1N33M

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n33M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n33M02
4B3TM 1HNZM 4DV3M 4G4NA 3SAUA 2HHHM 2F5OA 4DV2M 4LF6M 4DR6M 3U6CA 1TDZA 5FLXS 3GQ5A 2F5PA 4LF4M 3OTOM 4GKJM 2Q2EB 4G4OA 1NNJA 4LF8M 1Z59A 1Z5CA 4PDIA 3GPYA 4AQYM 4JI8M 2F5QA 4PCZA 3SAVA 1XNRM 2OQ4A 4LF9M 4LFCM 4PDGA 2OPFA 3U6QA 1R2YA 4G4RA 5IT9S 1Q3BA 4DV1M 3J7AS 4B3RM 4PD2A 3SARA 4DV7M 1N32M 2UXCM 4X66M 4YHHM 3VK7A 4DR1M 2HKJA 3W0FA 4ITQA 4GKKM 4DV4M 4B3MM 4X62M 5ITXA 1J5EM 3GPXA 3SASA 3SATA 5A2QS 4JI1M 1IBMM 1N34M 3GQ3A 4OX9M 5ITYA 1XMQM 4K0KM 1K3XA 1KFVA 2UXBM 4JI0M 3DOAA 4CISA 3JR4A 2VQFM 1MU5A 3J81S 1PJJA 4LF5M 3T1HM 3GPPA 2F4VM 3U6PA 4NRVA 2VQEM 1Q39A 4JI3M 4JYAM 4JV5M 4NRWA 2E5LM 1FJGM 1I94M 1TDHA 4G4QA 4LF7M 4KHPM 4LFAM 4DUZM 5LMNM 3JR5A 4NXMM 1MX0A 2UUCM 4JI6M 1Z5AA 4B3SM 4DR4M 1HR0M 3C58A 3T1YM 3U6DA 1K3WA 4DR5M 3U6EA 1HNXM 2F5SA 2UU9M 1N33M 3GO8A 3GPUA 1L1TA 2UXDM 2ZBKB 3VK8A 3SBJA 3GQ4A 1PJIA 3JAMS 5ITQA 1L2CA 4X65M 4DR2M 1K82A 5IWAM 4JI4M 1XNQM 2XZFA 3TWKA 4DV6M 2XZUA 3A45A 5ITRA 2ZM6M 2F5NA 3U6OA 2UUBM 5ITUA 4JI5M 3A46A 1Q3CA 4DR7M 3U6MA 4JI7M 1EE8A 3GP1A 1PM5A 3A42A 3J80S 3TWLA 4MB7A 1IBKM 5ITTA 3U6LA 1N36M 4X64M 4YY3M 4DR3M 1XC8A 4JI2M 2EA0A 4DUYM 1IBLM 1L2BA 5BR8M 3U6SA 1XMOM 4LFBM 4NXNM 1HNWM 2UUAM 3TWMA 4DV5M 1R2ZA 1L1ZA 5ITXE 4DV0M 1L2DA 3SAWA 5LMUM 1Z5BA
chains in the Genus database with same CATH superfamily
2C98A 4LJ8A 1HNZM 2DAMA 2HL7A 2ZTCA 3FUUA 2HHHM 2B3TA 3I04M 1OAIA 3C9PA 2NQ8C 2KNVA 3NBXX 1MN3A 1IN8A 1Z6TA 3MK6A 2DZLA 4NOOB 2CRUA 1NNJA 4LF8M 1G3IA 3C3EA 1JR3D 1PGYA 2WSEF 4KLNA 4EIWA 1GL7A 1XNRM 3GLGE 4ZPXA 1QQWA 2OQ4A 2O01F 2Y21A 2FH0A 2JWSA 2ZAMA 2LHGA 4B3RM 3UMMA 1ZQ9A 3VLFB 3SARA 1S3SA 1N32M 1PJSA 1TGUA 1PRBA 4IBKA 2C9OA 3T6PA 4YHHM 4DR1M 2ZTDA 4NC6A 1HQYE 2R6FA 4D82A 3PNVA 4W5WA 1J5EM 3HHWA 5FSWA 2OOBA 3SATA 2L09A 4JI1M 5EP2A 1OAOC 3HZJA 3EIHA 3KP0E 2JY5A 1QAOA 4LRTA 5EP4A 1IN4A 1PJJA 3PFIA 5JI2E 4LF5M 3GPPA 1IM2A 3FUVA 3GLGA 1D0KA 1ZMVA 1Q39A 3EIEA 2EKFA 4NRVA 3U6PA 4JV5M 4Z8XA 2E5LM 2L4EA 2CV0A 3AFHA 1E9SA 4FD2A 1FJGM 1VQ1A 2KDLA 4IIWA 3SMPA 4DUZM 2Z8YM 4NL4H 4ANRA 3HHYA 2Z4RA 4LFCM 3FTCA 2P5TA 4B7FA 1IXSA 3FTDA 3FYDA 1TTEA 2G3QA 3CTWB 2UUCM 4GRIA 1SXJD 1Z5AA 1GABA 2DAGA 4I5SA 3WHKA 3FUTA 2QQ8A 1TH3A 3U6EA 1HNXM 3KOXE 2UU9M 2LBCA 4LJ9A 3ZCBB 2DWLA 1OTRA 1QZEA 2I7PA 4PT5A 5L8RF 3JAMS 2KNZA 5ITQA 4GHAA 2R4EA 4MGHA 3LW5F 1K82A 1UFZA 2CHQA 2A5YB 3K8ZA 4LCBA 3V76A 3TWKA 4IBJA 5ITRA 1R6BX 2R46A 4REZA 2UUBM 3VDPA 3M7GA 4CHTB 5EP3A 1Q3CA 1N78A 4G6ZA 3U6MA 4JI7M 1NY5A 3AV0A 1C1KA 3MMPA 5H37D 3J2PB 4I8OA 3A42A 3J80S 2KRUA 3FUWA 3U5ZB 5ITTA 2JY6B 3KOWE 3T38A 3U6LA 1JQJC 4FWDA 1WIVA 3HHXA 4X64M 4DR3M 3GRRA 4TUWA 3QAUA 4AKHA 1L2BA 4M0WA 4OVZB 1R4GA 1G4AE 2HCBA 2QP9X 4LJAA 4LFBM 1G59A 4KO8A 5E6JA 3HU3A 3QWLA 1R2ZA 1L1ZA 3B7QA 2R44A 3AOEA 4IJFA 2FFJA 3QYBA 3KS4A 4DV3M 4G4NA 3SAUA 3SHFA 1E32A 1FNNA 5DYGA 2L2DA 1N77A 1T3TA 5JI3E 2DWNA 3M0EA 5KQDA 5FLXS 1YSYA 3FRHA 2Z7JA 4LF4M 3AOGA 3OTOM 2Q2EB 2RRUA 4G4OA 1Z5CA 3GPYA 1T43A 2XEPA 3HJSA 1SXJB 1WR1B 4MGIE 1HT2E 4R7GA 1KYIA 3L27A 3ZC7B 5FTJA 2FOIC 1OFIA 3F92A 4Y28F 2BWBA 3T15A 2H1RA 3W0LB 3U6QA 4MGKE 1DGHB 4KT0F 2BJWA 1Q3BA 2KW0A 3J7AS 3E46A 3I4YA 1QUSA 4IBBA 3U61B 4GHLA 1ZV1A 3K1JA 3E21A 3KFUG 2KRKA 3B7ZA 1IY0A 1VEKA 5C1BA 1WHCA 1G41A 2HKJA 1XB2B 3H4MA 4AZFA 1QVRA 5KO3A 3W0FA 2M60A 4IBIA 1P3QQ 4B08A 4DV4M 4B3MM 1L8QA 2CWBA 2LHCA 3R8FA 1LTMA 3H4JA 2V1UA 5EXPA 5A2QS 3GLFB 1YE9A 1IXRC 1N34M 3GQ3A 4OX9M 2F5OA 2FS1A 3L2AA 2XSZA 5IREB 5DFLA 3HX3A 3QYEA 2UXBM 2W82A 1QAMA 4BLCA 1YLAA 4QHTA 3DOAA 1VDDA 7CATA 2CEAA 3GRUA 3JR4A 1R5LA 3KS8A 1Y8GA 1ZMUA 4UN2B 2M5ZA 3T1HM 2MGWA 2KA6B 1QDRA 3UZUA 4JYAM 4JI3M 3GLHE 2ZANA 3MHVC 4LZJA 3PXGA 1IY2A 3LMMA 4D81A 3AOEC 1TDHA 4AKIA 2V1CA 3FRIA 4LFAM 1DGFA 1UM8A 3JR5A 2WZJA 5LMNM 3BXWA 2QBYA 3D8BA 1R7RA 4HEOA 4QNMA 1DV0A 2L7IA 