1N33M

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n33M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n33M02
4DV4M 2F5OA 2F4VM 3U6CA 1L2BA 4G4RA 4DV6M 1MX0A 1Z5AA 4YHHM 4DR6M 1TDHA 1L2DA 2Q2EB 4JV5M 1L1ZA 2XZFA 3GQ5A 4GKJM 5IWAM 4PDGA 4B3TM 4JYAM 4JI2M 4B3RM 1N34M 1I94M 5IT9S 3SAUA 3SASA 4K0KM 4NXMM 2EA0A 3A42A 3JR5A 2HHHM 4LF9M 4NRVA 4DV5M 4DV1M 3GPUA 2ZBKB 3GPXA 4DR2M 1HNXM 2VQEM 1Z5BA 1IBLM 4PDIA 3A46A 3C58A 4KHPM 1Q3BA 3U6SA 1N36M 1XNQM 3JAMS 4MB7A 3VK7A 4G4QA 1Z59A 4JI3M 4LF8M 5ITRA 1IBMM 1HR0M 2OQ4A 5BR8M 4NRWA 4JI7M 1FJGM 2UUCM 1NNJA 4DR3M 4DV7M 4X62M 4PD2A 4G4OA 4LF5M 2E5LM 3TWLA 3SBJA 2F5PA 4DR4M 4DUYM 1PJJA 4LF6M 2UXDM 1HNWM 2XZUA 1IBKM 4JI0M 3U6LA 3J7AS 3OTOM 2VQFM 4LFBM 3U6QA 1XC8A 2UUAM 2F5NA 2UUBM 1XNRM 4LFCM 4JI1M 4AQYM 5ITXA 3JR4A 5ITTA 2UU9M 1R2YA 3DOAA 5LMNM 2F5SA 3GPPA 3GP1A 5ITYA 4PCZA 4LFAM 4X64M 3SARA 5FLXS 3J80S 4X66M 2ZM6M 1J5EM 1N33M 2UXBM 4DR1M 1K3WA 1L2CA 4DV0M 4DR7M 4ITQA 4JI8M 1TDZA 3A45A 1PM5A 1K3XA 4LF7M 5ITQA 1Q39A 5LMUM 3J81S 1HNZM 4NXNM 1EE8A 1Q3CA 1KFVA 1MU5A 4DV3M 3U6EA 1K82A 3SAWA 4LF4M 3GQ3A 4DUZM 3GPYA 3SAVA 3T1HM 3GQ4A 1PJIA 1XMQM 4JI6M 4OX9M 3GO8A 1L1TA 5ITXE 1N32M 2OPFA 3U6OA 3W0FA 4B3MM 2HKJA 4DV2M 2F5QA 4CISA 4X65M 4DR5M 5A2QS 3U6DA 4YY3M 4JI5M 4JI4M 1Z5CA 3TWKA 1XMOM 4G4NA 3U6PA 2UXCM 5ITUA 1R2ZA 3U6MA 3T1YM 3TWMA 4B3SM 3SATA 4GKKM 3VK8A
chains in the Genus database with same CATH superfamily
2P5TA 2F5OA 2KEBA 3GRYA 2YFQA 4G4RA 1GVNA 1OAOC 4DR6M 3VFDA 3B89A 2DHYA 2LVQD 3B7QA 3BXWA 2L7HA 1GJTA 2QZ4A 2RGHA 2XEPA 2DWNA 5BPVA 5IT9S 1TGUA 5FTNA 3FRIA 1IN5A 3MHVC 2L4EA 3I51A 1TH4A 5JI3E 4LF9M 3LCUA 4NRVA 2V1UA 3GPUA 2ZBKB 3KDSE 1S3SA 1HNXM 2MGWA 5FTJA 1Z5BA 1IBLM 4PDIA 2DZOB 2JY7A 3CF6E 3C58A 1QAOA 2K0BX 3JAMS 3A98B 3UZUA 4G4QA 2LH0A 1SXJD 3KFUG 4GIPA 2CHGA 2LXEA 1G59A 1W5TA 4MM3B 4AG6A 1C1KA 5KQDA 1IBMM 1R4GA 1T43A 3NBIA 2XGNA 1EFUB 2QPAA 3J2PB 2CV2A 4NSRA 4UN2B 1E9RA 1FJGM 3T6PA 1QVRA 3GLIA 2DWLA 3W67A 2DHRA 4DR3M 4X62M 1GABA 4IBEA 2OOAA 4IBGA 1QUTA 3GLHE 2C98A 2OO9A 1QAQA 3U5ZB 2KNZA 2DZLA 5FTLA 2QSFX 4OVZB 3K2LA 5EP4A 2B3TA 2XZUA 1IBKM 4II7A 2JA2A 3U6LA 2LHGA 3AOEA 1XC8A 1SXJB 1GKIA 4IJFA 1XNRM 3SYKA 4CHTB 4LFCM 2R18A 1VEJA 5ITXA 2RKOA 4LRSA 3SMSA 1TF0B 3I01M 2UU9M 3DOAA 1D0MA 1JR3E 1QQWA 1WIVA 1ZQ9A 2VF7A 3C3EA 4RKUF 2BWEA 3GLIE 4X64M 4NOOB 2Z4RA 4MGHA 2ZM6M 3I4VA 2BJWA 3E4RA 2Y20A 4P16A 1L2CA 4L4UA 3M0EA 1ZV1A 4ITQA 2CEAA 4Y28F 3ILKA 1TDZA 3A45A 3B74A 5C1BA 3KOZE 2MROB 1YE9A 3PXGA 3J81S 3K8ZA 1EE8A 2MH8A 3HJ8A 3UJNA 1MU5A 1VEGA 1KFVA 1JB0F 3U6EA 2EO2A 1OFHA 1NY5A 3LVVA 1HQYE 1PGYA 2FNAA 4BLCA 1IXSB 3EIEA 4JI6M 4OX9M 1L1TA 5ITXE 4LG2A 3GLGA 3W0FA 4XGIA 4B3MM 4DV2M 2QCUA 2A5YB 2CFOA 2YQZA 5GKNA 5KQ8A 4X65M 3SYLA 1QZEA 2DI0A 4P17A 4AZFA 2G3QA 3B7NA 2O01F 2I7NA 4GITA 1KYIA 4JI4M 2KRKA 3KOXE 1AIPC 4M0WA 4CIZA 3TWKA 3Q8GA 5EXPA 3U6PA 2Y0QA 3TE6A 1L8QA 3HX3A 5ITUA 2J7OA 2QBYB 3AOEC 1XXHB 1R2ZA 2QNJA 3LVWA 5IZ7D 5EP2A 4B3SM 1AUAA 3SATA 2CV1A 3L28A 2W82A 4HLQA 4D81A 3ZC7B 3MJ5A 3IG8A 3U6CA 1WXQA 2LWXA 4IBIA 4DV6M 3NWLA 1GL7A 2XSZA 4WP2A 5EP1A 4YHHM 3T15A 1L2DA 4JV5M 5IREB 1L1ZA 1OFIA 4PDGA 4B3TM 3LQRA 1XB2B 1Z6TA 3LMMA 4GC9A 2FOIC 5EJCA 1I94M 4JYAM 1LTMA 4HEOA 5KPZA 1NJGA 2DAEA 5DNYA 4K0KM 3CTWB 3SMPA 4DBGB 3QAUA 3AKZA 4AKIA 2RRUA 4LCBA 4DR2M 4L8RC 2VQEM 2KZSA 3KSJA 2BWBA 2FE8A 2JZ0A 1Q3BA 3K9PA 3TL4X 3U6SA 4W5WA 3L29A 1Z59A 2APLA 4JI3M 2R4EA 1XHBA 4LF8M 4REZA 3VKHA 1T6OA 1G41A 4GMQA 4TUWA 2JY5A 5EXSA 3FTEA 4JI7M 2HAKA 3HGIA 4ZPXA 2WZJA 2Z8YM 4DV7M 1IXZA 4IJEA 1DGHA 1BVSA 2KZUA 1X37A 1NHGC 3IHPA 2M5ZA 1E94E 1IY2A 3TWLA 3SBJA 3GLHA 2RGOA 1VEKA 3FYCA 2R6FA 2YNMD 3RGSA 3KXEC 4I5SA 4DUYM 1G8PA 2ZTCA 3NBXX 3SHFA 2UXDM 1GL6A 4LZZA 2K9DA 2R62A 4F1IA 5C18A 4Z8XA 1IM2A 1QDTA 5EP3A 2VQFM 4LJ9A 3U6QA 2JXNA 3D8LA 2CHVA 5F3WA 1F4IA 2F5NA 2UUBM 1EIJA 1HT1E 2LVNC 4JI1M 4MH0E 4L15A 1G3IA 3U5ZA 5ITTA 4MGZE 