3C3EA

Crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei in complex with fo and gdp. northeast structural genomics consortium target mar46
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
305
structure length
305
Chain Sequence
b'MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAFLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-phospho-L-lactate transferase
publication title Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb
source organism Methanosarcina mazei go1
molecule tags Transferase
total genus 82
structure length 305
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 2.7.8.28: 2-phospho-L-lactate transferase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.240 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 CofD-like domain 3c3eA02
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 3c3eA01
3C3DA 3C3EA 2P0YA 3CGWA
chains in the Genus database with same CATH superfamily
1CC1S 2NTNA 1TYAE 3TTTA 1BGWA 4O2AA 2EA0A 4DCVA 5CTAA 2G25A 3BTSA 1JDPA 1CR1A 5HS6A 1IJBA 3HN6A 5D86A 2Y67A 1TF5A 3AZOA 3I6YA 2YCBA 4OQLA 5C5CA 1KY2A 2XQKA 1O5IA 1OBOA 1USIA 3ZE0B 4E51A 1J9EA 4D97A 2DTXA 5L3RA 4JI6M 4XFKA 4JI3M 1CUSA 4Q12A 4ZHQB 3M33A 3GFTA 3AUUA 2WT4A 3ZJ4A 1RAFA 1EXVA 4HEOA 7ABPA 3LM8A 3TIGA 4NICA 3UV3A 3VH2A 4PQYA 4OQDA 1MB0A 1JQDA 2WMOB 1G5PA 1H3FA 1A9PA 2O3TA 3CF6E 1G5IA 3H16A 2B2XA 4YT2A 2VA8A 4X3PA 3MZ0A 5IAGA 2BWEA 2DCUA 4Z7QB 3D3KA 4HZUB 2X9GA 4AJLA 5BNWA 1JDUA 1WO8A 4E07A 2ZVQX 1FNCA 1SZDA 2YIVX 4KO4S 1DRJA 4TTVA 2ZI7A 5LP6F 3IEKA 3A31A 3PWZA 3ZIUA 1T2DA 5DISB 5ERXA 1V41E 3STUA 4JJAA 3GW8A 1A9XB 3MBKA 3R7BA 4UBMA 2C8KA 2Q50A 2ZRGA 2A9KA 2UVPB 4IZHA 3I05A 2N47A 2OHVA 3T5AA 2R11A 5B1DA 3G0GA 1XCMA 3SMQA 2ZBQA 4B3RM 1FW6A 1Y4ZA 4FUQA 1RQNA 4Y9TA 1UBGA 5I6DA 1FE8A 2F9LA 4KPUB 2PGOA 1QVZA 1KY4A 3AM4A 3OM9A 3S2IA 1QZUA 2VPYA 5E1BA 4P98A 5JS6A 5JD3A 4RA6A 2UUBM 4EYKA 4ZCIA 1MB9A 4LJSA 4KVGA 3RE1A 4FZJA 2NW6A 4TT3D 4QJBA 2C3YA 3BMCB 4MRNA 1B42A 4R7TA 5TEVA 1D1SA 4TV8A 5FBZA 1L1FA 5U9CA 3N2GA 4KN6A 4CU5A 4OEHA 3N7UA 4FSDA 1FSSA 2UZ1B 2CFTA 4KR9A 3HKPA 4DUZM 1UZMA 1F4IA 1SWVA 5AKKA 1LJ8A 4YJGB 1Z13A 2I3BA 1IZZA 3Q10A 3TQQA 2BMDA 2NU6A 4HVCA 2Q2OA 2MYTA 4FHZA 1JJFA 1H2ZA 4ZI5A 4A16A 1LC0A 4WBSA 3LP8A 4J3FA 3TW8B 2E18A 3LW7A 4RH0A 3FSEA 3VDXA 4GIPA 3QVGA 4ZAFA 2CEKA 1ZH6A 1JDTA 5IDVA 1E8MA 4C2BA 4N8SA 4PRLA 5B2FA 2IEAA 3VPXA 3LW8A 3KQUA 4IJEA 1FU4A 4E30A 1UT8A 3C5EA 4D96A 3WADA 3WMEA 4C14A 3UAWA 4ALMA 4H3SA 3SKXA 1ZCAA 4GSLA 4LG1A 4ZXPA 1Y82A 4CW7A 5D00A 4EGAA 4DA0A 4F84A 3CR3C 3D4BA 4JT4A 1FU8A 1AGPA 3PQ8A 4DBZA 1XDGA 2X4GA 1QRTA 1DFGA 4RPGA 4GZ6A 1Y3IA 3RSGA 4IFEA 4XQ0A 4DLNA 1SH7A 5HE8A 3DW1X 4MCIA 4IIJA 2VT2A 2XZTA 3UJ6A 3F71A 2V7VA 4YMHA 3K72B 4N5HX 2VNSA 3U17A 4CXMA 3QWBA 4YHBA 1X1BA 1NPYA 3IT0A 4AO8A 1GT6A 2P2SA 3KJIA 1SCDA 3FW1A 4M21A 2FQWA 4L5AA 3M3HA 2A9FA 1NXPA 4JYBA 1KMHB 2V6MA 4JYCA 1CX9B 1SCQA 5ALSA 1EWKA 4D82A 1MLDA 5BR8M 4DMCA 4HLUA 5ITZB 1KQPA 4X1KB 3T38A 5L6LB 3EGWA 2V6IA 3K1AB 5A02A 5BT9A 5JD6A 1IG3A 1PJRA 4WKCA 1SC1A 5FUVA 3L1HA 2O1XA 2R8ZA 1XEWX 2LE0A 2JG3A 1RTKA 5K4GA 4MW7A 4Z4QA 3CH7A 3QLJA 4MWEA 3KS8A 4Z6YA 1BXZA 4C0KA 2ZCVA 3IP1A 3BXEA 2ZRIA 2JHCA 3EZXA 5JAIA 1HX7A 1M34B 4BE9A 2DETA 3KJHA 3OHPA 4AZWA 4DHWA 3KQKA 5HIIA 2Z56A 3AL3A 3DMGA 2J5QA 2UAGA 3VPSA 4IQGA 4XGIA 3MJSA 2AHOA 2CL5A 2J0UA 4ALKA 8MHTA 5K8TA 2XGNA 4ZO8A 5BUCA 4KI0A 4MQ4A 1J9ZA 3V9PA 3AETA 3IQWA 1Z4KA 2OHFA 1O58A 2HYIC 3NYRA 3UHPA 1ZAYA 3V42A 5ARCA 4YRDA 4JI5M 4K46A 1ZVJA 3Q12A 3Q1KA 2VP3A 4BFVA 1E3SA 1EVEA 3KR1A 3CX4A 1DV1A 3PGA1 3WK4A 1Z06A 3RVLA 3R0VA 2DNAA 1UJ4A 2HJRA 3A2NA 4NP6A 1A96A 3Q87B 4HDSB 1GM5A 2OPFA 4KC0A 1N9GB 3ZGOA 4LXYA 3EAFA 2ZYTX 4N9QA 1UADA 3WDSA 4QJ4A 4WZBE 5DBFA 3ZU2A 1LBIA 3K32A 4KMRA 2L17A 4W8GA 4LF9M 2GRUA 1WB9A 2QN2A 5J63A 1O94C 2QI9F 2B5VA 2WJZB 4L85A 3FM9A 4CM6A 1T36B 2H4FA 1KWGA 1R4NA 2OSBA 3MGGA 4QYIA 1CY2A 4RZXA 2GF9A 4CGZA 3IB6A 4PTYA 4GMFA 4IMIB 2J4DA 1CJMA 3KWFA 2K5UA 3ZE9A 4XB2A 4MA4A 3JS5A 4GI2A 2IBSA 4JUBA 3CA8A 2NN3C 2BTEA 3CCFA 5EJGA 4IL5A 4IO1A 3ID6C 3U80A 4N5MA 4GFDA 2QOEA 2GLXA 5LDGA 4BMOB 3PRJA 2DWNA 1NV8A 1ADYA 3EMVA 1E1LA 5LLDA 5IKMA 4S05A 3KSUA 3FX2A 3IMGA 2FE8A 2OCPA 3VR0A 1AKUA 2RDMA 3EXG1 2VEDA 2JFUA 2QTHA 3VI3B 3QSYA 3M1IA 1SXJE 1TK9A 2C8JA 1BXRA 2OP1A 3C6XA 1SULA 3SPXA 2YL2A 1EZZA 3O75A 3D3EA 4CEJA 4KMMA 3HYTA 2VQ6A 2R8EA 3AF2A 3HKBA 4CIYA 4POOA 5FA5A 3PA6A 4BFYA 1DXOA 1VLVA 2XNDD 2CUNA 3QJ5A 3W7BA 3C41J 1DFIA 1N4DA 4OP2A 3RTGA 4QNMA 1GA1A 2JLRA 2NUBA 1UC9A 4J1QA 3PP8A 2QRMA 3FSRA 5BUZA 3EX7C 3FPKA 4PCAA 1CXZA 4DDWA 4ZVMA 3AGQA 4MKHA 2NP7A 3DZIA 2PBLA 4KIUA 2CVQA 3PNVA 2IW3A 3EIHA 2CMKA 1XEWY 5IZ7D 4Q3BA 2J3JA 4IDCA 2DI0A 2GAIA 1CY4A 2GBGA 3I9FA 4YXWA 1Z6ZA 1VKZA 4BVLA 5B30A 1N2CA 4RPLA 4DV4B 4KQXA 2HHHM 