1SG9A 3CGWA 4NXMM 1MX0A 1IN7A 1GO5A 3FYCA 1G71A 1DO2A 3T1YM 1K3WA 1QDTA 4DR5M 5EXSA 4FWGA 3GPUA 4QNRA 1XXHB 2AHMA 3I51A 3UK6A 2CV1A 3U60B 2HAKA 3GQ4A 3THGA 3RGPA 3AJIB 1IQPA 4KODA 4L78A 4X65M 3GLIE 2R4JA 3B9PA 2R62A 4DBGB 3VFDA 3A45A 5FTKA 2L4FA 5ITUA 2DNAA 2EUCA 3KOZE 1NHGC 3GLHA 4AW4A 3A46A 4JI5M 3HJQA 3I01M 2XGNA 4MM3B 5EJCA 3L26A 2C5RA 1QZMA 2L7HA 2Z4SA 4CGYB 4QOSA 3TWLA 1IBKM 4M9SA 3K92A 8CATA 4OVZA 2XH9A 2JP7A 2L6OA 4DUYM 2FE8A 2EO2A 2ERCA 1IBLM 2FNAA 4R3DA 1NY6A 5BR8M 3U6SA 3A98B 3FUXA 3GLFE 1H6UA 5EP1A 2UUAM 1NJFA 4IBDA 2CV2A 3TWMA 2V6ZM 5ITXE 2JXNA 3SAWA 1XC8A 1Z5BA 4LGYA 3TQSA 4B3TM 3FE3A 2LNHC 1WGLA 3LCUA 2GQFA 4F1IA 2N35A 1GJSA 1YUBA 3GRYA 4FCWA 4QHSA 3FKEA 4F2LA 4OU7A 4OW0A 3GLIA 2RGOA 4Q7JA 3GQ5A 1SXJA 4GMQA 3LCVB 1E94E 3PVSA 5BPVA 1OKSA 4GKJM 4WW0A 1GLNA 2JUJA 2MJ5B 1Z59A 2LWXA 4AQYM 5GKNA 1QAQA 4PCZA 5KPRA 1OIZA 4GC9A 4LF9M 4WP2A 2XF3A 2G8LA 1J09A 2DAKA 2H5XA 2ZAOA 4AG5A 2OPFA 1R2YA 3KP1E 3FTFA 4I4LA 3CF2A 5IT9S 2LVOC 1D0LA 2JA2A 3W67A 4MH0E 1A5TA 1I4WA 2I7NA 4PD2A 2APLA 2KZUA 1IN5A 4MGZE 1WJ7A 2YNMD 4DV7M 2UXCM 3VKGA 3W68A 1GJTA 4IBCA 3DZDA 4X66M 2DHYA 3GLFA 3VK7A 2XFSA 4IBFA 3GRVA 1XXHE 2CUZA 3KVWA 4ITQA 4GKKM 5ITXA 4L16A 3GPXA 5IZ7D 2DHRA 2K9DA 3HHZA 5EXXA 1CUKA 3K9PA 1IN6A 3K9OA 4MGYE 1IBMM 4QOZC 2JY8A 2WSFF 1C7YA 2D7HA 3FD9A 3E9SA 1XMQM 1IXSB 2BNKA 4D80A 3B74A 3HJ8A 4LJ5A 1K3XA 1KFVA 3R9XB 1BVSA 4CISA 1DGBA 1IY1A 2VQFM 2OO9A 1XWIA 4L4UA 3SHGB 1MU5A 1ORYB 3DA1A 1Q02A 1VG5A 2F4VM 2DXIA 4GITA 4LJ7A 3ZH9B 3AKZA 1I94M 3MJ5A 4I81A 3KSJA 1JR3E 4G4QA 4FW9A 2R45A 3BOSA 4KHPM 4LG2A 5EQTA 2VDBB 4RNAA 1N75A 2HWJA 2LTUA 4B7GA 1SXJC 2R18A 5DNYA 1DO0A 4M9ZA 2LVQD 3RFWA 4CIZA 4RKUF 1XXHA 4FCTA 3AL0C 2DAEA 4B3SM 4DR4M 1HR0M 2MR9A 1OIPA 3C58A 3U60A 1DGGA 3U6DA 1KSFX 2QPAA 2XSZD 3J27B 1N33M 3GO8A 2OOAA 2X8AA 1L1TA 2UXDM 2ZBKB 1TR8A 2VIIA 1D0MA 1LV7A 1NSFA 1NV9A 2BJVA 2QHOB 3NWLA 5FTNA 2R65A 1V34A 4DR2M 1EFUB 1XNQM 2QENA 2XZFA 1NJGA 3TPZA 4DV6M 5FTLA 2ZM6M 2F5NA 3U6OA 3SYLA 2K0BX 2DWMA 2DI0A 3HU1A 4DR7M 4A3VB 2O5RA 1V33A 2O25A 4GEWA 4IBEA 3GP1A 2YQZA 1W5TA 2KHHA 3KDSE 2LXEA 1JR3A 1OJLA 2QCUA 5FTMA 3TE6A 3KSXA 2XLJA 5KQ8A 3B89A 4GH9A 4LZZA 4Z6YA 2LVPC 2XFTA 4XBOA 1N36M 2MH8A 2YFQA 2DZNB 2EJSA 3IHPA 2G5GX 2LVNC 4FWHA 3ILKA 5KPZA 2CE7A 4NXNM 1D2NA 2RGHA 1HNWM 5C18A 1JB0F 4NSOB 3FTEA 4LJ4A 2Z3XA 1L2DA 1GL6A 2X4AA 4LY6A 1OFHA 1SXJE 2C96A 2JZ0A 2J7OA 3SMSA 2C99A 2WSCF 4JN6A 4DV2M 4LF6M 4DR6M 3U5ZA 3U6CA 1TDZA 1F4IA 3CF6E 3KXEC 2J7NA 4P17A 4M9XA 2F5PA 3J7BA 2C9CA 1NO1A 4WURA 4BBAA 4PDIA 4JI8M 3KOYE 2F5QA 1TF0B 3SAVA 3NBIA 2BWEA 4PDGA 2CFOA 3HU2A 1HJPA 4CJ6A 4G4RA 2KZSA 3Q8XA 1T6OA 3LVVA 4DV1M 5EXTA 1TH4A 1QYRA 1J7KA 1ZAEA 4G3OA 5KPTA 3L29A 4HLQA 3DFZA 2KXEA 3HWSA 2MROB 2GNOA 3SC3A 5DYIA 4LJ6A 3KW6A 3C3DA 3ZQJA 3L25A 2X49A 4X62M 3B7NA 2K47A 3M6AA 1RU3A 3SASA 2Y0QA 1X37A 2LVAA 3RE8A 1GVNA 1VEGA 3K2LA 2J5YA 2K6BA 2QBYB 1ZMWA 2CHVA 5ITYA 1E9RA 3SYKA 4K0KM 1DGHA 1XHBA 4JI0M 2KNAA 2EKKA 2LH0A 3SFZA 1IFYA 2R0IA 1MJGM 3PNYA 1AIPC 3LVWA 1PJTA 3U61A 1NNUC 3J81S 4II7A 3CF0A 3HY5A 4P16A 2RKOA 4FCVA 1PJQA 3BBZA 2VQEM 4AI6A 4NRWA 1NV8A 2CHGA 4JXJA 4IBGA 4GC5A 3HKPA 5E26A 2QZ4A 4FVMA 4RF1A 3GLGB 2DZOB 4LF7M 2D7GA 4XK8F 4GIPA 1HQCA 1VEJA 3LQRA 1G8PA 3VKHA 3Q8GA 1QANA 3GLHB 1QUTA 2YR0A 4HL4A 1NHWC 3IG5A 4JI6M 2JNHA 1NVMA 2Y0TA 2DKLA 4B7HA 1V92A 2F5SA 4M0DA 4L8RC 3IG8A 3VK8A 3SBJA 3TL4X 1WGNA 2DENA 4LRSA 2QSFX 1AUAA 1PJIA 3E4RA 4AG6A 1L2CA 4AKGA 4L6V6 2Y20A 4XGIA 5IWAM 4JI4M 4S12A 4RF0A 2XZUA 1EIJA 4NSRA 2VF8A 1GKIA 2DVWB 2QNJA 3L28A 1IXZA 4IJEA 1EE8A 1PM5A 4R71A 4MB7A 4L15A 3WHLA 3GLIB 4LGMA 3UGJA 3IECA 4YY3M 3HGIA 4JI2M 1OQYA 1VDLA 3RGSA 2EA0A 3I4VA 4BB9A 2JZ1A 5F3WA 1HT1E 3UJNA 2VF7A 2CP8A 3LQQA 1XMOM 2DWZB 3VDUA 1TH2A 1W5SA 2KEBA 2JY7A 4DV5M 2D7EA 1WXQA 3D8LA 4DV0M 2DAIA 5LMUM
chains in the Genus database with same CATH topology
