1N33M

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 21
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n33M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n33M02
2E5LM 2UXCM 3GPYA 2VQFM 1L2CA 3SAUA 4DV6M 1L2DA 3VK7A 4NRWA 3U6DA 4B3TM 4K0KM 1NNJA 4YHHM 4JYAM 5ITRA 4LF5M 2F4VM 4LFAM 5ITUA 3J80S 4DV4M 1Z5AA 5BR8M 3SASA 1HNZM 2VQEM 4B3MM 3U6LA 2UXDM 4DUYM 5A2QS 1Q3BA 1PJIA 4JI7M 1XC8A 4X64M 3J81S 1EE8A 3A46A 3GQ4A 1TDZA 4DV0M 4DR2M 2XZUA 4NXMM 2UXBM 4LFCM 4B3RM 3T1YM 3SARA 1R2YA 5ITTA 1Q39A 1XMQM 1FJGM 5ITYA 3A45A 4X65M 3C58A 4DR5M 4MB7A 1XNQM 4G4OA 1J5EM 3GPUA 2HKJA 3GP1A 3OTOM 3U6OA 4JV5M 3U6PA 2UUBM 2F5OA 1HR0M 4LF4M 4DV3M 3U6QA 4JI3M 3JAMS 1L2BA 5IWAM 3JR4A 3SAWA 2XZFA 1I94M 4JI8M 4NRVA 3TWMA 2UU9M 3DOAA 1TDHA 4G4NA 4DR6M 4DR1M 1PM5A 2HHHM 5ITQA 4PDGA 4X66M 5FLXS 2F5QA 4LF9M 1N33M 4DV5M 4NXNM 3VK8A 4B3SM 4G4RA 4LF7M 4LFBM 2ZM6M 2F5SA 3TWKA 1XNRM 5IT9S 3U6SA 1IBKM 3SATA 4DR7M 4DV1M 4JI4M 2UUAM 3U6CA 4JI1M 1PJJA 4KHPM 1Z5BA 3TWLA 4OX9M 1HNXM 3GPXA 4PDIA 3J7AS 4JI5M 2UUCM 1N36M 3GO8A 1Q3CA 2OPFA 1Z59A 1N34M 4YY3M 4AQYM 2EA0A 4LF8M 3SBJA 2OQ4A 4PD2A 1MX0A 5ITXA 4G4QA 3GPPA 3U6EA 4JI0M 3SAVA 1XMOM 1L1TA 2ZBKB 3GQ3A 4DV7M 1L1ZA 4ITQA 5LMNM 1HNWM 2Q2EB 3JR5A 1K3XA 4CISA 4GKKM 2F5NA 1N32M 3U6MA 1K82A 4X62M 4LF6M 5LMUM 4DUZM 5ITXE 1IBLM 3A42A 1K3WA 1KFVA 1MU5A 2F5PA 4JI6M 4PCZA 4DR3M 1R2ZA 4GKJM 3GQ5A 1IBMM 4DR4M 4DV2M 3W0FA 3T1HM 4JI2M 1Z5CA
chains in the Genus database with same CATH superfamily
2UXCM 4QHTA 4QOZC 3UMMA 2O25A 2K0BX 3HY5A 1IXSB 1G41A 2L6OA 4GIPA 3GPYA 4IBCA 4AG5A 4MGZE 2ZTDA 4GMQA 3T15A 1SXJC 5KQDA 4IBDA 1G3IA 3E4RA 4R71A 5FTJA 3SAUA 1L2DA 3AOEC 1NSFA 3IHPA 2KA6B 4K0KM 4F2LA 3L25A 2LWXA 4LFAM 5EXPA 3UJNA 3VKGA 4DV4M 4MGIE 2VQEM 2CV2A 3B7QA 4X64M 2XF3A 1QUTA 4AKGA 3J81S 2R4EA 3GQ4A 1NJFA 2MH8A 3I04M 2UXBM 4GHAA 1TH3A 2KXEA 1C7YA 4B3RM 1NY5A 1Y8GA 2EJSA 2JY6B 3T1YM 2QBYB 1VDDA 2FE8A 2L09A 3D8LA 3QAUA 5ITTA 4BB9A 2X49A 3L27A 1XMQM 4II7A 2G5GX 3A45A 1XXHA 1WIVA 1OFHA 1WHCA 3H4MA 3LQQA 1H6UA 4Z8XA 5BPVA 3IG5A 3GP1A 3R8FA 4M9SA 3DFZA 5DYIA 4JN6A 1N75A 2C99A 4RF1A 3MHVC 3FUUA 2DWNA 4CJ6A 2F5OA 3U6QA 1WGLA 2EUCA 2M5ZA 3HWSA 3JAMS 3JR4A 2XZFA 4F1IA 4EIWA 2CV0A 1XXHE 5F3WA 3FKEA 2R44A 1NVMA 2D7GA 1E94E 1YLAA 3KP1E 3DOAA 1TDHA 1IY1A 2R18A 3RE8A 3FUWA 5L8RF 3GLIB 2JUJA 5C1BA 3KSXA 1NJGA 2M60A 3LCVB 4MM3B 3CTWB 5DNYA 2F5QA 4DV5M 2KZSA 3BXWA 2KZUA 4LF7M 1X37A 2DHYA 2RGOA 3I4VA 2D7EA 3TE6A 5FSWA 1EIJA 2K6BA 1QVRA 2CRUA 3W67A 1EFUB 4PT5A 3U6SA 3ZCBB 2C96A 3HHYA 3SATA 4DV1M 4JI4M 2UUAM 2LNHC 4JI1M 1IN7A 2X8AA 4MH0E 4NC6A 3GPXA 3U5ZA 3GRUA 1PJTA 3IECA 3HU1A 1Z59A 1UM8A 2L2DA 1E32A 4YY3M 4AQYM 4LJ6A 4LF8M 3LVWA 4Y28F 1WGNA 4PD2A 2DZOB 3GLGA 3BOSA 1AIPC 3KSJA 3GPPA 2FNAA 3SAVA 1L1ZA 2ZBKB 5FTLA 2HAKA 4IBJA 2FS1A 2QHOB 4DBGB 4WW0A 3EIHA 5KPTA 3AKZA 1ZMWA 1J09A 3HGIA 2Z4SA 1RU3A 4LY6A 4BLCA 4Z6YA 4X62M 4DUZM 2QPAA 3VKHA 3J7BA 1KFVA 4KO8A 2F5PA 3FRHA 3GLFA 1XXHB 2LH0A 3PVSA 1R2ZA 4GKJM 1IBMM 1D2NA 1P3QQ 4DV2M 4L78A 1TTEA 1NHWC 1S3SA 2LBCA 3CF0A 2E5LM 2QENA 2OOBA 3E21A 3AOGA 1GVNA 2ZTCA 1JR3A 3UGJA 2JY5A 1L2CA 1ZMUA 3KDSE 4DV6M 2WSFF 1QZMA 3NBXX 3GLFE 3C3DA 4G3OA 3HHWA 2YFQA 4L4UA 1LTMA 2QCUA 1NV9A 4LF5M 4M9ZA 4NOOB 2F4VM 2LVAA 2QP9X 2R6FA 1IM2A 3I01M 1Z5AA 4GITA 4B3MM 2YR0A 2I7NA 3U6LA 4DUYM 5A2QS 1XC8A 2HWJA 4KLNA 4HL4A 4M9XA 2J7OA 4D80A 1EE8A 2RGHA 3T38A 3VDUA 3U61A 4DV0M 2QQ8A 4DR2M 3QWLA 2XZUA 1N78A 2CFOA 3KOYE 4NSOB 4LFCM 1ZQ9A 2XEPA 3HJ8A 1DO0A 2L4EA 3LW5F 4HLQA 1FNNA 5ITYA 4IJFA 1FJGM 4X65M 1XNQM 2XSZA 3KS4A 1T3TA 1G8PA 1OJLA 1J5EM 1QQWA 2HKJA 4FW9A 3U6OA 3Q8XA 2CHVA 3TPZA 2G3QA 4GRIA 4DV3M 1GKIA 2EKFA 3THGA 4JXJA 3FYDA 4D82A 1YUBA 3WHKA 1LV7A 4JI8M 3FTDA 4NRVA 3UZUA 4GEWA 4B7HA 2LVQD 3KXEC 2Z3XA 4DR6M 3SHFA 1PM5A 2DXIA 2JZ1A 2K47A 3GRVA 3VFDA 2H1RA 4LZZA 3MJ5A 3AFHA 2DVWB 3AV0A 4LF9M 3ILKA 2XLJA 1G71A 4I4LA 1VEGA 2RRUA 3KOXE 2LHCA 3VK8A 