  1R2Y A;  5ITX A;  5ITQ A;  1N36 M;  4DV6 M;  1Z5A A;  2OQ4 A;  1FJG M;  2OPF A;  3U6Q A;  4JI5 M;  3SAV A;  4JYA M;  4CIS A;  4G4Q A;  3JR4 A;  4JI1 M;  1HNX M;  4DV1 M;  4YY3 M;  5ITR A;  3J81 S;  2VQE M;  2F4V M;  3U6M A;  4AQY M;  3J80 S;  1HNW M;  1K3W A;  1N34 M;  4DR6 M;  2HHH M;  3VK8 A;  1J5E M;  1IBM M;  3T1H M;  1XMQ M;  4G4O A;  4DV2 M;  2XZU A;  4JI4 M;  3TWK A;  1PJI A;  3DOA A;  3GPX A;  1IBK M;  3U6E A;  4DV0 M;  5IT9 S;  4PD2 A;  5ITT A;  2F5Q A;  3SAS A;  1PJJ A;  4GKJ M;  4LFA M;  1Z5C A;  3GPY A;  5ITY A;  3A42 A;  3U6S A;  4DUY M;  4G4R A;  3T1Y M;  4B3M M;  1XNR M;  4NXN M;  1HNZ M;  2UUC M;  2EA0 A;  4LF6 M;  1NNJ A;  4MB7 A;  1K3X A;  1XC8 A;  2UXD M;  1MU5 A;  1TDH A;  4B3T M;  3GPU A;  1L2D A;  1Q39 A;  4X62 M;  1R2Z A;  3SAU A;  3J7A S;  5LMU M;  3JAM S;  3VK7 A;  1N33 M;  2UUA M;  4K0K M;  5FLX S;  4X65 M;  4DV5 M;  4LFC M;  4KHP M;  2ZM6 M;  3W0F A;  4DUZ M;  5A2Q S;  3U6P A;  4LFB M;  4DV3 M;  1L1T A;  2E5L M;  3A46 A;  1EE8 A;  3GP1 A;  1IBL M;  3U6C A;  3TWM A; 
#chains in the Genus database with same CATH topology
 1JR3 E;  3R9X B;  1WJ7 A;  4GIP A;  4MGI E;  3I51 A;  1S3S A;  2J7O A;  4QNM A;  4DV7 M;  4PCZ A;  4Z8X A;  1W5S A;  3NBX X;  5L8R F;  1H6U A;  2LTU A;  2UU9 M;  2R45 A;  2YFQ A;  4FVM A;  3U61 A;  3A45 A;  1XMO M;  2EKK A;  1SXJ E;  3EIH A;  3HWS A;  5DFL A;  2LHG A;  2ZAM A;  2LVA A;  4LGY A;  2R44 A;  2V1C A;  2CFO A;  2MRO B;  2UXB M;  1TR8 A;  2EUC A;  5JI2 E;  4QHS A;  1Q3C A;  2ZBK B;  3TWL A;  2CV2 A;  4TUW A;  3U6D A;  2UUB M;  3HJ8 A;  3VKH A;  2OOA A;  4L16 A;  3HHY A;  1V92 A;  1XXH A;  1VDD A;  2K6B A;  3FTD A;  2C5R A;  4I8O A;  4MGZ E;  4LF5 M;  2LH0 A;  1MX0 A;  1OFI A;  2DWL A;  4LJ8 A;  5EJC A;  2JY5 A;  3AV0 A;  5BPV A;  2C98 A;  1GVN A;  3HJQ A;  1HQC A;  3PVS A;  4FD2 A;  2KNV A;  4I81 A;  3FE3 A;  3UJN A;  1Z59 A;  1KYI A;  2JZ0 A;  4AW4 A;  2AHM A;  3E21 A;  3HY5 A;  2QBY A;  4CGY B;  4IBG A;  1QAM A;  2WSC F;  2XZF A;  4NXM M;  1IFY A;  1I4W A;  2Y21 A;  4KOD A;  2L4F A;  3LMM A;  4AG6 A;  1L2C A;  1IN5 A;  4FCT A;  1DO0 A;  3U6O A;  1P3Q Q;  4NRV A;  5IWA M;  1PJS A;  2C9C A;  3R8F A;  2EKF A;  1Z5A A;  3B9P