2C98A 4LJ8A 1HNZM 2HL7A 3FUUA 2HHHM 2NQ8C 1IN8A 1Z6TA 3MK6A 4NOOB 1NNJA 4LF8M 1G3IA 1JR3D 4KLNA 4EIWA 1GL7A 1XNRM 4ZPXA 1QQWA 2OQ4A 2Y21A 2ZAMA 4B3RM 3UMMA 1ZQ9A 3VLFB 3SARA 1S3SA 1N32M 1TGUA 4YHHM 4IBKA 2C9OA 4DR1M 1HQYE 4D82A 3PNVA 4W5WA 1J5EM 3HHWA 5FSWA 3SATA 2L09A 4JI1M 5EP2A 3EIHA 3KP0E 1QAOA 4LRTA 5EP4A 1IN4A 1PJJA 3PFIA 5JI2E 4LF5M 3GPPA 1IM2A 3FUVA 3GLGA 3EIEA 4NRVA 1Q39A 3U6PA 4JV5M 4Z8XA 2E5LM 2CV0A 3AFHA 1E9SA 4FD2A 1FJGM 4IIWA 3SMPA 4DUZM 4NL4H 3HHYA 2Z4RA 3FTCA 2P5TA 4B7FA 3FTDA 3FYDA 3CTWB 2UUCM 4GRIA 1SXJD 1Z5AA 4I5SA 3WHKA 3FUTA 3U6EA 1TH3A 1HNXM 2UU9M 3KOXE 4LJ9A 3ZCBB 2DWLA 2I7PA 4PT5A 3JAMS 4GHAA 5ITQA 2R4EA 4MGHA 1K82A 2CHQA 3K8ZA 2A5YB 4LCBA 3TWKA 4IBJA 5ITRA 1R6BX 2R46A 4REZA 2UUBM 3VDPA 3M7GA 4CHTB 5EP3A 1Q3CA 1N78A 4G6ZA 3U6MA 4JI7M 1NY5A 3AV0A 1C1KA 5H37D 3J2PB 4I8OA 3A42A 3J80S 2KRUA 3FUWA 3U5ZB 5ITTA 3KOWE 3T38A 3U6LA 1JQJC 4FWDA 3HHXA 4X64M 4DR3M 3GRRA 4TUWA 3QAUA 4AKHA 1L2BA 4M0WA 4OVZB 1G4AE 2HCBA 2QP9X 4LJAA 4LFBM 1G59A 4KO8A 5E6JA 3HU3A 3QWLA 1R2ZA 1L1ZA 3AOEA 4IJFA 2FFJA 3KS4A 4DV3M 4G4NA 3SAUA 3SHFA 1E32A 1FNNA 5DYGA 1N77A 2F5OA 1T3TA 5JI3E 2DWNA 3M0EA 5KQDA 5FLXS 1YSYA 2Z7JA 4LF4M 3AOGA 3OTOM 2Q2EB 4G4OA 1Z5CA 3GPYA 2XEPA 3HJSA 1SXJB 4MGIE 1HT2E 4R7GA 1KYIA 3L27A 3ZC7B 5FTJA 2FOIC 1OFIA 3T15A 3W0LB 2H1RA 3U6QA 4MGKE 1DGHB 2BJWA 1Q3BA 2KW0A 3J7AS 3I4YA 4IBBA 3U61B 4GHLA 3K1JA 3KFUG 2KRKA 1IY0A 5C1BA 1G41A 2HKJA 3H4MA 4AZFA 5KO3A 1QVRA 3W0FA 2M60A 4IBIA 4B08A 4DV4M 4B3MM 1L8QA 3R8FA 2V1UA 5EXPA 5A2QS 3GLFB 1YE9A 1IXRC 1N34M 3GQ3A 4OX9M 3L2AA 2XSZA 5IREB 2UXBM 2W82A 1QAMA 4BLCA 4QHTA 3DOAA 1VDDA 7CATA 2CEAA 3GRUA 3JR4A 3KS8A 2M5ZA 3T1HM 2KA6B 3UZUA 4JYAM 4JI3M 4LZJA 2ZANA 3MHVC 3PXGA 1IY2A 3LMMA 4D81A 3AOEC 1TDHA 4AKIA 2V1CA 4LFAM 1DGFA 1UM8A 3JR5A 5LMNM 2QBYA 3D8BA 1R7RA 4QNMA 2L7IA 4NXMM 1MX0A 1IN7A 3FYCA 1DO2A 3T1YM 1K3WA 4DR5M 5EXSA 4FWGA 3GPUA 4QNRA 1XXHB 2AHMA 3I51A 3UK6A 2CV1A 3U60B 3GQ4A 3THGA 3RGPA 3AJIB 1IQPA 4KODA 4L78A 4X65M 2R4JA 3B9PA 2R62A 3VFDA 3A45A 5FTKA 5ITUA 3KOZE 2EUCA 3A46A 1NHGC 3GLHA 4AW4A 4JI5M 3HJQA 4MM3B 2XGNA 5EJCA 3L26A 2C5RA 1QZMA 2L7HA 2Z4SA 4CGYB 4QOSA 3TWLA 1IBKM 4M9SA 3K92A 8CATA 4OVZA 2XH9A 2L6OA 4DUYM 2FE8A 2EO2A 2ERCA 1IBLM 2FNAA 4R3DA 1NY6A 5BR8M 3U6SA 3A98B 3FUXA 1H6UA 5EP1A 2UUAM 1NJFA 4IBDA 2CV2A 3TWMA 2V6ZM 5ITXE 3SAWA 1XC8A 1Z5BA 4LGYA 3TQSA 4B3TM 2LNHC 1YUBA 3GRYA 4FCWA 4QHSA 3FKEA 4OU7A 4OW0A 3GLIA 2RGOA 3GQ5A 1SXJA 4GMQA 1E94E 3PVSA 5BPVA 4GKJM 4WW0A 1GLNA 1Z59A 2LWXA 4AQYM 5GKNA 1QAQA 4PCZA 5KPRA 4GC9A 4LF9M 4LFCM 2XF3A 2G8LA 1J09A 2ZAOA 4AG5A 2OPFA 3FTFA 1R2YA 3KP1E 4I4LA 3CF2A 5IT9S 2JA2A 4MH0E 1I4WA 2I7NA 4PD2A 2KZUA 1IN5A 4MGZE 2YNMD 4DV7M 2UXCM 3VKGA 4IBCA 3DZDA 4X66M 3GLFA 3VK7A 2XFSA 4IBFA 3GRVA 2CUZA 3KVWA 4ITQA 4GKKM 5ITXA 4L16A 3GPXA 5IZ7D 2DHRA 3HHZA 5EXXA 1IN6A 4MGYE 1IBMM 4QOZC 2D7HA 3FD9A 3E9SA 1XMQM 1IXSB 2BNKA 4D80A 3HJ8A 4LJ5A 1K3XA 1KFVA 3R9XB 4CISA 1DGBA 1IY1A 2VQFM 1XWIA 4L4UA 3SHGB 1MU5A 1ORYB 3DA1A 2F4VM 2DXIA 4GITA 4LJ7A 3ZH9B 3AKZA 1I94M 3MJ5A 4I81A 3KSJA 4G4QA 4FW9A 2R45A 3BOSA 4KHPM 4LG2A 5EQTA 4RNAA 1N75A 4B7GA 1SXJC 2R18A 5DNYA 1DO0A 4M9ZA 3RFWA 3AL0C 1XXHA 4FCTA 4B3SM 4DR4M 1HR0M 3C58A 3U60A 1DGGA 3U6DA 1KSFX 2QPAA 2XSZD 3J27B 1N33M 3GO8A 2X8AA 1L1TA 2UXDM 2ZBKB 2VIIA 1LV7A 1NSFA 2BJVA 3NWLA 5FTNA 2R65A 4DR2M 1XNQM 2QENA 2XZFA 1NJGA 3TPZA 4DV6M 5FTLA 2ZM6M 2F5NA 3U6OA 3SYLA 2DWMA 3HU1A 4DR7M 4A3VB 2O5RA 4IBEA 3GP1A 2YQZA 1W5TA 3KDSE 5FTMA 2LXEA 1JR3A 1OJLA 2QCUA 3TE6A 3KSXA 2XLJA 5KQ8A 4GH9A 4LZZA 4Z6YA 4XBOA 2XFTA 1N36M 2YFQA 2DZNB 2G5GX 4FWHA 3ILKA 5KPZA 2CE7A 4NXNM 1D2NA 2RGHA 1HNWM 5C18A 4NSOB 3FTEA 4LJ4A 2Z3XA 1L2DA 2X4AA 1GL6A 4LY6A 1OFHA 1SXJE 2C96A 2J7OA 3SMSA 2C99A 4DV2M 4JN6A 4LF6M 4DR6M 3U5ZA 3U6CA 1TDZA 3CF6E 3KXEC 2J7NA 4M9XA 2F5PA 3J7BA 2C9CA 4WURA 4BBAA 4PDIA 4JI8M 3KOYE 2F5QA 3SAVA 3NBIA 4PDGA 2CFOA 3HU2A 4G4RA 2KZSA 3Q8XA 3LVVA 4DV1M 5EXTA 1TH4A 