1KEEB 4XOUA 3RASA 2I8AA 1Z39A 3QKTA 1Z5GA 2C3MA 4G36A 2GSDA 1T2UA 2I3ZA 1SU8A 1YUBA 4YUYA 1GZ7A 2X77A 4XW2A 4GZLA 2GKOA 2PJDA 4G5FA 4AG6A 1Z4JA 1KEVA 2ZSFA 3DOUA 5J1TB 1DO2A 1UBEA 3AF6A 4JI0B 4HQ6A 1XEFA 4G09A 4C88A 1D0MA 2FH5B 2C9CA 4NJMB 5T4BA 5CNJA 1T5HX 2P79A 1AS2A 1PL7A 1NW9B 1T9AA 2G63A 1VRCA 1C3EA 3AUYA 2MTBA 3SF8A 1ZU4A 1UKEA 3DNPA 1Z4PX 3LPNA 3HJQA 1D1TA 3SJ7A 3SDBA 1NN1A 1L4MA 4B73A 5A7FA 3QEMA 3O2QB 1VQ1A 3OF3A 3VVCA 4F11A 4ND7A 1SKYE 4AMZA 2YXPX 4M1YA 3WGZA 4QC2A 4JOBA 3VISA 3BD6A 2O2CA 5JJCA 1KAGA 1GY8A 5P21A 1HF3A 4QYSA 3ORYA 4IV0A 2QSZA 4YUXA 4E1BA 1GRQA 2PL9A 1IHYA 1W4BA 3HDVA 2CB0A 4FT4A 2G80A 2XRZA 4Q3EA 4RWZA 2TMGA 1D3AA 1W2WB 3VJMA 1EVZA 4CLEA 5BSRA 1FP6A 3GJ8A 1V1MA 1B15A 5G0VA 1FUEA 1JJIA 1JAYA 2C29D 5CFRA 2GF2A 2YN2A 1GILA 1JPJA 2QLLA 2VH5R 3HCWA 3L0BA 4B6FA 2J87A 4JU9A 3UV6A 1DQSA 1XMOM 3L6OO 1XB2A 2PX3A 3TIVA 1VPEA 1D0SA 1JHAA 5TQ0B 4OH7A 1XZPA 2QD4A 2CFRA 1R8JA 3LT4A 3BXHA 2RKWA 2R3SA 4S1OA 4EY3A 1RXUA 1OR8A 1I3CA 2RBGA 2FUEA 4PNHA 2AD5A 3ZK7A 1CJUC 1R6VA 1I14A 4NXNM 4N0QA 5AIBA 2I6SA 1DKQA 1Y9EA 1EUDB 4BATA 3G2PA 4KSBA 1GKIA 4LGCA 4WN3A 3EMKA 5GGXA 4YFYA 4B6OA 4DCPA 5FUMA 1ZKMA 3F6YA 4R2LA 3UJCA 4GYJA 1EX9A 2DFPA 2BKVA 3QVUA 4PFKA 1RPZA 4RMHA 4D0LB 1J0BA 1KY5A 3JR3A 4HB2A 3I51A 4LRWA 4ZAVA 1H8HA 4OHWA 1W5TA 1A8UA 1L1TA 3AIIA 3GF4A 3QKIA 2BDEA 4YAKA 3NTRA 1SC6A 5HTKA 2Z98A 3QU7A 5KTOA 3I2YX 2CL7X 1F20A 1T2AA 4AN1A 1DUIA 4Q6BA 1PWYE 4KZKA 3IB3A 5C5EA 1VPLA 1GUBA 3ZWMA 3QGMA 2P9QA 3OIUA 4DDUA 3SVTA 3U1BA 3FNFA 1FYDA 1DJPA 2GYVA 2XJ4A 2BNKA 3IQXA 4AQYB 1Z59A 3K70C 5AVYA 3AHCA 3AU9A 4B6JA 3C43A 3V6LA 2AWNA 3VI4B 5KWVA 2G4VA 1ZN2A 2WW8A 2DHYA 4DBGB 3EF0A 3OEHD 1U9ZA 1KL7A 1NONA 1J8FA 4G97A 2HPAA 4ENTA 5G53C 3LQ1A 3C7DB 2JGAA 1KRXA 3SEFA 5ALOA 2QRLA 1IZ9A 5LOVF 1RWKA 1VBKA 1T3TA 1QZZA 4CQLB 3SAJA 2BIFA 1MOQA 1JBQA 5EJ2A 4LF6B 3WYGA 2O2IA 2CBZA 3MK6A 1P0CA 3FMPB 4RA9A 4DZRA 3DM9B 4G2TA 1R4MA 4BE7B 4OVZA 1QIJA 4EY4A 1G8MA 1N2XA 1XVTA 4P7KA 1E6CA 1L4BA 1SZCA 2NU7B 3SIXA 3TEJA 4LDNA 3N2YA 3OT1A 3O94A 2O8BB 4PONA 1YD7A 1JLRA 3DOAA 5ECYA 3JWJA 1H6UA 5C80A 3VZSA 3WISA 4K6MA 1G20A 4AW9A 3ND8A 1KORA 3FUVA 4R8KA 3VR4H 3KJGA 1A4XA 3ZWQA 4OB8A 5H80A 1RZVA 2NO9A 4MULA 3IVMA 1R6UA 4P1ZA 2RHTA 2RKBA 3BJRA 3KLPX 4ZYZA 5FO1A 5HMLA 5JJ5A 4C2TA 2XCIA 4WSOA 4C21A 1R4ZA 5K09A 1UBTS 2W90A 1KA9H 3FZEA 4YRAA 5I9IA 2RHCA 2BKLA 2RGEA 5IRCD 3MT7A 2QL7A 4PD2A 2OO5A 1VG0B 4IPTA 1ZJ4A 1G9SA 3WSWA 1VGQA 2AH5A 4RD6A 4H9GA 1L5MA 1DX6A 2LHGA 4HPXB 2I7PA 4B4OA 5K3EA 1EFUA 3DDHA 4DG8A 5K3AA 4ZT2A 1IDN1 3DFKA 2HWYA 5FOWA 2A8YA 3KXEC 4DEVA 1T5IA 2QN1A 2PU7A 4DMFA 3DMRA 4S35A 4QXMA 1V9LA 3DMDA 4NC9A 4BLWA 5JSZA 3R77A 3AM1A 1L4KA 4ZT3A 1U4SA 4Z99A 3EBPA 1PUXA 3GZ4A 4X93A 1GPWB 1YB5A 2AOXA 2G07A 3MA0A 1SHKA 3TWKA 2X58A 2GQFA 3FSJX 1YBAA 1ZBDA 4H4EA 1JQKA 1M54A 4ZKEA 3RRNA 1JALA 1V4BA 3U4DA 3KZVA 1JIQA 3D4NA 4DQVA 2IC5A 3CN9A 5CH3A 1Z29A 2QHOB 1Z4LA 4F5YA 4BVAA 9LDBA 4EL0A 1ZRSA 3NWPA 2ETXA 1P9NA 4HEHA 2GM5A 2CXHA 3MWEA 3C7TA 3RRXA 5FF9A 3I53A 5K0FA 3UJAA 4F6RA 4IYJA 3UG7A 4IZIA 1B74A 4MINA 3F1KA 3DOEA 3SOZA 1JYFA 2YHAA 1YQGA 3F6SA 3B6ZA 1T8SA 3ZCVA 5LWHA 4CCAA 1SIOA 1FSZA 1L7VC 3GZJA 5KYXA 1H3EA 1JW9B 5CVEA 4IAOA 3UAYA 4UN2B 3P96A 3O4GA 3MJRA 2H5JA 2WZCA 1B6GA 4F86A 4DC0A 2I1VB 1U7ZA 3RAEC 1VL8A 5ITWA 4BNWA 3LC1O 4A6PA 1IN4A 3LIPA 4TZTA 1E62A 4P32A 1WDMA 1M6WA 1RYHA 4E2WA 1T9BA 4WURA 5K45A 4JITA 3KKKA 1QB8A 1RI5A 3TZLA 1YO6A 1T1IA 3IE2A 1M1YB 1TO1E 4N8EA 2FHPA 4BWYA 4DV5M 1A72A 2XMDA 1B0AA 1Q0SA 3UWOA 3QE9Y 2JBWA 1YBVA 2ZYAA 1HL7A 3BSWA 3WHPA 5CYOA 2Q4EA 2AJBA 4HLQB 4LX8A 4FOPA 2F6RA 3G5TA 4MW1A 1WS6A 3V4OA 3GGCA 2QN8A 1FRZA 2AZXA 3N39C 2YW9A 1ZGGA 2F3TA 3D81A 3R76A 3UM9A 4A10A 4HATA 3OQMA 1P3DA 4KO8A 3T1OA 1RYYA 1V7PC 3DMFA 1T6OA 2FOXA 5I4BA 3H05A 1AG9A 2XDAA 3ASUA 3G2JA 1GRNA 3CG0A 2EEZA 2IYOA 1L7OA 1GRVA 1GSOA 1UKCA 3G8DA 3DVLA 5B4VA 2WTNA 4OHUA 2QAGB 5GQSA 1QP7A 1BGVA 4A9AA 4NCNA 5LZ2A 4HX5A 4LOKA 2H92A 3DWFA 2BONA 4MA0A 4LNUA 3PJDA 4ZYTA 2EHDA 5HQ3B 4PC6A 1UDAA 4X92A 3D5QA 1ESCA 4A82A 4XM2A 4MVWA 4RULA 1NFFA 1OE0A 2R1UA 2YWCA 2FWPA 3DMYA 2AC4A 4H60A 5JZBA 4D46A 4RXTA 3GMTA 2YCLA 4N7MA 5I9SA 1T10A 2NOAA 2AF4C 3K53A 1SQGA 5CW2A 3BRSA 3MFYA 5CA0B 1ZISA 3KYIB 3CUKA 4P4SB 1GPAA 4Y9SA 1KP9A 3ETJA 1E99A 3PKZA 3RJZA 3CNEA 2C3OA 3KT8A 3GBPA 4YIHA 1P60A 2BOVA 3DOCA 2M6LA 5F3RA 3ISJA 1GAWA 3EXIB 1SD1A 2VT3A 4D0NA 3O8DA 4MW4A 1QQTA 3M5PA 3MD9A 2XYQA 3PJGA 1R4GA 3S5JA 4NZ9A 1EBFA 2ZLBA 5F1OA 3UHAA 1WNTA 3L7OA 1ZG3A 4Z2YA 1CUUA 2O23A 3RSFA 1X9IA 3RJMA 2ZUWA 1RHMA 1OWPA 3IP6A 4CKCB 3AEUA 4A6DA 3IG8A 2AG6A 1JLLB 1UMKA 4YBRA 1RSZA 3OM8A 1PVDA 3I73A 5GV8A 1XQ6A 3FWKA 1V25A 2AVNA 3P9IA 3N59A 4Q1DA 1JSRA 1BS9A 4C3UA 3T61A 4M9RA 3OC0A 3PC3A 3O3OB 1IN7A 3INYA 3B74A 5EMMA 4UNSA 2CK3D 4JSTA 3UOGA 4MS4A 4BO6A 1NUAA 