A;  4JI5 M;  5H37 D;  2CV0 A;  2CE7 A;  5DYG A;  2DZN B;  3KP1 E;  4WP2 A;  2HAK A;  4G4Q A;  3JR4 A;  4JI1 M;  3L28 A;  3VKG A;  3GLH E;  2VQE M;  3FD9 A;  2O25 A;  3SYK A;  2F4V M;  1TF0 B;  2L2D A;  5FTM A;  1HNW M;  5IZ7 D;  1ZMV A;  2LNH C;  3MK6 A;  4GC5 A;  1K3W A;  2DZO B;  2QPA A;  2N35 A;  1G59 A;  3KSJ A;  3SC3 A;  1DGF A;  3PXG A;  5FSW A;  3U60 B;  1IN8 A;  2FFJ A;  4JI4 M;  2DKL A;  2DHY A;  4HL4 A;  3K92 A;  2OO9 A;  2D7E A;  3J27 B;  4S12 A;  4PD2 A;  2F5Q A;  5IT9 S;  5GKN A;  4GKJ M;  2V1U A;  2HCB A;  1Z5C A;  1QAN A;  3THG A;  5ITY A;  1SXJ C;  2EJS A;  3T1Y M;  1DO2 A;  1G4A E;  3K9O A;  4NXN M;  1HNZ M;  2XF3 A;  3CGW A;  3J2P B;  4IBE A;  4GIT A;  3H4M A;  3KFU G;  1TH3 A;  1GO5 A;  1A5T A;  3HU2 A;  3AOE C;  2CRU A;  4RF0 A;  3GLG E;  2O5R A;  2HWJ A;  3AJI B;  3QAU A;  4LJ5 A;  8CAT A;  4QHT A;  3U5Z A;  3J7A S;  3SYL A;  3VK7 A;  4NL4 H;  1TH2 A;  4RKU F;  1MJG M;  5FLX S;  1F4I A;  4DBG B;  2DNA A;  4R3D A;  2KA6 B;  2YR0 A;  3HU3 A;  2ZM6 M;  4L8R C;  4LFB M;  2GQF A;  1ORY B;  4ZPX A;  4DV3 M;  4BLC A;  2E5L M;  2P5T A;  3HU1 A;  1EE8 A;  3GP1 A;  1IXZ A;  1R4G A;  3MMP A;  2X49 A;  4L6V 6;  2L7I A;  2BJW A;  2M60 A;  3SAW A;  4X64 M;  4ITQ A;  2Z4R A;  4L4U A;  2LVP C;  2Z8Y M;  4PDI A;  5ITX E;  3KOX E;  4MGY E;  3SBJ A;  2R62 A;  4UN2 B;  5KQ8 A;  4B3S M;  2ZTC A;  4FW9 A;  4MM3 B;  1GLN A;  1NV8 A;  1QYR A;  1R7R A;  5EQT A;  4YHH M;  4M9S A;  5LMN M;  1KFV A;  1Q3B A;  2XLJ A;  4IBF A;  3ZC7 B;  4REZ A;  4AKG A;  4DR4 M;  1XNQ M;  1JR3 A;  4JV5 M;  2BNK A;  1K82 A;  2DEN A;  1TTE A;  1X37 A;  1N32 M;  3FRH A;  2F5O A;  3GO8 A;  2F5N A;  1IY2 A;  1YE9 A;  2R6F A;  4OX9 M;  3FUT A;  3KDS E;  3Q8G A;  1IM2 A;  3C9P A;  5FTJ A;  5C18 A;  2MJ5 B;  3PNV A;  2RGO A;  4F2L A;  4LF7 M;  3LVW A;  1OJL A;  2M5Z A;  2KNZ A;  3GLI E;  3BBZ A;  2G5G X;  1Z5B A;  1PGY A;  1NJG A;  1ZV1 A;  5KPT A;  1JB0 F;  2A5Y B;  3L2A A;  4KLN A;  5KQD A;  2KNA A;  3H4J A;  7CAT A;  3BOS A;  3V76 A;  2F5S A;  4JI8 M;  3E46 A;  3B89 A;  3AKZ A;  1LTM A;  4RF1 A;  1E9S A;  2DAI A;  3GQ3 A;  2CP8 A;  2DI0 A;  1NHW C;  1D0L A;  1WIV A;  2OQ4 A;  1FJG M;  2OPF A;  3U6Q A;  2CHV