1QYRA 1J7KA 1ZAEA 5KPTA 3L29A 4HLQA 3DFZA 2KXEA 3HWSA 3SC3A 5DYIA 4LJ6A 3KW6A 3L25A 2X49A 4X62M 2K47A 3M6AA 3SASA 2Y0QA 1X37A 3RE8A 1GVNA 3K2LA 2QBYB 2CHVA 5ITYA 1E9RA 3SYKA 4K0KM 1DGHA 1XHBA 4JI0M 2LH0A 3SFZA 3PNYA 3LVWA 3U61A 1NNUC 3J81S 4II7A 3CF0A 4P16A 2RKOA 4FCVA 2VQEM 4AI6A 4NRWA 2CHGA 4JXJA 4IBGA 4GC5A 3HKPA 5E26A 2QZ4A 4FVMA 4RF1A 3GLGB 2DZOB 4LF7M 2D7GA 4GIPA 1HQCA 1G8PA 3VKHA 1QANA 3GLHB 2YR0A 4HL4A 1NHWC 3IG5A 4JI6M 1NVMA 2Y0TA 4B7HA 2F5SA 4M0DA 4L8RC 3IG8A 3VK8A 3SBJA 3TL4X 4LRSA 1PJIA 3E4RA 4AG6A 1L2CA 4AKGA 2Y20A 4XGIA 5IWAM 4JI4M 4S12A 4RF0A 2XZUA 4NSRA 1GKIA 2DVWB 3L28A 1IXZA 4IJEA 1EE8A 1PM5A 4MB7A 4L15A 3WHLA 3GLIB 4LGMA 3UGJA 4YY3M 3HGIA 4JI2M 3RGSA 2EA0A 3I4VA 4BB9A 5F3WA 1HT1E 3UJNA 3LQQA 1XMOM 2DWZB 3VDUA 1TH2A 1W5SA 2KEBA 4DV5M 2D7EA 1WXQA 3D8LA 4DV0M 3LQRA 5LMUM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T M;  1HNZ M;  4DV3 M;  4G4N A;  3SAU A;  2HHH M;  2F5O A;  4DV2 M;  4LF6 M;  4DR6 M;  3U6C A;  1TDZ A;  5FLX S;  3GQ5 A;  2F5P A;  4LF4 M;  3OTO M;  4GKJ M;  2Q2E B;  4G4O A;  1NNJ A;  4LF8 M;  1Z59 A;  1Z5C A;  4PDI A;  3GPY A;  4AQY M;  4JI8 M;  2F5Q A;  4PCZ A;  3SAV A;  1XNR M;  2OQ4 A;  4LF9 M;  4LFC M;  4PDG A;  2OPF A;  3U6Q A;  1R2Y A;  4G4R A;  5IT9 S;  1Q3B A;  4DV1 M;  3J7A S;  4B3R M;  4PD2 A;  3SAR A;  4DV7 M;  1N32 M;  2UXC M;  4X66 M;  4YHH M;  3VK7 A;  4DR1 M;  2HKJ A;  3W0F A;  4ITQ A;  4GKK M;  4DV4 M;  4B3M M;  4X62 M;  5ITX A;  1J5E M;  3GPX A;  3SAS A;  3SAT A;  5A2Q S;  4JI1 M;  1IBM M;  1N34 M;  3GQ3 A;  4OX9 M;  5ITY A;  1XMQ M;  4K0K M;  1K3X A;  1KFV A;  2UXB M;  4JI0 M;  3DOA A;  4CIS A;  3JR4 A;  2VQF M;  1MU5 A;  3J81 S;  1PJJ A;  4LF5 M;  3T1H M;  3GPP A;  2F4V M;  3U6P A;  4NRV A;  2VQE M;  1Q39 A;  4JI3 M;  4JYA M;  4JV5 M;  4NRW A;  2E5L M;  1FJG M;  1I94 M;  1TDH A;  4G4Q A;  4LF7 M;  4KHP M;  4LFA M;  4DUZ M;  5LMN M;  3JR5 A;  4NXM M;  1MX0 A;  2UUC M;  4JI6 M;  1Z5A A;  4B3S M;  4DR4 M;  1HR0 M;  3C58 A;  3T1Y M;  3U6D A;  1K3W A;  4DR5 M;  3U6E A;  1HNX M;  2F5S A;  2UU9 M;  1N33 M;  3GO8 A;  3GPU A;  1L1T A;  2UXD M;  2ZBK B;  3VK8 A;  3SBJ A;  3GQ4 A;  1PJI A;  3JAM S;  5ITQ A;  1L2C A;  4X65 M;  4DR2 M;  1K82 A;  5IWA M;  4JI4 M;  1XNQ M;  2XZF A;  3TWK A;  4DV6 M;  2XZU A;  3A45 A;  5ITR A;  2ZM6 M;  2F5N A;  3U6O A;  2UUB M;  5ITU A;  4JI5 M;  3A46 A;  1Q3C A;  4DR7 M;  3U6M A;  4JI7 M;  1EE8 A;  3GP1 A;  1PM5 A;  3A42 A;  3J80 S;  3TWL A;  4MB7 A;  1IBK M;  5ITT A;  3U6L A;  1N36 M;  4X64 M;  4YY3 M;  4DR3 M;  1XC8 A;  4JI2 M;  2EA0 A;  4DUY M;  1IBL M;  1L2B A;  5BR8 M;  3U6S A;  1XMO M;  4LFB M;  4NXN M;  1HNW M;  2UUA M;  3TWM A;  4DV5 M;  1R2Z A;  1L1Z A;  5ITX E;  4DV0 M;  1L2D A;  3SAW A;  5LMU M;  1Z5B A; 
#chains in the Genus database with same CATH topology
 2C98 A;  4LJ8 A;  1HNZ M;  2DAM A;  2HL7 A;  2ZTC A;  3FUU A;  2HHH M;  2B3T A;  3I04 M;  1OAI A;  3C9P A;  2NQ8 C;  2KNV A;  3NBX X;  1MN3 A;  1IN8 A;  1Z6T A;  3MK6 A;  2DZL A;  4NOO B;  2CRU A;  1NNJ A;  4LF8 M;  1G3I A;  3C3E A;  1JR3 D;  1PGY A;  2WSE F;  4KLN A;  4EIW A;  1GL7 A;  1XNR M;  3GLG E;  4ZPX A;  1QQW A;  2OQ4 A;  2O01 F;  2Y21 A;  2FH0 A;  2JWS A;  2ZAM A;  2LHG A;  4B3R M;  3UMM A;  1ZQ9 A;  3VLF B;  3SAR A;  1S3S A;  1N32 M;  1PJS A;  1TGU A;  1PRB A;  4IBK A;  2C9O A;  3T6P A;  4YHH M;  4DR1 M;  2ZTD A;  4NC6 A;  1HQY E;  2R6F A;  4D82 A;  3PNV A;  4W5W A;  1J5E M;  3HHW A;  5FSW A;  2OOB A;  3SAT A;  2L09 A;  4JI1 M;  5EP2 A;  1OAO C;  3HZJ A;  3EIH A;  3KP0 E;  2JY5 A;  1QAO A;  4LRT A;  5EP4 A;  1IN4 A;  1PJJ A;  3PFI A;  5JI2 E;  4LF5 M;  3GPP A;  1IM2 A;  3FUV A;  3GLG A;  1D0K A;  1ZMV A;  1Q39 A;  3EIE A;  2EKF A;  4NRV A;  3U6P A;  4JV5 M;  4Z8X A;  2E5L M;  2L4E A;  2CV0 A;  3AFH A;  1E9S A;  4FD2 A;  1FJG M;  1VQ1 A;  2KDL A;  4IIW A;  3SMP A;  4DUZ M;  2Z8Y M;  4NL4 H;  