2P90A 1N2BA 2IIVA 2EWVA 4JT9A 2PX5A 4L8LA 1FOEB 4TKZA 1ZQ1A 2AE1A 3ICEA 2FOIA 3V8NA 2YV1A 4CTMA 4REQB 1P81A 3DBIA 4AWAA 1U5CA 3E3AA 4BMVA 5THQA 1NRWA 3VJRA 4QDZA 3QE2A 4OYRA 4KO2S 1ISGA 1LS1A 2NXEA 2EKLA 4JXKA 2WD7B 1PRBA 2JEYA 1HE4A 4UUPA 4WLVA 2MSNA 4FWTA 2VYCA 3RBZA 1ES9A 3AVUA 4JYZA 2ANCA 5C34B 5T5QA 1R9MA 4PT5A 1T4DA 5FIUA 4I4TB 2EU8A 4PBTA 3J7AC 1Q1QA 3IUNA 4FDUA 3A06A 4WUVA 1NN3A 1MVLA 5CD1A 1NSYA 2QUZA 2VAPA 3UMVA 5HCUA 1YCHA 2M1XA 4CGYB 1U1DA 1YFLA 2HMAA 5MF6A 2DU8A 3DCIA 2XVZA 4AP5A 1SC9A 5KHLB 2DZNB 1DIRA 1A82A 2PEYA 4P33A 2IFTA 1C7QA 5SV2A 1QIIA 2PL5A 4PR0A 3QX9A 1YRQA 1ULZA 3HA3A 2BVNA 3ZXYA 1GZUA 1U5BB 2E55A 3DEIA 4HXEB 2PH1A 4YGYA 2Z43A 2PUWA 2Y20A 4A91A 1VJRA 4QDTA 3DTVD 1TYCA 4IX9A 1NVDA 4MM3B 4CHTA 5JU6A 3COPA 5HK8A 1PLKA 2IYZA 3MBIA 4MHSA 2Z8YA 4TVOA 4W1RA 1JFFB 1NA5A 4YRIA 2HL6A 3HA7A 3GLVA 1WSAA 4DV6M 2YZ7A 3BBLA 4KFUA 3HVHA 3D43A 1V4NA 5EXEA 2V7QD 3VM6A 4V0KA 1X9GA 1UBKS 3NWEA 3WQHA 3IJPA 1ORYB 1FLAA 4JN6B 3JQ8A 1OMOA 3ND6A 1GG9A 4J0HA 4YVFA 2R46A 4MDFA 1GLNA 3AP2A 3QI2A 2ICAA 1P8JA 4E2FA 2XGGA 3R75A 1ECPA 3ZWPA 5JXIA 1T35A 4NYMR 1FP1D 1CY0A 2ID7A 1X7YB 3CS3A 2QLMA 5F23A 3ZWVA 6REQB 2XADA 3VPBA 3KXLA 1KO4A 1X1DA 3KOYA 1U94A 2W6QA 3GA5A 2F5SA 1VLJA 1AD2A 4PYOA 2GHQA 2Y76A 5CLQA 1V7QA 4QE3A 2XMCA 1AH2A 2OUIA 5B6PA 4HEA1 1EEHA 1LVUA 1K3TA 3U3XA 2GF0A 2GXQA 4EPXA 4UNRA 1XU9A 2AYXA 2PXHA 2WFLB 1N5JA 2XI4A 1ZRMA 4KPFC 5LP6A 2E21A 2NQ8A 5LMZA 2UXDM 5TSDA 2XITA 4BPBA 5JQGB 1N6KA 1Z4NA 2JFHA 2XDQA 1EFCA 1R37A 4R71A 1S8OA 1U3WA 4UZEA 3E0QA 1XVVA 2XUIA 4MKRA 3DJFA 4PRZA 4M99A 4MUGA 2F1KA 1I0IA 2VC2B 1Z5UA 5ITXA 1YDMA 3QBDA 2CL6X 4G5XA 3ZQ6A 2MSLA 3C3XA 2Q5FA 3H1TA 4FWBA 1QFMA 4TSFD 1E1KA 3LDAA 4HZGA 4EVQA 1P8AA 1RBYA 1NN5A 2FUCA 4K86A 1FVOA 4FMCF 4IGIA 1L2DA 2I3GA 2FWIA 1CDZA 4EKDA 1DC5A 3IHPA 4Y0AA 2EX0A 2HI0A 4F45A 5EE1A 2ZI6A 3B8HA 5AJTA 1NNJA 3JRWA 4YQEA 3W0LB 3RADC 4FW9A 4HXYA 4ZDWA 5C8VA 2CNWA 3WL3A 3P7MA 4I7EA 2FR0A 2OGWA 4Z3DA 4H4DA 3R7AA 3HWX1 2D00A 2H2WA 2XYGA 1JHMA 4ND8B 3LBFA 2VHCA 2MSDB 4D3DA 1W4AA 5GJWC 4GI3A 4PLYA 2UDPA 1PM5A 5I7SA 3LRPA 5E4TA 1AK9A 2I71A 1BU8A 1Q2UA 3AYZB 3EWNA 5JLAA 4JCOA 4Z9XA 1KEKA 2QMZA 2P9BA 2OCBA 3GPYA 3JZMA 4LOHA 1QORA 3OZWA 4NPHA 3OLCX 1L7AA 4LKRA 1NVGA 1QNLA 4N39A 1OQYA 5JMWA 1Q0TA 3A2LA 1Z2PX 2YNMC 4R4JA 4U7PB 3JPYA 2XXJA 1SVLA 3DQQA 1OLOA 4WNCA 3GCDA 2BN4A 3FFTA 3SXPA 4CL0A 1GSHA 2H48A 2GPWA 2XUZA 3TSCA 1UFZA 4N5NA 3AERA 3IUBA 2IUEA 1OBCA 3RUPA 4QWWA 3I2HA 3LQFA 1WETA 5M29A 4TKUB 4I36A 5KYWB 4RE5A 3EQ8A 3HZOA 2CVZA 2VP6A 2DHDA 5BYAA 4J2TA 3VAAA 1XPOA 3MWLA 3ZHTA 4Z54A 2WFAA 1G21E 4HGYA 2ADFA 3AWDA 3VPDA 3ZKWA 5CVUA 4J3NA 4BNYA 2F17A 5FOSA 4GOLD 4UATA 1SUFA 3KIPA 2RB5A 3KP0E 5BN5A 1VYTA 3DFZA 1H22A 3U3MA 1E59A 4XA8A 5EAIA 4LF8B 4M8KA 1ORTA 2ZB4A 2BEUA 2OBFA 4LV6A 2AOTB 3VFDA 2IWHA 3HRHA 4FS3A 1XRRA 4C5BA 1Q7EA 1GCUA 4NAUA 1G6HA 3UMBA 2QPTA 1Z4OA 1X8LA 1JFLA 1UBLS 4AO7A 3W6PA 5AVZA 1PDOA 5DPMA 3CLUC 1X7XA 2YV2A 2YZKA 1JWLA 2IHYA 3FVQA 3JYPA 4HDKA 5GIOE 1VMIA 3CLSD 2HCFA 1EVJA 2WF9A 5IXYA 2FB9A 4ZN6A 3SFZA 4CIZA 3NP7A 1Z74A 1ZOIA 4BEVA 2JK1A 1F2VA 3PNMA 4IBIA 3AVWA 2A58A 5L8VA 3I9OA 1BWPA 3ETEA 1CYEA 2P2YA 4HTFA 2I80A 4KVFA 4EVSA 3PYMA 1YS4A 2V9PA 3PE6A 2B3DA 2VHEA 5EQTA 3DEKA 4HP8A 4HSEA 1UEJA 5BSVA 3TFWA 4MDEA 1S02A 4IH4A 5DNYB 3DQZA 3KSAC 5C1DA 3JWIA 4G8DA 4BFUA 5EG5A 4HQOA 2PFGA 3KTAA 1ZGJA 4LX0A 3ANXA 1YKGA 3TTUA 3LOQA 4HUJA 1HL3A 3IUMA 4BQIA 1QLHA 5E7MA 4RVDA 4TQAA 2PMFA 2ASVA 5SZIA 3OICA 3DHYA 3THSA 2CLMB 2ORVA 4UMVA 3FKQA 2FFQA 1NJFA 2RHGB 1OX4A 2OPBA 3ORHA 5DTIA 4DCSA 4N1AA 3QF4A 4S1PA 2A67A 4BVHA 2UKDA 1XJ0A 5ENDA 4CNBA 1YONA 2G72A 1T29A 5DE3A 1JQLB 4CMIA 4ND4A 1W85B 1B6TA 3Q3EA 3WYBA 1XMJA 5J5CA 1WG8A 2LIVA 4EI8A 4I2NA 3KYDA 1V37A 4FKZA 5HXAA 3FUXA 3LT0A 4J0KA 2IJGX 3S44A 1VLQA 3KVWA 4DNQA 2GEKA 4DV3M 3KB6A 4L28A 2VR1A 4DPKA 4BKUA 3ZDZB 2I7XA 4GLLA 2CJWA 3ED1A 3UFXB 1ONPA 1L1EA 5L3QB 1WZIA 1WHTB 3ZDBA 4URVR 1H4VB 3BCUA 3I0MA 1PNQA 4A2CA 3UJPA 2Z2JA 3AK4A 1QWSA 1CZUA 1DXYA 1SXPA 2XWSA 5A5DA 5BR1A 4IWNA 1RDFA 4Y7DA 5KNBA 2FPUA 3EWSA 4ZQBA 4XUDA 4GG1A 4NH4A 1KVSA 1YR7A 1W48A 1JWBB 2Q4OA 3FYUA 4JLNA 4Y2XA 2IK8A 1ORVA 1BMDA 5K0LA 2C5RA 4UEWA 3QNUA 5I45A 1Z2OX 1NIPA 3URKA 3HHPA 3LC0A 3LU1A 1R66A 3SLGA 5AK3A 3MQ4A 4PLZA 3IP9A 1I3LA 4TWAA 2NAFA 1N2HA 2I67A 2FW6A 2R4TA 2X41A 5HZHA 1AB6A 4HFMA 3EMBA 2OLKA 1O97C 3ITEA 1F8FA 5FL3A 3H4MA 3MLEA 4ZZ1A 3IMEA 1J9GA 4F4IA 2AEMA 4B7CA 2ZAMA 3K1JA 1T13A 5DNDA 4QKQA 5EJEA 3KYJB 2W11A 2JHPA 3QFRA 3SIPA 5FNZA 3DKPA 4QOHA 1VDMA 3W5VA 3ZTTA 5HBGA 1IOLA 1HNWM 4NVRA 1XJQA 1UFOA 1USWA 1UQRA 5D3KA 4NYIR 3FBTA 1O89A 5DYYA 1JTFA 2VWPA 3TNYA 1XVIA 3GRFA 3JQAA 4PVCA 3ENVA 3AESA 4DLAA 1BXKA 4ITUA 3PYXA 4MB0A 5JJKA 3ZJYA 1DTSA 3RFFA 2B37A 5ERYA 2ZJ2A 5DCUA 4FM9A 3B1WA 2HF7A 3HSKA 1JQJC 3BWEA 2IVFA 