3E9SA 2XLJA 2XH9A 1LV7A 4S12A 5ITYA 1JR3A 4PCZA 4FWHA 2C5RA 3C9PA 2DZNB 3J80S 1SXJA 2VF8A 4QHSA 2L6OA 2CRUA 4X66M 3GRVA 2UXBM 1K3WA 3AL0C 4DV0M 4DR7M 3Q8XA 3KP1E 1ZMUA 3HHYA 5ITQA 5LMUM 2LHCA 4NXNM 1TH3A 2ZAOA 1OAIA 3LCVB 3M6AA 1E9SA 2H5XA 2C99A 4XK8F 3SAVA 1OQYA 3GQ4A 4LJ6A 3UMMA 4D80A 3E46A 3U60A 1XMQM 2CHQA 4OU7A 1SG9A 3GO8A 3R8FA 4CJ6A 3W0LB 2OPFA 3BOSA 1DO0A 5EQTA 3FUUA 2HKJA 5DYGA 2F5QA 2O25A 3U61A 1TR8A 3RGPA 4DR5M 1IN8A 1ORYB 1SXJE 3D8BA 5A2QS 4IBKA 1IXSA 2BJVA 3MK6A 1OTRA 4JI5M 3QYEA 2DAIA 1G4AE 3I04M 2Z3XA 4G4NA 1XMOM 2G8LA 2KRUA 4GEWA 5FTMA 1ZMVA 2LVPC 4FD2A 3T1YM 3TWMA 4JXJA 2QHOB 3CF2A 3KS4A 3KW6A 4GKKM 4LJ7A 1IFYA 1WGLA 2K47A 3HHXA 1QANA 4KLNA 2F4VM 3K92A 3HHZA 1MX0A 4R7GA 3H4JA 1IN7A 1TDHA 1MN3A 1YUBA 4IBJA 1N75A 1UFZA 2KNVA 2CUZA 2XZFA 3L2AA 3L26A 3FTCA 3FRHA 5IWAM 1YLAA 3UK6A 4JI2M 3AV0A 1N34M 4B3RM 5E6JA 4Q7JA 3SASA 3FTFA 2HWJA 3ZQJA 2C9OA 2I7PA 4NXMM 1VG5A 2R65A 3A42A 1VQ1A 4DV1M 1YSYA 2WSEF 3FE3A 2R45A 1PJQA 3J27B 4L6V6 3KVWA 3A46A 1NV8A 2KHHA 1N36M 1XNQM 3CGWA 3L27A 4KODA 2CE7A 4QNMA 1A5TA 4M9ZA 3HU3A 1PJTA 2C9CA 1DGFA 4EIWA 2J7NA 2EJSA 1HR0M 2N35A 4GH9A 4RNAA 2OQ4A 4NL4H 1GJSA 2O5RA 2X4AA 1XXHE 3KOYE 2OOBA 4F2LA 3ZH9B 5BR8M 2LBCA 1QAMA 3B7ZA 3PNYA 4QHTA 1CUKA 2KXEA 2QQ8A 4AKGA 1IY0A 4FCTA 2LNHC 4LF5M 2E5LM 1IN6A 4WW0A 1R5LA 2DAKA 3SFZA 1QYRA 2M60A 4D82A 3GLGB 3KS8A 2GQFA 2F5PA 2KW0A 4DR4M 1PJJA 2QP9X 2XSZD 1QZMA 3CF0A 1V92A 3HU1A 2Y21A 2ZAMA 2HCBA 1NY6A 4I4LA 5FSWA 3OTOM 1OJLA 1UM8A 4LFBM 2DVWB 4L16A 3TQSA 4FCVA 3GLFB 3GRRA 4AQYM 3FUTA 3KOWE 3WHKA 3JR4A 4JN6A 4AG5A 1MJGM 3FUWA 1HJPA 1R2YA 1GO5A 3EIHA 4GC5A 3H4MA 4B7HA 4LFAM 1NO1A 2V1CA 3SARA 2D7HA 1J5EM 1DO2A 1HT2E 3DZDA 3RFWA 4LY6A 3F92A 2EKKA 1KSFX 1VDLA 4JI8M 5L8RF 1K3XA 4LF7M 1TH2A 1Q39A 3HKPA 4RF0A 3IECA 1HNZM 4FCWA 2R46A 2Z7JA 1NV9A 2HL7A 4LJAA 3THGA 4DV3M 3SC3A 1K82A 3AFHA 2LVOC 2DWZB 5EXXA 3GPYA 1NVMA 5DYIA 1V34A 3FUXA 1VDDA 4AI6A 2KA6B 2D7GA 5KO3A 3AJIB 3U6OA 3B9PA 3HZJA 5KPRA 1C7YA 2GNOA 2JNHA 4OVZA 2X8AA 4R71A 3T38A 1TTEA 4GHLA 2L2DA 4CISA 3I4YA 2DXIA 4QOSA 3C3DA 1H6UA 1OIPA 3QWLA 4M9SA 3R9XB 2XFSA 1Z5CA 4I8OA 1IXRC 3M7GA 1DV0A 3LW5F 2UXCM 3PVSA 2CV0A 1W5SA 4ANRA 8CATA 2G5GX 1WGNA 1JR3D 2FS1A 1QDRA 1DGHB 1QUSA 3V76A 2JWSA 4GRIA 2YR0A 3VK8A 1P3QQ 2NQ8C 4CGYB 4Z6YA 4L78A 4M0DA 4DV4M 3VDPA 1RU3A 3FKEA 3GLHB 1L2BA 4NSOB 1NSFA 2CWBA 2JP7A 3PFIA 4LJ8A 1Z5AA 1Y8GA 4IBDA 4XBOA 3K9OA 2Q2EB 1IN4A 4OW0A 4WURA 4G3OA 3GQ5A 3GRUA 2DAGA 4GKJM 4HL4A 4I81A 3HJQA 4KT0F 4IBFA 3VLFB 3SAUA 1WJ7A 5DFLA 2QENA 2H1RA 3HY5A 4MGIE 5JI2E 3FTDA 1PRBA 3LQQA 2J5YA 2CP8A 4AW4A 2K6BA 3JR5A 2EA0A 4NC6A 4DV5M 2HHHM 1OKSA 4G6ZA 3GPXA 3BBZA 4RF1A 3GLIB 4KHPM 2R4JA 2R44A 2ERCA 3KP0E 4KO8A 2JY6B 4GHAA 4MB7A 3VK7A 2ZANA 1OIZA 1R6BX 2EKFA 3IG5A 2C96A 5FTKA 5ITRA 2L7IA 1T3TA 1NNUC 3L25A 2Z4SA 3TPZA 2QBYA 4NRWA 1D0KA 1XXHA 2UUCM 1NNJA 2VDBB 3J7BA 1SXJC 1NJFA 1WHCA 4PD2A 4G4OA 2FFJA 2V6ZM 3U60B 4MGYE 1WR1B 1J7KA 3QYBA 5E26A 3MMPA 2BNKA 4R3DA 4LRTA 4LF6M 2X49A 3U61B 1HNWM 4MGKE 3FD9A 4LJ5A 2WSCF 4LJ4A 2JY8A 4JI0M 4IBBA 4LGMA 3UGJA 1N78A 3J7AS 3VKGA 4FWGA 3E21A 1PJSA 1E32A 1J09A 2UUAM 3RE8A 1G71A 4A3VB 2WSFF 1IQPA 3HHWA 1ZMWA 3W68A 4BB9A 2R0IA 2MR9A 2AHMA 2DKLA 3FYDA 3ZCBB 2EUCA 3HU2A 4LGYA 3VDUA 2KNAA 2D7EA 3GPPA 5LMNM 3GP1A 2F5SA 4FWDA 1NHWC 5FLXS 3AOGA 1N33M 4DR1M 4BBAA 1JQJC 2MJ5B 1DGBA 2Y0TA 7CATA 2FH0A 3GLFA 4M9XA 1I4WA 4B7GA 1PM5A 2LVAA 2VIIA 5H37D 1Q3CA 4AKHA 4PT5A 3HJSA 4LF4M 3KSXA 3SAWA 1V33A 2DENA 3GQ3A 2DAMA 1HQCA 3DA1A 4FW9A 4DUZM 3T1HM 1PJIA 1R7RA 3GLGE 1ZAEA 3DFZA 3SHGB 1N32M 2L4FA 2XF3A 2KDLA 4FVMA 4IIWA 4LZJA 1D0LA 1XWIA 3WHLA 3HWSA 3PNVA 1GLNA 2XFTA 4IBCA 1N77A 3U6DA 2JZ1A 4YY3M 4B7FA 3K1JA 3GLFE 4B08A 2DWMA 1FNNA 2DNAA 2LTUA 2L09A 3FUVA 5EXTA 1IY1A 4QOZC 3U6MA 2ZTDA 1Q02A 5KPTA 1DGGA 2JUJA 1D2NA 4QNRA
chains in the Genus database with same CATH topology