4ANR A;  3HHY A;  2Z4R A;  4LFC M;  3FTC A;  2P5T A;  4B7F A;  1IXS A;  3FTD A;  3FYD A;  1TTE A;  2G3Q A;  3CTW B;  2UUC M;  4GRI A;  1SXJ D;  1Z5A A;  1GAB A;  2DAG A;  4I5S A;  3WHK A;  3FUT A;  2QQ8 A;  1TH3 A;  3U6E A;  1HNX M;  3KOX E;  2UU9 M;  2LBC A;  4LJ9 A;  3ZCB B;  2DWL A;  1OTR A;  1QZE A;  2I7P A;  4PT5 A;  5L8R F;  3JAM S;  2KNZ A;  5ITQ A;  4GHA A;  2R4E A;  4MGH A;  3LW5 F;  1K82 A;  1UFZ A;  2CHQ A;  2A5Y B;  3K8Z A;  4LCB A;  3V76 A;  3TWK A;  4IBJ A;  5ITR A;  1R6B X;  2R46 A;  4REZ A;  2UUB M;  3VDP A;  3M7G A;  4CHT B;  5EP3 A;  1Q3C A;  1N78 A;  4G6Z A;  3U6M A;  4JI7 M;  1NY5 A;  3AV0 A;  1C1K A;  3MMP A;  5H37 D;  3J2P B;  4I8O A;  3A42 A;  3J80 S;  2KRU A;  3FUW A;  3U5Z B;  5ITT A;  2JY6 B;  3KOW E;  3T38 A;  3U6L A;  1JQJ C;  4FWD A;  1WIV A;  3HHX A;  4X64 M;  4DR3 M;  3GRR A;  4TUW A;  3QAU A;  4AKH A;  1L2B A;  4M0W A;  4OVZ B;  1R4G A;  1G4A E;  2HCB A;  2QP9 X;  4LJA A;  4LFB M;  1G59 A;  4KO8 A;  5E6J A;  3HU3 A;  3QWL A;  1R2Z A;  1L1Z A;  3B7Q A;  2R44 A;  3AOE A;  4IJF A;  2FFJ A;  3QYB A;  3KS4 A;  4DV3 M;  4G4N A;  3SAU A;  3SHF A;  1E32 A;  1FNN A;  5DYG A;  2L2D A;  1N77 A;  1T3T A;  5JI3 E;  2DWN A;  3M0E A;  5KQD A;  5FLX S;  1YSY A;  3FRH A;  2Z7J A;  4LF4 M;  3AOG A;  3OTO M;  2Q2E B;  2RRU A;  4G4O A;  1Z5C A;  3GPY A;  1T43 A;  2XEP A;  3HJS A;  1SXJ B;  1WR1 B;  4MGI E;  1HT2 E;  4R7G A;  1KYI A;  3L27 A;  3ZC7 B;  5FTJ A;  2FOI C;  1OFI A;  3F92 A;  4Y28 F;  2BWB A;  3T15 A;  2H1R A;  3W0L B;  3U6Q A;  4MGK E;  1DGH B;  4KT0 F;  2BJW A;  1Q3B A;  2KW0 A;  3J7A S;  3E46 A;  3I4Y A;  1QUS A;  4IBB A;  3U61 B;  4GHL A;  1ZV1 A;  3K1J A;  3E21 A;  3KFU G;  2KRK A;  3B7Z A;  1IY0 A;  1VEK A;  5C1B A;  1WHC A;  1G41 A;  2HKJ A;  1XB2 B;  3H4M A;  4AZF A;  1QVR A;  5KO3 A;  3W0F A;  2M60 A;  4IBI A;  1P3Q Q;  4B08 A;  4DV4 M;  4B3M M;  1L8Q A;  2CWB A;  2LHC A;  3R8F A;  1LTM A;  3H4J A;  2V1U A;  5EXP A;  5A2Q S;  3GLF B;  1YE9 A;  1IXR C;  1N34 M;  3GQ3 A;  4OX9 M;  2F5O A;  2FS1 A;  3L2A A;  2XSZ A;  5IRE B;  5DFL A;  3HX3 A;  3QYE A;  2UXB M;  2W82 A;  1QAM A;  4BLC A;  1YLA A;  4QHT A;  3DOA A;  1VDD A;  7CAT A;  2CEA A;  3GRU A;  3JR4 A;  1R5L A;  3KS8 A;  1Y8G A;  1ZMU A;  4UN2 B;  2M5Z A;  3T1H M;  2MGW A;  2KA6 B;  1QDR A;  3UZU A;  4JYA M;  4JI3 M;  3GLH E;  2ZAN A;  3MHV C;  4LZJ A;  3PXG A;  1IY2 A;  3LMM A;  4D81 A;  3AOE C;  1TDH A;  4AKI A;  2V1C A;  3FRI A;  4LFA M;  1DGF A;  1UM8 A;  3JR5 A;  2WZJ A;  5LMN M;  3BXW A;  2QBY A;  3D8B A;  1R7R A;  4HEO A;  4QNM A;  1DV0 A;  2L7I A;  1SG9 A;  3CGW A;  4NXM M;  1MX0 A;  1IN7 A;  1GO5 A;  3FYC A;  1G71 A;  1DO2 A;  3T1Y M;  1K3W A;  1QDT A;  4DR5 M;  5EXS A;  4FWG A;  3GPU A;  4QNR A;  1XXH B;  2AHM A;  3I51 A;  3UK6 A;  2CV1 A;  3U60 B;  2HAK A;  3GQ4 A;  3THG A;  3RGP A;  3AJI B;  1IQP A;  4KOD A;  4L78 A;  4X65 M;  3GLI E;  2R4J A;  3B9P A;  2R62 A;  4DBG B;  3VFD A;  3A45 A;  5FTK A;  2L4F A;  5ITU A;  2DNA A;  2EUC A;  3KOZ E;  1NHG C;  3GLH A;  4AW4 A;  3A46 A;  4JI5 M;  3HJQ A;  3I01 M;  2XGN A;  4MM3 B;  5EJC A;  3L26 A;  2C5R A;  1QZM A;  2L7H A;  2Z4S A;  4CGY B;  4QOS A;  3TWL A;  1IBK M;  4M9S A;  3K92 A;  8CAT A;  4OVZ A;  2XH9 A;  2JP7 A;  2L6O A;  4DUY M;  2FE8 A;  2EO2 A;  2ERC A;  1IBL M;  2FNA A;  4R3D A;  1NY6 A;  5BR8 M;  3U6S A;  3A98 B;  3FUX A;  3GLF E;  1H6U A;  5EP1 A;  2UUA M;  1NJF A;  4IBD A;  2CV2 A;  3TWM A;  2V6Z M;  5ITX E;  2JXN A;  3SAW A;  1XC8 A;  1Z5B A;  4LGY A;  3TQS A;  4B3T M;  3FE3 A;  2LNH C;  1WGL A;  3LCU A;  2GQF A;  4F1I A;  2N35 A;  1GJS A;  1YUB A;  3GRY A;  4FCW A;  4QHS A;  3FKE A;  4F2L A;  4OU7 A;  4OW0 A;  3GLI A;  2RGO A;  4Q7J A;  3GQ5 A;  1SXJ A;  4GMQ A;  3LCV B;  1E94 E;  3PVS A;  5BPV A;  1OKS A;  4GKJ M;  4WW0 A;  1GLN A;  2JUJ A;  2MJ5 B;  1Z59 A;  2LWX A;  4AQY M;  5GKN A;  