3R1IA 4EDHA 1HDOA 2QU8A 4AKSA 3AUAA 1VE1A 2J45A 3Q98A 3WQBA 2V4UA 2H8KA 4DE5A 3ZJVA 1XZNA 1H0HA 1KDPA 4YMWA 2C58A 4GBED 4PCLA 2OT3B 3MJ4A 8AT1A 3ZY6A 2Q2VA 4ZHQF 3TZCA 2RK6A 1L2BA 4RO0A 4DXDA 1FW8A 3WK8A 5HUJA 2WT8A 5JYEA 7CATA 2QDKA 3L4EA 4EMUA 2G76A 3FDZB 2R0IA 3T35A 4DBLC 1NVTA 3GLUA 3H5VA 2XGJA 3LHFA 5JAZA 3KT6A 4RSGA 5IBPA 2DEUA 3SN6A 5JR3A 3G8BA 2R4UA 2XE6A 1ZY2A 1P1BA 1WHCA 1KIFA 2PTHA 4OSPA 5B64A 1J2UA 2ZAGA 1OXUA 5CR9A 5I9BA 3STTA 5IJWA 5D1NA 1OWLA 4Y1FA 3UT0A 2IZ0A 2XF2A 1EWTA 2ES4A 5FRDA 5JD4A 5KTNA 1VJCA 1QGZA 2YV4A 1N75A 5BRJA 1FMLA 5C8YB 1TCCA 2FK8A 4CN9A 3OZTA 3W6NA 3CO0S 3OTWA 4RVGA 1NU8A 4W7IA 2JFFA 1N8SA 4PWYA 1Y1SA 3CRVA 1BC5A 4B48A 1TD9A 3K31A 4R54A 4CMJA 5JC8A 3CV3A 2RSLA 2VDVE 4I4IA 1TLFA 3KKEA 4BWFB 1RAHA 2YINC 3W5JA 4N8DA 5ICCA 3PC8C 3KWMA 4H6VA 3OZGA 1NX6A 3U4QB 4FOSA 5IVHA 3DXXA 4GDMA 2O3QA 3GGJA 4FMBB 1IQ0A 1K4YA 4QXRA 2B8JA 3EXEA 1GQYA 3W06A 4BXOA 3PUWA 5KWSA 2IH4A 1EM8A 4YCBA 1K4KA 5DNCA 3UGQA 4X41A 3ZDAA 5ARBA 1U3GA 1RYDA 3KWJA 1FX0A 4X8MA 3KR0A 1KYXA 1HE5A 5H9WA 4TYMA 5BSHA 5HJ7A 1VGRA 4FYPA 3K73O 5IEJA 2X15A 1B1AA 2IV3A 3B7QA 3W2FA 3K8YA 4P2BA 3Q7IA 3L28A 4ZOLA 4L9RA 4GGPA 2QROA 5BOSB 4ZEOA 1BCRB 4JBNA 2FPLA 5EJAA 5JAQA 5LMUB 2VDBB 4A6XA 5AW5A 2QIPA 5KTPA 3BWDD 1SKQA 3BL6A 1NJGA 4HEQA 4HWTA 4BECA 4H35A 3DKKA 4QRHA 1T6ZA 5KQSA 4B3BA 1TTEA 4HQ0A 3KFLA 4PAGA 5FOXA 2XBMA 3HKDB 1JP7A 1AZLA 1XNRM 1NOKA 3WIUA 1HR0M 4B7ZA 1AV6A 3KKZA 1LK7A 5HQJA 5HKOA 3SSNA 5IAAA 3N2NA 1EKXA 2CV1A 4AJ4A 1JX6A 2PV0A 5B3JA 5EESA 1PL6A 3WRXC 4OREX 6GPBA 2JY8A 1WHSB 5A3JA 4NBUA 4TL6A 1NDQA 2VTKA 5FLXS 3OSUA 1SCUA 4TLEA 4W7SA 1TAGA 2AUTA 2WSEF 4FR2A 1X1EA 3OH8A 3KSDO 4MO2A 5E6UA 1ML3A 2QAGC 3VR4D 1LWOA 2QHXA 4TZ6A 5DHAA 5LOVA 1CEYA 5IAKA 3LHDA 2MGWA 1KI7A 3CSDA 3VNQA 3CLRD 3W8DA 4G4IA 4LC9A 1OPXA 4RC9A 3DR3A 2DQZA 4IDPA 2XRYA 4E2YA 2PUEA 2WNIA 5KWIA 1LY1A 2HCJB 1E3JA 4MR9A 1IQUA 1R88A 4XX1A 3D7KA 1PWHA 5MFZA 1NTOA 2F5OA 3WNQA 4K9PA 3I61A 2CFCA 4OQYA 3ETHA 4WFKA 4DCCA 4YY3M 3U6MA 1VXOA 5TXGA 4L8RC 3NI2A 2PZAA 5I7OA 3HG7A 3EGVA 1M2OA 3I2IA 1JSLA 4RJTA 3WHIA 1A9TA 2P40A 1R5OA 2QGNA 3AEYA 1HNXB 2AC7A 2PKRA 1J2YA 1LPMA 2O7RA 1XU4A 4U39A 3I5MA 3R5SA 5FQNA 1HDYA 2WJYA 1Z7EA 4PGAA 4MA5A 3EA4A 2YY5A 3AVQA 4IF4A 4ER6A 3GDFA 3LZDA 2CW5A 3HBNA 4ESHA 4C0SA 1WLYA 3E18A 3FFXA 2BE7A 1ZUNB 5CFLA 3EIFA 2DZOB 3LKBA 2HFKA 4GXTA 3L7LA 5DIZA 4GE3A 4RADA 3QXHA 1EINA 3DJYA 3HBLA 3LD9A 4EFNA 3ZNQA 2Q3HA 1WWKA 5CVVA 1KI6A 4YHHB 1Z6QA 2H1SA 1T5SA 4C2UA 1KTVA 3D8RA 3BA1A 3OQVA 3TLGA 4WD3A 1BVSA 3PNPA 4R7GA 4QRIA 1QONA 2JJYA 3ZXUB 3MRTA 4DWOA 1NT2A 3CRZA 4BJHB 1ICEA 1E2KA 3OX2A 5JECA 5CDYA 1Z5CA 2GZAA 2JVIA 4PNZA 2ZAYA 1Z68A 3ZH9B 3ZC3A 3TTSA 3RT7A 5HK9A 4J0GA 1FDWA 2WY2D 3SHTA 2ZJOA 3L7AA 2R8OA 1FFEA 2FQYA 5DN6D 4RTLA 1U4NA 3LX5A 3WMGA 5KYTA 3F8WA 4MUFA 1I7LA 4MQFA 2QL5A 3RG8A 2Q2QA 1NHGC 2CHUA 4E2XA 4QTYA 1TW3A 3VLFB 1D0IA 1LZLA 1E3WB 4P34A 3IOBA 3QAUA 1V96A 1U2DA 3FFWA 3GT3A 4GW3A 4MW0A 1R0KA 3SSMA 1CQIA 1EVYA 3U7FB 3PZRA 1YBMA 4AXXA 2A9OA 2FNAA 1KAEA 1OF1A 4BUZA 3MD0A 1OHHD 2WA2A 1M0TA 1OXSC 2JLZA 2ZXUA 4FR5A 4N3AA 3CIFA 3B9RA 1YNSA 4R6WA 1NGSA 3A3NA 2O48X 4OBWA 3FXAA 3F78A 3NGMA 3JW8A 1A9YA 4IJFA 5AI9A 4RTKA 3Q2OA 1WKBA 1YZLA 1IUKA 5EY5B 4JQZA 5K0SA 4ZYLA 1ZGBA 5H4HA 4UVEA 1M2HA 1NBIA 2A84A 1DJQA 1OFTA 1OFVA 1QNFA 3V4VB 3NVMB 3D6TB 5A5GA 1I9GA 5FLXA 2B92A 5DI3B 2VZ0A 2AF3C 4EQ6A 1O5OA 1HG0A 1IK4A 2VCYA 3A6HA 2DKFA 3R3ZA 1ZZGA 3ZC7B 5DNAA 5TARA 1VFPA 4R8RA 4AAYA 1Z3IX 1V34A 4RGQA 2QA5A 4FEYA 2GRAA 2XKAA 4CM7A 1D2RA 3OLQA 2P41A 4EO7A 1EFPA 2CF5A 1K7FB 3HB5X 5DXAA 1GP2A 1EP3B 4M0CA 1C7RA 3CEAA 2HJHA 1R8SA 3L6BA 1XDZA 3V80A 2R8PA 1P45A 4EY6A 2JARA 1GFSA 3MN1A 4BOYA 3VVLA 4YJDA 1ZW6A 2R60A 3GAAA 5KMGB 2FWRA 5F7ZA 5IC4A 4B6RA 2ISQA 2VOJA 4MQ6A 3QNMA 4EF6A 4CT5A 3KEQA 4DT1B 1U7UA 2FCRA 1U7OA 3ABIA 5DWDA 2CNLA 3TOZA 1XX6A 1WUTA 4Y6GB 1SCNE 4NPAA 4REMA 2OORC 4JI2M 3NWBA 2I4TA 1E3DA 3LO8A 4JK3A 2B61A 4QBGB 3RC7A 5BSGA 4MUBA 3S4YA 5C35A 1SBCA 4CIBA 4D8TA 5LQRA 5HUHA 3E27A 3ZCUA 4JC0A 1C3XA 3FRHA 3BFVA 4YJFA 5MFPA 3VUFA 3F4BA 10MHA 1WW3A 1K1EA 1X7WA 3BD7A 3PQFA 3UATA 4NESA 3DONA 1DKMA 3F2VA 2B8TA 2OKCA 4M0LA 5LQNA 4FYHA 3GLGE 4B17A 2RK3A 4Q4AB 1SIUA 2NUTB 4GZ5A 4UMEA 1XTQA 3JQFC 4PZZA 1IL0A 3PFFA 3T3DA 2QBYB 1G7CA 3K0KA 4MV0A 2OVBA 3JD4A 3AC0A 3RWOA 5K3FB 7YASA 3UC9A 2P5UA 3VR6A 4Q3LA 5KWJA 2DUNA 3K71B 2WF6A 1RADA 2HLNA 1Y3FE 4KK4A 4M1KA 4NMHA 3GG2A 3S8MA 3I1JA 1N32M 3ACBA 1U7HA 2YY6A 3IIKA 5IWCA 5TMBA 5EP4A 1E2LA 4RDHA 4B75A 4ZVLA 3BZBA 3F5QA 1RBZA 4MJ7A 2WUGA 2V6ZM 3G2KA 3D0KA 2X0EA 2BZ1A 3VR2D 5IG2A 1RMYA 4K6KA 1YXMA 3OQOA 2XRFA 5E6SA 1Z07A 4FQ8A 5GOTA 1GZ5A 3AUFA 1W1IA 2V6JA 2CMGA 1SU4A 1QLWA 3DS8A 4E6PA 1LI4A 4FX2A 1NNUC 3R23A 3MJTA 4RANA 3FOFC 2ZB2A 4AU1A 3S2ZA 2CGEA 4B6PA 2BTQA 3TYXA 1AOXA 4RTOA 