2HCBA 2DWZB 5FTMA 1IN4A 4KODA 2L4FA 2F5SA 4QNRA 1CUKA 3RGPA 2BWEA 1V34A 1DGHA 5IT9S 1QDRA 4L16A 4LJ7A 1NHGC 1IBKM 3U60B 3KVWA 1TH4A 2Z7JA 1QAQA 3RFWA 3B89A 4BBAA 3U6CA 4I5SA 1Z5BA 2DWMA 5EXTA 4PDIA 3M6AA 1MJGM 2CE7A 3HJSA 3QYEA 2XFSA 3GO8A 4L8RC 2OPFA 3SMPA 4B7GA 1ORYB 2JY8A 3H4JA 1N34M 2ZAOA 5EP3A 2EA0A 1IN6A 2WZJA 2C9OA 1VEKA 3SBJA 3DZDA 1IY0A 2BJVA 1SXJA 3IG8A 3R9XB 1MX0A 4AKHA 1GL7A 2R62A 1HQYE 3FTCA 3AOEA 5IREB 3VLFB 4G4QA 4CHTB 5KQ8A 4OVZA 1DGFA 3SMSA 5KO3A 3U6EA 1L1TA 1L8QA 2LHGA 2Q2EB 3J2PB 3PNVA 4ANRA 4IIWA 3U61B 1N32M 3U6MA 1IN5A 2KRUA 3PFIA 1V33A 3B7ZA 4QHSA 1D0MA 3KP0E 3L2AA 5EJCA 1IBLM 1MU5A 4IJEA 1BVSA 2AHMA 3M0EA 5FTKA 2Y20A 4XK8F 3T1HM 3FE3A 2CEAA 1Z5CA 2OOAA 4HEOA 2G8LA 3K8ZA 4FD2A 1WR1B 3GRYA 3K9PA 3J27B 5JI3E 2V6ZM 1QDTA 2KNVA 4AG6A 1DGBA 2MGWA 2CHQA 4B3TM 3HJQA 4YHHM 4JYAM 5ITRA 2H5XA 5ITUA 3SYKA 1PRBA 3HZJA 5BR8M 1HT1E 4WP2A 1HNZM 3SASA 2UXDM 5KPRA 1UFZA 3BBZA 5EP2A 1PJIA 4FWDA 4JI7M 1XHBA 5EXXA 3K92A 1KSFX 1GLNA 4D81A 2JP7A 5JI2E 2BWBA 5E6JA 3GLGE 3L26A 2LXEA 2C98A 2R4JA 3C9PA 1TDZA 1SG9A 1JB0F 1I4WA 1MN3A 1OAIA 2GQFA 3HU2A 5IZ7D 2Z8YM 1W5TA 3SARA 4AI6A 4AW4A 1QUSA 2ZAMA 4LJ8A 5C18A 3E46A 3Q8GA 2WSEF 4DR5M 4MB7A 2XGNA 2CV1A 1IXRC 4RKUF 3GPUA 2DI0A 3OTOM 2KW0A 2MJ5B 1A5TA 4L15A 3U6PA 3C3EA 3HHZA 1HR0M 4LF4M 2VIIA 2N35A 2O5RA 3SC3A 1L2BA 4MGHA 5IWAM 3I51A 2LVNC 4IBBA 3KFUG 4FVMA 1JR3E 2DKLA 1J7KA 1GJTA 3D8BA 2ZANA 4FWGA 2UU9M 4G4NA 2R65A 1QZEA 3ZC7B 2DAKA 3FD9A 2QNJA 2OO9A 1R7RA 4PDGA 5FLXS 1N33M 4AZFA 3ZH9B 4NXNM 2D7HA 3FUXA 3KS8A 1OTRA 1DO2A 4I81A 4G4RA 1OIZA 4LRSA 1NY6A 4LFBM 2B3TA 4B7FA 4M0DA 3GLHA 5KPZA 2ZM6M 3TWKA 1XNRM 2A5YB 4LJ4A 2C5RA 2LVOC 1DV0A 1JR3D 3U5ZB 1Z6TA 2KEBA 4RF0A 2NQ8C 2R45A 4FCVA 4DR7M 3EIEA 1WJ7A 2WSCF 2ERCA 3A98B 5GKNA 1PJJA 2KHHA 4XBOA 3TWLA 3NWLA 1WXQA 1YSYA 1VEJA 2RKOA 3GLHE 1OQYA 3AL0C 2UUCM 3J7AS 2R46A 2GNOA 3B7NA 1Q3CA 2R0IA 2APLA 3W68A 3GLGB 3L29A 2LTUA 1IN8A 1TH2A 1XWIA 1Q02A 3GRRA 4CGYB 2CP8A 2MR9A 2KDLA 5DYGA 1XMOM 2DAIA 3DA1A 1HNWM 4DV7M 1TR8A 1HT2E 2HL7A 2JZ0A 3M7GA 4GH9A 1OAOC 1K3XA 3T6PA 3TL4X 2XSZD 3GLFB 1K82A 3HKPA 2V1UA 4R7GA 2YNMD 3ZQJA 5LMUM 2CHGA 3CGWA 5FTNA 3A42A 1K3WA 1PJSA 2BJWA 2CUZA 4JI6M 1QANA 5DFLA 4DR3M 4B08A 4UN2B 3VDPA 3GQ5A 2BNKA 4DR4M 1JQJC 3W0FA 1GJSA 4JI2M 4P17A 1G4AE 4GC9A 4CIZA 4FCWA 1N77A 1GABA 3W0LB 2VQFM 2L7IA 2VDBB 3VK7A 4NRWA 4MGKE 3U6DA 1NNJA 4IBIA 3E9SA 1IY2A 3J80S 5H37D 1GO5A 3FUVA 3FTEA 1R4GA 4LJ9A 1Q3BA 1GL6A 4TUWA 1C1KA 1T6OA 1SXJE 3QYBA 3NBIA 1HJPA 1TF0B 4LJ5A 5E26A 3A46A 4NL4H 1IQPA 3B74A 4QOSA 3SFZA 3HU3A 4NXMM 3TQSA 1KYIA 1OKSA 3GLHB 1PJQA 1R2YA 1AUAA 3B9PA 8CATA 3HX3A 1Q39A 2DENA 2FFJA 1V92A 3C58A 2I7PA 2FH0A 4QNMA 5EP4A 1NV8A 4G4OA 1ZAEA 4JV5M 4LGYA 2Y0QA 4L6V6 2KNAA 3RGSA 2UUBM 4AKIA 5EXSA 1IXSA 4KT0F 2JWSA 2DNAA 4JI3M 3K1JA 1SXJD 1R5LA 3SAWA 3FYCA 3LCUA 4LRTA 1VG5A 3SYLA 1I94M 1QYRA 2K9DA 1NO1A 3F92A 3TWMA 1ZMVA 4IBGA 4IBFA 4M0WA 1VDLA 1W5SA 2JXNA 2L7HA 2DHRA 2DZLA 2JY7A 3PNYA 4DR1M 3FRIA 4MGYE 3L28A 3WHLA 3FTFA 2HHHM 2O01F 1D0LA 4OW0A 1YE9A 1TGUA 2MROB 3K2LA 3LMMA 4FWHA 4X66M 5ITQA 4GHLA 2C9CA 2JA2A 4FCTA 1T43A 4GC5A 2CWBA 4I8OA 4B3SM 2DAEA 3I4YA 4W5WA 3KOWE 1DGHB 2KRKA 5EQTA 3UK6A 2VF8A 2QSFX 4LJAA 4REZA 2QBYA 2VF7A 3PXGA 2DAMA 1QAMA 4OU7A 4LCBA 1G59A 2J5YA 2FOIC 2V1CA 2EKKA 3KW6A 1OFIA 2EO2A 2Y21A 4LZJA 1VQ1A 4WURA 2JNHA 3HHXA 1PGYA 4LG2A 4KHPM 1R6BX 2J7NA 4RNAA 1HNXM 4OX9M 3K9OA 3SHGB 4JI5M 1DGGA 3FUTA 3U60A 1N36M 4Q7JA 3KOZE 2KNZA 4A3VB 4S12A 1SXJB 1D0KA 1E9RA 4OVZB 1F4IA 3GLIA 2OQ4A 2DAGA 5ITXA 1IFYA 2Z4RA 2Y0TA 4R3DA 3AJIB 4JI0M 3LVVA 4ITQA 3GQ3A 1HQCA 3CF2A 4XGIA 5LMNM 1OIPA 3LQRA 4LGMA 3JR5A 4IBKA 4NSRA 2QZ4A 2W82A 1ZV1A 2XH9A 3CF6E 3MK6A 7CATA 2F5NA 4CISA 4GKKM 3GLIE 2P5TA 4LF6M 5EP1A 5ITXE 2XFTA 3MMPA 4G6ZA 4IBEA 1QAOA 2X4AA 2YQZA 4P16A 4PCZA 1NNUC 1XB2B 1IXZA 3V76A 2DWLA 4ZPXA 1E9SA 2DZNB 2LVPC
chains in the Genus database with same CATH topology
