3C3EA

Crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei in complex with fo and gdp. northeast structural genomics consortium target mar46
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
305
structure length
305
Chain Sequence
b'MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAFLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-phospho-L-lactate transferase
publication title Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb
source organism Methanosarcina mazei go1
molecule tags Transferase
total genus 82
structure length 305
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 2.7.8.28: 2-phospho-L-lactate transferase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.240 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 CofD-like domain 3c3eA02
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 3c3eA01
3CGWA 3C3EA 3C3DA 2P0YA
chains in the Genus database with same CATH superfamily
3W0FA 3WBKA 4XCQA 1CXZA 3S7TA 4FJ1A 1E66A 1R12A 4UM8B 4YUXA 4X1OA 3OY7A 2R47A 4IMRA 2JA1A 1JX6A 4N39A 1T2DA 5DHAA 1C3OB 4B3RB 5AVRA 2JIDA 4YCJA 1PFWA 1R4AA 5AW7A 2DQYA 1GGHA 1V3TA 5BN5B 2JY8A 2M2IA 3QYPA 4AULA 2BEVB 4HWTA 4BNIA 2UYOA 4CEIB 1WR1B 4Q82A 4Q5IA 2Z9BA 1UK9A 1LV8A 3IDQA 3Q88A 2WLSA 2DQZA 4I81A 2QAGA 4L7VA 3HRHA 2H5LA 1KSJA 3PEWA 1WQ3A 1N1EA 5KAMA 2C84A 3FXAA 3I92A 2YJZA 4Q4AB 5K0SA 4Q34A 1L5YA 5C31A 3X1DA 4HNGA 1MGPA 2C07A 1DPFA 3GWGA 2H85A 1J56A 3GFVA 3L6CA 3PLRA 1UODA 2DGDA 3CRNA 4LQ4A 5K03A 2AUMA 3KETA 1T1JA 2Q5JA 2GBLC 3NRJA 1ZHOA 2VJMB 5TVGA 4B8YA 4PFQA 4KP7A 2E85A 4GLOA 3FCUB 1KARA 4YPFA 2OO3A 2AEMA 4R83A 3EQ8A 2HWUA 3AWIA 1KEEB 3PJFA 2XYPA 1K3UB 3HGTA 5BSMA 4PLGA 4QQ8A 4ZOLF 4LDNA 2HSDA 2CB9A 4JVNA 3A06A 1A76A 4QU8A 2ZRNA 1I5RA 2XVAA 5CDSA 3DMTC 3PP8A 3PSHA 3AC0A 5DNYA 5C51B 2YZMA 3CU5A 4WFIA 4YAWA 4DCCA 1PCXA 4NEHB 3AOEC 2WB2A 4AF8A 4Y2QA 3JYQA 1HQYE 3K5HA 2QTRA 3MWDA 4YLGA 4GBGA 5DX0A 1BVYF 3DDZX 1GRNA 4L8FA 4D9CA 4NX2A 4CTJA 1W5FA 1NG1A 1MB9A 2HTFA 2UVQA 2HUPA 5FPTA 1NZDA 5ITZB 2GZ2A 4OKSA 1ESCA 4P86A 1Y7LA 4C0XA 3KXDA 5G1PA 2UUOA 2QRUA 1Q14A 3AG6A 5JMTA 3OWOA 4MQBA 2OD7A 3EXEB 4JI3M 5KC8A 5IREB 3K4HA 3W2TA 5C1DA 1TF7A 3AY6A 3ROEA 5J59A 1U11A 1MG5A 4UQPA 2IGTA 3GFQA 1L4BA 1VIVA 2H9YA 3HU1A 4GT1A 2BFBB 1WVGA 1Z4IA 2C3YA 5KX5A 2V8OA 4HVTA 3S1SA 1TCAA 1GV1A 3R24A 4DEXA 3L7CA 4YMIA 4PONA 4U9IS 2IVZA 4QOHA 3UK0A 4DC0A 4ZTZB 3C4QA 1XVVA 3HWRA 2VHYA 2GRJA 1T5OA 1WZEA 4WCFB 1C8VB 3A1SA 3VU0A 3TO5A 4NNJA 4D9MA 2ZIUB 4XQ0A 2UXDM 1SCKA 4UPDA 1VEJA 1GTG1 3J81k 1OLOA 1TM3E 3LX4A 4RW0A 5IDVA 3ZU3A 2NGRA 3QFFA 1IWPB 1ABFA 3DBIA 3OE7D 3T4UA 3EVNA 2HH9A 3QHPA 1NI4A 2ZWVA 3LKBA 3OE1A 2X19A 3AHDA 3UMMA 3ZGYA 3G23A 3L28A 3OE5A 1HY3A 4XM1A 4FYIA 4CEJB 1JXMA 2HMAA 3R09A 3AWDA 2Q2WA 3VZPA 4PCVA 3D1VA 4JLNA 1AXRA 3DWGA 4LQLA 3GGPA 4M8LA 4UULA 2G07A 5GAJA 1TFUA 3VPAA 3C5CA 3H5NA 3IEVA 1R27A 2MYTA 5DHQA 5BN4A 1H4VB 4BB0A 2XWPA 4X7MA 3ZWYA 3TX2A 1BXZA 2B36A 1IVSA 1AS0A 1PYOA 4YRKA 2AFHB 3KJZA 3H84A 3M89A 3ZZNA 5COQA 5G4LA 4A0QA 4QM7A 1NW7A 4K03A 3RE8A 2CDCA 4F4UA 4UPVA 1UF9A 1PJ3A 1G59A 4U2KA 1D2RA 1X77A 5JLJA 3PE3A 3AEXA 1YHZA 2E4UA 2Q46A 3CTPA 5THKA 3FCOA 2EX0A 5LIPA 1LKZA 1BVHA 2Y9PB 3O82A 4NCKA 3W5HA 4MV3A 4UFNA 3DBOB 5ENDA 4DQ0A 3RUDA 1YAJA 1ISHA 4JYAM 4DARA 2BVNA 4IKEA 3SDZA 1GSHA 1ACLA 3SKVA 1I0ZA 3SIRA 4LRSB 2BGRA 2Q8QA 5DIZA 1C0LA 2YYAA 1ISSA 3VK8A 3FRHA 3N7TA 5FX2A 3FPKA 4ZT5A 3H5IA 1OZHA 1WIWA 2KNVA 3REQA 1GPJA 4QQFA 3QH4A 4ZP1A 4L8WB 1KEVA 2HRBA 1NQAO 1TJ3A 1QNLA 3E7DA 1G3MA 3PQ3A 2B5OA 1JS1X 4RXUA 3GH1A 3IE2A 5ALUA 5LMNB 3EVGA 5JQWA 5FOUA 5A1TA 4N76A 3NJRA 1XZFA 3TR5A 2FMFA 3G0CA 1CLUA 3REFA 1XU7A 4Q4HB 4OHFA 4G84A 3QE0A 3MJ5A 1T9BA 5D3QA 4I4CA 1Q3TA 2VCHA 2FMKA 2D6FA 2F3UA 3AT1A 2C94A 2W2VA 4R1LA 4YV7A 4N82A 2XMSA 3ZIDA 4KAXA 2UXCM 3QVMA 2RBEA 4N4AA 2GAIA 3DYBA 1O0BA 4RSRA 1HYHA 1OBOA 1LA2A 1QH8B 3RJ5A 3N0XA 3SAJA 4KVAA 5ITRA 3PTZA 4AYXA 1P80A 4B74A 1XLTC 4QPCA 1L7MA 1YI1A 1JECA 1R15A 1HETA 3R23A 4HQNA 3TTWA 2YRFA 2FUKA 2ORED 1MHPA 5A05A 4QAQA 5BSUA 2UUAM 4AZ0B 2O4UX 1KI6A 3G5UA 4PR3A 4RTOA 4PNZA 2JFNA 1GXSA 3CUUA 1VB3A 2ZE7A 4UVIA 4YCBA 2JH8A 3OFSA 4MUGA 1TOAA 3UMRA 1V0JA 5HIKA 4A82A 1CULC 4F9GA 1W4ZA 4EB0A 3JS5A 1N9ZA 1KK3A 4K9QA 4PYLA 4A7PA 1F9EA 5I9MA 4JL8A 1AV6A 4D0SA 4K9LA 2XYRA 2XADA 2UZ1A 1X7XA 3MJ4A 4RANA 2B2CA 2PNJA 2H2FA 2W6QA 1DU4A 4BFUA 3HJAA 1M67A 1ZH0A 1TZBA 4L2IA 1H1LA 2PZ8A 4JMLA 1EIZA 3EGDB 1UQUA 3BHIA 5CA1A 4Q66C 3CSUA 1R3UA 3I1JA 2BCJQ 1YZVA 5DYYA 4AP6A 5IJ0A 1O57A 1G6HA 2SCUA 3X3HA 3VSCA 3OPYI 3ZCXA 5B58C 2GYYA 4NZPA 2BI4A 1T3ZA 1PDVA 3L05A 5DX8A 1T6ZA 3DAYA 3PQEA 1EE9A 4XWGA 3KSJA 2F1KA 2PLNA 4LMAA 2GVDC 4O5AA 4TVKA 3T5GA 2I4OA 5DH9A 3RK1A 1R4GA 3N6RA 3OP1A 5B3AA 4B6PA 4DIOA 4EKYA 1GLNA 5HKKA 2AQIA 1GEEA 4KE6A 1OC4A 5ALSA 3ESZA 2FZ4A 4ZKDA 2MYPA 3ZHSA 4J0GA 5DV9A 1NE2A 1UBTS 3LGSA 4KOAA 1A3CA 5E8RA 3L0YA 1NATA 1A2KC 5EUBA 2NT4A 1XF1A 1WMBA 2O19A 3WNZA 3FB1A 1KDRA 2XB9A 3C3XA 3SX2A 4V1CI 2Z09A 1BMFD 1JHUA 3NC0C 5FOSA 3ICEA 3ZWCA 1COZA 1XRNA 4YP5A 1PQ4A 2OUIA 4MLCA 3UJ8A 5ICGA 4ZPJA 1LX6A 3AV0A 2PUTA 2WUDA 1E6CA 2H48A 