2P5TA 2F5OA 2KEBA 3GRYA 2YFQA 4G4RA 1GVNA 4DR6M 3VFDA 2L7HA 2QZ4A 2XEPA 2RGHA 2DWNA 5BPVA 5IT9S 1TGUA 5FTNA 1IN5A 3MHVC 3I51A 1TH4A 5JI3E 4LF9M 4NRVA 2V1UA 3GPUA 2ZBKB 3KDSE 1S3SA 1HNXM 5FTJA 1Z5BA 1IBLM 4PDIA 2DZOB 3CF6E 3C58A 1QAOA 3JAMS 3A98B 3UZUA 4G4QA 2LH0A 1SXJD 3KFUG 4GIPA 2CHGA 2LXEA 1G59A 1W5TA 4MM3B 4AG6A 1C1KA 5KQDA 1IBMM 3NBIA 2XGNA 2QPAA 3J2PB 2CV2A 4NSRA 1E9RA 1FJGM 1QVRA 3GLIA 2DWLA 2DHRA 4DR3M 4X62M 4IBEA 4IBGA 2C98A 1QAQA 3U5ZB 5FTLA 4OVZB 3K2LA 5EP4A 2XZUA 1IBKM 4II7A 2JA2A 3U6LA 3AOEA 1XC8A 1SXJB 1GKIA 4IJFA 1XNRM 3SYKA 4CHTB 4LFCM 2R18A 5ITXA 2RKOA 4LRSA 3SMSA 2UU9M 3DOAA 1ZQ9A 1QQWA 4X64M 4NOOB 2Z4RA 4MGHA 2ZM6M 3I4VA 2BJWA 3E4RA 2Y20A 4P16A 1L2CA 4L4UA 3M0EA 4ITQA 2CEAA 3ILKA 1TDZA 3A45A 5C1BA 3KOZE 1YE9A 3PXGA 3J81S 3K8ZA 1EE8A 3HJ8A 3UJNA 1KFVA 1MU5A 3U6EA 2EO2A 1OFHA 1NY5A 3LVVA 1HQYE 2FNAA 4BLCA 1IXSB 3EIEA 4JI6M 4OX9M 1L1TA 5ITXE 4LG2A 3GLGA 3W0FA 4XGIA 4B3MM 4DV2M 2QCUA 2A5YB 2CFOA 2YQZA 5GKNA 5KQ8A 4X65M 3SYLA 4AZFA 2I7NA 4GITA 1KYIA 4JI4M 2KRKA 3KOXE 4M0WA 3TWKA 5EXPA 3U6PA 2Y0QA 3TE6A 1L8QA 5ITUA 2QBYB 2J7OA 3AOEC 1XXHB 1R2ZA 3LVWA 5IZ7D 5EP2A 4B3SM 3SATA 2CV1A 3L28A 2W82A 4HLQA 4D81A 3ZC7B 3MJ5A 3IG8A 3U6CA 1WXQA 2LWXA 4IBIA 4DV6M 3NWLA 1GL7A 2XSZA 4YHHM 5EP1A 3T15A 1L2DA 4JV5M 5IREB 1L1ZA 1OFIA 4PDGA 4B3TM 3LQRA 3LMMA 1Z6TA 4GC9A 4JYAM 2FOIC 5EJCA 1I94M 5KPZA 1NJGA 5DNYA 4K0KM 3CTWB 3SMPA 3QAUA 3AKZA 4AKIA 4LCBA 4DR2M 4L8RC 2VQEM 2KZSA 3KSJA 2FE8A 1Q3BA 3TL4X 3U6SA 4W5WA 3L29A 1Z59A 4JI3M 2R4EA 1XHBA 4LF8M 4REZA 3VKHA 4TUWA 1G41A 4GMQA 5EXSA 3FTEA 4JI7M 3HGIA 4ZPXA 4DV7M 1IXZA 4IJEA 1DGHA 2KZUA 1X37A 1NHGC 2M5ZA 1E94E 1IY2A 3TWLA 3SBJA 3GLHA 2RGOA 3FYCA 2YNMD 3RGSA 3KXEC 4I5SA 4DUYM 1G8PA 3SHFA 2UXDM 4LZZA 2R62A 5C18A 4Z8XA 1IM2A 5EP3A 2VQFM 5F3WA 4LJ9A 3U6QA 3D8LA 2CHVA 2F5NA 2UUBM 1HT1E 4JI1M 4MH0E 4L15A 1G3IA 3U5ZA 5ITTA 4MGZE 3E9SA 2XLJA 2XH9A 1LV7A 4S12A 5ITYA 1JR3A 4PCZA 4FWHA 2C5RA 2DZNB 3J80S 1SXJA 4QHSA 4X66M 2L6OA 2UXBM 3GRVA 1K3WA 3AL0C 4DV0M 4DR7M 3Q8XA 3KP1E 3HHYA 5ITQA 5LMUM 4NXNM 1TH3A 2ZAOA 3M6AA 1E9SA 2C99A 3SAVA 3GQ4A 4LJ6A 3UMMA 4D80A 3U60A 1XMQM 2CHQA 4OU7A 3GO8A 3R8FA 3W0LB 2OPFA 3BOSA 1DO0A 5EQTA 3FUUA 2HKJA 5DYGA 2F5QA 3U61A 3RGPA 4DR5M 1IN8A 1ORYB 1SXJE 3D8BA 5A2QS 4IBKA 2BJVA 3MK6A 4JI5M 1G4AE 2Z3XA 4G4NA 1XMOM 2G8LA 2KRUA 5FTMA 4FD2A 3T1YM 3TWMA 4JXJA 3KS4A 3CF2A 3KW6A 4GKKM 4LJ7A 2K47A 3HHXA 1QANA 4KLNA 2F4VM 3K92A 3HHZA 1MX0A 4R7GA 1IN7A 1TDHA 1YUBA 4IBJA 1N75A 2CUZA 2XZFA 3L2AA 3L26A 3FTCA 5IWAM 3UK6A 4JI2M 3AV0A 1N34M 4B3RM 5E6JA 3SASA 3FTFA 2C9OA 2I7PA 4NXMM 2R65A 3A42A 4DV1M 1YSYA 2R45A 3J27B 3KVWA 3A46A 1N36M 1XNQM 3L27A 4KODA 2CE7A 4QNMA 4M9ZA 3HU3A 2C9CA 4EIWA 1DGFA 2J7NA 1HR0M 4RNAA 4GH9A 2OQ4A 4NL4H 2O5RA 2X4AA 3KOYE 5BR8M 3ZH9B 3PNYA 1QAMA 4QHTA 2KXEA 4AKGA 1IY0A 4FCTA 2LNHC 4LF5M 2E5LM 1IN6A 4WW0A 3SFZA 1QYRA 2M60A 4D82A 3GLGB 3KS8A 2F5PA 2KW0A 4DR4M 1PJJA 2QP9X 2XSZD 1QZMA 3CF0A 3HU1A 2Y21A 2ZAMA 2HCBA 1NY6A 4I4LA 5FSWA 3OTOM 1OJLA 1UM8A 4LFBM 2DVWB 4L16A 3TQSA 4FCVA 3GLFB 3GRRA 4AQYM 3FUTA 3KOWE 3WHKA 3JR4A 4JN6A 4AG5A 3FUWA 1R2YA 3EIHA 4GC5A 3H4MA 4B7HA 4LFAM 3SARA 2V1CA 2D7HA 1J5EM 1DO2A 1HT2E 3DZDA 3RFWA 4LY6A 1KSFX 4JI8M 1K3XA 4LF7M 1TH2A 1Q39A 3HKPA 4RF0A 1HNZM 4FCWA 2R46A 2Z7JA 2HL7A 4LJAA 3THGA 4DV3M 3SC3A 1K82A 3AFHA 2DWZB 5EXXA 3GPYA 1NVMA 5DYIA 3FUXA 1VDDA 4AI6A 2KA6B 2D7GA 5KO3A 3AJIB 3U6OA 3B9PA 5KPRA 4OVZA 2X8AA 3T38A 4GHLA 4CISA 3I4YA 2DXIA 4QOSA 1H6UA 3QWLA 3R9XB 4M9SA 2XFSA 1Z5CA 4I8OA 1IXRC 3M7GA 2UXCM 3PVSA 2CV0A 1W5SA 8CATA 2G5GX 1JR3D 1DGHB 4GRIA 2YR0A 3VK8A 2NQ8C 4CGYB 4Z6YA 4L78A 4M0DA 4DV4M 3VDPA 3FKEA 3GLHB 1L2BA 4NSOB 1NSFA 3PFIA 4LJ8A 1Z5AA 4IBDA 4XBOA 2Q2EB 1IN4A 4OW0A 4WURA 3GQ5A 3GRUA 4GKJM 4HL4A 4I81A 3HJQA 4IBFA 3VLFB 3SAUA 2QENA 2H1RA 4MGIE 5JI2E 3FTDA 3LQQA 2EA0A 4AW4A 3JR5A 2HHHM 4DV5M 4G6ZA 3GPXA 4RF1A 3GLIB 4KHPM 2R4JA 2ERCA 3KP0E 4KO8A 4GHAA 4MB7A 3VK7A 2ZANA 