2UXCM 4QHTA 4QOZC 3UMMA 4GIPA 1IXSB 1G41A 2L6OA 3GPYA 4IBCA 4AG5A 4MGZE 4GMQA 3T15A 1SXJC 5KQDA 4IBDA 1G3IA 3E4RA 3SAUA 5FTJA 1L2DA 3AOEC 1NSFA 4K0KM 2KA6B 3L25A 2LWXA 4LFAM 5EXPA 3UJNA 3VKGA 4DV4M 4MGIE 2VQEM 2CV2A 4X64M 2XF3A 4AKGA 3J81S 2R4EA 3GQ4A 1NJFA 2UXBM 4GHAA 1TH3A 2KXEA 4B3RM 1NY5A 2QBYB 3T1YM 1VDDA 2FE8A 2L09A 3D8LA 3QAUA 5ITTA 4BB9A 2X49A 3L27A 1XMQM 4II7A 2G5GX 3A45A 1XXHA 1OFHA 4Z8XA 3H4MA 3LQQA 1H6UA 5BPVA 3IG5A 3GP1A 3R8FA 4M9SA 3DFZA 5DYIA 4JN6A 1N75A 2C99A 4RF1A 3MHVC 3FUUA 2DWNA 2F5OA 3U6QA 3HWSA 2EUCA 2M5ZA 3JAMS 3JR4A 2XZFA 4EIWA 2CV0A 5F3WA 3FKEA 1NVMA 2D7GA 1E94E 3KP1E 3DOAA 1TDHA 1IY1A 2R18A 3RE8A 3FUWA 3GLIB 5C1BA 3KSXA 1NJGA 2M60A 4MM3B 3CTWB 5DNYA 2F5QA 4DV5M 2KZSA 2KZUA 4LF7M 1X37A 2RGOA 3TE6A 3I4VA 2D7EA 5FSWA 1QVRA 4PT5A 3U6SA 3ZCBB 2C96A 3HHYA 3SATA 4DV1M 4JI4M 2UUAM 2LNHC 4JI1M 1IN7A 2X8AA 4MH0E 3GPXA 3U5ZA 3GRUA 3HU1A 1Z59A 1UM8A 4YY3M 1E32A 4AQYM 4LJ6A 4LF8M 3LVWA 4PD2A 2DZOB 3GLGA 3BOSA 3GPPA 3KSJA 2FNAA 3SAVA 1L1ZA 2ZBKB 5FTLA 4IBJA 4WW0A 3EIHA 5KPTA 3AKZA 1J09A 3HGIA 2Z4SA 4Z6YA 4LY6A 4BLCA 4X62M 4DUZM 2QPAA 3VKHA 3J7BA 1KFVA 4KO8A 2F5PA 3GLFA 1XXHB 2LH0A 3PVSA 1R2ZA 4GKJM 1IBMM 1D2NA 4DV2M 4L78A 1NHWC 1S3SA 3CF0A 2E5LM 2QENA 3AOGA 1GVNA 1JR3A 3UGJA 1L2CA 3KDSE 4DV6M 1QZMA 3HHWA 2YFQA 4L4UA 2QCUA 4LF5M 4M9ZA 4NOOB 2F4VM 2QP9X 1IM2A 1Z5AA 4GITA 4B3MM 2YR0A 2I7NA 3U6LA 4DUYM 5A2QS 1XC8A 4KLNA 4HL4A 4M9XA 2J7OA 4D80A 1EE8A 2RGHA 3T38A 3VDUA 3U61A 4DV0M 1N78A 4DR2M 3QWLA 2XZUA 2CFOA 3KOYE 4NSOB 4LFCM 1ZQ9A 2XEPA 3HJ8A 1DO0A 4HLQA 1FNNA 5ITYA 4IJFA 1FJGM 4X65M 1XNQM 2XSZA 3KS4A 1T3TA 1G8PA 1OJLA 1J5EM 1QQWA 2HKJA 4FW9A 3U6OA 3Q8XA 2CHVA 3TPZA 4GRIA 4DV3M 1GKIA 3THGA 4JXJA 3FYDA 4D82A 1YUBA 3WHKA 1LV7A 4JI8M 3FTDA 4NRVA 3UZUA 4B7HA 2Z3XA 3KXEC 4DR6M 3SHFA 1PM5A 2DXIA 2K47A 3GRVA 3VFDA 2H1RA 4LZZA 3MJ5A 3AFHA 2DVWB 3AV0A 4LF9M 3ILKA 2XLJA 4I4LA 3KOXE 3VK8A 2HCBA 2DWZB 5FTMA 1IN4A 4KODA 2F5SA 4QNRA 3RGPA 1DGHA 5IT9S 4L16A 4LJ7A 1NHGC 1IBKM 3U60B 3KVWA 1TH4A 2Z7JA 1QAQA 3RFWA 4BBAA 3U6CA 4I5SA 1Z5BA 2DWMA 5EXTA 4PDIA 3M6AA 2CE7A 3HJSA 4L8RC 2XFSA 3GO8A 2OPFA 3SMPA 4B7GA 1ORYB 1N34M 2ZAOA 5EP3A 2EA0A 1IN6A 2C9OA 3SBJA 3DZDA 1IY0A 2BJVA 1SXJA 3IG8A 3R9XB 1MX0A 4AKHA 1GL7A 2R62A 1HQYE 3FTCA 3AOEA 5IREB 3VLFB 4G4QA 4CHTB 5KQ8A 4OVZA 1DGFA 3SMSA 5KO3A 3U6EA 1L1TA 1L8QA 3J2PB 2Q2EB 3PNVA 4IIWA 3U61B 1N32M 3U6MA 1IN5A 2KRUA 3PFIA 4QHSA 3KP0E 3L2AA 5EJCA 1IBLM 1MU5A 4IJEA 2AHMA 3M0EA 5FTKA 2Y20A 3T1HM 2CEAA 1Z5CA 2G8LA 3K8ZA 4FD2A 3GRYA 3J27B 5JI3E 2V6ZM 4AG6A 1DGBA 2CHQA 4B3TM 3HJQA 4YHHM 4JYAM 5ITRA 5ITUA 3SYKA 5BR8M 1HT1E 1HNZM 3SASA 2UXDM 5KPRA 5EP2A 1PJIA 4FWDA 4JI7M 1XHBA 5EXXA 3K92A 1KSFX 1GLNA 4D81A 5JI2E 5E6JA 3L26A 2LXEA 2C98A 2R4JA 1TDZA 1I4WA 3HU2A 5IZ7D 4AI6A 3SARA 1W5TA 4AW4A 2ZAMA 4LJ8A 5C18A 4DR5M 4MB7A 2XGNA 2CV1A 1IXRC 3GPUA 3OTOM 2KW0A 4L15A 3U6PA 3HHZA 1HR0M 4LF4M 2VIIA 2O5RA 3SC3A 1L2BA 4MGHA 5IWAM 3I51A 4IBBA 3KFUG 4FVMA 1J7KA 3D8BA 2ZANA 4FWGA 2UU9M 4G4NA 2R65A 3ZC7B 3FD9A 1R7RA 4PDGA 5FLXS 1N33M 4AZFA 3ZH9B 4NXNM 2D7HA 3FUXA 3KS8A 1DO2A 4I81A 4G4RA 4LRSA 1NY6A 4LFBM 4B7FA 4M0DA 3GLHA 5KPZA 2ZM6M 3TWKA 1XNRM 2A5YB 4LJ4A 2C5RA 1JR3D 3U5ZB 1Z6TA 2KEBA 4RF0A 2NQ8C 2R45A 4FCVA 4DR7M 3EIEA 2ERCA 3A98B 5GKNA 1PJJA 4XBOA 3TWLA 3NWLA 1WXQA 1YSYA 2RKOA 3AL0C 3J7AS 2UUCM 2R46A 1Q3CA 3GLGB 3L29A 1IN8A 1TH2A 1XWIA 4CGYB 3GRRA 5DYGA 1XMOM 3DA1A 1HNWM 4DV7M 1HT2E 2HL7A 3M7GA 4GH9A 1K3XA 3TL4X 2XSZD 3GLFB 1K82A 3HKPA 2V1UA 4R7GA 2YNMD 5LMUM 2CHGA 5FTNA 3A42A 1K3WA 2BJWA 2CUZA 4JI6M 1QANA 4DR3M 4B08A 3VDPA 3GQ5A 2BNKA 4DR4M 1JQJC 3W0FA 4JI2M 1G4AE 4GC9A 4FCWA 1N77A 3W0LB 2VQFM 2L7IA 3VK7A 4NRWA 4MGKE 3U6DA 1NNJA 4IBIA 3E9SA 1IY2A 3J80S 5H37D 3FUVA 3FTEA 4LJ9A 1Q3BA 1GL6A 4TUWA 1C1KA 1SXJE 3NBIA 4LJ5A 5E26A 3A46A 4NL4H 1IQPA 4QOSA 3SFZA 3HU3A 4NXMM 3TQSA 1KYIA 3GLHB 1R2YA 3B9PA 8CATA 1Q39A 2FFJA 3C58A 2I7PA 