1QAQ A;  4PCZ A;  5KPR A;  1OIZ A;  4GC9 A;  4LF9 M;  4WP2 A;  2XF3 A;  2G8L A;  1J09 A;  2DAK A;  2H5X A;  2ZAO A;  4AG5 A;  2OPF A;  1R2Y A;  3KP1 E;  3FTF A;  4I4L A;  3CF2 A;  5IT9 S;  2LVO C;  1D0L A;  2JA2 A;  3W67 A;  4MH0 E;  1A5T A;  1I4W A;  2I7N A;  4PD2 A;  2APL A;  2KZU A;  1IN5 A;  4MGZ E;  1WJ7 A;  2YNM D;  4DV7 M;  2UXC M;  3VKG A;  3W68 A;  1GJT A;  4IBC A;  3DZD A;  4X66 M;  2DHY A;  3GLF A;  3VK7 A;  2XFS A;  4IBF A;  3GRV A;  1XXH E;  2CUZ A;  3KVW A;  4ITQ A;  4GKK M;  5ITX A;  4L16 A;  3GPX A;  5IZ7 D;  2DHR A;  2K9D A;  3HHZ A;  5EXX A;  1CUK A;  3K9P A;  1IN6 A;  3K9O A;  4MGY E;  1IBM M;  4QOZ C;  2JY8 A;  2WSF F;  1C7Y A;  2D7H A;  3FD9 A;  3E9S A;  1XMQ M;  1IXS B;  2BNK A;  4D80 A;  3B74 A;  3HJ8 A;  4LJ5 A;  1K3X A;  1KFV A;  3R9X B;  1BVS A;  4CIS A;  1DGB A;  1IY1 A;  2VQF M;  2OO9 A;  1XWI A;  4L4U A;  3SHG B;  1MU5 A;  1ORY B;  3DA1 A;  1Q02 A;  1VG5 A;  2F4V M;  2DXI A;  4GIT A;  4LJ7 A;  3ZH9 B;  3AKZ A;  1I94 M;  3MJ5 A;  4I81 A;  3KSJ A;  1JR3 E;  4G4Q A;  4FW9 A;  2R45 A;  3BOS A;  4KHP M;  4LG2 A;  5EQT A;  2VDB B;  4RNA A;  1N75 A;  2HWJ A;  2LTU A;  4B7G A;  1SXJ C;  2R18 A;  5DNY A;  1DO0 A;  4M9Z A;  2LVQ D;  3RFW A;  4CIZ A;  4RKU F;  1XXH A;  4FCT A;  3AL0 C;  2DAE A;  4B3S M;  4DR4 M;  1HR0 M;  2MR9 A;  1OIP A;  3C58 A;  3U60 A;  1DGG A;  3U6D A;  1KSF X;  2QPA A;  2XSZ D;  3J27 B;  1N33 M;  3GO8 A;  2OOA A;  2X8A A;  1L1T A;  2UXD M;  2ZBK B;  1TR8 A;  2VII A;  1D0M A;  1LV7 A;  1NSF A;  1NV9 A;  2BJV A;  2QHO B;  3NWL A;  5FTN A;  2R65 A;  1V34 A;  4DR2 M;  1EFU B;  1XNQ M;  2QEN A;  2XZF A;  1NJG A;  3TPZ A;  4DV6 M;  5FTL A;  2ZM6 M;  2F5N A;  3U6O A;  3SYL A;  2K0B X;  2DWM A;  2DI0 A;  3HU1 A;  4DR7 M;  4A3V B;  2O5R A;  1V33 A;  2O25 A;  4GEW A;  4IBE A;  3GP1 A;  2YQZ A;  1W5T A;  2KHH A;  3KDS E;  2LXE A;  1JR3 A;  1OJL A;  2QCU A;  5FTM A;  3TE6 A;  3KSX A;  2XLJ A;  5KQ8 A;  3B89 A;  4GH9 A;  4LZZ A;  4Z6Y A;  2LVP C;  2XFT A;  4XBO A;  1N36 M;  2MH8 A;  2YFQ A;  2DZN B;  2EJS A;  3IHP A;  2G5G X;  2LVN C;  4FWH A;  3ILK A;  5KPZ A;  2CE7 A;  4NXN M;  1D2N A;  2RGH A;  1HNW M;  5C18 A;  1JB0 F;  4NSO B;  3FTE A;  4LJ4 A;  2Z3X A;  1L2D A;  1GL6 A;  2X4A A;  4LY6 A;  1OFH A;  1SXJ E;  2C96 A;  2JZ0 A;  2J7O A;  3SMS A;  2C99 A;  2WSC F;  4JN6 A;  4DV2 M;  4LF6 M;  4DR6 M;  3U5Z A;  3U6C A;  1TDZ A;  1F4I A;  3CF6 E;  3KXE C;  2J7N A;  4P17 A;  4M9X A;  2F5P A;  3J7B A;  2C9C A;  1NO1 A;  4WUR A;  4BBA A;  4PDI A;  4JI8 M;  3KOY E;  2F5Q A;  1TF0 B;  3SAV A;  3NBI A;  2BWE A;  4PDG A;  2CFO A;  3HU2 A;  1HJP A;  4CJ6 A;  4G4R A;  2KZS A;  3Q8X A;  1T6O A;  3LVV A;  4DV1 M;  5EXT A;  1TH4 A;  1QYR A;  1J7K A;  1ZAE A;  4G3O A;  5KPT A;  3L29 A;  4HLQ A;  3DFZ A;  2KXE A;  3HWS A;  2MRO B;  2GNO A;  3SC3 A;  5DYI A;  4LJ6 A;  3KW6 A;  3C3D A;  3ZQJ A;  3L25 A;  2X49 A;  4X62 M;  3B7N A;  2K47 A;  3M6A A;  1RU3 A;  3SAS A;  2Y0Q A;  1X37 A;  2LVA A;  3RE8 A;  1GVN A;  1VEG A;  3K2L A;  2J5Y A;  2K6B A;  2QBY B;  1ZMW A;  2CHV A;  5ITY A;  1E9R A;  3SYK A;  4K0K M;  1DGH A;  1XHB A;  4JI0 M;  2KNA A;  2EKK A;  2LH0 A;  3SFZ A;  1IFY A;  2R0I A;  1MJG M;  3PNY A;  1AIP C;  3LVW A;  1PJT A;  3U61 A;  1NNU C;  3J81 S;  4II7 A;  3CF0 A;  3HY5 A;  4P16 A;  2RKO A;  4FCV A;  1PJQ A;  3BBZ A;  2VQE M;  4AI6 A;  4NRW A;  1NV8 A;  2CHG A;  4JXJ A;  4IBG A;  4GC5 A;  3HKP A;  5E26 A;  2QZ4 A;  4FVM A;  4RF1 A;  3GLG B;  2DZO B;  4LF7 M;  2D7G A;  4XK8 F;  4GIP A;  1HQC A;  1VEJ A;  3LQR A;  1G8P A;  3VKH A;  3Q8G A;  1QAN A;  3GLH B;  1QUT A;  2YR0 A;  4HL4 A;  1NHW C;  3IG5 A;  4JI6 M;  2JNH A;  1NVM A;  2Y0T A;  2DKL A;  4B7H A;  1V92 A;  2F5S A;  4M0D A;  4L8R C;  3IG8 A;  3VK8 A;  3SBJ A;  3TL4 X;  1WGN A;  2DEN A;  4LRS A;  2QSF X;  1AUA A;  1PJI A;  3E4R A;  4AG6 A;  1L2C A;  4AKG A;  4L6V 6;  2Y20 A;  4XGI A;  5IWA M;  4JI4 M;  4S12 A;  4RF0 A;  2XZU A;  1EIJ A;  4NSR A;  2VF8 A;  1GKI A;  2DVW B;  2QNJ A;  3L28 A;  1IXZ A;  4IJE A;  1EE8 A;  1PM5 A;  4R71 A;  4MB7 A;  4L15 A;  3WHL A;  3GLI B;  4LGM A;  3UGJ A;  3IEC A;  4YY3 M;  3HGI A;  4JI2 M;  1OQY A;  1VDL A;  3RGS A;  2EA0 A;  3I4V A;  4BB9 A;  2JZ1 A;  5F3W A;  1HT1 E;  3UJN A;  2VF7 A;  2CP8 A;  3LQQ A;  1XMO M;  2DWZ B;  3VDU A;  1TH2 A;  1W5S A;  2KEB A;  2JY7 A;  4DV5 M;  2D7E A;  1WXQ A;  3D8L A;  4DV0 M;  2DAI A;  5LMU M; 