1R6BX 3IG5A 2C96A 5FTKA 5ITRA 2L7IA 1T3TA 1NNUC 3L25A 2Z4SA 3TPZA 2QBYA 4NRWA 1XXHA 2UUCM 1NNJA 3J7BA 1SXJC 1NJFA 4PD2A 4G4OA 2FFJA 2V6ZM 3U60B 4MGYE 1J7KA 5E26A 2BNKA 4R3DA 4LRTA 4LF6M 2X49A 3U61B 1HNWM 4MGKE 3FD9A 4LJ5A 4LJ4A 4JI0M 1N78A 4IBBA 4LGMA 3UGJA 3J7AS 3VKGA 4FWGA 1E32A 1J09A 2UUAM 3RE8A 4A3VB 3HHWA 1IQPA 4BB9A 2AHMA 3ZCBB 3FYDA 2EUCA 3HU2A 4LGYA 3VDUA 5LMNM 2D7EA 3GPPA 2F5SA 3GP1A 4FWDA 1NHWC 5FLXS 3AOGA 1N33M 4DR1M 4BBAA 1JQJC 1DGBA 2Y0TA 7CATA 3GLFA 4M9XA 1I4WA 4B7GA 1PM5A 2VIIA 5H37D 1Q3CA 4AKHA 4PT5A 3HJSA 4LF4M 3KSXA 3SAWA 3GQ3A 4FW9A 1HQCA 3DA1A 4DUZM 3T1HM 1PJIA 1R7RA 1ZAEA 3DFZA 3SHGB 1N32M 2XF3A 4IIWA 4FVMA 4LZJA 1XWIA 3WHLA 3HWSA 3PNVA 1GLNA 2XFTA 4IBCA 1N77A 3U6DA 4YY3M 4B7FA 3K1JA 4B08A 2DWMA 1FNNA 2L09A 3FUVA 5EXTA 1IY1A 4QOZC 3U6MA 5KPTA 1DGGA 1GL6A 1D2NA 4QNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 M;  2F5O A;  2F4V M;  3U6C A;  1L2B A;  4G4R A;  4DV6 M;  1MX0 A;  1Z5A A;  4YHH M;  4DR6 M;  1TDH A;  1L2D A;  2Q2E B;  4JV5 M;  1L1Z A;  2XZF A;  3GQ5 A;  4GKJ M;  5IWA M;  4PDG A;  4B3T M;  4JYA M;  4JI2 M;  4B3R M;  1N34 M;  1I94 M;  5IT9 S;  3SAU A;  3SAS A;  4K0K M;  4NXM M;  2EA0 A;  3A42 A;  3JR5 A;  2HHH M;  4LF9 M;  4NRV A;  4DV5 M;  4DV1 M;  3GPU A;  2ZBK B;  3GPX A;  4DR2 M;  1HNX M;  2VQE M;  1Z5B A;  1IBL M;  4PDI A;  3A46 A;  3C58 A;  4KHP M;  1Q3B A;  3U6S A;  1N36 M;  1XNQ M;  3JAM S;  4MB7 A;  3VK7 A;  4G4Q A;  1Z59 A;  4JI3 M;  4LF8 M;  5ITR A;  1IBM M;  1HR0 M;  2OQ4 A;  5BR8 M;  4NRW A;  4JI7 M;  1FJG M;  2UUC M;  1NNJ A;  4DR3 M;  4DV7 M;  4X62 M;  4PD2 A;  4G4O A;  4LF5 M;  2E5L M;  3TWL A;  3SBJ A;  2F5P A;  4DR4 M;  4DUY M;  1PJJ A;  4LF6 M;  2UXD M;  1HNW M;  2XZU A;  1IBK M;  4JI0 M;  3U6L A;  3J7A S;  3OTO M;  2VQF M;  4LFB M;  3U6Q A;  1XC8 A;  2UUA M;  2F5N A;  2UUB M;  1XNR M;  4LFC M;  4JI1 M;  4AQY M;  5ITX A;  3JR4 A;  5ITT A;  2UU9 M;  1R2Y A;  3DOA A;  5LMN M;  2F5S A;  3GPP A;  3GP1 A;  5ITY A;  4PCZ A;  4LFA M;  4X64 M;  3SAR A;  5FLX S;  3J80 S;  4X66 M;  2ZM6 M;  1J5E M;  1N33 M;  2UXB M;  4DR1 M;  1K3W A;  1L2C A;  4DV0 M;  4DR7 M;  4ITQ A;  4JI8 M;  1TDZ A;  3A45 A;  1PM5 A;  1K3X A;  4LF7 M;  5ITQ A;  1Q39 A;  5LMU M;  3J81 S;  1HNZ M;  4NXN M;  1EE8 A;  1Q3C A;  1KFV A;  1MU5 A;  4DV3 M;  3U6E A;  1K82 A;  3SAW A;  4LF4 M;  3GQ3 A;  4DUZ M;  3GPY A;  3SAV A;  3T1H M;  3GQ4 A;  1PJI A;  1XMQ M;  4JI6 M;  4OX9 M;  3GO8 A;  1L1T A;  5ITX E;  1N32 M;  2OPF A;  3U6O A;  3W0F A;  4B3M M;  2HKJ A;  4DV2 M;  2F5Q A;  4CIS A;  4X65 M;  4DR5 M;  5A2Q S;  3U6D A;  4YY3 M;  4JI5 M;  4JI4 M;  1Z5C A;  3TWK A;  1XMO M;  4G4N A;  3U6P A;  2UXC M;  5ITU A;  1R2Z A;  3U6M A;  3T1Y M;  3TWM A;  4B3S M;  3SAT A;  4GKK M;  3VK8 A; 
#chains in the Genus database with same CATH topology
 2P5T A;  2F5O A;  2KEB A;  3GRY A;  2YFQ A;  4G4R A;  1GVN A;  1OAO C;  4DR6 M;  3VFD A;  3B89 A;  2DHY A;  2LVQ D;  3B7Q A;  3BXW A;  2L7H A;  1GJT A;  2QZ4 A;  2RGH A;  2XEP A;  2DWN A;  5BPV A;  5IT9 S;  1TGU A;  5FTN A;  3FRI A;  1IN5 A;  3MHV C;  2L4E A;  3I51 A;  1TH4 A;  5JI3 E;  4LF9 M;  3LCU A;  4NRV A;  2V1U A;  3GPU A;  2ZBK B;  3KDS E;  1S3S A;  1HNX M;  2MGW A;  5FTJ A;  1Z5B A;  1IBL M;  4PDI A;  2DZO B;  2JY7 A;  3CF6 E;  3C58 A;  1QAO A;  2K0B X;  3JAM S;  3A98 B;  3UZU A;  4G4Q A;  2LH0 A;  1SXJ D;  3KFU G;  4GIP A;  2CHG A;  2LXE A;  1G59 A;  1W5T A;  4MM3 B;  4AG6 A;  1C1K A;  5KQD A;  1IBM M;  1R4G A;  1T43 A;  3NBI A;  2XGN A;  1EFU B;  2QPA A;  3J2P B;  2CV2 A;  4NSR A;  4UN2 B;  1E9R A;  1FJG M;  3T6P A;  1QVR A;  3GLI A;  2DWL A;  3W67 A;  2DHR A;  4DR3 M;  4X62 M;  1GAB A;  4IBE A;  2OOA A;  4IBG A;  1QUT A;  3GLH E;  2C98 A;  2OO9 A;  1QAQ A;  3U5Z B;  2KNZ A;  2DZL A;  5FTL A;  2QSF X;  4OVZ B;  3K2L A;  5EP4 A;  2B3T A;  2XZU A;  1IBK M;  4II7 A;  2JA2 A;  3U6L A;  2LHG A;  