4QNMA 5EP4A 4G4OA 1ZAEA 4JV5M 4LGYA 2Y0QA 2UUBM 3RGSA 4AKIA 5EXSA 4JI3M 3K1JA 1SXJD 3SAWA 3FYCA 4LRTA 3SYLA 1I94M 1QYRA 3TWMA 4IBGA 4IBFA 4M0WA 1W5SA 2L7HA 2DHRA 3PNYA 4DR1M 4MGYE 3L28A 3WHLA 3FTFA 2HHHM 4OW0A 1YE9A 1TGUA 3K2LA 3LMMA 4FWHA 4X66M 5ITQA 4GHLA 2C9CA 2JA2A 4FCTA 4GC5A 4I8OA 4B3SM 3I4YA 4W5WA 3KOWE 1DGHB 2KRKA 5EQTA 3UK6A 4LJAA 4REZA 2QBYA 3PXGA 1QAMA 4OU7A 4LCBA 1G59A 2V1CA 2FOIC 3KW6A 1OFIA 2EO2A 2Y21A 4LZJA 4WURA 3HHXA 4LG2A 4KHPM 1R6BX 2J7NA 4RNAA 1HNXM 4OX9M 3SHGB 4JI5M 1DGGA 3FUTA 3U60A 1N36M 3KOZE 4A3VB 4S12A 1SXJB 1E9RA 4OVZB 3GLIA 2OQ4A 5ITXA 2Z4RA 2Y0TA 4R3DA 3AJIB 4JI0M 3LVVA 4ITQA 3GQ3A 1HQCA 3CF2A 4XGIA 5LMNM 3LQRA 4LGMA 3JR5A 4IBKA 4NSRA 2QZ4A 2W82A 4CISA 2XH9A 3CF6E 3MK6A 7CATA 2F5NA 4GKKM 2P5TA 4LF6M 5EP1A 5ITXE 2XFTA 4G6ZA 4IBEA 1QAOA 2X4AA 2YQZA 4P16A 4PCZA 1NNUC 1IXZA 2DWLA 4ZPXA 1E9SA 2DZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L M;  2UXC M;  3GPY A;  2VQF M;  1L2C A;  3SAU A;  4DV6 M;  1L2D A;  3VK7 A;  4NRW A;  3U6D A;  4B3T M;  4K0K M;  1NNJ A;  4YHH M;  4JYA M;  5ITR A;  4LF5 M;  2F4V M;  4LFA M;  5ITU A;  3J80 S;  4DV4 M;  1Z5A A;  5BR8 M;  3SAS A;  1HNZ M;  2VQE M;  4B3M M;  3U6L A;  2UXD M;  4DUY M;  5A2Q S;  1Q3B A;  1PJI A;  4JI7 M;  1XC8 A;  4X64 M;  3J81 S;  1EE8 A;  3A46 A;  3GQ4 A;  1TDZ A;  4DV0 M;  4DR2 M;  2XZU A;  4NXM M;  2UXB M;  4LFC M;  4B3R M;  3T1Y M;  3SAR A;  1R2Y A;  5ITT A;  1Q39 A;  1XMQ M;  1FJG M;  5ITY A;  3A45 A;  4X65 M;  3C58 A;  4DR5 M;  4MB7 A;  1XNQ M;  4G4O A;  1J5E M;  3GPU A;  2HKJ A;  3GP1 A;  3OTO M;  3U6O A;  4JV5 M;  3U6P A;  2UUB M;  2F5O A;  1HR0 M;  4LF4 M;  4DV3 M;  3U6Q A;  4JI3 M;  3JAM S;  1L2B A;  5IWA M;  3JR4 A;  3SAW A;  2XZF A;  1I94 M;  4JI8 M;  4NRV A;  3TWM A;  2UU9 M;  3DOA A;  1TDH A;  4G4N A;  4DR6 M;  4DR1 M;  1PM5 A;  2HHH M;  5ITQ A;  4PDG A;  4X66 M;  5FLX S;  2F5Q A;  4LF9 M;  1N33 M;  4DV5 M;  4NXN M;  3VK8 A;  4B3S M;  4G4R A;  4LF7 M;  4LFB M;  2ZM6 M;  2F5S A;  3TWK A;  1XNR M;  5IT9 S;  3U6S A;  1IBK M;  3SAT A;  4DR7 M;  4DV1 M;  4JI4 M;  2UUA M;  3U6C A;  4JI1 M;  1PJJ A;  4KHP M;  1Z5B A;  3TWL A;  4OX9 M;  1HNX M;  3GPX A;  4PDI A;  3J7A S;  4JI5 M;  2UUC M;  1N36 M;  3GO8 A;  1Q3C A;  2OPF A;  1Z59 A;  1N34 M;  4YY3 M;  4AQY M;  2EA0 A;  4LF8 M;  3SBJ A;  2OQ4 A;  4PD2 A;  1MX0 A;  5ITX A;  4G4Q A;  3GPP A;  3U6E A;  4JI0 M;  3SAV A;  1XMO M;  1L1T A;  2ZBK B;  3GQ3 A;  4DV7 M;  1L1Z A;  4ITQ A;  5LMN M;  1HNW M;  2Q2E B;  3JR5 A;  1K3X A;  4CIS A;  4GKK M;  2F5N A;  1N32 M;  3U6M A;  1K82 A;  4X62 M;  4LF6 M;  5LMU M;  4DUZ M;  5ITX E;  1IBL M;  3A42 A;  1K3W A;  1KFV A;  1MU5 A;  2F5P A;  4JI6 M;  4PCZ A;  4DR3 M;  1R2Z A;  4GKJ M;  3GQ5 A;  1IBM M;  4DR4 M;  4DV2 M;  3W0F A;  3T1H M;  4JI2 M;  1Z5C A; 
#chains in the Genus database with same CATH topology
 2UXC M;  4QHT A;  4QOZ C;  3UMM A;  2O25 A;  2K0B X;  3HY5 A;  1IXS B;  1G41 A;  2L6O A;  4GIP A;  3GPY A;  4IBC A;  4AG5 A;  4MGZ E;  2ZTD A;  4GMQ A;  3T15 A;  1SXJ C;  5KQD A;  4IBD A;  1G3I A;  3E4R A;  4R71 A;  5FTJ A;  3SAU A;  1L2D A;  3AOE C;  1NSF A;  3IHP A;  2KA6 B;  4K0K M;  4F2L A;  3L25 A;  2LWX A;  4LFA M;  5EXP A;  3UJN A;  3VKG A;  4DV4 M;  4MGI E;  2VQE M;  2CV2 A;  3B7Q A;  4X64 M;  2XF3 A;  1QUT A;  4AKG A;  3J81 S;  2R4E A;  3GQ4 A;  1NJF A;  2MH8 A;  3I04 M;  2UXB M;  4GHA A;  1TH3 A;  2KXE A;  1C7Y A;  4B3R M;  1NY5 A;  1Y8G A;  2EJS A;  2JY6 B;  3T1Y M;  2QBY B;  1VDD A;  2FE8 A;  2L09 A;  3D8L A;  3QAU A;  5ITT A;  4BB9 A;  2X49 A;  3L27 A;  1XMQ M;  4II7 A;  2G5G X;  3A45 A;  1XXH A;  1WIV A;  1OFH A;  1WHC A;  3H4M A;  3LQQ A;  1H6U A;  4Z8X A;  5BPV A;  3IG5 A;  3GP1 A;  3R8F A;  4M9S A;  3DFZ A;  5DYI A;  4JN6 A;  1N75 A;  2C99 A;  4RF1 A;  3MHV C;  3FUU A;  2DWN A;  4CJ6 A;  2F5O A;  3U6Q A;  1WGL A;  2EUC A;  2M5Z A;  3HWS A;  3JAM S;  3JR4 