A;  1TH4 A;  3U60 A;  3SAV A;  1IY0 A;  2GNO A;  1JR3 D;  2YQZ A;  3T15 A;  3K9P A;  5EP4 A;  4DV1 M;  2DAG A;  2K9D A;  2MGW A;  1IXR C;  1NO1 A;  2L7H A;  2R4J A;  3U6M A;  1TGU A;  1BVS A;  4II7 A;  4R7G A;  3SHG B;  4FWG A;  2KXE A;  5KO3 A;  4GRI A;  2HHH M;  1J7K A;  1SXJ D;  1V33 A;  5KPR A;  3IEC A;  5EP2 A;  1D0K A;  1QQW A;  1G71 A;  2H1R A;  4IBC A;  4G4O A;  4AKI A;  2Y20 A;  3M0E A;  3HGI A;  4B7F A;  2R65 A;  1SXJ B;  2JY7 A;  2C96 A;  2XFS A;  2ZAO A;  3VDP A;  4DV0 M;  5ITT A;  3B74 A;  3HHW A;  3SAS A;  3KVW A;  4LFA M;  4EIW A;  3K2L A;  4IBI A;  3WHK A;  1VEJ A;  3A42 A;  4DUY M;  1L8Q A;  4B3M M;  2JWS A;  2JY8 A;  2UUC M;  3RFW A;  3FKE A;  3FYC A;  3FUW A;  4MB7 A;  3MHV C;  1XC8 A;  2UXD M;  3HX3 A;  5KPZ A;  2QEN A;  4B3T M;  3GPU A;  3FYD A;  1W5T A;  1OQY A;  3KXE C;  1L2D A;  1XXH E;  3TE6 A;  1VDL A;  4Z6Y A;  2LVO C;  4LCB A;  2MH8 A;  3E9S A;  1OIZ A;  2H5X A;  3W0L B;  2JA2 A;  5LMU M;  4FCW A;  4ANR A;  2UUA M;  4LFC M;  3I4V A;  4HLQ A;  4NSO B;  1NHG C;  2NQ8 C;  2R0I A;  2R46 A;  4LJ7 A;  5E26 A;  2KW0 A;  1IBL M;  3U6C A;  2LBC A;  3TWM A;  2QQ8 A;  2FH0 A;  3NWL A;  1HQY E;  1E9R A;  1HT1 E;  3DZD A;  5ITU A;  2VQF M;  1WGL A;  4KO8 A;  1ZMU A;  3GLH B;  1OAO C;  4FWH A;  5EP3 A;  4PDG A;  4DR1 M;  5F3W A;  4LRT A;  3E4R A;  2UXC M;  4DR5 M;  3DFZ A;  1J09 A;  2LVQ D;  1G8P A;  1E32 A;  4LF9 M;  4QOZ C;  3TQS A;  1EIJ A;  4LJ6 A;  5EXS A;  3HKP A;  1NY5 A;  1TDZ A;  3FUU A;  2HKJ A;  2O01 F;  1NY6 A;  3KOZ E;  1Y8G A;  4M9Z A;  3RGS A;  3VLF B;  4A3V B;  4AZF A;  3ILK A;  4NC6 A;  4MH0 E;  2Z7J A;  1IQP A;  1VEK A;  3HHX A;  3ZCB B;  1IXS B;  2DWM A;  4LGM A;  1T6O A;  2C9O A;  4G4N A;  1YUB A;  2V6Z M;  4B7G A;  1UM8 A;  1T3T A;  1L1Z A;  3LQR A;  1R5L A;  2HL7 A;  2ERC A;  3DA1 A;  2Q2E B;  3A98 B;  3C3E A;  4IJF A;  2JZ1 A;  3IHP A;  4LF8 M;  1OKS A;  4DR3 M;  1GL6 A;  1PM5 A;  3JR5 A;  4IIW A;  3C3D A;  4LF4 M;  3CF6 E;  1L2B A;  1R6B X;  5EP1 A;  1HR0 M;  1N75 A;  2R4E A;  5FTK A;  2F5P A;  4AKH A;  1ZQ9 A;  3CF0 A;  2FS1 A;  3LVV A;  3L25 A;  3GLG B;  3J7B A;  3OTO M;  2LWX A;  1FNN A;  4HEO A;  3K8Z A;  2BJV A;  2J5Y A;  4DR2 M;  4JI0 