#chains in the Genus database with same CATH homology
 2C98 A;  4LJ8 A;  1HNZ M;  2HL7 A;  3FUU A;  2HHH M;  2NQ8 C;  1IN8 A;  1Z6T A;  3MK6 A;  4NOO B;  1NNJ A;  4LF8 M;  1G3I A;  1JR3 D;  4KLN A;  4EIW A;  1GL7 A;  1XNR M;  4ZPX A;  1QQW A;  2OQ4 A;  2Y21 A;  2ZAM A;  4B3R M;  3UMM A;  1ZQ9 A;  3VLF B;  3SAR A;  1S3S A;  1N32 M;  1TGU A;  4YHH M;  4IBK A;  2C9O A;  4DR1 M;  1HQY E;  4D82 A;  3PNV A;  4W5W A;  1J5E M;  3HHW A;  5FSW A;  3SAT A;  2L09 A;  4JI1 M;  5EP2 A;  3EIH A;  3KP0 E;  1QAO A;  4LRT A;  5EP4 A;  1IN4 A;  1PJJ A;  3PFI A;  5JI2 E;  4LF5 M;  3GPP A;  1IM2 A;  3FUV A;  3GLG A;  3EIE A;  4NRV A;  1Q39 A;  3U6P A;  4JV5 M;  4Z8X A;  2E5L M;  2CV0 A;  3AFH A;  1E9S A;  4FD2 A;  1FJG M;  4IIW A;  3SMP A;  4DUZ M;  4NL4 H;  3HHY A;  2Z4R A;  3FTC A;  2P5T A;  4B7F A;  3FTD A;  3FYD A;  3CTW B;  2UUC M;  4GRI A;  1SXJ D;  1Z5A A;  4I5S A;  3WHK A;  3FUT A;  3U6E A;  1TH3 A;  1HNX M;  2UU9 M;  3KOX E;  4LJ9 A;  3ZCB B;  2DWL A;  2I7P A;  4PT5 A;  3JAM S;  4GHA A;  5ITQ A;  2R4E A;  4MGH A;  1K82 A;  2CHQ A;  3K8Z A;  2A5Y B;  4LCB A;  3TWK A;  4IBJ A;  5ITR A;  1R6B X;  2R46 A;  4REZ A;  2UUB M;  3VDP A;  3M7G A;  4CHT B;  5EP3 A;  1Q3C A;  1N78 A;  4G6Z A;  3U6M A;  4JI7 M;  1NY5 A;  3AV0 A;  1C1K A;  5H37 D;  3J2P B;  4I8O A;  3A42 A;  3J80 S;  2KRU A;  3FUW A;  3U5Z B;  5ITT A;  3KOW E;  3T38 A;  3U6L A;  1JQJ C;  4FWD A;  3HHX A;  4X64 M;  4DR3 M;  3GRR A;  4TUW A;  3QAU A;  4AKH A;  1L2B A;  4M0W A;  4OVZ B;  1G4A E;  2HCB A;  2QP9 X;  4LJA A;  4LFB M;  1G59 A;  4KO8 A;  5E6J A;  3HU3 A;  3QWL A;  1R2Z A;  1L1Z A;  3AOE A;  4IJF A;  2FFJ A;  3KS4 A;  4DV3 M;  4G4N A;  3SAU A;  3SHF A;  1E32 A;  1FNN A;  5DYG A;  1N77 A;  2F5O A;  1T3T A;  5JI3 E;  2DWN A;  3M0E A;  5KQD A;  5FLX S;  1YSY A;  2Z7J A;  4LF4 M;  3AOG A;  3OTO M;  2Q2E B;  4G4O A;  1Z5C A;  3GPY A;  2XEP A;  3HJS A;  1SXJ B;  4MGI E;  1HT2 E;  4R7G A;  1KYI A;  3L27 A;  3ZC7 B;  5FTJ A;  2FOI C;  1OFI A;  3T15 A;  3W0L B;  2H1R A;  3U6Q A;  4MGK E;  1DGH B;  2BJW A;  1Q3B A;  2KW0 A;  3J7A S;  3I4Y A;  4IBB A;  3U61 B;  4GHL A;  3K1J A;  3KFU G;  2KRK A;  1IY0 A;  5C1B A;  1G41 A;  2HKJ A;  3H4M A;  4AZF A;  5KO3 A;  1QVR A;  3W0F A;  2M60 A;  4IBI A;  4B08 A;  4DV4 M;  4B3M M;  1L8Q A;  3R8F A;  2V1U A;  5EXP A;  5A2Q S;  3GLF B;  1YE9 A;  1IXR C;  1N34 M;  3GQ3 A;  4OX9 M;  3L2A A;  2XSZ A;  5IRE B;  2UXB M;  2W82 A;  1QAM A;  4BLC A;  4QHT A;  3DOA A;  1VDD A;  7CAT A;  2CEA A;  3GRU A;  3JR4 A;  3KS8 A;  2M5Z A;  3T1H M;  2KA6 B;  3UZU A;  4JYA M;  4JI3 M;  4LZJ A;  2ZAN A;  3MHV C;  3PXG A;  1IY2 A;  3LMM A;  4D81 A;  3AOE C;  1TDH A;  4AKI A;  2V1C A;  4LFA M;  1DGF A;  1UM8 A;  3JR5 A;  5LMN M;  2QBY A;  3D8B A;  1R7R A;  4QNM A;  2L7I A;  4NXM M;  1MX0 A;  1IN7 A;  3FYC A;  1DO2 A;  3T1Y M;  1K3W A;  4DR5 M;  5EXS A;  4FWG A;  3GPU A;  4QNR A;  1XXH B;  2AHM A;  3I51 A;  3UK6 A;  2CV1 A;  3U60 B;  3GQ4 A;  3THG A;  3RGP A;  3AJI B;  1IQP A;  4KOD A;  4L78 A;  4X65 M;  2R4J A;  3B9P A;  2R62 A;  3VFD A;  3A45 A;  5FTK A;  5ITU A;  3KOZ E;  2EUC A;  3A46 A;  1NHG C;  3GLH A;  4AW4 A;  4JI5 M;  3HJQ A;  4MM3 B;  2XGN A;  5EJC A;  3L26 A;  2C5R A;  1QZM A;  2L7H A;  2Z4S A;  4CGY B;  4QOS A;  3TWL A;  1IBK M;  4M9S A;  3K92 A;  8CAT A;  4OVZ A;  2XH9 A;  2L6O A;  