5EI5A 2OBNA 4GO1A 4IIYA 3IT1A 1SOMA 4IEFB 3RS7A 1AO3A 1E1YA 4P84A 3MGCA 1E1DA 5BVHB 5I4IA 1O94A 3E3LA 2DOKA 4J7UA 5E8RA 3BEOA 3GAZA 3IAM6 2FX5A 1P29A 1TW2A 3SYNA 1NLFA 3HCDA 2HA6A 4FHGA 5KNCA 1QQAA 1VIYA 1JFRA 1W4RA 4NENA 4W63A 2WJ6A 3ORFA 3UOAB 4CV1A 5CFZA 1Y8GA 2JFYA 1WB5A 4YROA 4DLKA 3M6WA 1FP4B 5CYPA 2C4VA 1TUBB 5DTJA 4YRZA 3H1PA 2IZOA 1R8XA 3TQHA 3NXKA 3UHFA 2P5TB 5KOIA 1XCPA 2VH1A 1LZKA 3JASA 3ZS8A 5DW0A 4HNVA 5FWYA 4C7OB 3GFRA 3P19A 2QSYA 4I99A 5I7RA 1C7YA 3NHAA 3FKSD 1NI3A 3UXMA 1ZAKA 2WJWA 3ON5A 3EMDA 3KOZE 2QUKA 3EYWA 4GNRA 1YZHA 3M1LA 3OESA 2AZTA 4EL5A 1QOQB 5ADHA 2ZIEA 4Y6OA 2GK4A 3KJNA 5B53A 1OILA 1ZH2A 4EUEA 3D3WA 1PGPA 4MEJA 3GMDA 3N70A 4G1FA 1EQ2A 1X7HA 4CV2A 3JARA 3FAKA 1J8MF 4NMXB 5CG2A 5CIQA 2ZBUA 4X65M 3GDHA 2IDKA 1CKEA 1CWUA 4I5IA 2QVYX 1XR3A 1SQFA 4KGVA 5LQAA 5EIHA 2A0KA 4BO4A 2ZTSA 4LZZA 1IOVA 1U9CA 3SXUA 2YWEA 4N6GA 3G2IA 4CMHA 2ORWA 5HZKA 2QAJA 3AVYA 3DZGA 4DV7M 5F3WA 3K5HA 4MUNA 4MSUA 2JB9A 1GUDA 1J2RA 1ZVVA 3PNQA 4PQFA 4C29A 3F7MA 3DW3X 1M74A 4JB0A 4OK6A 3AR2A 3ZHCA 4ERNA 3DYBA 1Z4QA 4EYGA 1RYNA 1IPHA 1QE0A 5BV7A 4B46A 4HNSA 4TKVA 2Q9BA 2L2QA 4B45A 4Z4CA 2OECA 3E81A 1UKVY 4U3JB 4JVNA 4QVIA 4LRTA 3JYLA 2X7XA 1S89A 3UQZA 2V97A 1FS4A 4C7MA 3FWNA 1KJZA 1XAJA 5F2NA 1HGXA 3A9VA 5CJJA 2I1WA 1RCFA 3V1TC 4JQYA 4XRGA 3CVXA 4C6TB 3A26A 1CZNA 3SHQA 1H6CA 2G4LA 3AEZA 4RJKA 1MXFA 3HLTA 3GROA 2FK7A 5BSFA 3M6FA 2Z4RA 2HHLA 4PIVA 1ZI9A 3V1LA 3QNWA 2X0DA 2VF2A 3JQ6A 4LQDA 4ZU1X 3CSSA 2ID4A 4BMZA 2RHDA 3A1EA 3TQSA 1JG7A 1XVLA 2PRSA 1QR2A 4QJIA 1L4YA 4D8WA 4DPLA 3L9WA 5FI5A 3UUGA 4B81A 3M3DA 1TCUA 3SYTA 4AJ9A 2GZ3A 5T8KC 4G2NA 1CE8A 5DO9A 5HKBA 4QJ3A 3IOCA 5THXA 4MWSA 3AR6A 1PR2A 2JZCA 4KXNA 3QKRA 3UQYS 4P17A 5TRTA 3P2OA 2IQ5A 3QVJA 2TMKA 4FK8A 4IGAA 1VKHA 2MOKA 2YFQA 4LMPA 4FFWA 4QG7A 4NBLA 2A0WA 2KZUA 5AVOA 2QLBA 1GU1A 4HDRB 1AX9A 4HB3A 1OAAA 4GR9A 5DF1A 4XGKA 2KYRA 3DOOA 1WF3A 4M6WB 2YQ4A 2GZMA 4R5MA 3AJRA 1QGED 4UMFA 4MUKA 4BNTA 4GI5A 1T5OA 2IA5A 4J4TA 1OPRA 3QUQA 3RHZA 2IYWA 3EIQA 5K0NA 4A5OA 1UPUA 1LWNA 1F9EA 4JR1A 2H7VA 1W2HA 1AGYA 4GEWA 1PV4A 3TZBA 4CF5A 2QQ5A 4IJ6A 4QG3A 3IQEA 2G8NA 1TM4E 4IY1A 2X5KO 2O3JA 4HT3B 2B69A 4JYAM 1DLJA 1I01A 3ZLUA 3LJKA 3TKAA 1M2GA 1SQSA 1X87A 3N87A 4HVAA 2J33A 4GRAA 4WFIA 2VYVD 1LS6A 1M6NA 5ENZA 1GAQA 2O3SA 3C6MA 2FSSA 4M1EA 3LLMA 1USVA 4I8DA 4DILA 5JO0A 1WA5A 3IDAA 2DUUA 3NBIA 1CJTC 2CV2A 3GGPA 4HWRA 2R96A 5JYDA 4ZVPA 5ITRA 1SB9A 1ODKA 1ZN7A 3WLLA 3ANSA 2PUBA 4NE7A 5CITA 2FEAA 1HYHA 2AYYA 3LH5A 5JROA 3WR5A 3KT0A 1L5NA 3A3YA 2CC2A 2X8WA 3O8OA 2WQZA 3U3OA 4LWZA 1G0NA 3Q3GE 5IDYA 4KLNA 4M37A 3WWOA 3DM5A 4I14A 4BQPA 4OMFG 4LWPA 1PZEA 3MK31 4WJLA 4HDMA 4EZEA 4PHTA 4KTTE 1Q3TA 1VA5A 3W34A 5CFMA 3TMYA 2GCOB 1K88A 3P45A 3IVGA 1X94A 4Z6KA 3PB3A 3I4CA 3AI1A 4ZU6X 3BQNB 4KRXA 4XQGA 1KJYA 4FMDB 4BQQA 4OHXA 1UXGA 2L82A 4FGZA 3B6EA 4MQ5A 1M6EX 1DKRA 3HKCA 4HWPA 3FF4A 4AS3A 2BGRA 4GEKA 2QRUA 4UQPA 8OHMA 2TMDA 4FQ5A 2XDWA 2LCQA 4AZVA 4OXYA 3B13B 1DC6A 4WY8A 4WOJA 4WXHA 2OYCA 2FMUA 4YPOA 3I8SA 5F7XA 2C9DA 3L93A 2BM9A 4E22A 2NO4A 3H2BA 2HC9A 3G8AA 1M0SA 4JUFA 3ZV5A 3KQNA 1F4PA 3VHXB 3K96A 1N0IA 7AT1A 3SDSA 2BFFA 4LHXA 1W0CA 3ECAA 2P27A 2AXNA 2ZTUA 3DYVA 4RFSA 3Q85A 3DL0A 4OQZA 4N9WA 3VO1A 5CA0F 4LKOA 1O0SA 4OQ4A 2XB4A 1A95A 2WAMA 4HAZA 4TVSA 3ESDA 3ROEA 1SKBA 4TTTS 2C88A 4WESB 1FDUA 1QG6A 2R47A 2ZT7A 3BBZA 3R5HA 1HLPA 3QXGA 4KDRA 3OZCA 4L15A 5E2IA 1YMQA 3HR7A 3TL3A 3JRXA 4C4OA 4EAAA 4C06A 1KFVA 4M98A 4OQMA 3NALA 2EKFA 2IRWA 4GHLA 4R01A 1B0ZA 3LWDA 3TJZA 4MW5A 3L4JA 5DCLA 2QG4A 3PQ2A 2AI2A 1JEQA 1TX4B 3TKLA 5EKXA 2PJRA 3MHPA 1B6RA 3NCTA 4RQUA 2G08A 4M7WA 1SVIA 3ZE6A 2SNIE 1KBZA 2WKRA 2ZZMA 4B3JA 3THWB 4ZQCB 2ZI9A 4UFOA 4C4PA 2YMLA 1B4DA 4QQ8A 1PGNA 2GILA 5G0SA 4HGPA 1UM9B 1WSDA 5AHOA 4UM9B 1ZN9A 2D8AA 2MWMA 5EINA 5JDIC 1RKUA 2BCJQ 4LTMA 1T0UA 5A7GA 1XYVA 4OK5A 2JJ1A 4FJ2A 1NW3A 4C03A 1VLLA 1E9CA 3GFBA 4QUIA 4YAWA 3F97A 2F3PA 4I55B 1RI1A 5DGIA 3H19A 4DAEA 4MB2A 3HO8A 3TVYA 5HKLA 2OZLB 4U2EA 1A5AB 4M38A 3HBAA 4K2AA 4U2FA 4M0WA 3B5JA 2NNLD 2OV1A 4TZKA 1FTNA 4TXHA 4D3ZA 4OHFA 1U1IA 4BB5A 5T3YA 3OP4A 3E9EA 2FUNB 1VL1A 3KKQA 4QHYA 4ER0A 3DWEX 3IBGA 2Q3DA 4CQMD 3V3KA 2HA5A 2ZIXB 3S1LA 3LDHA 3MFQA 1T0IA 4HRYA 4P3XA 2VJMB 4I4TF 4I1OA 2YMPA 2ATCA 1Y6RA 1CB0A 2WT9A 3TSAA 3RF6A 3KL4A 2LPMA 3HXLA 3A28A 4X8LA 1Z0FA 3GUZA 3QVVA 4PC1A 4QSHA 1INLA 1L5QA 2J5BA 1JT2A 9ABPA 3H65A 1T26A 3ROPA 5BNFA 1UPAA 4B6QA 3SQMA 5JW6A 2C8VA 4P92A 2RB4A 4KL8S 4CETA 3CUEF 3LK7A 1DTWA 3PVCA 3DZFA 4RJLA 3QYPA 1V11A 3G7UA 3MYYA 5FV4A 3KPUA 4MJLA 4BVBA 4HNQA 1O4VA 2FN9A 1FZTA 4IV8A 4F2DA 3U7GA 1MA0A 2OO3A 4MPTA 1U1FA 5LN1A 5EKSA 2P0YA 3QX3A 4K0KB 3IIEA 4NTZA 4A0SA 2DHEA 3SQNA 2NU9B 4GVXA 4ZK2A 3JWPA 5COQA 5AJWA 4YR7A 2HGSA 4UDNA 2X0IA 2IOQA 1NVMA 2BF7A 3ZXIA 4MW2A 3BB4A 2O19A 3J7AS 5FI0B 