M;  3PNY A;  1QVR A;  2QZ4 A;  2JY6 B;  3D8L A;  5FTL A;  1QAO A;  5ITQ A;  4DV6 M;  2D7H A;  1N36 M;  1DGH B;  1OFH A;  1Q02 A;  2RGH A;  2B3T A;  1YLA A;  3HHZ A;  4JYA M;  2L6O A;  2LHC A;  3T38 A;  1HNX M;  2KZS A;  1SXJ A;  5DNY A;  2XEP A;  3AFH A;  1WXQ A;  2MR9 A;  3KW6 A;  4QOS A;  1XWI A;  2KRK A;  4M0D A;  3ZH9 B;  3KP0 E;  3KS4 A;  3BXW A;  3LW5 F;  3J80 S;  4AQY M;  1N77 A;  1N34 M;  3PFI A;  4NOO B;  1XHB A;  1QAQ A;  2WSF F;  4RNA A;  3QYB A;  3VK8 A;  4NSR A;  3AOE A;  3CF2 A;  2XH9 A;  1IBM M;  3T1H M;  4QNR A;  3I04 M;  1JQJ C;  4CIZ A;  4LJA A;  3TWK A;  1PJI A;  3M6A A;  2KDL A;  3GPX A;  1IBK M;  4I4L A;  2CWB A;  2L09 A;  3FTC A;  3GLF E;  1ZMW A;  2FOI C;  3U6S A;  2DWN A;  1GKI A;  4G4R A;  1XNR M;  1Z6T A;  3KS8 A;  4FWD A;  3F92 A;  3FUX A;  2APL A;  2R18 A;  2ZTD A;  3VFD A;  4LJ4 A;  2LVN C;  2DHR A;  1MU5 A;  4IBK A;  3LCV B;  2L4E A;  1HJP A;  3GRV A;  1IN7 A;  3UGJ A;  2QCU A;  4MGK E;  2D7G A;  2CEA A;  3SMP A;  1IY1 A;  4X62 M;  1LV7 A;  3GLI B;  1R2Z A;  1C1K A;  4G6Z A;  3SAU A;  4BBA A;  1KSF X;  4XGI A;  4R71 A;  4LRS A;  3GRR A;  3HJS A;  3JAM S;  3WHL A;  1DGG A;  2JNH A;  2FNA A;  3IG8 A;  4X65 M;  4KHP M;  3U6P A;  2DAK A;  3B7N A;  2I7P A;  2G8L A;  2QSF X;  3GLH A;  1L1T A;  1OAI A;  3SMS A;  4GMQ A;  3TPZ A;  3FTE A;  4IBB A;  4WUR A;  2I7N A;  2JXN A;  1NV9 A;  5DYI A;  3GLF B;  2QHO B;  3B7Q A;  3B7Z A;  2CHQ A;  4OW0 A;  4P17 A;  4B08 A;  4Y28 F;  2VF8 A;  5EXT A;  3ZQJ A;  4G3O A;  1IXS A;  1XB2 B;  1PJQ A;  2X4A A;  3KOW E;  4OVZ B;  4B3R M;  1AUA A;  4M9X A;  4D80 A;  4Q7J A;  1QZM A;  2G3Q A;  4M0W A;  5BR8 M;  4OU7 A;  2DAE A;  3KSX A;  4GKK M;  2X8A A;  4LZZ A;  2YNM D;  4AG5 A;  2FE8 A;  2W82 A;  4CJ6 A;  4IJE A;  3UMM A;  2KRU A;  1D0M A;  4JI6 M;  2Y0T A;  1WGN A;  3VDU A;  1OTR A;  4JI3 M;  3C58 A;  3Q8X A;  3GLG A;  3W68 A;  2RKO A;  3U61 B;  2CV1 A;  3QWL A;  4FCV A;  4DR7 M;  1G41 A;  2DWZ B;  1HT2 E;  2EO2 A;  1QZE A;  5FTN A;  1QDT A;  1E94 E;  2BWE A;  3GQ4 A;  2WSE F;  1N78 A;  1NVM A;  1D2N A;  2JUJ A;  4JN6 A;  2Z3X A;  1DGH A;  4AI6 A;  3GPP A;  4B7H A;  4JI2 M;  3SAR A;  3EIE A;  2JP7 A;  3MJ5 A;  4L78 A;  