3AOE A;  1XC8 A;  1SXJ B;  1GKI A;  4IJF A;  1XNR M;  3SYK A;  4CHT B;  4LFC M;  2R18 A;  1VEJ A;  5ITX A;  2RKO A;  4LRS A;  3SMS A;  1TF0 B;  3I01 M;  2UU9 M;  3DOA A;  1D0M A;  1JR3 E;  1QQW A;  1WIV A;  1ZQ9 A;  2VF7 A;  3C3E A;  4RKU F;  2BWE A;  3GLI E;  4X64 M;  4NOO B;  2Z4R A;  4MGH A;  2ZM6 M;  3I4V A;  2BJW A;  3E4R A;  2Y20 A;  4P16 A;  1L2C A;  4L4U A;  3M0E A;  1ZV1 A;  4ITQ A;  2CEA A;  4Y28 F;  3ILK A;  1TDZ A;  3A45 A;  3B74 A;  5C1B A;  3KOZ E;  2MRO B;  1YE9 A;  3PXG A;  3J81 S;  3K8Z A;  1EE8 A;  2MH8 A;  3HJ8 A;  3UJN A;  1MU5 A;  1VEG A;  1KFV A;  1JB0 F;  3U6E A;  2EO2 A;  1OFH A;  1NY5 A;  3LVV A;  1HQY E;  1PGY A;  2FNA A;  4BLC A;  1IXS B;  3EIE A;  4JI6 M;  4OX9 M;  1L1T A;  5ITX E;  4LG2 A;  3GLG A;  3W0F A;  4XGI A;  4B3M M;  4DV2 M;  2QCU A;  2A5Y B;  2CFO A;  2YQZ A;  5GKN A;  5KQ8 A;  4X65 M;  3SYL A;  1QZE A;  2DI0 A;  4P17 A;  4AZF A;  2G3Q A;  3B7N A;  2O01 F;  2I7N A;  4GIT A;  1KYI A;  4JI4 M;  2KRK A;  3KOX E;  1AIP C;  4M0W A;  4CIZ A;  3TWK A;  3Q8G A;  5EXP A;  3U6P A;  2Y0Q A;  3TE6 A;  1L8Q A;  3HX3 A;  5ITU A;  2J7O A;  2QBY B;  3AOE C;  1XXH B;  1R2Z A;  2QNJ A;  3LVW A;  5IZ7 D;  5EP2 A;  4B3S M;  1AUA A;  3SAT A;  2CV1 A;  3L28 A;  2W82 A;  4HLQ A;  4D81 A;  3ZC7 B;  3MJ5 A;  3IG8 A;  3U6C A;  1WXQ A;  2LWX A;  4IBI A;  4DV6 M;  3NWL A;  1GL7 A;  2XSZ A;  4WP2 A;  5EP1 A;  4YHH M;  3T15 A;  1L2D A;  4JV5 M;  5IRE B;  1L1Z A;  1OFI A;  4PDG A;  4B3T M;  3LQR A;  1XB2 B;  1Z6T A;  3LMM A;  4GC9 A;  2FOI C;  5EJC A;  1I94 M;  4JYA M;  1LTM A;  4HEO A;  5KPZ A;  1NJG A;  2DAE A;  5DNY A;  4K0K M;  3CTW B;  3SMP A;  4DBG B;  3QAU A;  3AKZ A;  4AKI A;  2RRU A;  4LCB A;  4DR2 M;  4L8R C;  2VQE M;  2KZS A;  3KSJ A;  2BWB A;  2FE8 A;  2JZ0 A;  1Q3B A;  3K9P A;  3TL4 X;  3U6S A;  4W5W A;  3L29 A;  1Z59 A;  2APL A;  4JI3 M;  2R4E A;  1XHB A;  4LF8 M;  4REZ A;  3VKH A;  1T6O A;  1G41 A;  4GMQ A;  4TUW A;  2JY5 A;  5EXS A;  3FTE A;  4JI7 M;  2HAK A;  3HGI A;  4ZPX A;  2WZJ A;  2Z8Y M;  4DV7 M;  1IXZ A;  4IJE A;  1DGH A;  1BVS A;  2KZU A;  1X37 A;  1NHG C;  3IHP A;  2M5Z A;  1E94 E;  1IY2 A;  3TWL A;  3SBJ A;  3GLH A;  2RGO A;  1VEK A;  3FYC A;  2R6F A;  2YNM D;  3RGS A;  3KXE C;  4I5S A;  4DUY M;  1G8P A;  2ZTC A;  3NBX X;  3SHF A;  2UXD M;  1GL6 A;  4LZZ A;  2K9D A;  2R62 A;  4F1I A;  5C18 A;  4Z8X A;  1IM2 A;  1QDT A;  5EP3 A;  2VQF M;  4LJ9 A;  3U6Q A;  2JXN A;  3D8L A;  2CHV A;  5F3W A;  1F4I A;  2F5N A;  2UUB M;  1EIJ A;  1HT1 E;  2LVN C;  4JI1 M;  4MH0 E;  4L15 A;  1G3I A;  3U5Z A;  5ITT A;  4MGZ E;  3E9S A;  2XLJ A;  2XH9 A;  1LV7 A;  4S12 A;  5ITY A;  1JR3 A;  4PCZ A;  4FWH A;  2C5R A;  3C9P A;  2DZN B;  3J80 S;  1SXJ A;  2VF8 A;  4QHS A;  2L6O A;  2CRU A;  4X66 M;  3GRV A;  2UXB M;  1K3W A;  3AL0 C;  4DV0 M;  4DR7 M;  3Q8X A;  3KP1 E;  1ZMU A;  3HHY A;  5ITQ A;  5LMU M;  2LHC A;  4NXN M;  1TH3 A;  2ZAO A;  1OAI A;  3LCV B;  3M6A A;  1E9S A;  2H5X A;  2C99 A;  4XK8 F;  3SAV A;  1OQY A;  3GQ4 A;  4LJ6 A;  3UMM A;  4D80 A;  3E46 A;  3U60 A;  1XMQ M;  2CHQ A;  4OU7 A;  1SG9 A;  3GO8 A;  3R8F A;  4CJ6 A;  3W0L B;  2OPF A;  3BOS A;  1DO0 A;  5EQT A;  3FUU A;  2HKJ A;  5DYG A;  2F5Q A;  2O25 A;  3U61 A;  1TR8 A;  3RGP A;  4DR5 M;  1IN8 A;  1ORY B;  1SXJ E;  3D8B A;  5A2Q S;  4IBK A;  1IXS A;  2BJV A;  3MK6 A;  1OTR A;  4JI5 M;  3QYE A;  2DAI A;  1G4A E;  3I04 M;  2Z3X A;  4G4N A;  1XMO M;  2G8L A;  2KRU A;  4GEW A;  5FTM A;  1ZMV A;  2LVP C;  4FD2 A;  3T1Y M;  3TWM A;  4JXJ A;  2QHO B;  3CF2 A;  3KS4 A;  3KW6 A;  4GKK M;  4LJ7 A;  1IFY A;  1WGL A;  2K47 A;  3HHX A;  1QAN A;  4KLN A;  2F4V M;  3K92 A;  3HHZ A;  1MX0 A;  4R7G A;  3H4J A;  1IN7 A;  1TDH A;  1MN3 A;  1YUB A;  4IBJ A;  1N75 A;  1UFZ A;  2KNV A;  2CUZ A;  2XZF A;  3L2A A;  3L26 A;  3FTC A;  3FRH A;  5IWA M;  1YLA A;  3UK6 A;  4JI2 M;  3AV0 A;  