1L6IA 2VJCA 4BCBA 1PSWA 4M54A 3ZD6A 1TNDA 3OFJA 3H5NA 3A36A 3VDUA 3AF5A 2EJUA 1UC5B 4GM1A 2FZVA 4D9JA 3QUSA 2ZXEA 4ENWA 4NQRA 3RIYA 3BRWD 1R50A 3HXOA 2FG7C 3HHEA 2Z58A 2A0YA 3IHLA 4CM9D 2EAUA 2WD8A 1KQGA 2QG6A 1G1AA 5BQPA 2IUTA 3IEMA 1US8B 1S2DA 3K0SA 2FRVA 2M9MA 3R0ZA 1WF6A 2O4UX 1OTXA 1P7WA 2ZSJA 3Q3VA 2EBHX 4OHZA 3W8NA 4BO9A 4YRMA 1I7QB 3QU2A 2VHWA 1OXVA 2BBOA 5FOTA 3F5MA 4JJKA 4ZHQA 3KC2A 3I52A 3CM0A 1XNHA 2AKAB 3VRHA 5CCXA 2VI5A 3TNLA 5CNMA 4DC1A 4ZZ3A 4G4JA 1GGEA 1SVOA 1THGA 3C3WA 1JSCA 4G56A 2I62A 4HZUA 2G5GX 4LJ4A 3EC2A 1THZA 2X42A 1F4VA 5JMOA 1UEIA 5A4KA 1IOWA 2KW0A 2BMJA 3FZNA 4LJLA 2CSXA 1K82A 2ZR9A 4P4TA 5JQGF 2CJXA 1HYQA 1RHQA 2VDWB 1KYWA 4AYWA 2UVPA 3GP5A 1CUKA 1NURA 2VYND 4ZI3A 4WXYB 3IPXA 1G2PA 4UPEA 4HQLA 4D9HA 1WY5A 4NBNA 1W9MA 3CZ4A 4TTSA 2RHMA 3JQGA 4WXEA 4E15A 2HWJA 1VHDA 3SVZA 2WILA 5ALNA 4JV5M 2IP4A 3U9LA 1JHVA 4MV6A 2IXBA 421PA 1ZVKA 2CY0A 4KPUA 4JYMA 4J07A 3KL2A 3WS7A 2AG5A 3M1YA 4KU4A 2PVSA 1ZJZA 3PHCA 1IH8A 4U0KA 1MPTA 2UZ4A 5L45A 3DO6A 4R41A 4JB3A 4XDZA 1F8XA 1NAIA 1LTQA 1N2JA 1T1EA 1G19A 1OREA 1XCJA 3RHFA 2OWDA 4E12A 1L7DA 5EMHA 5HJEA 4V0SA 3N0XA 3RAJA 5MGNA 3L0IB 5BPFA 5AWFC 3GN2A 1EFDN 3ZY4A 2DZLA 4UPDA 3A6GA 1E7SA 1GNPA 5GZ3A 3KFXA 3OKCA 3RR2A 2L2DA 2F43A 4AMYA 4LBYA 4XR4A 4G26A 2JWSA 4A7PA 4CTKA 5I3CA 3INTA 4UM8B 1COZA 4MUHA 4YJGA 1J7KA 3PDCA 1CNFA 1ELOA 4UDOA 5JXGA 2OSVA 3X1MA 1WTCA 2O1EA 1IHXA 2VF5X 4QEDA 1M0WA 1XKXA 3ZGLA 1BWSA 3PLRA 2BJHA 3I0NA 4H27A 1MORA 5T4FA 2OV3A 5ETJA 3ZIDA 3MJVA 2H3EA 4CM4B 1H0RA 2PMEA 4DIMA 5LM3A 2X8AA 3R5TA 3TB4A 2G1UA 4BKPA 2Q4TA 1OT3A 4BV9A 2GNPA 4P31A 4WY2A 5CVCA 1G4HA 1C41A 4EPTA 1CYDA 2EYUA 1CUZA 4L3OA 1ZR4A 4OYLA 2JJ8A 2ZTLA 2GM3A 3NHMA 4YFVA 1WZ2A 1KARA 5HX7A 4ZMSA 2OKGA 4ZMRA 1QBGA 3TL2A 3OZSA 2VATA 4PPFA 3H9JA 2AR0A 4P4GA 4JLPA 5K3CA 2LTUA 2BELA 4TLMB 3DBRA 4P53A 5CK4A 4BS9A 1NLYA 1R4AA 4C78A 4YT8A 5KINB 4JUCA 3O8QB 4PO8A 2Y1CA 3BMXA 1I2DA 1YACA 1QPZA 4H0CA 1YQTA 4NCBA 1S2LA 5FBQB 4CT4B 1ND5A 3GFOA 2IYQA 2J67A 3IA2A 2Q49A 3VPCA 3EQ6A 5ULLA 4WXPA 4RPJA 1DGGA 1UQTA 3OQ6A 2Y92A 4JODA 5T6MA 3EQZA 1XA0A 1Z0KA 2OM6A 4IG4A 2D13A 9GPBA 4OA8A 5IX8A 1KMHA 3NHYA 5ICSA 2H11A 2V7XA 2X14A 2PKEA 4R1SA 3LVRE 4OP1A 2GZ2A 3X2SA 3KM0A 1GZVA 1P2VA 3WB1A 1GO5A 2BFBB 1SRRA 2BD0A 4GHWA 3HVKA 3A1SA 3LCUA 1QYVA 2R1TB 5ITZA 4N0PA 1OGYA 1X92A 4MRAA 3D8HA 1EFTA 5DBEX 3W5UA 4URFA 3K1AA 3EEQA 4Q9HA 3MB5A 3BMOB 2ATVA 3CEMA 3CISA 3O3NB 1YVDA 4I6EA 4FFVA 4XYGA 3L8HA 4TGLA 2VHJA 1GDDA 2I4NA 4URWR 5EA2A 2ZS8A 1UBSB 5KCMA 3NGLA 1HQCA 3AW8A 2R8XA 1ZONA 3EVNA 3K9LA 2VRCA 3JYHA 1YULA 4W9NC 2IOFA 4WA7A 4MWBA 1PTKA 4P3PA 2FKAA 4DC9A 1MX1A 4E5NA 4ZEMA 1CQXA 5A2QS 3I2JA 3L6DA 2V7UA 2R84A 1NR1A 5FH9A 1CRPA 1DZ3A 2CCKA 3KQPA 4RKQA 1IEVA 3UUWA 2VHXA 1C1DB 3FHOA 1U6IA 1SC3A 4HGRA 1N2OA 2IX3A 3ZI7A 1I3NA 2OM2A 2HBQA 3NHPA 1U8FO 5L7WA 4NXMB 1W1WA 2JCVA 4RTPA 3KE9A 5K7SA 4L7VA 2VLBA 4MYRA 2A3RA 2HBYA 3PU6A 3HN7A 1PJLA 1GCAA 2WI8A 2DAMA 2Y0CA 3SAUA 2LTAA 4RZ3A 4O4HB 4HDSA 1GV1A 1Q0RA 1N9GA 5I51A 4GMHA 5BN4B 1DELA 2Y93A 5F64A 3PRKE 4B40A 3W9SA 3O1IC 2CJYA 1W36B 1JR3A 1TIKA 2FWAA 1XAIA 1EZ1A 4ARVA 2SCUB 1T36A 2WHRA 1UCFA 4XWTA 3MT8A 2QK4A 4P2GA 2ID9A 5C51B 3B5EA 4QGBA 2CL0X 4ZT4A 2E9SA 1G5QA 2J46A 4WN9B 3IA7A 4NMWA 2FE1A 2NWQA 1P2DA 5J47A 1IULA 1BFDA 2MINA 1RC0A 1R8QA 2OY0A 4MIEA 1YE5A 3MF4A 1QDUA 1LLQA 3S70A 1X80B 4DANA 4RF0A 1DG3A 5COAA 3QIVA 5IU6A 3S7ZA 3K30A 1YRLA 4GHAA 5EJMA 4TS4A 3NM5A 4FXPA 3ITNA 1O7JA 4ONEA 1GPH1 3L82B 4QU0A 2GKGA 5L3VA 3IERA 5K03A 3H11B 5F7OA 1COWA 4FGUA 2GVZC 3W5SA 1L7XA 4DA7A 3ELWA 1FJ2A 4LS3A 2F4VM 1CB7A 3OAAD 3NETA 3UT5B 4WVLA 4G86A 2XD9A 1R0LA 2IEZA 4C2AA 3NHZA 4FW8A 2II6A 1S8FA 1YQUA 4S0ZA 1X0VA 2DFKB 2HMUA 4KDFA 2NVBA 2YNMA 2IDMA 4DNXA 5KTTA 1V5WA 1E9SA 3PQCA 1N0HA 3M6XA 1CF9A 1UBCA 2GN6A 1X7GA 5DBGA 4JWTA 5SICE 4A3SA 3IQZA 3GJZA 3ZGNA 3OF2A 2C98A 4LXHA 3TMKA 1W30A 3QWLA 2WHXA 1PEYA 4C05A 3I62A 3VO2A 1I2CA 1DJNA 5FUBA 4E70A 1HEUA 1AA6A 1SEPA 4EY5A 1C9EA 4FWGA 4NNPA 2D7CA 3L7NA 2ZTCA 2Q5IA 3DHEA 4JUDX 4Q9NA 1HNZB 4Q7KA 3LTNC 3CRNA 4B0OA 4LSGA 3WJ7A 3SZ3A 5J4VA 4RWEA 3PQ6A 1UJ5A 3MERA 3ND7A 3NUGA 3HLYA 4IVQA 3ACDA 4O0MA 4OB7A 3HJFA 1T9ZA 1ZM2A 2HWXA 1XZKA 2F8MA 1W1UA 4EBFA 2ZG6A 1OVGA 3EJWA 1CERA 4HB0A 2B7BA 1FK8A 4I1IA 4G0YA 3JATB 2ZB3A 4LJ7A 4FDMA 2W4QA 3RIEA 5A2QA 2C9OA 4FZ3A 1Y42X 2ID8A 1Q3BA 2LVQD 4NJMA 4FFOA 4LF5B 2I7VA 3T7JA 3A6PC 2E4AA 2EL9A 1B93A 4B7HA 2D4AA 2VQDA 3OLXA 2ERXA 4D4IA 2ZUDA 1RXSA 1UC4B 2GAJA 1G8FA 2FJPA 4RW0A 2P1DA 3FR7A 4FDLA 5B37A 4DQXA 3U7RA 1L5VA 2GETA 3WHKA 2FPRA 3SBJA 3D6FA 1JXAA 1PZGA 1WE2A 3OE4A 1XDSA 1CFJA 1JFSA 4A26A 1ZU5A 1PN3A 3BXWA 2GYUA 4IOLA 1QOPB 4AJNA 3ZZ1A 4CFZA 5JFTA 4F1IA 4BPRA 2DPMA 2C99A 1E1NA 3IR5A 4WK6A 3V97A 2EFCB 2PUJA 2J6BA 3I39X 4IJUA 1DJOA 4RPKA 1NE7A 2QRPA 1QM5A 1K8YB 1KVRA 