2J3JA 3UJAA 4B73A 5ERYA 4HYEA 3TG8A 4UCFA 3KEGA 2OILA 5BO5A 2EFJA 1B43A 3C3WA 4MUBA 5LR6A 2PX0A 2HY7A 3KD2A 3ZHXA 2VWHA 1L5GB 3L5KA 2YW9A 1UBKS 2OFOA 3V5NA 5EQDA 2CP8A 4BNTA 1E8NA 2I5PO 1HT2E 2WTUA 4N7JA 2A1TS 4O3FA 1L6RA 5LQMA 1ODKA 4WBSA 1QVVA 1A50B 5BOSB 5KQPA 3P4UA 4H3KB 3DB1A 4YHHB 4RF4A 3PX3A 5AJTA 3DL0A 2QZJA 2YVAA 4OREX 1E6MA 2YJ6A 3SXUA 4A0HA 1O97D 3AI7A 4IIDA 4WLUA 1CW2B 3X1YA 3A7DA 3Q7RA 2QRKA 1XN1A 4YAEA 1RQXA 3VMMA 4W5HA 1B1CA 3IURA 3VPHA 5ENZA 4TTRA 4JVLA 4X6XA 4X93A 1NHGC 3M34A 1V1MA 1RC8A 5BXQC 2VP2A 1Z3IX 3VPDA 2QR2A 3G6WA 4UAJA 1JWBB 4YMVA 3B9QA 4EF6A 1JR4A 5M7EA 3QHQA 4CNQA 2ERCA 3KXEC 4ZXFA 2QROA 1BCSB 4JI1M 1Q7TA 1V35A 2P5TB 2C5FA 2YFKA 3ZDDA 3OEWA 5JFGA 3KB6A 4MRMA 1HMPA 4XGIA 3V00A 3R3ZA 3K05A 1SCIA 2QMUA 2IYFA 4BRSA 3G13A 4IPTA 5CJPA 4C7OB 2XBMA 2AJDA 5IKPA 4W4TA 1M2OB 2QN8A 4LRTA 3ZCTA 3LK7A 1UDAA 3P9CA 2A8YA 1DIHA 1I10A 1XYGA 5HQTA 4RK7A 2WUGA 4M54A 1TGUA 2FSPA 1Z6YA 1GPNA 1UAAA 1AO3A 1JTEA 4GC9A 4UUPA 1DS6A 2I71A 1BJTA 1T13A 2WHYA 1B6GA 4YMWA 1A9RA 4EYKA 3VR3A 1ZMWA 3OZUA 4KLRA 2VEDA 3DOIA 5PNTA 4G9BA 2W2XA 1KIMA 5EJAA 4DV1M 1REQB 1IVNA 3RFCA 2O5RA 1SG0A 4NOKA 1NW8A 4Q4JA 4OGFA 5CDUA 2L82A 1KJ8A 4MYHA 5C7YA 1KZ1A 4KC0A 4F72A 1T5SA 3CV3A 2XODA 1MJFA 2X9NA 4E6PA 4RFVA 4LJ9A 3ESQA 4I5DA 4IG4A 1C3EA 3OOHA 3I4FA 1OASA 3CFYA 2OFFA 2GQ0A 3CX7A 4DGSA 3QAUA 1CR1A 4YRBA 3GT3A 2JFVA 4R8RA 2XUFA 2W2PA 1FXUA 2FZLA 3PL1A 1USUA 2IV2X 4ZGGA 2PDAA 4EHAA 3UMGA 3CRMA 2NUTB 3CJTA 2BTOA 3UJPA 3ETEA 3NTVA 1IOLA 2VNKA 4M0UA 1SBQA 2RHDA 4HDSB 4MDFA 1S8NA 3RQSA 2EL7A 3A36A 4FGZA 1J9EA 2EYUA 1YH3A 2WIFA 3RTCA 5A5EA 4RD3A 3IILA 3ZG6A 2ES4A 4C89A 3B89A 1K4YA 1N57A 2Y77A 1VE9A 1YDMA 1ZN7A 3IA7A 4CJ6A 3ZWQA 3EA0A 4BMZA 3IV9A 5AUNB 2FE4A 5IXJA 3JV7A 4W8GA 4NDZA 4AX4A 2V58A 1FS6A 1XD2B 4RAOA 4DIMA 4R5HA 2Q5CA 3HBMA 3KFLA 5KU7A 1Y6FA 3G89A 4JJZA 4YJDA 1S8OA 3HLKA 1KJQA 4QXOA 3W9BA 2REOA 4JITA 4Q39A 1FB5A 4DOMA 1IRIA 4CM6A 5GQSA 1F1BA 2O8EA 5KC9A 1D04A 5CVEA 4CPDA 3V9PA 3S99A 2QN2A 3HABA 3SJAA 2JFHA 4PRZA 4A5SA 2NP7A 3F8TA 4L5YA 1DP4A 5GGYA 1ORRA 3HZHA 3FH0A 3Q0IA 2A58A 1G98A 3O4HA 5JISA 1U0JA 5KPTA 4QYWA 1K97A 4UVDA 2DRIA 1ZVKA 2CXHA 1H5NA 3D64A 5AKJA 4CETA 1RM3A 4KH0A 4O33A 3SKXA 4L5BA 3D4BA 4HATA 1OH6A 5DNEA 3ZIUA 2BCEA 5AOAA 2ZIFA 3BIFA 3O4RA 3IB6A 3TOXA 5ALVA 3RAPR 5GONA 4RABA 4ROSA 1R0SA 3I45A 2M1ZA 1VDLA 5JSZB 4DV7M 5LYYA 2B99A 2XEDA 3CGGA 3KYJB 1CJKC 2IW1A 3AJRA 1OA1A 1Y6QA 2R7KA 1HEUA 3LPCA 1TAUA 4DZZA 5EXXA 1AHHA 5FAKA 2FE8A 3RANA 4DA0A 2Z2YA 1G5RA 3RRXA 1TTPB 3M5PA 2H8KA 1G5TA 1NBAA 2A94A 4FIDA 2W2QA 1L4GA 3U3JA 2ADOA 2J31A 1JB9A 1DCMA 1DBIA 2GESA 4LZOA 1NSFA 5EIBC 1V39A 3OOWA 1IM5A 1SEVA 3CTWB 2X0RA 4MUAA 1O94A 4LY6A 5F23A 3G0IA 1NDHA 2GI4A 2YMLA 3EYAA 4B3SM 3VKVA 1E9BA 4YDSA 4QZVA 4GPTA 3L4BC 3TF5A 5EQJB 5ARDA 1EQ2A 1XEWY 3PHBE 1FMFA 3O0TA 2WJIA 2B3DA 5SYAA 2ZT5A 5BUSA 2DP4E 1QZXA 2WSYB 4ITRC 5HSGA 2WWHA 2JZOA 4ZKEA 2AG8A 1MA3A 3G2PA 3RAEC 4S0XA 5BT8A 2FX3A 5IAOA 4RIFA 2SNIE 4JT2A 1ZUD1 2FEKA 5H82A 1PJIA 4G5GA 4TMWA 4HB2A 1D0LA 3QWFA 1ULUA 3NMUF 4GXQA 3ECSA 5KQMA 4ITVA 3AUXA 4X64M 5L8RF 1UT5A 3H0KA 4M9SA 4O4LA 1G19A 1D6SA 3IUQA 1D4AA 4EJSC 4QT0A 4AS2A 5FOXA 3H13A 3M6MD 4ZCRA 3ROMA 1RHJA 1R9GA 5AW4A 4ECAA 3JWJA 1OWNA 4XCVA 1T10A 2H4XA 1Y34E 1PYDA 3PC7A 5FL7D 3AV3A 1RYEA 3EXHA 2QHOB 1WQ1R 4EZEA 5A7GA 3Q7IA 4UZSA 4YMSA 4EUKA 1WB4A 1PJSA 3UCFA 2QTFA 4FPXA 1J07A 4HTFB 1IEWA 3VNVA 4XQEA 5DGCA 3IMKA 1R1DA 5ITVA 3QTBA 4MW6A 1HNZB 5M34A 4DNXA 5B4TA 4REMA 3F97A 3ASUA 2A0YA 3H1GA 3V1TC 5A06A 4DMFA 1Y3AA 4FGJA 2OBFA 3WRXA 4ZZIA 4NU0A 1O5IA 3RTGA 1BXGA 4INZA 3B7GA 3A1EA 2O3RA 2BZ1A 3E5NA 2XZOA 2OECA 2FSIA 4C1NA 1E89A 4F4FA 3O5AA 5DHSA 1PWYE 2W42A 1PNVA 4QNNA 2ZUSA 3AR4A 2G0AA 4BATA 3BWMA 4M8NE 4Q15A 4I6EA 1JYFA 4GYJA 4TYPA 1F8UA 5JJBA 1PL6A 3W8FA 3F67A 4BS9A 2VAPA 2GLXA 2RC5A 4PNHA 4YDHB 2O1EA 3ZK7A 2PKRA 3G1TA 4DR3B 2HLDD 4L4XA 3ZD8A 3U09A 2Q3MA 4EGAA 1EK5A 1PFYA 4FEAA 1U0SY 4CMGA 4IZHA 2OM2A 6GPBA 3IR7A 1SOVA 1C1YA 3UMJA 4LVUA 2R5WA 2KMLA 4UVEA 2D59A 3ZCRA 4YYEA 3SSNA 1M8PA 1E2EA 1WB6A 2P4EA 2OBMA 3LZDA 2P4UA 4BTLA 2VWQA 2EC5A 3QNUA 4TS9A 3IL2A 5CVJA 4DTCA 4HPJB 5HBGA 5E4TA 1OPXA 1GTZA 1W34A 3TUZC 5CT4A 2BH2A 4OUDA 3ZDRA 4TTQA 2BEJA 3RS0A 2XKKA 6YASA 1U28A 4XFDA 1CQJA 2BBSA 1Y5IA 5DO9A 3KL2A 1J7KA 2GWRA 2O0KA 2PUDA 3U7GA 5B1SA 4MTCA 1ECJA 4ZOCA 2ZSKA 3NJ8A 1SCUA 3ZCQA 1NX6A 4L85A 1KK1A 2IEBA 2B9EA 4BFXA 4B87A 5LWHA 2G1KA 4RYDA 4CGYA 1N3IA 4ZO4A 3H17A 1B41A 3OEHA 4P82A 5C2JB 1D6NA 5EEHA 1U8CB 3PRKE 4QO7A 3RRFA 4KVFA 4D74A 1Q1EA 2ZAMA 2PQ0A 4GP6A 4D41A 3WDSA 1VSVA 3SZUA 1PR9A 1RWVA 3K0FB 2EZ4A 5JNWA 1SBNE 5EJCA 3U3ZA 1OREA 1ZY2A 1XQ1A 3RU9A 1QHFA 4DQVA 3MIIA 5I48A 2HRRA 3TWMA 1O0SA 2PGAA 3LBAA 4K0KB 3QW2A 1DKMA 1H1TA 2POCA 4BMCA 1UBGA 3TEJA 3LPNA 4D6PA 4NZMA 3TQCA 4CQLA 3A6FA 1ISGA 5HE8A 1CHDA 1VI2A 3GDWA 3O3MB 3OMLA 3BZBA 4FHEA 3NB0A 2IYZA 3RKUA 1T8WA 5E9JA 3CN9A 3CUTA 4UHKA 2CUNA 1SUFA 4DBVO 3NBQA 3MERA 3FUTA 3CVUA 2QTHA 1XCOA 1NN1A 1OTHA 4D9EA 2YJ5A 1JIIA 2VBFA 3ZE7A 2PQ2A 3JQAA 1IIRA 3IAM1 3PL5A 2DPGA 5A6SB 3L04A 2B5WA 2R62A 5CB4F 3T1VA 3KAPA 1YWGO 3E23A 5DWDA 4GL4A 