1N34 M;  4B3R M;  5E6J A;  4Q7J A;  3SAS A;  3FTF A;  2HWJ A;  3ZQJ A;  2C9O A;  2I7P A;  4NXM M;  1VG5 A;  2R65 A;  3A42 A;  1VQ1 A;  4DV1 M;  1YSY A;  2WSE F;  3FE3 A;  2R45 A;  1PJQ A;  3J27 B;  4L6V 6;  3KVW A;  3A46 A;  1NV8 A;  2KHH A;  1N36 M;  1XNQ M;  3CGW A;  3L27 A;  4KOD A;  2CE7 A;  4QNM A;  1A5T A;  4M9Z A;  3HU3 A;  1PJT A;  2C9C A;  1DGF A;  4EIW A;  2J7N A;  2EJS A;  1HR0 M;  2N35 A;  4GH9 A;  4RNA A;  2OQ4 A;  4NL4 H;  1GJS A;  2O5R A;  2X4A A;  1XXH E;  3KOY E;  2OOB A;  4F2L A;  3ZH9 B;  5BR8 M;  2LBC A;  1QAM A;  3B7Z A;  3PNY A;  4QHT A;  1CUK A;  2KXE A;  2QQ8 A;  4AKG A;  1IY0 A;  4FCT A;  2LNH C;  4LF5 M;  2E5L M;  1IN6 A;  4WW0 A;  1R5L A;  2DAK A;  3SFZ A;  1QYR A;  2M60 A;  4D82 A;  3GLG B;  3KS8 A;  2GQF A;  2F5P A;  2KW0 A;  4DR4 M;  1PJJ A;  2QP9 X;  2XSZ D;  1QZM A;  3CF0 A;  1V92 A;  3HU1 A;  2Y21 A;  2ZAM A;  2HCB A;  1NY6 A;  4I4L A;  5FSW A;  3OTO M;  1OJL A;  1UM8 A;  4LFB M;  2DVW B;  4L16 A;  3TQS A;  4FCV A;  3GLF B;  3GRR A;  4AQY M;  3FUT A;  3KOW E;  3WHK A;  3JR4 A;  4JN6 A;  4AG5 A;  1MJG M;  3FUW A;  1HJP A;  1R2Y A;  1GO5 A;  3EIH A;  4GC5 A;  3H4M A;  4B7H A;  4LFA M;  1NO1 A;  2V1C A;  3SAR A;  2D7H A;  1J5E M;  1DO2 A;  1HT2 E;  3DZD A;  3RFW A;  4LY6 A;  3F92 A;  2EKK A;  1KSF X;  1VDL A;  4JI8 M;  5L8R F;  1K3X A;  4LF7 M;  1TH2 A;  1Q39 A;  3HKP A;  4RF0 A;  3IEC A;  1HNZ M;  4FCW A;  2R46 A;  2Z7J A;  1NV9 A;  2HL7 A;  4LJA A;  3THG A;  4DV3 M;  3SC3 A;  1K82 A;  3AFH A;  2LVO C;  2DWZ B;  5EXX A;  3GPY A;  1NVM A;  5DYI A;  1V34 A;  3FUX A;  1VDD A;  4AI6 A;  2KA6 B;  2D7G A;  5KO3 A;  3AJI B;  3U6O A;  3B9P A;  3HZJ A;  5KPR A;  1C7Y A;  2GNO A;  2JNH A;  4OVZ A;  2X8A A;  4R71 A;  3T38 A;  1TTE A;  4GHL A;  2L2D A;  4CIS A;  3I4Y A;  2DXI A;  4QOS A;  3C3D A;  1H6U A;  1OIP A;  3QWL A;  4M9S A;  3R9X B;  2XFS A;  1Z5C A;  4I8O A;  1IXR C;  3M7G A;  1DV0 A;  3LW5 F;  2UXC M;  3PVS A;  2CV0 A;  1W5S A;  4ANR A;  8CAT A;  2G5G X;  1WGN A;  1JR3 D;  2FS1 A;  1QDR A;  1DGH B;  1QUS A;  3V76 A;  2JWS A;  4GRI A;  2YR0 A;  3VK8 A;  1P3Q Q;  2NQ8 C;  4CGY B;  4Z6Y A;  4L78 A;  4M0D A;  4DV4 M;  3VDP A;  1RU3 A;  3FKE A;  3GLH B;  1L2B A;  4NSO B;  1NSF A;  2CWB A;  2JP7 A;  3PFI A;  4LJ8 A;  1Z5A A;  1Y8G A;  4IBD A;  4XBO A;  3K9O A;  2Q2E B;  1IN4 A;  4OW0 A;  4WUR A;  4G3O A;  3GQ5 A;  3GRU A;  2DAG A;  4GKJ M;  4HL4 A;  4I81 A;  3HJQ A;  4KT0 F;  4IBF A;  3VLF B;  3SAU A;  1WJ7 A;  5DFL A;  2QEN A;  2H1R A;  3HY5 A;  4MGI E;  5JI2 E;  3FTD A;  1PRB A;  3LQQ A;  2J5Y A;  2CP8 A;  4AW4 A;  2K6B A;  3JR5 A;  2EA0 A;  4NC6 A;  4DV5 M;  2HHH M;  1OKS A;  4G6Z A;  3GPX A;  3BBZ A;  4RF1 A;  3GLI B;  4KHP M;  2R4J A;  2R44 A;  2ERC A;  3KP0 E;  4KO8 A;  2JY6 B;  4GHA A;  4MB7 A;  3VK7 A;  2ZAN A;  1OIZ A;  1R6B X;  2EKF A;  3IG5 A;  2C96 A;  5FTK A;  5ITR A;  2L7I A;  1T3T A;  1NNU C;  3L25 A;  2Z4S A;  3TPZ A;  2QBY A;  4NRW A;  1D0K A;  1XXH A;  2UUC M;  1NNJ A;  2VDB B;  3J7B A;  1SXJ C;  1NJF A;  1WHC A;  4PD2 A;  4G4O A;  2FFJ A;  2V6Z M;  3U60 B;  4MGY E;  1WR1 B;  1J7K A;  3QYB A;  5E26 A;  3MMP A;  2BNK A;  4R3D A;  4LRT A;  4LF6 M;  2X49 A;  3U61 B;  1HNW M;  4MGK E;  3FD9 A;  4LJ5 A;  2WSC F;  4LJ4 A;  2JY8 A;  4JI0 M;  4IBB A;  4LGM A;  3UGJ A;  1N78 A;  3J7A S;  3VKG A;  4FWG A;  3E21 A;  1PJS A;  1E32 A;  1J09 A;  2UUA M;  3RE8 A;  1G71 A;  4A3V B;  2WSF F;  1IQP A;  3HHW A;  1ZMW A;  3W68 A;  4BB9 A;  2R0I A;  2MR9 A;  2AHM A;  2DKL A;  3FYD A;  3ZCB B;  2EUC A;  3HU2 A;  4LGY A;  3VDU A;  2KNA A;  2D7E A;  3GPP A;  5LMN M;  3GP1 A;  2F5S A;  4FWD A;  1NHW C;  5FLX S;  3AOG A;  1N33 M;  4DR1 M;  4BBA A;  1JQJ C;  2MJ5 B;  1DGB A;  2Y0T A;  7CAT A;  2FH0 A;  3GLF A;  4M9X A;  1I4W A;  4B7G A;  1PM5 A;  2LVA A;  2VII A;  5H37 D;  1Q3C A;  4AKH A;  4PT5 A;  3HJS A;  4LF4 M;  3KSX A;  3SAW A;  1V33 A;  2DEN A;  3GQ3 A;  2DAM A;  1HQC A;  3DA1 A;  4FW9 A;  4DUZ M;  3T1H M;  1PJI A;  1R7R A;  3GLG E;  1ZAE A;  3DFZ A;  3SHG B;  1N32 M;  2L4F A;  2XF3 A;  2KDL A;  4FVM A;  4IIW A;  4LZJ A;  1D0L A;  1XWI A;  3WHL A;  3HWS A;  3PNV A;  1GLN A;  2XFT A;  4IBC A;  1N77 A;  3U6D A;  2JZ1 A;  4YY3 M;  4B7F A;  3K1J A;  3GLF E;  4B08 A;  2DWM A;  1FNN A;  2DNA A;  2LTU A;  2L09 A;  3FUV A;  5EXT A;  1IY1 A;  4QOZ C;  3U6M A;  2ZTD A;  1Q02 A;  5KPT A;  1DGG A;  2JUJ A;  1D2N A;  4QNR A; 