2XWJI 4JOCA 1K5HA 2JD1A 4ZYUA 4D81A 4PYRA 2VDPB 2JKYA 3W5HA 2CMFA 2DKOA 5C8YF 3NEJA 3SMVA 2BP7B 2V4MA 4FCCA 1QP4A 3SICE 2JFZA 5AVKA 3LBNA 4C5CA 1S4MA 3GN1A 2DPHA 3GWGA 3K0AB 3HGTA 4NS1A 4X6YA 4MCJA 2H1RA 3QY0A 4E46A 1QZMA 2AK2A 3LF1A 1G8HA 1O03A 1OJ7A 2AX3A 4TLDA 3I5AA 4KIGA 3EQ7A 5CBKA 4ZGWA 4MV7A 1KYYA 1E0KA 3BK7A 1JB1A 3O90A 3E8MA 1G71A 5DM0A 3N6XA 4IEIA 2QPOA 1G59A 2UXCM 3DDSA 2VZLA 4GWGA 3FUUA 4MMXB 4DRZA 1KQOA 1NP7A 3GFPA 2JUJA 1EUDA 3F49S 1MJNA 3EW9A 2YVKA 4MVJF 2XZDA 2ZJ8A 1YASA 4HWOA 5I5EA 3O83A 3JV7A 1EGQA 3JR4A 3DGEC 5DGHA 5IJ0B 2P11A 5ITVA 4ID3A 4PGFA 3UPUA 5C5DA 1UMBB 4NDNE 1W25A 1Z5NA 3MELA 4LYEA 4X6LA 1DAEA 2C5LA 5BW5A 4W5RA 3HMKA 2FPGA 3ZDYB 5AOBA 2FMXA 4JGIA 2XH8A 2OXTA 3OTQA 2YWJA 2WABA 3HRKA 3G2MA 2BSQA 4C0AC 4G6ZA 3L7YA 1Z82A 4FYWA 2VSOA 3U6LA 4D4LA 1Z7WA 1JJAA 3FYSA 2G09A 5HRAA 3PUHA 4IGFA 2CNBA 4FFBB 1QDEA 6ABPA 1L7PA 4KSYA 1WJGA 4A8TA 5JVDB 4LJAA 1PFYA 1E1CB 1N2GA 3ZY2A 1VA4A 3MT0A 1HWYA 2P4EA 5EXPA 5JSHA 4JLMA 3VV3A 2IYYA 4IG9A 3DT6A 2RGDA 1XAGA 4KODA 1RXYA 3V33A 4Q03A 3X1DA 1F5NA 2PR7A 1R0BA 3EVAA 2JLUA 3CJTA 1JVBA 1GSAA 4ZEWA 3WI7A 1E79D 4M22A 3EFBA 3W8EA 2I2CA 2W93A 2HIMA 3WIVA 1WZNA 1T4CB 1U2SA 4YCNA 1Z16A 2P0EA 2QVZX 4QL3A 5ALRA 5EKDA 5A4FS 3T12A 4N03A 2IU4A 4GKKB 3IQHX 4B3DA 1N6RA 4LBWA 1HDXA 2W83A 1P31A 2C5GA 2NU7A 1XXHB 2BMWA 5IF9A 1BX0A 3NUZA 1KZ7B 3C3CA 1OIVA 2O8BA 5FL7A 5L4LA 5MN4A 4XPIB 4JJEA 5ALQA 5FFNA 1CHDA 3W5DA 4E3WA 3DWIA 2VBCA 4AJPA 3BGOS 1DDOA 4TV9B 4BJ3A 5BW4A 2MSEB 3NMUF 3CT6A 5CDFE 1VE9A 4BKRA 2JLQA 3PC6A 3AY7A 5F1YA 5TJHA 4YRTA 3TRIA 4Y6QA 4CUZA 4LXUA 2DYKA 4Q1VA 5FEUA 1TCAA 3QEKA 2BGLA 1QXSA 1YB4A 1F3LA 3D2CA 1KYZA 4D9BA 5BVGB 4IOKA 2IZ6A 4K40A 1VB5A 2IWRA 2AN9A 3SBEA 3F9RA 2QSUA 3HU1A 1PVOA 1HH4A 1UBNA 3RUHA 1GITA 3O6VA 3N7TA 1BU5A 2C2HA 3K9QO 3BM5A 1U7TA 2B2CA 1KDYA 3MRSA 3UOWA 3GQ4A 5CAEB 2XTAA 1OKKD 1ACMA 3VZDA 4K5QA 1ENOA 1GVNA 1YH3A 3N0WA 4NU0A 3W90A 4RSMA 3R9IA 3ODGA 2IXFA 3HR4A 4PRKA 3VKUA 2I6FA 6AT1A 1WB4A 4CKZA 4YP1A 3LCMA 2ATXA 3FWPA 4IBJA 1GTJ1 2G1AA 2XGOA 1RJ9A 5D01A 1VYUA 4B5KA 2QX7A 3S40A 1TT5A 3K0BA 1P5ZB 4YJHB 3LUFA 3VZPA 2PKWA 5A3VA 1RLOA 3IHKA 4GNKA 2P9GA 3PX2A 4BQOA 1RQGA 3SOPA 4MYHA 2YOGA 2YASA 3PDIB 1QH8A 1ZEJA 1OH6A 1YE3A 2VRBA 3KZXA 2Z2YA 4EUHA 1P5FA 4WLFA 2O5EA 1J0CA 4DLPA 3QITA 4I5FA 1NC1A 4WP2A 3CVYA 2ZJ1A 1UBJS 3HTXA 3AJEA 3L02A 5KBYA 1JHDA 5KHAA 2EARA 3AF1A 1ZMOA 4N18A 2PUAA 2PGAA 3KOXA 4B85A 2ZDGA 3HEBA 3C58A 5ED0A 4RTQA 3T1YM 1AUQA 3OZDA 3J7TA 4Q18A 1MABA 1WNFA 3ZH2A 4EVIA 4UAGA 1V6SA 3UH0A 2WSYB 1DGFA 1QP8A 3VKWA 1I1OA 4QEKA 4RTNA 2XB2A 1GAEO 1KDRA 2RARA 1F2DA 1VKRA 1J23A 4O5AA 4OD0A 3IPYA 1E3LA 3N9IA 4UUBA 4B7GA 2GJSA 3SBXA 3E5RA 4D9EA 4J90A 3UK6A 1AN9A 4E3ZA 1VZ3A 5JBNA 3OPYB 5CDUA 4U8HA 2LH0A 4F8YA 1OYWA 4Z3OA 1R0ZA 4DVJA 1BEUB 3HACA 4JB8A 4ESOA 3I12A 4BNLA 2BFCA 1C3OA 4Z0PA 2ZIVB 5DGDA 4YMIA 3CH4B 3D8UA 4WLOA 2IYTA 3RUDA 3ZE7A 5AI6A 5EIWA 3UPDA 3UIEA 2UXBB 2DH5A 4FYJA 1QF7A 3TLBA 4Q4CA 1FRNA 1JUDA 1CF4A 3RG2A 3D0RA 2DWUA 4RQAA 1Z8NA 2OYRA 3NW9A 5MN5A 4ZZ2A 1E9BA 3DZDA 5B7GA 2OHGA 4HLQA 4DQKA 6CHYA 1YRHA 4FWHA 1IHOA 3FD9A 1M2NA 4RF1A 3BG5A 4GLFA 5CJPA 1O8BA 3U6KA 4BTLA 4LDQA 3K0FB 4KYIB 1KMMA 3ZJ5A 3GPCA 5EHXA 1PL0A 3JAMS 4K7JA 1JFVA 3THOA 3WRXA 2ZRBA 2RHJA 5HTOA 5L4NA 1OFHA 4QBKA 4UM7A 4WQMA 2P5SA 1ZMVA 3Q8MA 2J7PA 4JBWA 1T6BY 3H5LA 3HNRA 2NIPA 5TC4A 3QI7A 3UCFA 4PYJA 3X44A 1O08A 2HX1A 4O2LA 2QAGA 3PFHA 1HLGA 4I8IA 1T15A 2DULA 2MYNA 2GESA 1QCZA 3INNA 5ALPA 4ND1A 3EIOA 2UUCB 1B73A 1C81A 3C3BA 1PCXA 2HD4A 4EB6B 4NEHB 5L7YA 3KEOA 4MHTA 4BC1A 2RI0A 5A5FA 2ZR7A 3L6EA 3E53A 4EO4A 4HGOA 3OIDA 2HV8A 3A1FA 5ALUA 1YS2X 2ZPUA 3MHTA 5CA0A 1YJAA 2Y6UA 4P4SA 1P1HA 4DXHA 2P9TA 3GLFE 4EITA 3V7YA 3PDUA 1M1NB 5I9MA 1CSEE 4X64B 1D2EA 4LF7B 1BGXT 3FROA 1FXUA 1DT3A 4NFSA 1WBDA 1XD2B 2EWWA 4JDPA 1I3MA 5BWCA 3KXKA 3WWPA 3B9PA 2PSSA 2YVLA 2QQGA 2SICE 3ANLA 1P2GA 3WQQA 3FJ1A 5EXSA 3A11A 5KYGA 1L5LA 1FSPA 4BRWA 3D5EA 5CLLA 1OZ0A 4P86A 3HWSA 2JGRA 5DGXA 1ISFA 1TTTA 1XVAA 1GQ2A 4PAQA 4D8UA 1D2CA 4KQGA 1R18A 2O5RA 2H5IA 2PPVA 3SYRA 2HW8A 4K9LA 2Q3LA 2X2FA 4FC7A 3NORA 1C2TA 3T5MA 3TQIA 3JTMA 1UMDB 5JG7A 4CKCA 3RAFC 1IEWA 2P3SA 1KQNA 3CF4A 2RAVA 3KK0A 2JGLA 3P97A 5AXCA 1Z7BA 3WGGA 3A42A 3WAJA 1LPPA 3UXEA 1N6LA 1KWKA 4KJXA 3BXZA 3F2IA 3WLFA 4EI2A 2GA8A 5ESXA 4PHFA 3HJHA 1QR6A 3QWAA 2P6PA 3CH6A 5JI2E 1ZM3A 3HSYA 3QOXA 2VUSA 1ADJA 5D84A 1DI0A 1SBNE 3G7NA 5H02A 1Y8AA 2IPXA 2LVBA 4WECA 5ILOA 1OH5A 2C57A 3EUEA 4B3HA 4ISCA 3LY8A 1FNNA 1L4FA 3V4RA 1LW7A 1QWOA 5LMNM 3VHRA 1E7WA 821PA 4R05A 4X91A 2AFRA 1L1ZA 4WXRA 4K26A 4REQA 4B7AA 2QPAA 3OLZA 4DBVO 2J4FA 3PC4A 3EZFA 3AM5A 1J5EB 1DNPA 3PKIA 4Q82A 4TMYA 2V0CA 2MROB 4H2DA 4U00A 1ZM9A 4JBYA 3F67A 4YIKA 2WD7A 5HP4A 1SHUX 1FMFA 2XKJE 4QM7A 3G5UA 1NHGA 2XE7A 4JI1B 5E0KB 1FQOA 1AKNA 