A;  2XZF A;  4F1I A;  4EIW A;  2CV0 A;  1XXH E;  5F3W A;  3FKE A;  2R44 A;  1NVM A;  2D7G A;  1E94 E;  1YLA A;  3KP1 E;  3DOA A;  1TDH A;  1IY1 A;  2R18 A;  3RE8 A;  3FUW A;  5L8R F;  3GLI B;  2JUJ A;  5C1B A;  3KSX A;  1NJG A;  2M60 A;  3LCV B;  4MM3 B;  3CTW B;  5DNY A;  2F5Q A;  4DV5 M;  2KZS A;  3BXW A;  2KZU A;  4LF7 M;  1X37 A;  2DHY A;  2RGO A;  3I4V A;  2D7E A;  3TE6 A;  5FSW A;  1EIJ A;  2K6B A;  1QVR A;  2CRU A;  3W67 A;  1EFU B;  4PT5 A;  3U6S A;  3ZCB B;  2C96 A;  3HHY A;  3SAT A;  4DV1 M;  4JI4 M;  2UUA M;  2LNH C;  4JI1 M;  1IN7 A;  2X8A A;  4MH0 E;  4NC6 A;  3GPX A;  3U5Z A;  3GRU A;  1PJT A;  3IEC A;  3HU1 A;  1Z59 A;  1UM8 A;  2L2D A;  1E32 A;  4YY3 M;  4AQY M;  4LJ6 A;  4LF8 M;  3LVW A;  4Y28 F;  1WGN A;  4PD2 A;  2DZO B;  3GLG A;  3BOS A;  1AIP C;  3KSJ A;  3GPP A;  2FNA A;  3SAV A;  1L1Z A;  2ZBK B;  5FTL A;  2HAK A;  4IBJ A;  2FS1 A;  2QHO B;  4DBG B;  4WW0 A;  3EIH A;  5KPT A;  3AKZ A;  1ZMW A;  1J09 A;  3HGI A;  2Z4S A;  1RU3 A;  4LY6 A;  4BLC A;  4Z6Y A;  4X62 M;  4DUZ M;  2QPA A;  3VKH A;  3J7B A;  1KFV A;  4KO8 A;  2F5P A;  3FRH A;  3GLF A;  1XXH B;  2LH0 A;  3PVS A;  1R2Z A;  4GKJ M;  1IBM M;  1D2N A;  1P3Q Q;  4DV2 M;  4L78 A;  1TTE A;  1NHW C;  1S3S A;  2LBC A;  3CF0 A;  2E5L M;  2QEN A;  2OOB A;  3E21 A;  3AOG A;  1GVN A;  2ZTC A;  1JR3 A;  3UGJ A;  2JY5 A;  1L2C A;  1ZMU A;  3KDS E;  4DV6 M;  2WSF F;  1QZM A;  3NBX X;  3GLF E;  3C3D A;  4G3O A;  3HHW A;  2YFQ A;  4L4U A;  1LTM A;  2QCU A;  1NV9 A;  4LF5 M;  4M9Z A;  4NOO B;  2F4V M;  2LVA A;  2QP9 X;  2R6F A;  1IM2 A;  3I01 M;  1Z5A A;  4GIT A;  4B3M M;  2YR0 A;  2I7N A;  3U6L A;  4DUY M;  5A2Q S;  1XC8 A;  2HWJ A;  4KLN A;  4HL4 A;  4M9X A;  2J7O A;  4D80 A;  1EE8 A;  2RGH A;  3T38 A;  3VDU A;  3U61 A;  4DV0 M;  2QQ8 A;  4DR2 M;  3QWL A;  2XZU A;  1N78 A;  2CFO A;  3KOY E;  4NSO B;  4LFC M;  1ZQ9 A;  2XEP A;  3HJ8 A;  1DO0 A;  2L4E A;  3LW5 F;  4HLQ A;  1FNN A;  5ITY A;  4IJF A;  1FJG M;  4X65 M;  1XNQ M;  2XSZ A;  3KS4 A;  1T3T A;  1G8P A;  1OJL A;  1J5E M;  1QQW A;  2HKJ A;  4FW9 A;  3U6O A;  3Q8X A;  2CHV A;  3TPZ A;  2G3Q A;  4GRI A;  4DV3 M;  1GKI A;  2EKF A;  3THG A;  4JXJ A;  3FYD A;  4D82 A;  1YUB A;  3WHK A;  1LV7 A;  4JI8 M;  3FTD A;  4NRV A;  3UZU A;  4GEW A;  4B7H A;  2LVQ D;  3KXE C;  2Z3X A;  4DR6 M;  3SHF A;  1PM5 A;  2DXI A;  2JZ1 A;  2K47 A;  3GRV A;  3VFD A;  2H1R A;  4LZZ A;  3MJ5 A;  3AFH A;  2DVW B;  3AV0 A;  4LF9 M;  3ILK A;  2XLJ A;  1G71 A;  4I4L A;  1VEG A;  2RRU A;  3KOX E;  2LHC A;  3VK8 A;  2HCB A;  2DWZ B;  5FTM A;  1IN4 A;  4KOD A;  2L4F A;  2F5S A;  4QNR A;  1CUK A;  3RGP A;  2BWE A;  1V34 A;  1DGH A;  5IT9 S;  1QDR A;  4L16 A;  4LJ7 A;  1NHG C;  1IBK M;  3U60 B;  3KVW A;  1TH4 A;  2Z7J A;  1QAQ A;  3RFW A;  3B89 A;  4BBA A;  3U6C A;  4I5S A;  1Z5B A;  2DWM A;  5EXT A;  4PDI A;  3M6A A;  1MJG M;  2CE7 A;  3HJS A;  3QYE A;  2XFS A;  3GO8 A;  4L8R C;  2OPF A;  3SMP A;  4B7G A;  1ORY B;  2JY8 A;  3H4J A;  1N34 M;  2ZAO A;  5EP3 A;  2EA0 A;  1IN6 A;  2WZJ A;  2C9O A;  1VEK A;  3SBJ A;  3DZD A;  1IY0 A;  2BJV A;  1SXJ A;  3IG8 A;  3R9X B;  1MX0 A;  4AKH A;  1GL7 A;  2R62 A;  1HQY E;  3FTC A;  3AOE A;  5IRE B;  3VLF B;  4G4Q A;  4CHT B;  5KQ8 A;  4OVZ A;  1DGF A;  3SMS A;  5KO3 A;  3U6E A;  1L1T A;  1L8Q A;  2LHG A;  2Q2E B;  3J2P B;  3PNV A;  4ANR A;  4IIW A;  3U61 B;  1N32 M;  3U6M A;  1IN5 A;  2KRU A;  3PFI A;  1V33 A;  3B7Z A;  4QHS A;  1D0M A;  3KP0 E;  3L2A A;  5EJC A;  1IBL M;  1MU5 A;  4IJE A;  1BVS A;  2AHM A;  3M0E A;  5FTK A;  2Y20 A;  4XK8 F;  3T1H M;  3FE3 A;  2CEA A;  1Z5C A;  2OOA A;  4HEO A;  2G8L A;  3K8Z A;  4FD2 A;  1WR1 B;  3GRY A;  3K9P A;  3J27 B;  5JI3 E;  2V6Z M;  1QDT A;  2KNV A;  4AG6 A;  1DGB A;  2MGW A;  2CHQ A;  4B3T M;  3HJQ A;  4YHH M;  4JYA M;  5ITR A;  2H5X A;  5ITU A;  3SYK A;  1PRB A;  3HZJ A;  5BR8 M;  1HT1 