4EX6A 4RD1A 1KWGA 3HN6A 1RYBA 2QGNA 4LF8M 4IO0A 3I5XA 1T0HB 2HA3A 4C76A 4HNHA 5K0GA 3DOCA 4L78A 3G8AA 4K2AA 2QVCA 2DFPA 4MUYA 4O4LF 4WESB 2VSYA 2I1VB 2VZ0A 2Z6QA 5K0TA 1EDOA 3A6EA 3ZWOA 1N78A 3KLOA 4UFPA 2J5XA 4FUQA 3Q10A 2AYXA 3QENA 2Q21A 1FA9A 3QELB 2L2DA 1PAUA 1RPAA 3AR3A 4R2MA 3PFFA 3I34X 7MDHA 4A8JA 3Q6MA 2EKQA 3W8EA 3T3EA 3BRWD 4YUZA 5CJJA 2G67A 3ER6A 1H85A 3Q5GA 3GEMA 1SOWA 3DMDA 2PJDA 4D9KA 3S81A 2WHQA 1SUIA 2ZSIA 1J5EB 1N2ZA 1EJBA 3DPSA 1YBVA 1PP4A 3PNYA 3ZWBA 2IA5A 1ZCJA 4AICA 4Y8VA 5B3JA 2RHHA 3EWAA 3VR0A 3GFGA 4R3UC 2EX1A 5LZ9A 1V8BA 2A9PA 3BOSA 4ID9A 1KZ7B 3O8QA 2V6FA 1WAMA 5GJBA 2ZYAA 4MS1B 1TX4B 4J9VA 4PGAA 2VG8A 4ZMSA 4BVKA 1CIPA 1U90A 1XK7A 4XIIA 5IXSA 4NARA 2OOAA 2NU9A 4AY6A 2Q2QA 4WZAB 3KT8A 2VZLA 1AF4A 3K9NA 3ONVA 1JHZA 2XECA 2WT4A 4BXOA 3R5TA 4PAQA 4Q1BA 2JLUA 4Y6SA 1XQ9A 3AEYA 4PY2A 3FOBA 4BBPA 2H1SA 4GLJA 3RT1A 4MB7A 1SU8A 3GUCA 3KKOA 4AQYB 4JYMA 4ENPA 3N8NA 3OJXA 1CZKA 3K9FC 1F51E 1MABA 1MP0A 3UYKA 3E9EA 2DSNA 3K5IA 3IMEA 3CRW1 5AHRA 5FWNA 1Z6AA 5CD1A 4BQPA 5F3DA 2RIPA 4X63A 2ZSJA 3V8BA 1Z5AA 1AB6A 1EKXA 3KT0A 1SN7A 4HVLA 1KJYA 4G97A 1PQYA 4DJJA 5DTEA 3BKWA 4R0NA 2BKXA 2OP1A 4UTNA 4YX9A 1E64A 1Z35A 3VR6A 1LC3A 4BMOB 3UANA 2C2GA 3D1LA 4MSUA 1NUTA 1PL8A 4DKJA 1NE7A 1KMQA 4YRIA 1XAHA 1L5RA 3RF7A 3UJ3X 5CU7A 1LPMA 2R7LA 1Z6QA 5CFOA 3FYCA 2FRDA 4RD6A 3VHLB 2PVPA 1DWQA 2Q5FA 2AB0A 1A9TA 4YRRA 3PEYA 2WD7A 5HRCA 2CGEA 3MAJA 3SMQA 5KSYA 3NHUA 1T29A 4RV4A 3D2BA 4CTMA 2BBWA 1E6KA 3RC9A 3H9JA 2HHLA 5JNUA 5KTYA 1CR0A 2IXDA 4YJGA 4E6EA 1HFJA 5JIBA 4LHWA 1TO1E 2MYNA 3WOVA 1GUAA 3GA7A 2PYZA 2EJUA 3IJEB 2B4KA 4P4SB 3IAFA 2ZE8A 4L72A 1QGED 1CUUA 3RVSA 3ICPA 3GPPA 3KOYE 2DLNA 3VU1A 2WDPA 5EPUA 3GQ3A 4BQQA 1BH2A 3OP4A 2ZB8A 4GMHA 5JRZA 1AQLA 1G20E 4YREA 4PX3A 1AN0A 1KYYA 1YR7A 1IULA 4PG8A 1F2DA 4CTKA 2QOEA 5DEIA 2X1MA 4CR7A 2QVYX 2AWOA 4X71A 1IJKA 2X14A 3F6EX 1CEQA 4R7GA 4ZT2A 2HRCA 1Z75A 2V3CC 1KVRA 1NQVA 3LH5A 3W68A 1ILEA 3TJZA 4NPAA 3UT0A 3NWJA 4KLNA 2VJNA 4DMRA 2B5VA 4PFJA 5EINA 2ZW9A 3SEZA 2Q62A 3KUKA 5I51A 3HO8A 1AURA 1KEWA 1BTOA 2NLOA 3K70D 4C7VA 3J80S 1KU0A 1RLIA 5FBHA 2VTBB 4LFCB 2HIAA 4NI5A 2RKWA 3UMBA 5CXUA 3HV0A 3SR4A 5HPYB 1SQ5A 2B7CA 1M3SA 1KU6A 4ACBA 2ZB3A 3CF6E 2IEDA 3HB5X 1U0BB 2HMVA 1KJNA 4XRGA 2QZZA 2JL1A 2W7TA 2QL7A 3LM8A 2JEOA 2I29A 5EY5B 4BBZA 4KXYA 3TIXB 1KSFX 1H8ED 4R1MA 1J97A 1Q20A 3V8PA 1MA0A 4REQA 4ZOLB 1U9JA 1YS9A 1RM0A 1V2GA 1G38A 2O23A 2F1IA 3TNFA 2J9YB 3TZKA 1YJAA 1I6LA 2DWUA 2ZTHA 1YSCA 3BZWA 3LY7A 5HZMA 3K5WA 2BMDA 3AVQA 1THGA 3FN4A 5J4YA 3T8YA 3RD5A 3NOOA 4LWZA 4LZPA 1Q7GA 2CFOA 3IMGA 4MCHA 2ZGVA 5KTRA 4DSAA 1T25A 5H1YA 4RXMA 2DAKA 1E1LA 2ZSDA 2ZRPA 4JY7A 4F3CA 4PO3X 2L6OA 2GBLA 4ZQEA 3O4VA 5ALYA 2N0SA 4KVGA 2W0SA 4ZGBA 2PCLA 2RGUA 4OAOA 3KOUA 9ABPA 4TZ6A 3T7AA 4QYIA 1X86B 3C41J 4ZQBA 5I9TA 1RC0A 3LKDA 1P8AA 2OCDA 4TS1A 4BFCA 5GP1A 3HHWA 2FWNA 2KLBA 10MHA 2HGSA 3PX7A 5ICEA 5FWXB 4K26A 3E1KA 3NG1A 2Z6AA 1A2OA 3WGNA 1SIWA 3Q40A 2CVOA 3S1LA 2J6HA 3AOEA 1HE8B 4Z6YA 3VDPA 4GRDA 1O7JA 3E4CA 4REZA 1CJVC 2YBEA 1VL5A 2DZOB 5KWEA 2EKKA 4TM8A 2PRJA 3V33A 1YJCA 2YCBA 3AHCA 5ITTA 1T3GA 3TSOA 3LC0A 4AUEA 4BEWA 1A8UA 3TXAA 1YHYA 1E8MA 2PQMA 4C9BA 3CBQA 5BMOA 3NKLA 3K96A 4DIKA 3SU8A 2FVYA 3S28A 1H42A 4LFAM 3BH0A 1UWLA 3EW7A 1EHIA 4IDQA 4LNUB 1DHTA 4JIGA 5FT9A 4TLCA 1CRQA 4PE5B 5TPWA 3QKWA 4CISA 2PKYX 1AQIA 2D5LA 6REQA 1XRSB 2QYHA 3W7BA 1ACJA 1TUEA 4MKHA 2JAOA 2EARA 1F4LA 2ZRFA 4B6JA 2G83A 2IZ5A 1PJ2A 4F56A 1PNQA 4I5FA 2B4TO 2EFEB 2R66A 2AN9A 2O8CA 3QF4B 1USVA 5EGNA 2CLSA 1QKIA 4MLZA 1A69A 5E0OA 1ZIDA 5I45A 2A9QA 2R00C 4UDOA 1A71A 2ORYA 3DYVA 4NOOB 2QJTA 1J39A 3T15A 3ZBPA 4RKQA 2QXUA 3B2QA 4WTOA 3SF8B 3WGTA 1Y7HA 2WSSA 4O4JA 4BN4A 1SXJC 4B33A 4HL6A 3EDCA 4YLYA 2P2CA 3DTVA 4P92A 5BV8A 4H6VA 5E6SB 4H31A 2BL4A 3IEKA 5IW8A 3KV1A 2WU0A 3EUWA 4TV8F 4F91B 1EK2A 4PZPA 2QBYB 2RJ3A 3U4IA 4PIMA 1C0KA 1TH3A 2PS0A 2YOHA 4EI2A 5HHTA 1Z0UA 1I2AA 4WAUA 3THWB 3CUWA 2PKQO 1KYVA 3U3KA 4MYSA 2R8EA 2H54A 2AVDA 1NW3A 3STUA 3MG9A 1IUKA 2C88A 3QWLA 5AK3A 2A78A 3Q8XA 5A7FA 4XIFA 3AZPA 4RVGA 2X5OA 1VG0B 4RPHA 2G4VA 1LGYA 1OYWA 2CDBA 1QMGA 4LXTA 2QAGB 1KP2A 3EDRA 1MOSA 5JQGF 1AUVA 3D2LA 5FB3A 1YJBA 3TLBA 1PKXA 2YYYA 1XVAA 2PIDA 3C24A 4J0JA 4MZDA 1KDOA 4ECEA 1XZJA 3P9SA 4JX9A 4D5EA 4UMDA 2Z8XA 4QOSA 5C5DA 3WHLA 2CMFA 4B2LA 4W5NA 4BRUA 1T1IA 5TF0A 3FX2A 3RTAA 1X3LA 1QYDA 4PZ0A 1E2IA 2B21A 4F8EA 4E03A 1F8GA 4DMLA 2Y2UA 4WQMA 4LA4A 4ZYUA 3D4NA 1HV8A 1I2CA 3NAMA 1ZJ4A 2SECE 3LL4A 4DFDA 4YJFA 3G8CA 1UKCA 4NAHA 4DJDC 3K1JA 5DN9A 2J5BA 3HQ4O 1GPWB 2QN9A 1IHUA 3FCXA 2QVLA 1ANKA 1SCNE 3IAS6 3OU7A 3MWDB 3H5OA 2HA0A 1ZL0A 3RJZA 1BSVA 2BHSA 4MWCA 3QXJA 1YNSA 3UB4A 5IN4A 1QDEA 1KO5A 3JWHA 2CCJA 2IKSA 1Q16A 2NO6A 1NLZA 4GX1A 1UPTA 2B4QA 1PT9A 1SXJE 3QI7A 4PCAA 4YMUA 3EZ9A 2QJWA 3N59A 2WVHA 1MZPA 2ZYSA 5E6UA 3ISTA 4BCBA 2AXNA 3B52X 3GLIE 4I1UA 4DSUA 3NORA 3FOEC 2JGKA 2XB6A 1XLTA 2YZ7A 5DZSA 4D80A 5AVZA 4IFEA 1XYYA 2WA2A 1ND5A 4DUPA 1UC9A 2Z5GA 1HI9A 1P7WA 3DW1X 2VO1A 4M83A 2GAFA 2FPGB 4KQ9A 3N7UA 3R7FA 4YFVA 3JQ9C 1ISIA 3OI7A 4U7JA 4IVRA 1Z2NX 3JYNA 3FPGA 1LXCA 3L92A 4W5JA 2YWXA 3WQRA 2Q45A 1EQUA 5A0VA 4L9WA 3LMKA 5KUTA 1E9AA 1YQXA 1KQPA 1GGVA 1F7VA 3L1UA 4RULA 4V0LA 3O7WA 5LQJA 4QGHA 1RHQA 1MO3A 3DV2A 4IGEA 3K9GA 3R9IA 4Z4IA 4NENB 4GKKM 4QUJA 3DLBA 1XC7A 1XAGA 5FNZA 1YU6A 1ZFNA 5A4FS 3RLIA 2VNAA 5C32A 4HRXA 1GA6A 2BJVA 3ENQA 3RTDA 2ODBA 5DJ5A 1VRVA 3U4HA 1DTWB 3P2EA 2OWDA 5KQLA 4EW3A 3DLTA 3BGDA 2IXFA 2WZQA 5BN4B 1VCHA 1KR2A 1VKHA 3E4DA 3LX8A 4H1TA 5TVKA 2KE5A 2VHZA 4D8VA 3PWSA 4RC9A 1XEXA 3ZBQA 4G5HA 1MAWA 2JAHA 1NNI1 3LWZA 4O4JF 4IJKA 3WS7A 4WOBA 3IEMA 3RKRA 3UHAA 4PNEA 1CE8A 4O2BA 2Q5IA 1XKLA 1E2FA 3TW6A 4HFMA 3EWSA 1X42A 3ZWMA 1GTVA 5HZHA 1QZTA 3ZY5A 2OOKA 3DZFA 1ULSA 4TMXA 4HYTA 3ORQA 1YMQA 2HGZA 4NECA 1NMYA 3QYFA 3N5CA 1XJQA 3BS4A 3EIOA 4P5PA 1B6SA 4L50A 3B60A 3HUEA 2H8GA 2PCJA 4RKRA 5IZ7D 3GJ6A 3V8EA 4JQCA 4WN9A 3N58A 3U7RA 4DMGA 3NNNA 5AKLA 3CXUA 1E1MA 1U8TA 1BKDR 3SQXA 1D6MA 2P11A 5CT5A 1PT6A 1T8PA 2ZDQA 4EWLA 4Q7JA 1JP7A 3BN3A 3DVAA 4G1UC 4GH9A 1HXHA 2QV7A 5JS2A 3FPJA 3PPYA 2XE7A 1YD7A 2GETA 3EOZA 4ZA2A 2FS1A 1C7ZA 5BWMA 4D0NA 1I7QB 5CHEA 2JEYA 1YRLA 2N9UA 5AI4A 3NM6B 4MGKE 1FYWA 5AJYA 2HLPA 3L7IA 4DMKA 2HA4A 2N3ZA 3M3DA 3ND7A 2BZGA 4ZVLA 3KL4A 1T5IA 2VKQA 3JQGA 3PIIA 4G3XA 4FSHA 5CFNA 1G8KA 3X2FA 5KPDA 5BUQA 1JIUA 3MWJA 3TLZA 2MSDB 2PGNA 4WVLA 2BTQA 3KVOA 1J2JA 3PKIA 1B1AA 2RGYA 4G8CA 4M53A 4P3KA 4ER0A 4EVIA 1NOJA 4CKWA 1E7MA 4CZ2A 4RFLA 3I30X 1KMHA 2TSYB 2WUVA 1L5LA 1SBTA 3DHVA 1J7JA 1UFQA 3T0GA 1N2XA 2RB5A 4KJZA 1T4BA 4FOOA 4F3NA 1AZSC 4NF2A 1P18A 1RLJA 4QHYA 2ZE6A 4H7EA 2QD5A 1V9LA 3L0PA 3S5JA 4R2LA 1HG1A 3B6IA 1H22A 3ASZA 3Q7QA 3MAGA 1H8HD 4I8DA 1UJMA 2QU8A 1FYXA 3QEAZ 2Z5LA 4ZVSA 1KI6B 4O4IA 3WMEA 2VQEB 2PN1A 3KBBA 4QBGB 3L4JA 1GXSB 3ODPA 1OIZA 2VQFM 3GLRA 5CJ2A 1NHGA 4C3OB 5EG5A 2PVCA 3S2SA 7GPBA 2OOBA 2AEJA 2J3DA 4BNGA 1TMKA 5JNSA 2C9CA 5KX5F 5G2OA 4B4DA 4Q3NA 1M6YA 1F4PA 3RSHA 1BDIA 4BO0A 2Q8NA 2FUEA 5J5VA 3SHWA 1NUUA 4EEXA 2GBCA 2UZ1B 1X7XB 3D7KA 3RIMA 3VZCA 1O97C 2AJCA 2H16A 3NTLA 1XQYA 3EPJA 1QF7A 2L09A 5TT1A 4LXUA 2PTHA 1PZHA 3V4SA 3AVYA 5JSFA 4L2IB 4K86A 1IEQA 1PYGA 4OW0A 3OT1A 1XMVA 4GGMX 2SCUB 3OHSX 3DFMA 2YV5A 3BBZA 3C7AA 4N0MA 4CM1A 2CL5A 4BWGA 4F4IA 3JATA 2GDZA 4G1VA 2DTXA 2X6TA 2ZVDA 4PC1A 2GN4A 1QFZA 4QEKA 5G0SA 4A9AA 1DJPA 1UWCA 5CXXA 4NH0A 4AY4A 4GNKA 1UMBA 3BGVA 1NF8A 1PJBA 2X5JO 5FAXA 4BASA 2AN4A 2QR3A 2JKVA 2HIMA 3FTFA 5KZMB 3LZCA 3T5AA 3ADDA 2ZSUA 1TPZA 2E82A 1VEKA 2D0PB 3LT2A 1C30A 2D2XA 3DQPA 1IBLM 3TZEA 3AUAA 4AO6A 3LI2A 4HDOB 1E6UA 3UMVA 4CF4A 2JH3A 3SC2A 4KT0F 1ZSVA 3HX3A 3CIFA 4MDHA 2BWBA 3OD5A 1D5WA 3KLBA 4RHXA 4GS5A 4TZKA 1MFPA 2JGNA 4CVNA 3CG0A 4L08A 1KJJA 4BO6A 2W2MA 4UVGA 1U7ZA 1RIFA 4EA7A 4LI3X 4OHVA 1XK6A 2JFBA 4O2BF 3DQZA 4MRSA 2LPMA 4YXWA 4X62M 3EZXA 1BWRA 3L77A 3IKTA 4I5IA 1M9NA 1R4MA 2COKA 2PJZA 1G9TA 1BAPA 2PANA 1AF7A 3CNBA 1OHHD 2QNBA 1CRLA 1PZGA 4EL5A 1PX2A 4B3XA 2PMBA 2N1BA 3VYVA 3ZDFA 4HDRA 4G26A 3MCVA 5IYZA 1EX7A 3SC4A 1Z07A 4KO2S 4ZEXA 3L1HA 1MAHA 1BE1A 4RJJA 5JI3E 1CJCA 1VMIA 3PR1A 3VPFA 4RO0A 4GICA 3RUAA 4LHSA 3PG5A 1P1FA 4LWQA 5EJ6A 1U2QA 3AL2A 2J32A 5K0NA 3U39A 3SXUB 4JEIA 3NNSA 3L7LA 2PS1A 1NYTA 1JLLA 3THYA 3L7KA 1I5EA 1W581 3IR5A 3BSSA 1V1MB 3LHKA 5A9RA 2HCRA 3KE8A 1AUQA 3FDFA 4ZT4A 4TT8A 5CX1A 3MZ0A 1ITZA 2FWAA 5HKLA 4UUBA 1P1IA 3VUFA 3ABSB 5EE5B 3U26A 4LQDA 4NS4A 1F4IA 1W9MA 1FYFA 4PHGA 4DUYB 4XB6B 2FWBA 1ZD9A 5TXGA 1ZEMA 3S70A 4EJ0A 4NJMB 3L4SO 4PN3A 2JXNA 1Y8RB 1QK4A 4AF7A 1IZ7A 2M32A 5H70A 1EP3B 1OAAA 5GV8A 4CG2A 3P2MA 2ZUBA 5BR1A 4ZVMA 2VXOA 1QMPA 4LRTB 4ND2A 5DGDA 2QSFX 4CKEA 3T6PA 4O4IF 4ZEVA 2HB6A 5BR8B 1Z3CA 3WK8A 4EGCB 1W2HA 3I3OA 4ND3A 3HCRA 4CT0A 2UXBM 5LQSA 1XRJA 3LLMA 2FK7A 1UDWA 4KO4S 4MUJA 4OB6A 4X85A 5AKYA 4H1UA 4K9DA 4DLZA 1D0MA 3WO0A 4CWAA 1N0UA 3GMIA 3FCYA 2P5SA 2AV6A 4QNMA 3DUWA 3L4BA 4KWIA 3NBZC 1PS9A 4OHPA 1GGJA 4Q4JB 5H3HA 4DV6B 2FF7A 2ZJAA 5JXHA 5B6JA 2AD1A 3WWDA 5CA1F 5B7NA 3A11A 3SHVA 2M5ZA 3CF4A 3KR0A 4H7FA 4AJ2A 1RIIA 2QD1A 4G6ZA 4OYLA 4U7GA 4RUKA 3B20A 1U1GA 3G49A 2CVQA 2IE8A 3QBTA 4S3MA 2R84A 2FNAA 4LJ8A 3QI2A 4KKXB 4LHZA 2JP7A 2WE8A 3H8JA 1P4JA 2CZCA 1W44A 4NCXA 4WY5A 3QP9A 2IP4A 3NBIA 2BI8A 1IBSA 3BSWA 2HC9A 3SAWA 4TQAA 1U2SA 3ANSA 3MWKA 1EP2B 4UAGA 1CUZA 1YL7A 1E99A 1SURA 2JIBA 4ZEOA 3UN1A 1IM2A 1C5KA 1XTVA 4CHTA 3PJEA 4Z7JA 4JLVA 1FK8A 1BU8A 1NAHA 3UBTA 4EJSA 3K1AA 1WXXA 2VXCA 3KQWA 3WNVA 2W2OA 1IN4A 2OGUA 2GBGA 5KVVA 3FZQA 5BPVA 2J0EA 2VOJA 3OIGA 5KVAA 3BFVA 3EZ6A 4G4NA 4BNLA 2CXSA 2GR9A 1UK8A 4MVJP 1W88A 5I7EA 1B42A 4WJLA 4JEMA 4GM4A 4RVDA 4XVCA 2B35A 4YB8A 1EDEA 3LYUA 2F7SA 3W5VA 1VI5A 1HQDA 3HJBA 4YRSA 4M0PA 4YMHA 4JI7B 4KPUA 4A03A 4LRXA 2FFJA 3WE7A 4IZ6A 4OBBA 4AQ7A 3SZMA 3EAQA 4K81B 2OLKA 3MTIA 5CEJA 3OJLA 1C1DB 4FMDF 3TRIA 4GSLA 1V16A 3NOXA 2IY9A 4CV0A 3NASA 4K1XA 5CFLA 5DYIA 1LB1B 1DARA 2IYWA 1C1HA 4W7SA 2YXBA 3PDWA 2XYGA 2AF4C 1Z36A 3LCVB 1QRRA 3MJHA 3NW9A 2NO4A 3FHOA 1FNBA 3P1JA 5FORA 1F0YA 5DP1A 1K89A 3KSMA 4D42A 1GTSA 4BVLA 1KHHA 1AZTA 1Z16A 3FNEA 3CH6A 3ZNOA 4B82A 1C7JA 4IRXA 4MQMA 4WE3A 3FPSA 1O6CA 2Z56A 2V8BA 2J3QA 3R0XA 4OXYA 1KIFA 4OJTA 4M1MA 3B1JA 4BO4A 3WJAA 4UOZA 2C2ZA 1F5NA 1CF9A 5AHKA 2LZ0A 3CRRA 3HRIA 4I1VA 2XDWA 