1G3I A;  4GC9 A;  3SAT A;  3I01 M;  4X66 M;  3U6L A;  2CHG A;  3GQ5 A;  3AOG A;  1XXH B;  1SG9 A;  4GEW A;  4LZJ A;  2RRU A;  4PT5 A;  4JI7 M;  4D81 A;  4W5W A;  1I94 M;  1MN3 A;  1NJF A;  4WW0 A;  2DZL A;  2KZU A;  4GHL A;  1DGB A;  4NRW A;  5EXX A;  4GHA A;  4DV4 M;  4D82 A;  1R2Y A;  5ITX A;  1DV0 A;  2ZAN A;  2XSZ A;  3M7G A;  5E6J A;  1T43 A;  3GRU A;  4IBD A;  4XK8 F;  3L26 A;  2QBY B;  3LQQ A;  4CIS A;  1NNU C;  4KT0 F;  2DXI A;  2QP9 X;  2VDB B;  3RE8 A;  4YY3 M;  5ITR A;  3J81 S;  5EXP A;  3GRY A;  2K0B X;  3AL0 C;  2XGN A;  2CUZ A;  4DR6 M;  3UK6 A;  1C7Y A;  1GJS A;  2Y0Q A;  1J5E M;  5IRE B;  3NBI A;  2DAM A;  1RU3 A;  2LXE A;  1EFU B;  1XMQ M;  2J7N A;  4DV2 M;  2XZU A;  1GJT A;  3DOA A;  2KEB A;  2XFT A;  3U6E A;  1IN4 A;  2Z4S A;  3RGP A;  1PRB A;  1PJJ A;  2BWB A;  3GLI A;  1YSY A;  4JXJ A;  1GAB A;  1VG5 A;  1GL7 A;  4IBJ A;  3GPY A;  1IN6 A;  3LCU A;  4BB9 A;  2VF7 A;  2KHH A;  3QYE A;  3K1J A;  4I5S A;  4GH9 A;  4CHT B;  1VQ1 A;  4LG2 A;  3TL4 X;  3SFZ A;  2EA0 A;  3FUV A;  4L15 A;  4LF6 M;  1QDR A;  2K47 A;  3HZJ A;  1VEG A;  3L27 A;  1NNJ A;  1K3X A;  1UFZ A;  1WHC A;  3CTW B;  5JI3 E;  2C99 A;  4F1I A;  2XSZ D;  3FTF A;  1TDH A;  1V34 A;  3D8B A;  4XBO A;  1Q39 A;  4LY6 A;  1NSF A;  2DVW B;  3L29 A;  3GLF A;  1OIP A;  1WR1 B;  3UZU A;  1CUK A;  1ZAE A;  3FRI A;  4LJ9 A;  3T6P A;  1N33 M;  4K0K M;  3I4Y A;  2OOB A;  3W67 A;  4DV5 M;  5C1B A;  3W0F A;  5A2Q S;  2WZJ A;  4DUZ M;  4OVZ A;  3SHF A;  4MGH A;  1PJT A;  3A46 A;  2QNJ A;  1QUS A;  2VII A;  3KOY E;  3IG5 A;  1AIP C;  1QUT A;  4P16 A;  3U5Z B; 
#chains in the Genus database with same CATH homology
 3R9X B;  4DV7 M;  4GIP A;  4MGI E;  3I51 A;  1S3S A;  2J7O A;  4QNM A;  4PCZ A;  4Z8X A;  1W5S A;  1H6U A;  2UU9 M;  2R45 A;  2YFQ A;  4FVM A;  3U61 A;  3A45 A;  1XMO M;  3EIH A;  1SXJ E;  3HWS A;  2ZAM A;  4LGY A;  2V1C A;  2CFO A;  2UXB M;  2EUC A;  5JI2 E;  4QHS A;  1Q3C A;  2ZBK B;  3TWL A;  2CV2 A;  4TUW A;  3U6D A;  2UUB M;  3HJ8 A;  3VKH A;  4L16 A;  3HHY A;  1XXH A;  1VDD A;  3FTD A;  2C5R A;  4I8O A;  4MGZ E;  4LF5 M;  2LH0 A;  1MX0 A;  1OFI A;  2DWL A;  4LJ8 A;  5EJC A;  3AV0 A;  5BPV A;  2C98 A;  