E;  4WP2 A;  1HNZ M;  3SAS A;  2UXD M;  5KPR A;  1UFZ A;  3BBZ A;  5EP2 A;  1PJI A;  4FWD A;  4JI7 M;  1XHB A;  5EXX A;  3K92 A;  1KSF X;  1GLN A;  4D81 A;  2JP7 A;  5JI2 E;  2BWB A;  5E6J A;  3GLG E;  3L26 A;  2LXE A;  2C98 A;  2R4J A;  3C9P A;  1TDZ A;  1SG9 A;  1JB0 F;  1I4W A;  1MN3 A;  1OAI A;  2GQF A;  3HU2 A;  5IZ7 D;  2Z8Y M;  1W5T A;  3SAR A;  4AI6 A;  4AW4 A;  1QUS A;  2ZAM A;  4LJ8 A;  5C18 A;  3E46 A;  3Q8G A;  2WSE F;  4DR5 M;  4MB7 A;  2XGN A;  2CV1 A;  1IXR C;  4RKU F;  3GPU A;  2DI0 A;  3OTO M;  2KW0 A;  2MJ5 B;  1A5T A;  4L15 A;  3U6P A;  3C3E A;  3HHZ A;  1HR0 M;  4LF4 M;  2VII A;  2N35 A;  2O5R A;  3SC3 A;  1L2B A;  4MGH A;  5IWA M;  3I51 A;  2LVN C;  4IBB A;  3KFU G;  4FVM A;  1JR3 E;  2DKL A;  1J7K A;  1GJT A;  3D8B A;  2ZAN A;  4FWG A;  2UU9 M;  4G4N A;  2R65 A;  1QZE A;  3ZC7 B;  2DAK A;  3FD9 A;  2QNJ A;  2OO9 A;  1R7R A;  4PDG A;  5FLX S;  1N33 M;  4AZF A;  3ZH9 B;  4NXN M;  2D7H A;  3FUX A;  3KS8 A;  1OTR A;  1DO2 A;  4I81 A;  4G4R A;  1OIZ A;  4LRS A;  1NY6 A;  4LFB M;  2B3T A;  4B7F A;  4M0D A;  3GLH A;  5KPZ A;  2ZM6 M;  3TWK A;  1XNR M;  2A5Y B;  4LJ4 A;  2C5R A;  2LVO C;  1DV0 A;  1JR3 D;  3U5Z B;  1Z6T A;  2KEB A;  4RF0 A;  2NQ8 C;  2R45 A;  4FCV A;  4DR7 M;  3EIE A;  1WJ7 A;  2WSC F;  2ERC A;  3A98 B;  5GKN A;  1PJJ A;  2KHH A;  4XBO A;  3TWL A;  3NWL A;  1WXQ A;  1YSY A;  1VEJ A;  2RKO A;  3GLH E;  1OQY A;  3AL0 C;  2UUC M;  3J7A S;  2R46 A;  2GNO A;  3B7N A;  1Q3C A;  2R0I A;  2APL A;  3W68 A;  3GLG B;  3L29 A;  2LTU A;  1IN8 A;  1TH2 A;  1XWI A;  1Q02 A;  3GRR A;  4CGY B;  2CP8 A;  2MR9 A;  2KDL A;  5DYG A;  1XMO M;  2DAI A;  3DA1 A;  1HNW M;  4DV7 M;  1TR8 A;  1HT2 E;  2HL7 A;  2JZ0 A;  3M7G A;  4GH9 A;  1OAO C;  1K3X A;  3T6P A;  3TL4 X;  2XSZ D;  3GLF B;  1K82 A;  3HKP A;  2V1U A;  4R7G A;  2YNM D;  3ZQJ A;  5LMU M;  2CHG A;  3CGW A;  5FTN A;  3A42 A;  1K3W A;  1PJS A;  2BJW A;  2CUZ A;  4JI6 M;  1QAN A;  5DFL A;  4DR3 M;  4B08 A;  4UN2 B;  3VDP A;  3GQ5 A;  2BNK A;  4DR4 M;  1JQJ C;  3W0F A;  1GJS A;  4JI2 M;  4P17 A;  1G4A E;  4GC9 A;  4CIZ A;  4FCW A;  1N77 A;  1GAB A;  3W0L B;  2VQF M;  2L7I A;  2VDB B;  3VK7 A;  4NRW A;  4MGK E;  3U6D A;  1NNJ A;  4IBI A;  3E9S A;  1IY2 A;  3J80 S;  5H37 D;  1GO5 A;  3FUV A;  3FTE A;  1R4G A;  4LJ9 A;  1Q3B A;  1GL6 A;  4TUW A;  1C1K A;  1T6O A;  1SXJ E;  3QYB A;  3NBI A;  1HJP A;  1TF0 B;  4LJ5 A;  5E26 A;  3A46 A;  4NL4 H;  1IQP A;  3B74 A;  4QOS A;  3SFZ A;  3HU3 A;  4NXM M;  3TQS A;  1KYI A;  1OKS A;  3GLH B;  1PJQ A;  1R2Y A;  1AUA A;  3B9P A;  8CAT A;  3HX3 A;  1Q39 A;  2DEN A;  2FFJ A;  1V92 A;  3C58 A;  2I7P A;  2FH0 A;  4QNM A;  5EP4 A;  1NV8 A;  4G4O A;  1ZAE A;  4JV5 M;  4LGY A;  2Y0Q A;  4L6V 6;  2KNA A;  3RGS A;  2UUB M;  4AKI A;  5EXS A;  1IXS A;  4KT0 F;  2JWS A;  2DNA A;  4JI3 M;  3K1J A;  1SXJ D;  1R5L A;  3SAW A;  3FYC A;  3LCU A;  4LRT A;  1VG5 A;  3SYL A;  1I94 M;  1QYR A;  2K9D A;  1NO1 A;  3F92 A;  3TWM A;  1ZMV A;  4IBG A;  4IBF A;  4M0W A;  1VDL A;  1W5S A;  2JXN A;  2L7H A;  2DHR A;  2DZL A;  2JY7 A;  3PNY A;  4DR1 M;  3FRI A;  4MGY E;  3L28 A;  3WHL A;  3FTF A;  2HHH M;  2O01 F;  1D0L A;  4OW0 A;  1YE9 A;  1TGU A;  2MRO B;  3K2L A;  3LMM A;  4FWH A;  4X66 M;  5ITQ A;  4GHL A;  2C9C A;  2JA2 A;  4FCT A;  1T43 A;  4GC5 A;  2CWB A;  4I8O A;  4B3S M;  2DAE A;  3I4Y A;  4W5W A;  3KOW E;  1DGH B;  2KRK A;  5EQT A;  3UK6 A;  2VF8 A;  2QSF X;  4LJA A;  4REZ A;  2QBY A;  2VF7 A;  3PXG A;  2DAM A;  1QAM A;  4OU7 A;  4LCB A;  1G59 A;  2J5Y A;  2FOI C;  2V1C A;  2EKK A;  3KW6 A;  1OFI A;  2EO2 A;  2Y21 A;  4LZJ A;  1VQ1 A;  4WUR A;  2JNH A;  3HHX A;  1PGY A;  4LG2 A;  4KHP M;  1R6B X;  2J7N A;  4RNA A;  1HNX M;  4OX9 M;  3K9O A;  3SHG B;  4JI5 M;  1DGG A;  3FUT A;  3U60 A;  1N36 M;  4Q7J A;  3KOZ E;  2KNZ A;  4A3V B;  4S12 A;  1SXJ B;  1D0K A;  1E9R A;  4OVZ B;  1F4I A;  3GLI A;  2OQ4 A;  2DAG A;  5ITX A;  1IFY A;  2Z4R A;  2Y0T A;  4R3D A;  3AJI B;  4JI0 M;  3LVV A;  4ITQ A;  3GQ3 A;  1HQC A;  3CF2 A;  4XGI A;  5LMN M;  1OIP A;  3LQR A;  4LGM A;  3JR5 A;  4IBK A;  4NSR A;  2QZ4 A;  2W82 A;  1ZV1 A;  2XH9 A;  3CF6 E;  3MK6 A;  7CAT A;  2F5N A;  4CIS A;  4GKK M;  3GLI E;  2P5T A;  4LF6 M;  5EP1 A;  5ITX E;  2XFT A;  3MMP A;  4G6Z A;  4IBE A;  1QAO A;  2X4A A;  2YQZ A;  4P16 A;  4PCZ A;  1NNU C;  1XB2 B;  1IXZ A;  3V76 A;  2DWL A;  4ZPX A;  1E9S A;  2DZN B;  2LVP C; 