5L9AA 5AXCA 3FNGA 3T7CA 1K8QA 4OO3A 1HGXA 1WGLA 3TSZA 4CR8A 1NVXQ 1N3BA 2CYAA 4PR0A 3F6RA 4UTVA 1FPMA 1L4MA 1QE3A 1JQAA 4IQFA 1QLHA 3CS3A 4H4CA 4DXDA 4OJYA 4E0BA 3C48A 1R7RA 3E05A 2R68A 1NXQA 4QXRA 3TECE 2FUG6 3O84A 2JCVA 2HSEA 4BO2A 1G21B 5DVZA 4FE7A 5TLSA 3MFYA 3F9IA 3GJRA 3GJTA 1UKBA 4J1TA 3EBPA 4HXYA 4ZANA 2VPZA 3UUEA 2KJQA 2ZG6A 1B73A 1DJNA 1QP7A 1JU9A 4QJ4A 1ULAA 3IHPA 3X1JA 5G0UA 1ZUNA 5H80A 5CB4B 2WVGA 1CNFA 5HS6A 4DNQA 5GWXA 4EI9A 1RJWA 3N28A 4JZKA 2B2NA 1SBCA 1GPBA 2QORA 3W6UA 1H2RS 1AM4D 2M6RA 3LT1A 1H9BA 3TW4A 1KL7A 1ZNXA 1RRGA 1M7GA 3KJXA 4ZQCB 1DFIA 4BFSA 2PL5A 4N0DA 2XDQA 1T1RA 4ZPXA 3ITEA 3VZSA 4CU2A 1OV6A 5TQVA 5I9LA 3PXCX 4E09A 3GDHA 4ZCSA 4BYGA 2R3SA 3ZCSA 5EIWA 4HJXA 3DO6A 1V4VA 3V6MA 4BO1A 3TPFA 2ZUEA 1HTWA 5FP0A 2EFDB 1F48A 4L28A 4HWPA 2D3WA 4JHXA 5LVAA 2QUIA 1T1EA 2JHAA 2XNDA 3EXHB 4LFBB 3G3EA 3HJ8A 1MF7A 1E2UA 3NHYA 4L5CA 5EI5A 1Y4AE 1IMJA 3NYRA 2XMZA 3HVKA 5LMUM 2Z3XA 4JJ7A 3B7WA 3WR5A 3IQZA 2H1CA 1JR3D 1QR6A 4MHOA 2ZBPA 4QEZA 3DF9A 4BQOA 5DLEA 4U9HS 4OD0A 2W6JA 1HNWM 3QYAA 3D3WB 4BFZA 1PR0A 4IICA 5D3MA 3VVCA 3OMXA 2VDPB 3U1BA 1H5UA 4MEAA 1R9MA 2FSUA 3QU9A 5KJCA 5EUQB 3QU5A 4MKZA 1AUXA 3CE9A 3ZXUB 4CM9A 4F2GA 2EQBA 2M9MA 1OX4A 3H18A 3NS7A 2IH4A 3HXQA 4X00A 3PEEA 4RDHA 4FNOA 2BUCA 4PZUA 1G5IA 4NMXB 1DUVG 3GQ5A 3IERA 4WGGA 5THQA 3UTCA 1QQWA 4ZDWA 2Y0DA 3LC1O 3BCRA 1CUHA 1C8LA 1G71A 4DDVA 2W8BA 1F1JA 1IH8A 2ZVJA 4EYSA 3INTA 4PZCA 4KN6A 3FMVA 3ZW8A 2WUFA 3IP6A 3DV0A 1B2LA 1CY1A 4BGIA 5EP4A 2IYNA 4XEHA 4PIVA 4EJ6A 3PQ8A 4PYNA 5JH7A 1EXNA 5LLDA 1VJ1A 5IFKA 1T1GA 3HLTA 3TLYA 3KOYA 1I14A 3I9V1 3ASYA 5J63A 4JI8B 3IULA 2J5QA 4BLRA 3KSUA 3OLVA 2V7WA 4HZGA 4IHJA 1M1ZA 1DI0A 2B25A 1FRZA 1AGNA 2ACWA 1VBKA 2CWWA 3AOGA 3P32A 1E60A 2VAXA 2GN8A 2JFUA 5H68A 5IRCD 5GONF 3STTA 1G20A 5AW5A 3WLPA 2XMRA 5HE9A 3LP8A 4X61A 2UUCB 1CQJB 3BJIC 2FV8A 1MU0A 4CODB 3V3KA 2YMPA 1H0RA 1YOVA 4YQYA 2JI9A 4AY3A 2EWMA 4RZQA 3MA0A 3SEQA 4J3FA 1SCUB 4AB1A 1UAYA 4MEBA 2P41A 5AJWA 1N6OA 3W90A 4CQJA 1SVOA 2G3YA 2VDJA 3EE6A 4H6XA 2I4RA 2K2WA 2QJFA 1NXXA 1J0DA 4G4SP 4YV1A 1ISRA 4HBGA 2NZXA 1YVUA 2I22A 2YFYA 1RZ3A 4R8LA 3THOA 1K68A 1M6HA 2E2WA 1NWHA 3MMPA 4YA6A 3CZ5A 1PRYA 3IS3A 2QQFA 3DP9A 3NH6A 2D1QA 3EC2A 3DS8A 3B82A 4M86A 3CEPB 4UM9D 3RHZA 2JVJA 1KQFA 2PKWA 2C2XA 2WTEA 5BW5A 1OSNA 3IFSA 4PVCA 3F3MA 1YI0A 3DL4A 4JBHA 3U62A 1VYUA 3DCJA 3ILKA 5F5NA 2FWMX 4MH0E 3IAHA 2N46A 1LY1A 1CB0A 2WIJA 1ONPA 2OGSA 2ECQA 3GFTA 4KYTA 4ZV9A 1ELOA 4GOKA 1RSZA 5AKEA 3JQAB 1VMDA 4AO7A 2VT2A 3NX4A 5JZ9A 3HVIA 3A32A 1P6UA 4EKGA 2IXTA 4O25A 2UVPA 4YRDA 4HDMA 4KR0A 1Y5MA 3RPEA 5HIJA 4W5TA 2QN1A 1KRXA 2QR5A 3V2HA 4DA9A 2IQ5A 3BBLA 5JU6A 2IZOA 1IBMM 3U7EB 3DOUA 2C31A 4H2DA 1OROA 3SSMA 3DKPA 4L9RA 2QN7A 4RS4A 2F9FA 1F8FA 5IABA 2IUYA 3EXG2 3KK0A 2LNHC 2YNMC 5H3LA 4BLQA 3OTWA 2IHNA 3WMRA 1YR8A 4GG1A 4F3RA 4A8JB 3K72B 2IGBA 3DBLA 1TUGA 2ZRBA 5F9FA 4RD4A 4BP3A 2DVWB 4HK4A 3JQPA 2C0PA 2EKBA 5CHYA 3OX1A 4ZYXA 1KZ6A 1C9KA 5LBUA 1ULHA 2V7VA 1EK6A 2QU7A 4YJ3A 3L1VA 4ARIA 2CV2A 4BEVA 1RDFA 5MF6A 5F76A 4OLBA 3VNUA 3MIZA 4Q9DA 1R5LA 1Q3KA 4K9OA 2EP5A 3V55A 2WMOB 4R81A 5JZMA 3WGMA 2W11A 2KZUA 2OD9A 4B47A 3STYA 4DSTA 1O89A 1ZK4A 5B7GA 5EMMA 3K1TA 1YR9A 4UE3S 5NLLA 4GECA 2GN2A 4MVJI 3THXA 3ZTYA 1PSWA 1IHYA 3ZE9A 1Q0TA 1ULZA 3LQ2A 4FFVA 1VI6A 2DBYA 2AJLI 1GABA 4F97A 1UP7A 3EZGA 5EZ6B 1ECFA 4C4AA 2V6BA 5JANA 1JJIA 2REQB 4J0KA 3O8CA 4C30A 4B2IA 3OM0A 2ZAGA 1DOAA 3NKVA 1GZUA 3ZY2A 1OTXA 1YLAA 4HPWA 5T4HA 5ALLA 3LJKA 3LDUA 4LYDA 2G0TA 3UCEA 3K70C 4MIEA 2VF4X 2PT5A 2VOEA 4AZ3B 1KZ4A 2W5UA 2XJ4A 3DE6X 1T2UA 4E07A 1L2CA 3R6WA 5ETJA 4AK9A 3CCFA 3ZZUA 3VPBA 3OQHA 3FUWA 4FEEA 2NQ8A 1YR2A 3TNYA 1UBMS 1NQUA 4DSZA 1MABB 5JH7F 2F3TA 2DETA 3EZLA 1RCFA 3ESDA 1N2BA 5MFPA 4BKUA 2Y6UA 1M6VA 4D4KA 1OWOA 5LM3A 3FSGD 2FMIA 3MOIA 4TKUA 4IHJF 4TKVA 1IEXA 1H9CA 3WSWA 3E9YA 5ESWA 1P72A 5HXAA 1CKEA 4QUBA 3WTBA 3JRXA 1FYVA 4FILA 2HYDA 5TV2A 3RREA 3CLSD 1J00A 4EX7A 4ZCQA 4ER6A 2BKEA 2HSWA 2ZUFA 4M55A 1CC1S 2C3PA 1R2YA 2Z4TA 5ICCA 3V2UA 4HAVA 4L0DA 3VYUB 2KSQA 2C42A 4HLNA 3N2EA 2GVNA 3BD6A 4Q18A 2PZAA 5ES3A 2VI5A 1T9KA 5JECA 2QJRA 5HEKA 1V3VA 3SG0A 5CP8A 3AR9A 2PAFA 4AKGA 16PKA 1FX1A 2WJGA 4LC9A 3ZXSA 2H29A 2O59A 2YFQA 1CY7A 1UP4A 3HSSA 2QNIA 5U1PA 4YJGB 1KAHA 4RSMA 4Y2XA 3M7GA 3OCJA 4UBIA 3FYUB 1YB6A 1MIOA 4CDNA 4J90A 2X5KO 1YFLA 2ZI9A 2NYUA 2QDXA 1GVHA 1GQSA 4DSNA 3R8XA 2JWSA 3V32A 3GUZA 2MINA 1T9GS 4TV8B 1KAQA 2PLWA 2RRUA 5I4CA 1TJPB 3GAMA 4U9UA 4TTJA 3K3PA 3IO5A 2GPNA 2ZRIA 2CNLA 3Q12A 4YQFA 3A1TA 3IP5A 3QU2A 1SK9A 2BGUA 1F4VA 1ICEA 1M72A 4KDCA 2WJWA 3WSVA 3PHIA 1CD5A 4HYYA 4G2NA 1KE2A 1UBHS 1WWKA 2PA0A 3EGWA 2FUCA 3E9QA 1RQRA 3KALA 5HILA 3HBNA 3S2EA 1G9SA 1LS1A 1MU5A 4I55A 3GPDG 2H5IA 2QI9C 3ME5A 5IM4A 2EBWA 2R00A 3IKJA 4KXXA 2W82A 2IF0A 3KWLA 5E3JA 1WY5A 3UA3A 4ZEWA 4V38A 3KQKA 3OFND 1A95A 3N2KA 5JQGB 3MBIA 1SXJA 5L3QA 5FLYA 3NEYA 2BDTA 1WF3A 3NHFA 3TI7A 2GN6A 3HDVA 1N5OX 3AHHA 2BUBA 4E2ZA 5A62A 1D2CA 4GBJA 2Z5FA 3WDLA 1DKQA 4KQXA 1LFAA 3GLIA 4IIVA 2B30A 4G0OA 4JKOA 4QSMA 3ELWA 1T2AA 2RGRA 3H5LA 4C4OA 1VRWA 5T7BA 3HYLA 5I5GA 3D3KA 4AJ9A 4REQB 