1GVN A;  3HJQ A;  1HQC A;  3PVS A;  4FD2 A;  3UJN A;  4I81 A;  1Z59 A;  1KYI A;  4AW4 A;  2AHM A;  2QBY A;  4CGY B;  4IBG A;  1QAM A;  2XZF A;  4NXM M;  1I4W A;  2Y21 A;  4KOD A;  4AG6 A;  3LMM A;  1L2C A;  1IN5 A;  4FCT A;  1DO0 A;  3U6O A;  4NRV A;  5IWA M;  2C9C A;  3R8F A;  3B9P A;  1Z5A A;  4JI5 M;  5H37 D;  2CV0 A;  2CE7 A;  5DYG A;  2DZN B;  3KP1 E;  4G4Q A;  3JR4 A;  4JI1 M;  3L28 A;  3VKG A;  2VQE M;  3FD9 A;  3SYK A;  2F4V M;  5FTM A;  1HNW M;  5IZ7 D;  2LNH C;  3MK6 A;  1K3W A;  4GC5 A;  2DZO B;  2QPA A;  1G59 A;  3KSJ A;  3SC3 A;  1DGF A;  3PXG A;  5FSW A;  3U60 B;  1IN8 A;  2FFJ A;  4JI4 M;  4HL4 A;  3K92 A;  5IT9 S;  2D7E A;  3J27 B;  4S12 A;  4PD2 A;  2F5Q A;  5GKN A;  4GKJ M;  2V1U A;  2HCB A;  1Z5C A;  1QAN A;  3THG A;  5ITY A;  1SXJ C;  3T1Y M;  1DO2 A;  1G4A E;  4NXN M;  1HNZ M;  2XF3 A;  3J2P B;  4IBE A;  4GIT A;  3H4M A;  3KFU G;  1TH3 A;  3HU2 A;  3AOE C;  4RF0 A;  2O5R A;  3AJI B;  3QAU A;  4LJ5 A;  8CAT A;  4QHT A;  3U5Z A;  3J7A S;  3SYL A;  3VK7 A;  4NL4 H;  1TH2 A;  5FLX S;  4R3D A;  2KA6 B;  2YR0 A;  3HU3 A;  2ZM6 M;  4L8R C;  4LFB M;  1ORY B;  4ZPX A;  4DV3 M;  4BLC A;  2E5L M;  2P5T A;  3HU1 A;  1EE8 A;  3GP1 A;  1IXZ A;  2X49 A;  2L7I A;  2BJW A;  2M60 A;  3SAW A;  4X64 M;  4ITQ A;  2Z4R A;  4L4U A;  4PDI A;  5ITX E;  3KOX E;  4MGY E;  3SBJ A;  2R62 A;  5KQ8 A;  4B3S M;  4FW9 A;  4MM3 B;  5EQT A;  1GLN A;  1QYR A;  1R7R A;  4YHH M;  1KFV A;  5LMN M;  4M9S A;  1Q3B A;  2XLJ A;  4IBF A;  3ZC7 B;  4REZ A;  4AKG A;  4DR4 M;  1XNQ M;  1JR3 A;  4JV5 M;  2BNK A;  1K82 A;  1N32 M;  1X37 A;  2F5O A;  3GO8 A;  2F5N A;  1IY2 A;  1YE9 A;  4OX9 M;  3FUT A;  3KDS E;  5FTJ A;  1IM2 A;  5C18 A;  3PNV A;  2RGO A;  4LF7 M;  3LVW A;  1OJL A;  2M5Z A;  2G5G X;  1Z5B A;  1NJG A;  5KPT A;  2A5Y B;  3L2A A;  4KLN A;  5KQD A;  7CAT A;  3BOS A;  2F5S A;  4JI8 M;  3AKZ A;  4RF1 A;  1E9S A;  3GQ3 A;  1NHW C;  2OQ4 A;  1FJG M;  2OPF A;  3U6Q A;  2CHV A;  1TH4 A;  3U60 A;  3SAV A;  1IY0 A;  1JR3 D;  2YQZ A;  3T15 A;  5EP4 A;  4DV1 M;  1IXR C;  2L7H A;  2R4J A;  3U6M A;  1TGU A;  4II7 A;  4R7G A;  3SHG B;  4FWG A;  2KXE A;  5KO3 A;  4GRI A;  2HHH M;  1J7K A;  1SXJ D;  5KPR A;  