4DUY M;  2FE8 A;  2EO2 A;  2ERC A;  1IBL M;  2FNA A;  4R3D A;  1NY6 A;  5BR8 M;  3U6S A;  3A98 B;  3FUX A;  1H6U A;  5EP1 A;  2UUA M;  1NJF A;  4IBD A;  2CV2 A;  3TWM A;  2V6Z M;  5ITX E;  3SAW A;  1XC8 A;  1Z5B A;  4LGY A;  3TQS A;  4B3T M;  2LNH C;  1YUB A;  3GRY A;  4FCW A;  4QHS A;  3FKE A;  4OU7 A;  4OW0 A;  3GLI A;  2RGO A;  3GQ5 A;  1SXJ A;  4GMQ A;  1E94 E;  3PVS A;  5BPV A;  4GKJ M;  4WW0 A;  1GLN A;  1Z59 A;  2LWX A;  4AQY M;  5GKN A;  1QAQ A;  4PCZ A;  5KPR A;  4GC9 A;  4LF9 M;  4LFC M;  2XF3 A;  2G8L A;  1J09 A;  2ZAO A;  4AG5 A;  2OPF A;  3FTF A;  1R2Y A;  3KP1 E;  4I4L A;  3CF2 A;  5IT9 S;  2JA2 A;  4MH0 E;  1I4W A;  2I7N A;  4PD2 A;  2KZU A;  1IN5 A;  4MGZ E;  2YNM D;  4DV7 M;  2UXC M;  3VKG A;  4IBC A;  3DZD A;  4X66 M;  3GLF A;  3VK7 A;  2XFS A;  4IBF A;  3GRV A;  2CUZ A;  3KVW A;  4ITQ A;  4GKK M;  5ITX A;  4L16 A;  3GPX A;  5IZ7 D;  2DHR A;  3HHZ A;  5EXX A;  1IN6 A;  4MGY E;  1IBM M;  4QOZ C;  2D7H A;  3FD9 A;  3E9S A;  1XMQ M;  1IXS B;  2BNK A;  4D80 A;  3HJ8 A;  4LJ5 A;  1K3X A;  1KFV A;  3R9X B;  4CIS A;  1DGB A;  1IY1 A;  2VQF M;  1XWI A;  4L4U A;  3SHG B;  1MU5 A;  1ORY B;  3DA1 A;  2F4V M;  2DXI A;  4GIT A;  4LJ7 A;  3ZH9 B;  3AKZ A;  1I94 M;  3MJ5 A;  4I81 A;  3KSJ A;  4G4Q A;  4FW9 A;  2R45 A;  3BOS A;  4KHP M;  4LG2 A;  5EQT A;  4RNA A;  1N75 A;  4B7G A;  1SXJ C;  2R18 A;  5DNY A;  1DO0 A;  4M9Z A;  3RFW A;  3AL0 C;  1XXH A;  4FCT A;  4B3S M;  4DR4 M;  1HR0 M;  3C58 A;  3U60 A;  1DGG A;  3U6D A;  1KSF X;  2QPA A;  2XSZ D;  3J27 B;  1N33 M;  3GO8 A;  2X8A A;  1L1T A;  2UXD M;  2ZBK B;  2VII A;  1LV7 A;  1NSF A;  2BJV A;  3NWL A;  5FTN A;  2R65 A;  4DR2 M;  1XNQ M;  2QEN A;  2XZF A;  1NJG A;  3TPZ A;  4DV6 M;  5FTL A;  2ZM6 M;  2F5N A;  3U6O A;  3SYL A;  2DWM A;  3HU1 A;  4DR7 M;  4A3V B;  2O5R A;  4IBE A;  3GP1 A;  2YQZ A;  1W5T A;  3KDS E;  5FTM A;  2LXE A;  1JR3 A;  1OJL A;  2QCU A;  3TE6 A;  3KSX A;  2XLJ A;  5KQ8 A;  4GH9 A;  4LZZ A;  4Z6Y A;  4XBO A;  2XFT A;  1N36 M;  2YFQ A;  2DZN B;  2G5G X;  4FWH A;  3ILK A;  5KPZ A;  2CE7 A;  4NXN M;  1D2N A;  2RGH A;  1HNW M;  5C18 A;  4NSO B;  3FTE A;  4LJ4 A;  2Z3X A;  1L2D A;  2X4A A;  1GL6 A;  4LY6 A;  1OFH A;  1SXJ E;  2C96 A;  2J7O A;  3SMS A;  2C99 A;  4DV2 M;  4JN6 A;  4LF6 M;  4DR6 M;  3U5Z A;  3U6C A;  1TDZ A;  3CF6 E;  3KXE C;  2J7N A;  4M9X A;  2F5P A;  3J7B A;  2C9C A;  4WUR A;  4BBA A;  4PDI A;  4JI8 M;  3KOY E;  2F5Q A;  3SAV A;  3NBI A;  4PDG A;  2CFO A;  3HU2 A;  4G4R A;  2KZS A;  3Q8X A;  3LVV A;  4DV1 M;  5EXT A;  1TH4 A;  1QYR A;  1J7K A;  1ZAE A;  5KPT A;  3L29 A;  4HLQ A;  3DFZ A;  2KXE A;  3HWS A;  3SC3 A;  5DYI A;  4LJ6 A;  3KW6 A;  3L25 A;  2X49 A;  4X62 M;  2K47 A;  3M6A A;  3SAS A;  2Y0Q A;  1X37 A;  3RE8 A;  1GVN A;  3K2L A;  2QBY B;  2CHV A;  5ITY A;  1E9R A;  3SYK A;  4K0K M;  1DGH A;  1XHB A;  4JI0 M;  2LH0 A;  3SFZ A;  3PNY A;  3LVW A;  3U61 A;  1NNU C;  3J81 S;  4II7 A;  3CF0 A;  4P16 A;  2RKO A;  4FCV A;  2VQE M;  4AI6 A;  4NRW A;  2CHG A;  4JXJ A;  4IBG A;  4GC5 A;  3HKP A;  5E26 A;  2QZ4 A;  4FVM A;  4RF1 A;  3GLG B;  2DZO B;  4LF7 M;  2D7G A;  4GIP A;  1HQC A;  1G8P A;  3VKH A;  1QAN A;  3GLH B;  2YR0 A;  4HL4 A;  1NHW C;  3IG5 A;  4JI6 M;  1NVM A;  2Y0T A;  4B7H A;  2F5S A;  4M0D A;  4L8R C;  3IG8 A;  3VK8 A;  3SBJ A;  3TL4 X;  4LRS A;  1PJI A;  3E4R A;  4AG6 A;  1L2C A;  4AKG A;  2Y20 A;  4XGI A;  5IWA M;  4JI4 M;  4S12 A;  4RF0 A;  2XZU A;  4NSR A;  1GKI A;  2DVW B;  3L28 A;  1IXZ A;  4IJE A;  1EE8 A;  1PM5 A;  4MB7 A;  4L15 A;  3WHL A;  3GLI B;  4LGM A;  3UGJ A;  4YY3 M;  3HGI A;  4JI2 M;  3RGS A;  2EA0 A;  3I4V A;  4BB9 A;  5F3W A;  1HT1 E;  3UJN A;  3LQQ A;  1XMO M;  2DWZ B;  3VDU A;  1TH2 A;  1W5S A;  2KEB A;  4DV5 M;  2D7E A;  1WXQ A;  3D8L A;  4DV0 M;  3LQR A;  5LMU M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...