4L7QA 5B58T 4HF7A 4XSHA 2NO1A 4IKPA 1M5UA 3GF4A 3SEFA 4YJ3F 2GNAA 3T7IA 3EGXA 3AESB 3FBWA 3CLUD 4PXAA 1P81A 3D3JA 3VDMA 1WHSA 5BYBA 3D9QX 1QOPB 4G5OA 4FGLA 2CL0X 2Q3DA 1M2FA 5IUJC 2H1RA 3KVYA 3AVOA 2A9KA 3KR9A 2N42A 3K9BA 2OV3A 1TKRA 1KH2A 1SR8A 1CDZA 3DZBA 2D7HA 3FWYA 3FNHA 3DNPA 4PPFA 4G3OA 1B00A 2VJKA 1I1HA 4DS3A 3DMTA 2RK4A 3Q8WA 2MMCA 2RGBA 2PK3A 5BSGA 5DISB 5BYKA 4QUGA 4MVJM 2CXNA 2JLSA 2HJWA 4N12A 1TK3A 3ON5A 1AXEA 3V80A 4GIBA 3K9HA 3GO4A 1I80A 1PUXA 1QUTA 2JCSA 5SYMA 1MJGM 3WLHA 2XCTB 4TMKA 4DUGA 3L7BA 3NFRA 1WUYA 4IQ4A 4LGCA 4XYGA 2ODEA 2BD0A 2AQHA 4Q21A 4K6GA 4XVUA 3TDKA 4U2DA 5EJFA 4NYJQ 3FTDA 4M99A 1FP6A 2B1RA 3O3NB 4RFSA 1VPEA 3ZHOA 1K3WA 3CEAA 4M0LA 1HL3A 4W1PA 1VDMA 1YTUA 5CLGA 4OG2A 1GZDA 4DZTA 1YCDA 1ATIA 1ZIPA 2XA9A 1QOZA 3F92A 4KXWA 5AHXA 2RAPA 5U4QA 1AXGA 6REQB 1JDVA 2VSXA 4HH3C 5YASA 1PT8A 3BGOS 3RUIA 1PHPA 5E7QA 4POAA 3HC7A 1KY4A 2ONKA 4JV5B 1TRKA 1NFQA 2ZROA 5H02A 1POXA 2BOVA 3L06A 1L4UA 4H7PA 4IYJA 3ZWAA 3JQ9A 2P8SA 1W19A 1ZZGA 2QY6A 2R4UA 2LKCA 5CK5A 3THGA 3EEYA 3G5LA 2W6PA 4ARZB 4TQUS 1XIVA 5TMBA 3C97A 1GUFA 4ERXA 2BKUA 1VEGA 1AKYA 1HTBA 3V48A 3QVLA 1IBRA 1PGPA 1NN5A 4W8OA 3F6PA 4O4JB 1Z45A 5EWJA 3CLTD 2E87A 3DTVB 3D31A 4DM3A 2PWYA 5E2IA 5EESA 2LP4Y 4WRRA 1CF2O 2BRUC 3ZU4A 3RJMA 2DWNA 1J23A 2Q0QA 2UUBB 3BMNA 3UOWA 2I0FA 1YVPA 2FKAA 4DM4A 1W4RA 1P17A 3ISVA 5BNWA 4KQKA 4AWBA 1NJ5A 5D5QA 1GILA 4P3NA 2GK4A 4FHCA 4B31A 4C4RA 4MAMA 4C6TA 1H5QA 1W25A 5J4VA 1D8AA 2WIBA 4WK0B 1JIVA 3WNCA 3EXFA 1GNPA 2KI5A 4LBVA 2VNSA 1UT8A 3EGIA 2B8NA 3DZGA 5A5FA 2H52A 2E7ZA 2D5AA 2QIPA 4GMDA 3Q8MA 4FR0A 2ZVQX 4IFBA 5ANRB 3SQOA 3NWBA 2ODTX 1DJLA 4O3MA 3M4JA 3IHLA 3MJDA 3AR5A 3HWSA 3D4LA 1EUDA 4ZJPA 4OQXA 5TT0A 4RELA 3UVEA 5B1YA 1A7UA 4N6GA 4R1OA 5IVDA 1Z5GA 1ZP6A 1A9ZA 2OBLA 5AMXA 3T3MB 1JHRA 1SVIA 3L49A 2O2HA 4Y2YA 3FFTA 1NVGA 3GCWA 2DUNA 2NSLA 3VBCA 1SHJA 4RH0A 1ESMA 4XXHA 5JR3A 4DHWA 5DNYB 3Q8LA 2V7QD 2XNCA 3QPCA 4L3OA 5CNKA 4Q01A 5JS8A 4ILEA 2OO5C 4U7HA 3W06A 3WMWA 3VNAA 3RM3A 1UKYA 3NIFB 1NSTA 4HJRA 2PUFA 2CUKA 3RV4A 3OM8A 4L9AA 4XX1A 1GAJA 5JNLA 4R2KA 2O8FA 3VC2A 4GOOD 3V1LA 4FXOA 4CEHA 1KJWA 1TM7E 3DUFA 2A1TR 1JMVA 3GGGA 1UJCA 3Q2OA 1VKJA 2GHRA 1PGNA 4RNAA 3F5DA 1N1MA 4TT3D 5IEBA 2FPMA 1X8XA 4ND4A 2H9IA 5FJJA 2VP0A 4UBOA 5KSOA 3PE6A 2IS6A 3F7TA 1AK1A 3A26A 3V8QA 1KORA 1Y8CA 4J75A 4UXJA 1KO1A 3QEOA 1ZMBA 5KX5B 5IG2A 3WA7A 1B74A 421PA 1QO7A 4FCCA 5KTOA 3JZMA 5KKAA 1SK8A 5E6UB 3GJSA 1G9XA 3ZD9A 1DMSA 1GARA 3ZJTA 2AX4A 2HBQA 1XCLA 4EF4A 1RKVA 1XE3A 3ECAA 4KI0A 2IPAB 5IWAM 2VNJA 1ZGAA 4RA6A 4BMVA 1PG2A 4G8JA 1Z26A 1FSSA 5IBQA 1WBJB 3B6EA 2VDVE 1A96A 3SFTA 4U0JA 4QECA 4DV3M 2Q7DA 5H5JA 1L4FA 1NI4B 3VC3A 3L82B 3O2QB 2GEDA 2CEAA 2PXXA 4KNWA 1M2JA 4UTOA 1Y7PA 2ID4A 1Q39A 4LE1A 2D2IA 4PN7A 2DC1A 4DWJA 1F8YA 4FFSA 1J1UA 1SD5A 2HJVA 1VYVA 3C6BA 1BQ4A 5JZSA 3QXXA 5B1EA 2OHIA 3QNWA 3NO4A 4D3XA 4HAZA 4XB2A 4WDQA 3L27A 2F62A 1RWMA 1C7RA 3LBNA 1SVWA 2JJMA 3G1WA 4XFKA 4Y6PA 3ZEIA 2EG5A 1N0WA 1NMXA 1QGZA 3Q85A 5IK2A 4F71A 3A6ZA 4JQZA 2LTUA 4RLQA 1W0KA 3ROPA 3ZU2A 1QU2A 3M1YA 1NXPA 4ENQA 4L8VA 4YCMA 4FJ2A 1E4YA 3C8UA 4JI6B 4R69A 4MIYA 4RKUF 2QTTA 1EHYA 1FQJA 1D6JA 4KFTA 3LQYA 4BFVA 4IIGA 3T7KA 4ODIA 1A9SA 3X2SA 7CATA 5C7OO 1NGSA 4OXKA 3AERA 3GJ3A 4WZ6A 2B4YA 4MUFA 1EWKA 4O2BB 4EYGA 2FG6C 1AN9A 4GMFA 1AQYA 2IX9A 4U00A 2IU4A 4GSYA 3A9SA 4RMJA 3N2YA 1OZ0A 2PX8A 1XNJA 2CL7X 5GZ3A 3E2PA 4ESVA 3A4YA 4B84A 4LVNA 3ZV3A 3TWOA 4G0NA 4LGMA 1KPIA 3HHZA 3QMWA 1EHCA 3REQB 1NN0A 1TFRA 2D0DA 3V1KA 1TXGA 5C81A 3QVGA 4C05A 3KOOA 3CHYA 4NXNM 4KTTE 2ZZMA 5TNXA 2AE2A 4FYJA 2D13A 1L7XA 1X1QA 5REQA 3L93A 4RNDB 1BC5A 1QIDA 3UH0A 3HEBA 3F2VA 2D5CA 3DDHA 2XA1A 3KPYA 3EDYA 3ZE8A 3V6LA 2XCRB 5AIBA 1BFKA 2C54A 3WOHA 1K5HA 2G76A 2PMFA 1HYEA 1LLUA 4DQDA 2XZLA 2HM7A 2K9DA 5ALDA 2AQ8A 3ZVNA 3IYLW 5JCXA 3JQGB 2F1RA 1V5WA 3UENA 4Q9IA 1EDDA 4XOIA 1QPZA 5JZVA 4HRVA 4BJ5A 2EJTA 2C9OA 1UZAA 2PUCA 1PJ4A 3WI7A 5LJIA 3AMVA 3H8VA 2BTQB 2GKOA 4PLTA 2XNHA 3E48A 4DV4B 4P7GA 3CTMA 4MKGA 2FLVA 4G0XA 1BDMA 4CKWB 4JVMA 3PNOA 2VATA 1U4OA 4UHCA 1KMHB 2R6ZA 4YP7A 2GJ4A 1KO8A 4B0OA 2JI6A 3F2IA 4MGYR 2WKWA 1PDOA 3R4VA 1E5DA 3BWVA 4BOYA 3NBAA 2JIPA 1UBJS 3BXGA 4WA8A 2FY8A 4ESEA 1T36A 3DJFA 4O4IB 2GFQA 4Q93A 1HYGA 3PGMA 2NVBA 4J76A 3OUUA 1NMEA 4OMCA 1X39A 2Q7XA 4Q9KA 4M9QA 3NHPA 3MT9A 4ML3A 4UUMA 1SWWA 1CTQA 4LOLA 1EM8A 2GPYA 2VHUA 2VL7A 4RK1A 2VS1A 4ZVOA 1Y1SA 1D2GA 3IHWA 5EIAA 3UUFA 4V3BA 3W5DA 3PGXA 1USWA 1H1LB 3VOSA 3WQHA 1CUEA 3C3KA 5CA1B 3JRNA 5IJ0B 2FFQA 1WHCA 1MEOA 2QQGA 5ALWA 3GYBA 2J5KA 3O8OA 1L3IA 3C8HA 1RXWA 2ACVA 4ZVKA 3VNRA 3ANNA 3TX6A 3OT1B 4ITUA 4XJVA 5DTQA 4FD2A 1WUJS 1D09A 2X0IA 5CEFA 1DG3A 1E1DA 5F78A 1ODCA 2NXNA 2X4LA 3I32A 4MX8A 2I2WA 1HURA 3OT4A 1HNZM 3KELA 4IR7A 2O6LA 4ED9A 4YC7A 3ZXIA 5KWSA 4RSHA 3AUJB 4CT5A 1NUAA 3RS4A 1HDEA 1UMBB 3I3SR 3DD5A 1E7WA 4UBKA 5AICA 1E7RA 2PEZA 4K6MA 1CS0A 2JLYA 2ESRA 2YY7A 4OK5A 2KDLA 2D7JA 2HT6A 3LBFA 1SUWA 3KUCA 3AVWA 4GSKA 1M0WA 1ZVMA 1C30B 3E21A 1Z68A 3K8YA 2QMOA 1FSGA 1I4DD 5CVVA 3ZPXA 3W9SA 3PIDA 2IXBA 1JHMA 4OXIA 1KDZA 5LC1A 1P2GA 4D6YA 4UAUA 3R2JA 2W6ID 4YRGA 4RTKA 5TQ0A 