#chains in the Genus database with same CATH homology
 2P5T A;  2F5O A;  2KEB A;  3GRY A;  2YFQ A;  4G4R A;  1GVN A;  4DR6 M;  3VFD A;  2L7H A;  2QZ4 A;  2XEP A;  2RGH A;  2DWN A;  5BPV A;  5IT9 S;  1TGU A;  5FTN A;  1IN5 A;  3MHV C;  3I51 A;  1TH4 A;  5JI3 E;  4LF9 M;  4NRV A;  2V1U A;  3GPU A;  2ZBK B;  3KDS E;  1S3S A;  1HNX M;  5FTJ A;  1Z5B A;  1IBL M;  4PDI A;  2DZO B;  3CF6 E;  3C58 A;  1QAO A;  3JAM S;  3A98 B;  3UZU A;  4G4Q A;  2LH0 A;  1SXJ D;  3KFU G;  4GIP A;  2CHG A;  2LXE A;  1G59 A;  1W5T A;  4MM3 B;  4AG6 A;  1C1K A;  5KQD A;  1IBM M;  3NBI A;  2XGN A;  2QPA A;  3J2P B;  2CV2 A;  4NSR A;  1E9R A;  1FJG M;  1QVR A;  3GLI A;  2DWL A;  2DHR A;  4DR3 M;  4X62 M;  4IBE A;  4IBG A;  2C98 A;  1QAQ A;  3U5Z B;  5FTL A;  4OVZ B;  3K2L A;  5EP4 A;  2XZU A;  1IBK M;  4II7 A;  2JA2 A;  3U6L A;  3AOE A;  1XC8 A;  1SXJ B;  1GKI A;  4IJF A;  1XNR M;  3SYK A;  4CHT B;  4LFC M;  2R18 A;  5ITX A;  2RKO A;  4LRS A;  3SMS A;  2UU9 M;  3DOA A;  1ZQ9 A;  1QQW A;  4X64 M;  4NOO B;  2Z4R A;  4MGH A;  2ZM6 M;  3I4V A;  2BJW A;  3E4R A;  2Y20 A;  4P16 A;  1L2C A;  4L4U A;  3M0E A;  4ITQ A;  2CEA A;  3ILK A;  1TDZ A;  3A45 A;  5C1B A;  3KOZ E;  1YE9 A;  3PXG A;  3J81 S;  3K8Z A;  1EE8 A;  3HJ8 A;  3UJN A;  1KFV A;  1MU5 A;  3U6E A;  2EO2 A;  1OFH A;  1NY5 A;  3LVV A;  1HQY E;  2FNA A;  4BLC A;  1IXS B;  3EIE A;  4JI6 M;  4OX9 M;  1L1T A;  5ITX E;  4LG2 A;  3GLG A;  3W0F A;  4XGI A;  4B3M M;  4DV2 M;  2QCU A;  2A5Y B;  2CFO A;  2YQZ A;  5GKN A;  5KQ8 A;  4X65 M;  3SYL A;  4AZF A;  2I7N A;  4GIT A;  1KYI A;  4JI4 M;  2KRK A;  3KOX E;  4M0W A;  3TWK A;  5EXP A;  3U6P A;  2Y0Q A;  3TE6 A;  1L8Q A;  5ITU A;  2QBY B;  2J7O A;  3AOE C;  1XXH B;  1R2Z A;  3LVW A;  5IZ7 D;  5EP2 A;  4B3S M;  3SAT A;  2CV1 A;  3L28 A;  2W82 A;  4HLQ A;  4D81 A;  3ZC7 B;  3MJ5 A;  3IG8 A;  3U6C A;  1WXQ A;  2LWX A;  4IBI A;  4DV6 M;  3NWL A;  1GL7 A;  2XSZ A;  4YHH M;  5EP1 A;  3T15 A;  1L2D A;  4JV5 M;  5IRE B;  1L1Z A;  1OFI A;  4PDG A;  4B3T M;  3LQR A;  3LMM A;  1Z6T A;  4GC9 A;  4JYA M;  2FOI C;  5EJC A;  1I94 M;  5KPZ A;  1NJG A;  5DNY A;  4K0K M;  3CTW B;  3SMP A;  3QAU A;  3AKZ A;  4AKI A;  4LCB A;  4DR2 M;  4L8R C;  2VQE M;  2KZS A;  3KSJ A;  2FE8 A;  1Q3B A;  3TL4 X;  3U6S A;  4W5W A;  3L29 A;  1Z59 A;  4JI3 M;  2R4E A;  1XHB A;  4LF8 M;  4REZ A;  3VKH A;  4TUW A;  1G41 A;  4GMQ A;  5EXS A;  3FTE A;  4JI7 M;  3HGI A;  4ZPX A;  4DV7 M;  1IXZ A;  4IJE A;  1DGH A;  2KZU A;  1X37 A;  1NHG C;  2M5Z A;  1E94 E;  1IY2 A;  3TWL A;  3SBJ A;  3GLH A;  2RGO A;  3FYC A;  2YNM D;  3RGS A;  3KXE C;  4I5S A;  4DUY M;  1G8P A;  3SHF A;  2UXD M;  4LZZ A;  2R62 A;  5C18 A;  4Z8X A;  1IM2 A;  5EP3 A;  2VQF M;  5F3W A;  4LJ9 A;  3U6Q A;  3D8L A;  2CHV A;  2F5N A;  2UUB M;  1HT1 E;  4JI1 M;  4MH0 E;  4L15 A;  1G3I A;  3U5Z A;  5ITT A;  4MGZ E;  3E9S A;  2XLJ A;  2XH9 A;  1LV7 A;  4S12 A;  5ITY A;  1JR3 A;  4PCZ A;  4FWH A;  2C5R A;  2DZN B;  3J80 S;  1SXJ A;  4QHS A;  4X66 M;  2L6O A;  2UXB M;  3GRV A;  1K3W A;  3AL0 C;  4DV0 M;  4DR7 M;  3Q8X A;  3KP1 E;  3HHY A;  5ITQ A;  5LMU M;  4NXN M;  1TH3 A;  2ZAO A;  3M6A A;  1E9S A;  2C99 A;  3SAV A;  3GQ4 A;  4LJ6 A;  3UMM A;  4D80 A;  3U60 A;  1XMQ M;  2CHQ A;  4OU7 A;  3GO8 A;  3R8F A;  3W0L B;  2OPF A;  3BOS A;  1DO0 A;  5EQT A;  3FUU A;  2HKJ A;  5DYG A;  2F5Q A;  3U61 A;  3RGP A;  4DR5 M;  1IN8 A;  1ORY B;  1SXJ E;  3D8B A;  5A2Q S;  4IBK A;  2BJV A;  3MK6 A;  4JI5 M;  1G4A E;  2Z3X A;  4G4N A;  1XMO M;  2G8L A;  2KRU A;  5FTM A;  4FD2 A;  3T1Y M;  3TWM A;  4JXJ A;  3KS4 A;  3CF2 A;  3KW6 A;  4GKK M;  4LJ7 A;  2K47 A;  3HHX A;  1QAN A;  4KLN A;  2F4V M;  3K92 A;  3HHZ A;  1MX0 A;  4R7G A;  1IN7 A;  1TDH A;  1YUB A;  4IBJ A;  1N75 A;  2CUZ A;  2XZF A;  3L2A A;  3L26 A;  3FTC A;  5IWA M;  3UK6 A;  4JI2 M;  3AV0 A;  1N34 M;  4B3R M;  5E6J A;  3SAS A;  3FTF A;  2C9O A;  2I7P A;  4NXM M;  2R65 A;  3A42 A;  4DV1 M;  1YSY A;  2R45 A;  3J27 B;  3KVW A;  3A46 A;  1N36 M;  1XNQ M;  3L27 A;  4KOD A;  2CE7 A;  4QNM A;  4M9Z A;  3HU3 A;  2C9C A;  4EIW A;  1DGF A;  2J7N A;  1HR0 M;  4RNA A;  4GH9 A;  2OQ4 A;  4NL4 H;  2O5R A;  2X4A A;  3KOY E;  5BR8 M;  3ZH9 B;  3PNY A;  1QAM A;  4QHT A;  2KXE A;  4AKG A;  1IY0 A;  4FCT A;  2LNH C;  4LF5 M;  2E5L M;  1IN6 A;  4WW0 A;  3SFZ A;  1QYR A;  2M60 A;  4D82 A;  3GLG B;  3KS8 A;  2F5P A;  2KW0 A;  4DR4 M;  1PJJ A;  2QP9 X;  2XSZ D;  1QZM A;  3CF0 A;  3HU1 A;  2Y21 A;  2ZAM A;  2HCB A;  1NY6 A;  4I4L A;  5FSW A;  3OTO M;  1OJL A;  1UM8 A;  4LFB M;  2DVW B;  4L16 A;  3TQS A;  4FCV A;  3GLF B;  3GRR A;  4AQY M;  3FUT A;  3KOW E;  3WHK A;  3JR4 A;  4JN6 A;  4AG5 A;  3FUW A;  1R2Y A;  3EIH A;  4GC5 A;  3H4M A;  4B7H A;  4LFA M;  3SAR A;  2V1C A;  2D7H A;  1J5E M;  1DO2 A;  1HT2 E;  3DZD A;  3RFW A;  4LY6 A;  1KSF X;  4JI8 M;  1K3X A;  4LF7 M;  1TH2 A;  1Q39 A;  3HKP A;  4RF0 A;  1HNZ M;  4FCW A;  2R46 A;  2Z7J A;  2HL7 A;  4LJA A;  3THG A;  4DV3 M;  3SC3 A;  1K82 A;  3AFH A;  2DWZ B;  5EXX A;  3GPY A;  1NVM A;  5DYI A;  3FUX A;  1VDD A;  4AI6 A;  2KA6 B;  2D7G A;  5KO3 A;  3AJI B;  3U6O A;  3B9P A;  5KPR A;  4OVZ A;  2X8A A;  3T38 A;  4GHL A;  4CIS A;  3I4Y A;  2DXI A;  4QOS A;  1H6U A;  3QWL A;  3R9X B;  4M9S A;  2XFS A;  1Z5C A;  4I8O A;  1IXR C;  3M7G A;  2UXC M;  3PVS A;  2CV0 A;  1W5S A;  8CAT A;  2G5G X;  1JR3 D;  1DGH B;  4GRI A;  2YR0 A;  3VK8 A;  2NQ8 C;  4CGY B;  4Z6Y A;  4L78 A;  4M0D A;  4DV4 M;  3VDP A;  3FKE A;  3GLH B;  1L2B A;  4NSO B;  1NSF A;  3PFI A;  4LJ8 A;  1Z5A A;  4IBD A;  4XBO A;  2Q2E B;  1IN4 A;  4OW0 A;  4WUR A;  3GQ5 A;  3GRU A;  4GKJ M;  4HL4 A;  4I81 A;  3HJQ A;  4IBF A;  3VLF B;  3SAU A;  2QEN A;  2H1R A;  4MGI E;  5JI2 E;  3FTD A;  3LQQ A;  2EA0 A;  4AW4 A;  3JR5 A;  2HHH M;  4DV5 M;  4G6Z A;  3GPX A;  4RF1 A;  3GLI B;  4KHP M;  2R4J A;  2ERC A;  3KP0 E;  4KO8 A;  4GHA A;  4MB7 A;  3VK7 A;  2ZAN A;  1R6B X;  3IG5 A;  2C96 A;  5FTK A;  5ITR A;  2L7I A;  1T3T A;  1NNU C;  3L25 A;  2Z4S A;  3TPZ A;  2QBY A;  4NRW A;  1XXH A;  2UUC M;  1NNJ A;  3J7B A;  1SXJ C;  1NJF A;  4PD2 A;  4G4O A;  2FFJ A;  2V6Z M;  3U60 B;  4MGY E;  1J7K A;  5E26 A;  2BNK A;  4R3D A;  4LRT A;  4LF6 M;  2X49 A;  3U61 B;  1HNW M;  4MGK E;  3FD9 A;  4LJ5 A;  4LJ4 A;  4JI0 M;  1N78 A;  4IBB A;  4LGM A;  3UGJ A;  3J7A S;  3VKG A;  4FWG A;  1E32 A;  1J09 A;  2UUA M;  3RE8 A;  4A3V B;  3HHW A;  1IQP A;  4BB9 A;  2AHM A;  3ZCB B;  3FYD A;  2EUC A;  3HU2 A;  4LGY A;  3VDU A;  5LMN M;  2D7E A;  3GPP A;  2F5S A;  3GP1 A;  4FWD A;  1NHW C;  5FLX S;  3AOG A;  1N33 M;  4DR1 M;  4BBA A;  1JQJ C;  1DGB A;  2Y0T A;  7CAT A;  3GLF A;  4M9X A;  1I4W A;  4B7G A;  1PM5 A;  2VII A;  5H37 D;  1Q3C A;  4AKH A;  4PT5 A;  3HJS A;  4LF4 M;  3KSX A;  3SAW A;  3GQ3 A;  4FW9 A;  1HQC A;  3DA1 A;  4DUZ M;  3T1H M;  1PJI A;  1R7R A;  1ZAE A;  3DFZ A;  3SHG B;  1N32 M;  2XF3 A;  4IIW A;  4FVM A;  4LZJ A;  1XWI A;  3WHL A;  3HWS A;  3PNV A;  1GLN A;  2XFT A;  4IBC A;  1N77 A;  3U6D A;  4YY3 M;  4B7F A;  3K1J A;  4B08 A;  2DWM A;  1FNN A;  2L09 A;  3FUV A;  5EXT A;  1IY1 A;  4QOZ C;  3U6M A;  5KPT A;  1DGG A;  1GL6 A;  1D2N A;  4QNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...