5EP2 A;  1QQW A;  2H1R A;  4IBC A;  4G4O A;  4AKI A;  2Y20 A;  3M0E A;  3HGI A;  4B7F A;  2R65 A;  1SXJ B;  2XFS A;  2C96 A;  2ZAO A;  3VDP A;  4DV0 M;  5ITT A;  3HHW A;  3SAS A;  3KVW A;  4LFA M;  4EIW A;  3K2L A;  4IBI A;  3WHK A;  3A42 A;  4DUY M;  1L8Q A;  4B3M M;  2UUC M;  3RFW A;  3FKE A;  3FYC A;  3FUW A;  4MB7 A;  3MHV C;  1XC8 A;  2UXD M;  5KPZ A;  2QEN A;  4B3T M;  3GPU A;  3FYD A;  1W5T A;  3KXE C;  1L2D A;  3TE6 A;  4Z6Y A;  4LCB A;  3E9S A;  3W0L B;  2JA2 A;  5LMU M;  4FCW A;  2UUA M;  4LFC M;  3I4V A;  4HLQ A;  4NSO B;  1NHG C;  2NQ8 C;  2R46 A;  4LJ7 A;  5E26 A;  2KW0 A;  1IBL M;  3U6C A;  3TWM A;  3NWL A;  1HQY E;  1E9R A;  1HT1 E;  3DZD A;  5ITU A;  2VQF M;  4KO8 A;  3GLH B;  4FWH A;  4DR1 M;  5EP3 A;  4PDG A;  5F3W A;  2UXC M;  4LRT A;  3E4R A;  4DR5 M;  3DFZ A;  1J09 A;  4LF9 M;  1G8P A;  1E32 A;  4QOZ C;  3TQS A;  4LJ6 A;  5EXS A;  3HKP A;  1NY5 A;  1TDZ A;  3FUU A;  2HKJ A;  1NY6 A;  3KOZ E;  3RGS A;  4M9Z A;  3VLF B;  4A3V B;  4AZF A;  3ILK A;  4MH0 E;  2Z7J A;  1IQP A;  3HHX A;  3ZCB B;  1IXS B;  2DWM A;  4LGM A;  2C9O A;  4G4N A;  1YUB A;  2V6Z M;  4B7G A;  1UM8 A;  1T3T A;  1L1Z A;  3LQR A;  2HL7 A;  2ERC A;  3DA1 A;  2Q2E B;  3A98 B;  4IJF A;  4LF8 M;  4DR3 M;  1GL6 A;  1PM5 A;  3JR5 A;  4IIW A;  4LF4 M;  3CF6 E;  1L2B A;  1R6B X;  5EP1 A;  1HR0 M;  1N75 A;  2R4E A;  5FTK A;  2F5P A;  4AKH A;  1ZQ9 A;  3CF0 A;  3LVV A;  3L25 A;  3GLG B;  3J7B A;  3OTO M;  2LWX A;  1FNN A;  3K8Z A;  2BJV A;  4DR2 M;  4JI0 M;  3PNY A;  1QVR A;  2QZ4 A;  3D8L A;  5FTL A;  1QAO A;  5ITQ A;  4DV6 M;  2D7H A;  1N36 M;  1DGH B;  1OFH A;  2RGH A;  3HHZ A;  4JYA M;  2L6O A;  3T38 A;  1HNX M;  2KZS A;  1SXJ A;  5DNY A;  2XEP A;  3AFH A;  1WXQ A;  4QOS A;  3KW6 A;  1XWI A;  2KRK A;  4M0D A;  3ZH9 B;  3KP0 E;  3KS4 A;  1N77 A;  4AQY M;  3J80 S;  1N34 M;  3PFI A;  4NOO B;  1XHB A;  1QAQ A;  4RNA A;  3VK8 A;  4NSR A;  3AOE A;  3CF2 A;  2XH9 A;  1IBM M;  3T1H M;  4QNR A;  1JQJ C;  4LJA A;  3TWK A;  1PJI A;  3M6A A;  3GPX A;  1IBK M;  4I4L A;  2L09 A;  3FTC A;  2FOI C;  3U6S A;  2DWN A;  1GKI A;  4G4R A;  1XNR M;  1Z6T A;  3KS8 A;  4FWD A;  3FUX A;  2R18 A;  3VFD A;  4LJ4 A;  2DHR