2R8BA 1QXSA 2A5LA 3SC2B 4RPLA 5BWCA 3SIXA 4I7EA 4ZVVA 3AV0B 3UAOA 4JL6A 5GPBA 1TLFA 4EYEA 3RSQA 1GSAA 4FDTA 4QYSA 5FBQB 1BQEA 2XUOA 3YASA 3K2EA 3VTZA 5LWQA 1GQYA 5JSQA 1U5BA 1UFVA 1ENPA 1GLVA 1P3Y1 3IO3A 4RK0A 5MN6A 3IDZA 3TLCA 1CUGA 4ONEA 2VLIA 4HD8A 2CD7A 4FMDB 5A0FA 2I2BA 3B3QA 1JDZA 3R5HA 1R4MB 2ODPA 2YL2A 3GLTA 4HDQB 1ZR2A 1GAEO 3WAGA 4R0MA 2A4KA 2XDYA 2OCLA 3IR6A 4TL9A 2OL4A 4MV5A 1F9AA 3MYYA 2IJGX 3BULA 4HDRB 4EG1A 1P1KA 1ADJA 3DO5A 1P4AA 4Y2TA 1KDYA 4TYYA 2FQWA 2EZ9A 1VLHA 1JV2B 4DCNA 5EHIA 4UTPA 1LCIA 2I2CA 2C8LA 3W05A 1KQNA 1AKNA 1VHJA 3NEJA 1VHQA 2N47A 4WINA 1KVSA 4GGPA 5AVUA 2Q41A 3VH3A 2X8WA 1GKLA 2GA8A 1T2EA 3EVTA 1W29A 1ST2A 4KLAA 2IPNA 2O0MA 2ERXA 3THYB 2F1JA 3UJ7A 3IQGX 2I87A 2Q3HA 5F73A 1YS4A 4YAJA 5ADWA 5TDHA 2GTPA 1Y0BA 4LG2A 1UZNA 1GCUA 2QRPA 5AW6A 4UUNA 2WSMA 1UH5A 1EVJA 2XXAA 3NVDA 5CX1B 2R60A 1UXIA 5LXTA 2ZQYA 2A7XA 1ZAEA 4MRMB 4KUHA 2Y1KA 3AY0A 2WSFF 1LBSA 4RA9A 3B51X 2WIDA 5KHLB 3PCTA 3FVQA 4BX9A 4KXNA 4E13A 5DULA 2H51A 4KEAA 5FA6A 3NV9A 2PXAA 2EIXA 2WB4A 5ADVA 2ENUA 1THTA 4K9NA 3P4YA 4IDFA 2EYQA 1Q02A 3PFNA 3N39C 4CKEB 1L7PA 4RSGA 5FEUA 3CUKA 3WB2A 2XKAA 4QOJA 1E3EA 2F5OA 2A1UA 2C9MA 1MRZA 4PQRA 5GJCA 3AHGA 2O57A 5P8WA 2HL7A 1Z8HA 2V96A 1VCIA 3OO1A 1H4QA 4P38A 4TSFD 2PWZA 3PQDA 3EVCA 4KUGA 3MGKA 2FSGA 3RYFA 2Z1MA 3GL9A 2BC9A 4F9FA 1CETA 4J4TA 3T1YM 3W9YA 4L02A 2D1FA 4P53A 3DPIA 1ZUIA 2IS1A 1QCCA 3EHDA 1Q3HA 1FFGA 4RAQA 3BQNB 2DH6A 3EPLA 3MGBA 3HJQA 3T7TA 3C1OA 2JBWA 1IY8A 2CC2A 1YL5A 3BBPA 4R6WA 1YA4A 3NZEA 3VR4A 4ZCTA 3DR3A 1KMMA 3G0BA 2WPDD 3LPDA 5J43A 3OBBA 2D7CA 3K2BA 4KN8A 4P4LA 1YS1X 3IB3A 3RF6A 2XSZD 2J4DA 1XA3A 1OC2A 3RH0A 2F00A 3QHAA 3TSCA 4DA4A 3OECA 4JOQA 1DAFA 3EQ9A 1MJNA 5F51A 4C0KA 2VBGA 1L3BA 4O29A 5BUCA 3OKCA 1NBOA 3KZVA 1ZD2P 2MWMA 1NBWB 3H16A 1C3XA 1SZCA 4LWPA 4DR1B 2WJ4A 2VTDA 1W4BA 5LKRA 4CHTB 2ZB2A 2K87A 1KP3A 3IRUA 4PANA 1OR8A 3IELA 3K1AB 2P62A 1R6XA 2P6OA 5L4NA 1JH8A 3C4VA 1QP0A 4GMXA 5JZOA 2XF3A 4LTMA 5A4AA 1OWMA 3UWDA 2XH9A 4TOIA 5E1DA 4RHYA 3COSA 2DAMA 2O8EB 4NEGA 1L5WA 5K0CA 1R5JA 2ZYDA 1WMFA 3B9PA 1QZMA 1W88B 3KS8A 7ADHA 5GZ6A 5DOZA 2O8VA 2C95A 1N92A 5K99A 1E9VA 2BFOA 1CUCA 1P31A 2J7PA 4R2IA 3SXJA 2FR0A 4RXTA 4U7DA 5ITSA 2LUOA 1E0KA 3ZDZB 3AR6A 2P91A 1WDKA 4KPUB 1IXZA 4UU1A 3V8VA 1LW7A 3LHSA 3E7XA 4NZOA 1P0FA 3PC8C 3HK2A 3R0IA 5C37A 1OKKA 3LG2A 4MJXA 5KTTA 4PDGA 1V16B 3GJQA 4D92A 2FW6A 5GONB 3E70C 3HU2A 4XPIA 1TYEB 3BIWA 5IYZF 1TQ6A 4JT8A 1H1DA 3GHHA 2ZUDA 4ME6A 2HPAA 4Q9NA 1ZC3A 3MS4A 2NAFA 5EJGA 4EKDA 1VZ2A 1NXWA 2B8WA 4XDZA 3ZWVA 3TZQA 3GFOA 2GEJA 4X24A 3GT0A 1CERA 2NMVA 1X87A 3H3FA 4DJTA 4Q19A 4R8KA 4WNAA 1CQZA 4MDEA 3ZWPA 2FZWA 2EHDA 2RFLA 2X3YA 3R7NA 3VKUA 1PJAA 3FCEA 3HMKA 2WNSA 3FGZA 3STHA 4W82A 1FNMA 3L40A 2HF9A 3KWFA 2LVNC 2UU9M 1ULTA 4IM7A 1PK9A 3C6MA 2P9YA 1GA4A 3DWEX 3PEVA 2GCPA 3DAPA 5K3SA 3USCS 2XLJA 4DBZA 4AUKA 3DFUA 4DZRA 2JGRA 2P27A 1P7YA 5ALXA 4UAVA 3UAWA 2QZ4A 5LXTF 3KVWA 2WWXA 3KB1A 1FFHA 1JBKA 3MCUA 3KCQA 3E2IA 4BJ1A 3RUPA 2QX9A 1KETA 3DFZA 2Y1WA 3I6IA 1R2ZA 5KDLA 1B0UA 4NR0A 1NUPA 2IZ6A 4CCYA 2FN7A 3B9BA 3B6ZA 2E4ZA 4ZYZA 3R5SA 4JI5M 2XMBA 2FDRA 2CCKA 1FLAA 1DGHA 4BLSA 3T35A 3KJEA 1NQ5A 1Y7IA 1YAHA 5AJHA 1NVDA 1Q0HA 1CBUA 2PR7A 2JLXA 1A1VA 1BHJA 4LCJA 4W9NC 3U7HB 2NQTA 2ZRAA 1RBMA 4TS4A 5T3YA 1ZUNB 4PX2A 1GDHA 2QZ9A 4BWVA 1GPAA 4EGSA 3RADC 3N8HA 4O4LB 5CMLA 3LQQA 4L76A 4AT1A 3T5CA 3FHJA 1MNQA 1Z5VA 4K9RA 1FTSA 4R01A 3ITKA 2XDAA 1ZM9A 3TKYA 4Y2HA 2QMYA 1RYMA 3QVSA 3R6TA 3ENNA 1XKTA 3GZNA 3FNIA 1PQWA 3GGSA 2DHQA 2XDQB 1V47A 5JD6A 2X0FA 1H3EA 3RVDA 3E8MA 4LYYA 3SHQA 4UHHA 4PBSA 3HTXA 5KBYA 3FUUA 4PF1A 1QFSA 4F4DA 2DQKA 1GITA 3WFIA 1BGWA 4B3TB 3IT3A 1G64A 4EBBA 2PS9A 1XZEA 1ZQ9A 5HFNA 1ODFA 3WLIA 3EARA 4BN0A 2IYQA 4I8XA 2DAIA 3H5TA 2J7KA 3J7AC 2QW0X 4EO9A 3E8SA 4HLCA 1AU9A 2XCSB 3WRYC 1LZLA 3DJYA 3F0TA 3MSCA 4WECA 4D8TA 4D3YA 2Y0QA 1BXGB 4WLFA 2AI3A 4JN6A 4OQFA 5GM1A 3QWBA 4CM4A 2OXEA 2NUAA 5D3MB 3KU4A 1N4AA 4GPIB 2C0CA 3GLQA 3GNTA 5JMOA 4RTPA 2LBCA 3ESRA 4N7BA 2OYRA 1OX4B 1HOTA 4Y6GB 1VYTA 2YNMA 2XRZA 3QEMA 4AJLA 3LO8A 1DINA 2PPLA 4JR2A 3OM9A 1G6Q1 4URFA 5K09A 2CLFB 1JPJA 4KOEC 1U9YA 2C4TA 1Z5NA 2W8BB 1ZX1A 2RHJA 3M5CA 2G63A 4E5NA 4ZC1A 4OFWA 2HHHM 4JGGA 1NRJB 3RABA 3T4XA 4JP2A 3VU9A 5ALGA 2EV9A 3KPUA 3R7LA 4WKGA 3TI9A 2PRKA 1UM9A 1YL6A 3SICE 2W2LD 4Z4FA 4IHJB 4OUDB 1YZKA 4PLZA 3I9JA 3GEBA 1MW8X 4ISCA 4IBFA 2V6IA 5K45A 1VOTA 2BI7A 3S6JA 5EIHA 4LRUA 4BBAA 4DA6A 4Y6OA 2G70A 4GVLA 2WD8A 2FG7C 5C1PA 2BFDA 5IS2A 1N34B 4NCJA 1KOFA 4RTQA 2FW0A 3WL7A 3I4VA 1O03A 1DG9A 1OILA 4JQYA 4GLFA 3T3NA 2X40A 2Y20A 4I1SA 3PVSA 4CGYB 5HIIA 2AKAB 5DCWA 3SBDA 1K3XA 2LE0A 4QRDA 1OLXA 1PWHA 3EFOA 4WFQA 1NNUC 1JL3A 4NV0A 5IKOA 4Q3LA 2IZ7A 4EMBA 2WVJA 4LC0A 5AKXA 3T1QA 3B9RA 5JS6A 2NVUA 2O2EA 2Q3JA 1XAJA 1FW6A 1U7XA 4H7HA 5TEWA 2R8OA 4BPBA 1OXKB 4M1WA 2CNOA 2AXEA 3JX9A 4I9NA 2ZM5A 1NVFA 4QATA 1SJ9A 2R4QA 5LLSA 1KEPA 4CQLB 2P0AA 1B4DA 3NWLA 1MB3A 3L0BA 4BNYA 4CQNA 4R7TA 4UU8A 4XW2A 5DHRA 4B3RM 3ORSA 2C82A 4WOKA 4Q1AA 5FUVA 5EAIA 4EZIA 1EGQA 5TS3A 3P19A 2CCGA 5AW2A 4KXUA 5EHZA 3GMDA 1NVMA 1T5BA 3PHGA 3KW6A 1PDWA 