#chains in the Genus database with same CATH homology
 2UXC M;  4QHT A;  4QOZ C;  3UMM A;  4GIP A;  1IXS B;  1G41 A;  2L6O A;  3GPY A;  4IBC A;  4AG5 A;  4MGZ E;  4GMQ A;  3T15 A;  1SXJ C;  5KQD A;  4IBD A;  1G3I A;  3E4R A;  3SAU A;  5FTJ A;  1L2D A;  3AOE C;  1NSF A;  4K0K M;  2KA6 B;  3L25 A;  2LWX A;  4LFA M;  5EXP A;  3UJN A;  3VKG A;  4DV4 M;  4MGI E;  2VQE M;  2CV2 A;  4X64 M;  2XF3 A;  4AKG A;  3J81 S;  2R4E A;  3GQ4 A;  1NJF A;  2UXB M;  4GHA A;  1TH3 A;  2KXE A;  4B3R M;  1NY5 A;  2QBY B;  3T1Y M;  1VDD A;  2FE8 A;  2L09 A;  3D8L A;  3QAU A;  5ITT A;  4BB9 A;  2X49 A;  3L27 A;  1XMQ M;  4II7 A;  2G5G X;  3A45 A;  1XXH A;  1OFH A;  4Z8X A;  3H4M A;  3LQQ A;  1H6U A;  5BPV A;  3IG5 A;  3GP1 A;  3R8F A;  4M9S A;  3DFZ A;  5DYI A;  4JN6 A;  1N75 A;  2C99 A;  4RF1 A;  3MHV C;  3FUU A;  2DWN A;  2F5O A;  3U6Q A;  3HWS A;  2EUC A;  2M5Z A;  3JAM S;  3JR4 A;  2XZF A;  4EIW A;  2CV0 A;  5F3W A;  3FKE A;  1NVM A;  2D7G A;  1E94 E;  3KP1 E;  3DOA A;  1TDH A;  1IY1 A;  2R18 A;  3RE8 A;  3FUW A;  3GLI B;  5C1B A;  3KSX A;  1NJG A;  2M60 A;  4MM3 B;  3CTW B;  5DNY A;  2F5Q A;  4DV5 M;  2KZS A;  2KZU A;  4LF7 M;  1X37 A;  2RGO A;  3TE6 A;  3I4V A;  2D7E A;  5FSW A;  1QVR A;  4PT5 A;  3U6S A;  3ZCB B;  2C96 A;  3HHY A;  3SAT A;  4DV1 M;  4JI4 M;  2UUA M;  2LNH C;  4JI1 M;  1IN7 A;  2X8A A;  4MH0 E;  3GPX A;  3U5Z A;  3GRU A;  3HU1 A;  1Z59 A;  1UM8 A;  4YY3 M;  1E32 A;  4AQY M;  4LJ6 A;  4LF8 M;  3LVW A;  4PD2 A;  2DZO B;  3GLG A;  3BOS A;  3GPP A;  3KSJ A;  2FNA A;  3SAV A;  1L1Z A;  2ZBK B;  5FTL A;  4IBJ A;  4WW0 A;  3EIH A;  5KPT A;  3AKZ A;  1J09 A;  3HGI A;  2Z4S A;  4Z6Y A;  4LY6 A;  4BLC A;  4X62 M;  4DUZ M;  2QPA A;  3VKH A;  3J7B A;  1KFV A;  4KO8 A;  2F5P A;  3GLF A;  1XXH B;  2LH0 A;  3PVS A;  1R2Z A;  4GKJ M;  1IBM M;  1D2N A;  4DV2 M;  4L78 A;  1NHW C;  1S3S A;  3CF0 A;  2E5L M;  2QEN A;  3AOG A;  1GVN A;  1JR3 A;  3UGJ A;  1L2C A;  3KDS E;  4DV6 M;  1QZM A;  3HHW A;  2YFQ A;  4L4U A;  2QCU A;  4LF5 M;  4M9Z A;  4NOO B;  2F4V M;  2QP9 X;  1IM2 A;  1Z5A A;  4GIT A;  4B3M M;  2YR0 A;  2I7N A;  3U6L A;  4DUY M;  5A2Q S;  1XC8 A;  4KLN A;  4HL4 A;  4M9X A;  2J7O A;  4D80 A;  1EE8 A;  2RGH A;  3T38 A;  3VDU A;  3U61 A;  4DV0 M;  1N78 A;  4DR2 M;  3QWL A;  2XZU A;  2CFO A;  3KOY E;  4NSO B;  4LFC M;  1ZQ9 A;  2XEP A;  3HJ8 A;  1DO0 A;  4HLQ A;  1FNN A;  5ITY A;  4IJF A;  1FJG M;  4X65 M;  1XNQ M;  2XSZ A;  3KS4 A;  1T3T A;  1G8P A;  1OJL A;  1J5E M;  1QQW A;  2HKJ A;  4FW9 A;  3U6O A;  3Q8X A;  2CHV A;  3TPZ A;  4GRI A;  4DV3 M;  1GKI A;  3THG A;  4JXJ A;  3FYD A;  4D82 A;  1YUB A;  3WHK A;  1LV7 A;  4JI8 M;  3FTD A;  4NRV A;  3UZU A;  4B7H A;  2Z3X A;  3KXE C;  4DR6 M;  3SHF A;  1PM5 A;  2DXI A;  2K47 A;  3GRV A;  3VFD A;  2H1R A;  4LZZ A;  3MJ5 A;  3AFH A;  2DVW B;  3AV0 A;  4LF9 M;  3ILK A;  2XLJ A;  4I4L A;  3KOX E;  3VK8 A;  2HCB A;  2DWZ B;  5FTM A;  1IN4 A;  4KOD A;  2F5S A;  4QNR A;  3RGP A;  1DGH A;  5IT9 S;  4L16 A;  4LJ7 A;  1NHG C;  1IBK M;  3U60 B;  3KVW A;  1TH4 A;  2Z7J A;  1QAQ A;  3RFW A;  4BBA A;  3U6C A;  4I5S A;  1Z5B A;  2DWM A;  5EXT A;  4PDI A;  3M6A A;  2CE7 A;  3HJS A;  4L8R C;  2XFS A;  3GO8 A;  2OPF A;  3SMP A;  4B7G A;  1ORY B;  1N34 M;  2ZAO A;  5EP3 A;  2EA0 A;  1IN6 A;  2C9O A;  3SBJ A;  3DZD A;  1IY0 A;  