A;  1MU5 A;  4IBK A;  3GRV A;  1IN7 A;  3UGJ A;  2QCU A;  4MGK E;  2D7G A;  2CEA A;  3SMP A;  1IY1 A;  4X62 M;  1LV7 A;  3GLI B;  1R2Z A;  1C1K A;  4G6Z A;  3SAU A;  4BBA A;  1KSF X;  4XGI A;  4LRS A;  3GRR A;  3HJS A;  3JAM S;  3WHL A;  1DGG A;  2FNA A;  3IG8 A;  4X65 M;  4KHP M;  3U6P A;  3GLH A;  2I7P A;  2G8L A;  1L1T A;  3SMS A;  4GMQ A;  3TPZ A;  3FTE A;  4IBB A;  4WUR A;  2I7N A;  5DYI A;  3GLF B;  2CHQ A;  4OW0 A;  4B08 A;  5EXT A;  4OVZ B;  2X4A A;  3KOW E;  4B3R M;  4M9X A;  4D80 A;  5BR8 M;  1QZM A;  4M0W A;  4OU7 A;  4GKK M;  3KSX A;  2X8A A;  4LZZ A;  2YNM D;  4AG5 A;  2FE8 A;  2W82 A;  4IJE A;  3UMM A;  2KRU A;  4JI6 M;  2Y0T A;  3VDU A;  4JI3 M;  3C58 A;  3Q8X A;  3GLG A;  2RKO A;  3U61 B;  2CV1 A;  3QWL A;  4FCV A;  4DR7 M;  1G41 A;  2DWZ B;  1HT2 E;  2EO2 A;  5FTN A;  1E94 E;  1N78 A;  3GQ4 A;  1NVM A;  1D2N A;  4JN6 A;  2Z3X A;  1DGH A;  4AI6 A;  3GPP A;  4B7H A;  4JI2 M;  3SAR A;  3EIE A;  3MJ5 A;  4L78 A;  1G3I A;  4GC9 A;  3SAT A;  4X66 M;  3U6L A;  2CHG A;  3GQ5 A;  3AOG A;  1XXH B;  4LZJ A;  4PT5 A;  4JI7 M;  4D81 A;  4W5W A;  1I94 M;  1NJF A;  4WW0 A;  2KZU A;  4GHL A;  1DGB A;  4NRW A;  5EXX A;  4GHA A;  4DV4 M;  4D82 A;  1R2Y A;  5ITX A;  2ZAN A;  2XSZ A;  3M7G A;  5E6J A;  3GRU A;  4IBD A;  3L26 A;  2QBY B;  3LQQ A;  4CIS A;  1NNU C;  2DXI A;  2QP9 X;  3RE8 A;  4YY3 M;  5ITR A;  3J81 S;  5EXP A;  3GRY A;  3AL0 C;  2XGN A;  2CUZ A;  4DR6 M;  3UK6 A;  2Y0Q A;  1J5E M;  5IRE B;  3NBI A;  2LXE A;  1XMQ M;  2J7N A;  4DV2 M;  2XZU A;  3DOA A;  2KEB A;  2XFT A;  3U6E A;  1IN4 A;  2Z4S A;  3RGP A;  1PJJ A;  3GLI A;  1YSY A;  4JXJ A;  3GPY A;  1GL7 A;  4IBJ A;  1IN6 A;  4BB9 A;  4I5S A;  3K1J A;  4CHT B;  4GH9 A;  4LG2 A;  3TL4 X;  3SFZ A;  2EA0 A;  3FUV A;  4L15 A;  4LF6 M;  2K47 A;  1NNJ A;  3L27 A;  1K3X A;  5JI3 E;  3CTW B;  2C99 A;  3FTF A;  2XSZ D;  1TDH A;  3D8B A;  4XBO A;  1Q39 A;  4LY6 A;  1NSF A;  2DVW B;  3L29 A;  3GLF A;  3UZU A;  4LJ9 A;  1ZAE A;  1N33 M;  4K0K M;  3I4Y A;  4DV5 M;  5C1B A;  3W0F A;  5A2Q S;  4DUZ M;  4OVZ A;  3SHF A;  4MGH A;  3A46 A;  3KOY E;  2VII A;  3IG5 A;  4P16 A;  3U5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...