2ORIA 3EPKA 4FC6A 4QNRA 1SVKA 4PZEA 2GN9A 3PHJA 3VJMA 3ANXA 3B3AA 3M6UA 2R86A 1SKYB 3CLSC 1FSZA 1OLUA 1TYBE 5G1OA 1XTRA 4MVJG 1L7EA 4JXZA 2D74A 3QMVA 5AQ1A 5FYDA 4RD0A 1GO2A 4GVXA 4LVCA 4DW8A 2UVPB 2QIOA 2GARA 3RVPA 2GF9A 4HDMB 4E70A 5FTJA 4IUBS 4JJIA 2GH1A 1QAMA 1W5AA 4NKRA 3FZEA 1FTGA 1XMSA 2DFNA 4E5VA 3LUCA 2F4VB 5F12A 5CITA 2E0IA 4NBVA 1VG1A 2YXLA 2OHOA 4QHSA 3EVDA 3ML1A 4PCUA 2A9JA 4Z86A 2KXEA 3AP1A 3B7PA 3KHSA 3MTGA 5D6NA 2Z04A 3PZBA 3DBLB 3UW1A 3JRWA 1R0YA 2P3LA 4XM0A 1BVSA 3COYA 3PXEA 4G9GA 1VJ5A 2XZTA 1JFVA 3ZHBA 4H9GA 3CA8A 5JI2E 2J4CA 3P0JA 1TJ5A 2WZCA 1P4HA 3PDJA 2UYGA 4QQRA 4YJ3B 3R0JA 3U6PA 5ES4B 3HHPA 3O8QB 3T1HB 3WAKA 4WXRA 3BEDA 4ETWA 1P0IA 4YVFA 4OLHA 3EULA 2XOXA 3EIWA 2DLCX 2VT7A 3GFSA 4I5SA 2Q6KA 1LBHA 4AZFA 5DTIA 4AROA 3OCCA 3ZNQA 4M0FA 2VPPA 1ECCA 1A8IA 3THXB 1D4OA 4B4UA 3SYLA 2J59A 2CHEA 2W83A 4IX9A 4CXMA 1A2QA 2NU9B 3MELA 1E1NA 1NW4A 4S1PA 1E1CA 4BNKA 2WTAA 4WXHA 1PFUA 2E4VA 1QNFA 3OTIA 4ANFA 1D7AA 4BXOB 4AI6A 1AK2A 3WRWA 2W48A 2PKEA 1E0JA 4C78A 1R37A 2QNRA 4WDRA 3EDMA 1LDYA 3PWZA 4HDKA 3UXMA 4B17A 1K8XB 2OBXA 2OQ2A 2D4AA 4DLAA 3SJCA 3LIPA 2B4AA 5DGTA 1ETUA 4HOYA 3IP7A 5LL6P 3L1KA 1KI1A 4IFIA 4X60A 2PD3A 4FDAA 2VYVD 3IQEA 5EHQA 3K4PA 4ER7A 4YT4A 1W75A 4D46A 1GNRA 4P3XA 2PJUA 3SXPA 3GUVA 4BIMA 1V9CA 3EBLA 2EIHA 4TKVB 1IXSA 4JYZA 5FTKA 2NOAA 3T99A 2WEKA 2X1HA 5ABPA 2EX4A 1NG9A 2PGXA 3BF7A 4ZYLA 4HXFB 5TRTA 1Q0QA 5CURA 2A14A 2X1LA 2Y3IA 1V6SA 3RVRA 3KU1A 5LP1A 4LIPD 3DOAA 2NTNA 5FO1A 2WIKA 1RPZA 1I7SB 3CLUC 1L1FA 5B3LA 1RLOA 1NQXA 2O8BA 4XOUA 1VIDA 4EFKA 4JUIA 4N5HX 2WD7B 2CFRA 3H19A 4M4SA 5T57A 4TLMB 3C3EA 4C21A 5TX7A 4QD3A 5D87A 2W37A 3LGXA 3A3NA 3NPAA 1QCYA 3SGLA 3W6OA 2OZKA 1LDMA 3ONDA 4O2LA 4OK6A 4ZO6A 4YROA 3CPEA 5IVIA 5I7SA 3NWEA 1ORYB 3T9FA 4FQ7A 3LDHA 4HQ6A 4KHPB 3VSBA 3ET4A 2QDKA 4FIZA 5FUXA 3TNLA 4KQ1A 2HDOA 4EDFA 1VCMA 4J0EA 1HYQA 1WRBA 3NIWA 1XMOB 2ECKA 4RJLA 3R9KA 1ZA2A 1E3WA 1GPH1 3HKCA 4LDJA 3RARA 3DA8A 3AW8A 1JDUA 2J3KA 4X7RA 2MINB 2I66A 2NTVA 3QFRA 2OAQ1 5TF4A 4FINA 1YFKA 4QHTA 3JQFC 1O77A 2H1WA 4IJUA 4Z54A 2H4JA 1AGRA 1TQDA 1R8JA 1JQ3A 2H3HA 3D3QA 4K9MA 4ZI5A 1EFAA 1PD0A 4JX8A 1E2PA 4J9UE 1FUIA 2XMPA 4QUAA 1M8KA 4YV2A 1DDGA 2XXBA 3BL8A 5JW6A 2B2XA 2RONA 5LMNM 4S1VA 3JAWA 2KBEA 4EENA 3V9AA 2GPTA 5ADHA 1M10A 4ALKA 5FWYA 2G17A 4DLRA 4GKJB 4RHUA 5J58A 4HFJA 3UKOA 1V43A 1IL0A 3N2KB 3EASA 1XU4A 5G0VA 1KMCA 5IXYA 4B8ZA 1SIOA 1UOPA 3BXHA 2UVDA 4FLMA 3LXUX 1CUSA 3KJIA 5JC1A 3B6KA 3LUDA 4OGWA 5EEGA 4GPBA 4A0GA 3HCWA 4UOQA 2GERA 3QYEA 4B7GA 2YWBA 4HAYA 4Q7QA 1QBKC 3OE7A 3H1EA 7MHTA 4RZ2A 4O8CA 5LA6A 4V03A 4LMBA 4DREA 3CLTC 1GDDA 3IPRA 1G8SA 5KYYA 1KFBB 5K8UA 4C3UA 3C6QA 4HRYA 3I2GA 4L27A 4GHLA 4BKMA 2PFKA 4FFRA 4FGUA 1OAOC 1FP1D 2OYSA 2FTKE 1X6VA 2WFAA 3I1IA 3O90A 4OHZA 3PQ5A 4ARBA 4G36A 1M8FA 1JFRA 4N48A 4URUR 3GUHA 2QE7D 4A26A 1KIAA 2V6MA 4QYIB 1I4LD 4WH0A 1PFGA 2DOKA 3AY3A 1ZGGA 5JAOA 2ATIA 2GXSA 5KINB 1MO4A 5JROA 3MRVA 1KSHA 4YP1A 5KEIA 1P5ZB 3SKYA 1PR2A 4OQEA 4FN4A 1NTOA 2JGDA 2I1LA 3FD9A 5CH3A 1I3KA 1W2GA 1W7AA 3K32A 4HUTA 2DERA 2X9QA 2HRQA 4F85A 2AR0A 5AKHA 3ZEAA 3T54A 4B85A 2ZJ1A 3I8XA 4J2HA 4UNPA 3J7TA 3EF0A 4G0PA 3SVLA 1B26A 5JVDA 5LUAA 1A98A 2PWPA 2WF5A 2FWRA 4EQZA 3FR8A 1C9MA 5KOHA 3WWCA 1R0WA 3U7QA 2KYRA 3BIOA 2NZJA 1GPLA 1EESA 3NXKA 2W2TA 1VPDA 4I8IA 3PJDA 4EH1A 3SSOA 3TPZA 5EUCA 3TCKA 1RRVA 3PDUA 4BCDA 3IT1A 4DCJA 5TPWB 4ZDJA 4JQOA 3UV6A 5F52A 3IOBA 5FPPA 4RGBA 4IW3B 4WFKA 3N2LA 2FPIA 1AO0A 2QQ8A 3T5MA 1NW6A 2NUBA 5CVCA 2V3WA 2OXCA 3KKZA 1N77A 4X0EA 2R2AA 3U0VA 3MB8A 4LRQA 2IU0A 2EWWA 4CYMA 2O8CB 1WB9A 3EVEA 1N7JA 4HZIA 3DDWA 2RBGA 4EG0A 3P9ZA 1AY0A 4OTZA 5E3IA 5MGBA 1DX4A 3RC1A 3ZCVA 2FQYA 1STOA 3CZ4A 2C5BA 3VBEA 2RGEA 1U80A 2NV2B 4BIIA 2AC4A 2BKVA 1PS0A 2NU7A 4GUDA 4EPXA 4CCAA 5CG2A 3L1IA 4ZTUB 1SOAA 2VF2A 4EZBA 2QUZA 4PAOA 3TZLA 3IIEA 1YSYA 4Y3UA 1P5RA 5EWJB 4IJWA 5FF9A 3LAWA 5A9SA 1RFLA 5BN3A 2GPJA 4Y2JA 2YJGA 4NDAA 3DE5X 3LC7O 1DG1G 1S8AA 2X9GA 3GO8A 2FZ5A 3BMNB 1H8HA 2WNHA 3VHQA 2R85A 4DCMA 2AS0A 3WGIA 3MWLA 5L7TA 1FRFS 3H2KA 3RHTA 1TR8A 1HDIA 3OEED 4JCOA 5BR4A 4I55F 1RU3A 4ZJZA 4C6TB 3PENA 3Q8XB 5IM4F 4YHHM 4QPPA 2B4RO 3RAFC 1LTQA 5H4HA 2KS6A 1EINA 3VDRA 2A9OA 4MYTA 2IEGA 1ZUWA 1N8NA 2G77B 1E5TA 1QRTA 1W6UA 5E7MA 3OFJA 1QH9A 4U6SA 5L4SA 1MB2A 4LX0A 4GWGA 4N5MA 4C0BA 4HXEB 5A3RA 3H2ZA 3A2MA 3QMMA 2QT1A 5K4HA 4M9UA 4KX3A 4QTYA 1CUVA 1T1SA 3TJMA 5DBGA 2EZ8A 4F6RA 4TRJA 4NCBA 4JUCA 3GK3A 3NHLA 1DKUA 2OC4A 4CIWA 3HSYA 4KFSA 4TYMA 1R8YA 2EF1A 4ALMA 4YJFB 4Y67A 4HQKA 2XY4A 3W2IA 2I4NA 4D1YA 5TS2A 5F2OA 3X1KA 3UGQA 4B3GA 1T4MA 4MXDA 3SHGB 3T3IA 2RAVA 3W4KA 3PIRA 2QD4A 2CE7A 2O8FB 3PNMA 1G5QA 4Z2AA 3PEFA 5LZ7A 2GZSA 5EFZA 1MJ5A 5C4MA 2ODAA 2ASEA 2R6R1 5FPSA 4ZT3A 5GVSA 4F1WA 2L42A 4XIGS 2MSWA 3LRTA 5AWFC 4GIPA 3W5IA 1IUNA 4UCWA 3I51A 5DXJA 3E7PA 3WYFA 2HWYA 4PYOA 3RG2A 1BMTA 3EAGA 1N7GA 4KO8A 4RTNA 3VKFA 1QUSA 1FZTA 1BMFA 1UXKA 4P3PA 3P0EA 1N1GA 2O4CA 4RTLA 3N86A 4MVYA 1PVVA 4D45A 1XGKA 3TSYA 1N9GA 1S89A 2MSEB 2AN5A 3NVKI 1YTLA 1KO7A 4F60A 4C0AC 4FKBA 2CV0A 4XLZA 1VQ1A 3W79A 2R25B 1DBWA 3ZI0A 3VSDA 4WADA 3WWZA 3ACDA 1N2JA