2BJV A;  1SXJ A;  3IG8 A;  3R9X B;  1MX0 A;  4AKH A;  1GL7 A;  2R62 A;  1HQY E;  3FTC A;  3AOE A;  5IRE B;  3VLF B;  4G4Q A;  4CHT B;  5KQ8 A;  4OVZ A;  1DGF A;  3SMS A;  5KO3 A;  3U6E A;  1L1T A;  1L8Q A;  3J2P B;  2Q2E B;  3PNV A;  4IIW A;  3U61 B;  1N32 M;  3U6M A;  1IN5 A;  2KRU A;  3PFI A;  4QHS A;  3KP0 E;  3L2A A;  5EJC A;  1IBL M;  1MU5 A;  4IJE A;  2AHM A;  3M0E A;  5FTK A;  2Y20 A;  3T1H M;  2CEA A;  1Z5C A;  2G8L A;  3K8Z A;  4FD2 A;  3GRY A;  3J27 B;  5JI3 E;  2V6Z M;  4AG6 A;  1DGB A;  2CHQ A;  4B3T M;  3HJQ A;  4YHH M;  4JYA M;  5ITR A;  5ITU A;  3SYK A;  5BR8 M;  1HT1 E;  1HNZ M;  3SAS A;  2UXD M;  5KPR A;  5EP2 A;  1PJI A;  4FWD A;  4JI7 M;  1XHB A;  5EXX A;  3K92 A;  1KSF X;  1GLN A;  4D81 A;  5JI2 E;  5E6J A;  3L26 A;  2LXE A;  2C98 A;  2R4J A;  1TDZ A;  1I4W A;  3HU2 A;  5IZ7 D;  4AI6 A;  3SAR A;  1W5T A;  4AW4 A;  2ZAM A;  4LJ8 A;  5C18 A;  4DR5 M;  4MB7 A;  2XGN A;  2CV1 A;  1IXR C;  3GPU A;  3OTO M;  2KW0 A;  4L15 A;  3U6P A;  3HHZ A;  1HR0 M;  4LF4 M;  2VII A;  2O5R A;  3SC3 A;  1L2B A;  4MGH A;  5IWA M;  3I51 A;  4IBB A;  3KFU G;  4FVM A;  1J7K A;  3D8B A;  2ZAN A;  4FWG A;  2UU9 M;  4G4N A;  2R65 A;  3ZC7 B;  3FD9 A;  1R7R A;  4PDG A;  5FLX S;  1N33 M;  4AZF A;  3ZH9 B;  4NXN M;  2D7H A;  3FUX A;  3KS8 A;  1DO2 A;  4I81 A;  4G4R A;  4LRS A;  1NY6 A;  4LFB M;  4B7F A;  4M0D A;  3GLH A;  5KPZ A;  2ZM6 M;  3TWK A;  1XNR M;  2A5Y B;  4LJ4 A;  2C5R A;  1JR3 D;  3U5Z B;  1Z6T A;  2KEB A;  4RF0 A;  2NQ8 C;  2R45 A;  4FCV A;  4DR7 M;  3EIE A;  2ERC A;  3A98 B;  5GKN A;  1PJJ A;  4XBO A;  3TWL A;  3NWL A;  1WXQ A;  1YSY A;  2RKO A;  3AL0 C;  3J7A S;  2UUC M;  2R46 A;  1Q3C A;  3GLG B;  3L29 A;  1IN8 A;  1TH2 A;  1XWI A;  4CGY B;  3GRR A;  5DYG A;  1XMO M;  3DA1 A;  1HNW M;  4DV7 M;  1HT2 E;  2HL7 A;  3M7G A;  4GH9 A;  1K3X A;  3TL4 X;  2XSZ D;  3GLF B;  1K82 A;  3HKP A;  2V1U A;  4R7G A;  2YNM D;  5LMU M;  2CHG A;  5FTN A;  3A42 A;  1K3W A;  2BJW A;  2CUZ A;  4JI6 M;  1QAN A;  4DR3 M;  4B08 A;  3VDP A;  3GQ5 A;  2BNK A;  4DR4 M;  1JQJ C;  3W0F A;  4JI2 M;  1G4A E;  4GC9 A;  4FCW A;  1N77 A;  3W0L B;  2VQF M;  2L7I A;  3VK7 A;  4NRW A;  4MGK E;  3U6D A;  1NNJ A;  4IBI A;  3E9S A;  1IY2 A;  3J80 S;  5H37 D;  3FUV A;  3FTE A;  4LJ9 A;  1Q3B A;  1GL6 A;  4TUW A;  1C1K A;  1SXJ E;  3NBI A;  4LJ5 A;  5E26 A;  3A46 A;  4NL4 H;  1IQP A;  4QOS A;  3SFZ A;  3HU3 A;  4NXM M;  3TQS A;  1KYI A;  3GLH B;  1R2Y A;  3B9P A;  8CAT A;  1Q39 A;  2FFJ A;  3C58 A;  2I7P A;  4QNM A;  5EP4 A;  4G4O A;  1ZAE A;  4JV5 M;  4LGY A;  2Y0Q A;  2UUB M;  3RGS A;  4AKI A;  5EXS A;  4JI3 M;  3K1J A;  1SXJ D;  3SAW A;  3FYC A;  4LRT A;  3SYL A;  1I94 M;  1QYR A;  3TWM A;  4IBG A;  4IBF A;  4M0W A;  1W5S A;  2L7H A;  2DHR A;  3PNY A;  4DR1 M;  4MGY E;  3L28 A;  3WHL A;  3FTF A;  2HHH M;  4OW0 A;  1YE9 A;  1TGU A;  3K2L A;  3LMM A;  4FWH A;  4X66 M;  5ITQ A;  4GHL A;  2C9C A;  2JA2 A;  4FCT A;  4GC5 A;  4I8O A;  4B3S M;  3I4Y A;  4W5W A;  3KOW E;  1DGH B;  2KRK A;  5EQT A;  3UK6 A;  4LJA A;  4REZ A;  2QBY A;  3PXG A;  1QAM A;  4OU7 A;  4LCB A;  1G59 A;  2V1C A;  2FOI C;  3KW6 A;  1OFI A;  2EO2 A;  2Y21 A;  4LZJ A;  4WUR A;  3HHX A;  4LG2 A;  4KHP M;  1R6B X;  2J7N A;  4RNA A;  1HNX M;  4OX9 M;  3SHG B;  4JI5 M;  1DGG A;  3FUT A;  3U60 A;  1N36 M;  3KOZ E;  4A3V B;  4S12 A;  1SXJ B;  1E9R A;  4OVZ B;  3GLI A;  2OQ4 A;  5ITX A;  2Z4R A;  2Y0T A;  4R3D A;  3AJI B;  4JI0 M;  3LVV A;  4ITQ A;  3GQ3 A;  1HQC A;  3CF2 A;  4XGI A;  5LMN M;  3LQR A;  4LGM A;  3JR5 A;  4IBK A;  4NSR A;  2QZ4 A;  2W82 A;  4CIS A;  2XH9 A;  3CF6 E;  3MK6 A;  7CAT A;  2F5N A;  4GKK M;  2P5T A;  4LF6 M;  5EP1 A;  5ITX E;  2XFT A;  4G6Z A;  4IBE A;  1QAO A;  2X4A A;  2YQZ A;  4P16 A;  4PCZ A;  1NNU C;  1IXZ A;  2DWL A;  4ZPX A;  1E9S A;  2DZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...