4JLWA 5D6OA 3SD7A 1CK4A 1JLKA 4O59O 3OQPA 1GQSA 1UDBA 4I4TA 4YQZA 2GAFA 2FAXA 4PTLA 5ALJA 1ODTC 4B3TB 4H18A 4O2BB 1P72A 1JXQA 1YSCA 1P18A 1I4LD 2FN3A 3BC1A 2QXUA 4TMVA 2D0PB 2W7TA 2C4KA 3COSA 4FNOA 4N3CA 5I5GA 5JNUA 4Z4IA 1D7AA 2FSFA 4ZDKA 3FSGA 2QGFA 1TZMA 2PS1A 4KAJA 4WKGA 1GXSB 1DAHA 3V46A 3V7UA 2Q27A 2YR0A 3PXDA 3JAMA 2JI6A 2F8SA 3GUUA 1WSBA 2JZ1A 4UMDA 3ONFA 1PR3A 1E2EA 5SZJA 2DH6A 1REQB 3UJHA 2I6UA 2OBXA 3P0HA 3T4XA 3GZTB 1T3ZA 3E3OA 3LPLA 5FUWA 1E2IA 5L51A 2C2ZA 5AVTA 4M0KA 5KYNA 2PLFA 1K4MA 3FBGA 2GM4A 1JFFA 5K9ZA 3MTEA 3SATA 1XZCA 4Y28F 2P9ZA 3SSOA 3UK0A 4AJHA 3FDJA 1Y8QB 4GMDA 3ZUGA 1VJ1A 2N75A 4YT4A 3Q9NA 2FX3A 4CV3A 1CETA 4JN6A 5JCPA 3WNZA 2J7NA 1L1QA 2I6GA 2K7ZA 4CNQA 3BIFA 4BAZA 4D8YA 2X8LA 3TNDA 1D03A 1JS1X 3L7BA 4K05A 2EGHA 1TQ4A 2X4AA 4DR4M 1N5RA 3RTDA 1WMEA 5EJ4A 5AM1A 2GBFA 1H2EA 1UWVA 5U1PA 5IARA 4QM6A 2CUTA 4A0RA 4E94A 5EUCA 4PSDA 5JAHA 5KDOA 2OORA 1P9LA 3HO6A 3H5OA 4BEJA 2NNWB 2VPZA 2FXVA 2OMKA 4I0WB 4BFLA 1RQLA 3R6DA 1ND6A 2NAPA 3CNBA 5IJZA 1VG5A 3OM1A 4IH1A 3CUWA 4H7JA 3UH1A 4GLOA 2O7SA 4B8WA 4DM7A 4UVDA 5M34A 1N57A 2GXUA 4TMFA 3JWGA 3WLNA 1P1IA 3V32A 3WLQA 3N2EA 2YWHA 1CUVA 3RDPA 2JY6B 2WFLA 2H2GA 2G0NA 5D5QA 1TM3E 4YV0A 4CJXA 5JQGA 4MVJI 1DWQA 5LZ4A 4R1QA 1UPTA 2OFFA 1NBWB 4NJEB 3JQFA 3QK7A 2G17A 3JQ7B 1IFXA 4FOLA 4Q1AA 3P2IA 4ETWA 2Q6IA 4M1OA 2G7ZA 3UKOA 2PKXA 5EWMA 2Q3BA 1W36C 1F3OA 1QIEA 3F9CA 4BN5A 3V7FA 1HMYA 4D3FA 3KB8A 3LXUX 4DQ0A 3H75A 4CR6A 2NTJA 4LOLA 4UE3S 1NLMA 5JTTA 2DWQA 1RT9A 4F56A 4DIFA 4JAVC 1UJBA 4MJXA 3PHHA 2Y2UA 5AVQA 5J4LA 4NAVA 3G0BA 1LPBB 4EFMA 4OM7A 3GA7A 3JSXA 4CT0A 2VSYA 3HWRA 2QT0A 2FZCA 3T7IA 2R97A 3FYHA 3DBOB 2JP7A 5CXXA 1PD1A 4K1XA 3NU1A 2V7WA 1PZXA 3A4VA 1NNUA 1YZVA 3HI4A 4GF5A 3F5SA 3B5IA 4F5ZA 3GK3A 3I4VA 4K6FA 3T7DA 2I55A 1VP9A 3PTZA 5KZMB 1O95C 1P6UA 5H8WA 1VJ5A 1DKNA 4KH1A 5KYKA 4TN1A 2A5DA 4ZV9A 3H1AA 4JFAA 3RBAA 4TZ0A 1WR8A 2R1VB 4RAOA 4JLAA 3OCJA 2D1RA 4F96A 1XZQA 4FZRA 4CYMA 4NSNA 2A0FA 4H08A 4EMBA 4BKQA 1XUOA 4M86A 1G6KA 2PS0A 2PUTA 1NRJB 4KQEA 3C5CA 3Q0EA 5KYVA 3HKEB 4JGGA 2GCEA 1MP0A 3BMQA 2BM8A 1P44A 2FW9A 2C3PA 3W2TA 5EIBC 3COJA 1UJ2A 2XUJA 3HJUA 2HU8A 3GJSA 4AKTA 2G9RA 3HYLA 2R62A 3I2KA 1EJBA 2C0CA 4MK4A 3D6HA 3PFGA 1IONA 3KU1A 3G49A 2GNOA 1FUKA 1PAUA 3YASA 1UBHS 3FCCA 1RJWA 4TKUA 1R64A 3G23A 2QGZA 1UIRA 5KYWA 3DLHA 5EVJA 5GONB 2FW7A 3IULA 5H82A 2P68A 3L6CA 5AUNB 1RMTA 1TZJA 4LHWA 2AJDA 5CHEA 2JEOA 2Q1YA 3UYLA 4R1OA 4FMDF 4RIHA 4YNBA 3PENA 4DARA 2FG5A 3H2HA 1GU0A 4NV0A 4HLNA 1UQUA 3KLBA 4FQ7A 4KQ9A 4TWZA 4P83A 3OMXA 4OMUA 3ZCPA 4HH3C 3REQA 3ZEAA 3BOSA 1TF2A 4PLTA 3ZPXA 2JKVA 1Q7BA 3C3AA 2QZJA 1FSFA 2ACWA 3H8WA 2V98A 1DGQA 1C4WA 4IIVA 1IZ7A 3VC7A 3DDNA 3OTOB 4MEBA 2WJVA 1U7PA 3H2KA 3X3HA 3AJAA 1JHOA 1BOOA 3OWXA 1VECA 2WFMA 4YH1A 4EENA 2BFWA 3CTMA 4X66M 2YC4C 2ZTDA 3UJ9A 4OFZA 4G07A 2WOOA 4CG3A 1JAXA 2BH2A 4ZEXA 4RS3A 5EP3A 2JFWA 1OYYA 3VYWA 2PQ2A 4HR7A 1IIRA 2ZUSA 2ZIGA 1N1EA 4C08A 5IWAB 1WP9A 4YC7A 4ZQIA 4YRBA 2ZB8A 4WJKB 1RLIA 4LPKA 2XR1A 3VSCA 1HXHA 1HT3A 2J0QA 2RI6A 3RODA 4YBZA 3GDOA 4B3SM 1HSZA 3WL5A 4J0FA 3CB2A 4F71A 2YMQA 1E7MA 5ALVA 4MMYB 2B1JA 4MS1A 5DNYA 2P9CA 3ZHBA 1FJXA 4OJMX 5KQGA 3TF5A 1ZJWA 2OBLA 2PQMA 4ZODA 1YWGO 2Y0QA 4BNZA 1EWVA 1R0YA 3P9SA 4ZO7A 3I5XA 5CH5A 1N8KA 1AHIA 3BSSA 2QNBA 1MCZA 4LDJA 3L7KA 2GCNA 5BWLA 1GEEA 4IDAA 2OCIA 3DHVA 3MS7A 4CODB 2Z08A 1JIIA 1ZOPA 1N7GA 1CU1A 1MX0A 5JWHA 2JAQA 1M5UA 1T5BA 1SCAA 3P9QA 3N2KA 2YUIA 1W85A 3UB2A 1XPUA 5T8KA 4QX6A 4A2WA 1ZV1A 3A6KA 1Y63A 3A9CA 1IXSA 4H7FA 2PUVA 3IPAA 4I55F 1G291 1S01A 1ZRNA 3K09C 1YOVB 3W4KA 1A9ZA 3PEFA 4FJ1A 4Q39A 2PNFA 5F4ZA 1TPZA 3UFXA 3D7RA 4G0WA 4DV1B 5L3QA 2WTMA 5KQMA 4HRAA 3NDPA 4CEHB 1LDYA 1XYGA 1HE8B 1MTZA 1CHNA 4AUEA 5BRAA 1HDZA 4WBNB 3PT5A 2IEGA 1UPFA 4LY0A 4D3YA 1A04A 3SK0A 4UJ3A 3VUEA 4C7JA 2O59A 3F7OA 5IVDA 3ILSA 1KOJA 4RMNA 4TT8A 4NH0A 1N36B 1V43A 3FMOB 2W4MA 4B7UA 3B89A 1GT91 4DA4A 1TAUA 2HO4A 3GIWA 4PN7A 1XP8A 4CG2A 4W8HA 1MOSA 3RNLA 1TAHA 3R20A 5DDIP 1OU4A 1RXEA 3DBLB 5HKKA 3PQDA 4H77A 1M2FA 3KB2A 1SNYA 4XM0A 1PP4A 1OASA 3QVWA 1YHZA 5IBRA 4KWEA 2HPHA 4PGHA 3UAGA 3KJEA 1RYFA 2B21A 1QUFA 4EKYA 1ZNXA 3IAS6 5TVKA 5JCZA 1Y37A 1YUMA 4UFPA 3OBBA 1JEOA 5EKTA 4OI1A 4PN3A 4ATNA 1A9XA 3ECSA 4V0MA 3ZWCA 1W0KA 4JVLA 1ML4A 3F6EX 5HW0A 2D2IA 4ESEA 2Y1XA 3AR3A 4R2MA 1TVMA 2P2LA 1ISRA 5FWNA 1ZC4A 3RKRA 3RU9A 2R87A 1GPLA 3HFRA 3IBCA 3LA6A 3DBHB 1YJBA 2WAOA 3RGPA 1P62B 4HO1X 3DE0X 3M9WA 5C9ZA 2W0SA 4N82A 3AVTA 5A62A 3BIWA 4ZXFA 1CQZA 2H5EA 3ESBA 1JQBA 1DVRA 5EZSA 3DVQX 4EHDA 3MUOA 4HGQA 1SKMA 5KVSA 1Z17A 4ZALA 3PUZA 1DL5A 5K3SA 1HT0A 3BMCA 1BMTA 5L4SA 1PV1A 3ZDDA 2MDTA 3WA7A 1RYZA 1KZYC 4DSOA 3EPKA 3D1JA 4ZOEA 1C8BA 1RZRA 3DAPA 2FXIA 4WCDA 5TPZA 2REQB 5KI6A 1T4MA 2UZ1A 5KREA 4PDIA 1QYIA 2BGKA 1UWLA 1C9MA 4H0FA 1CDEA 4L16A 5JPIA 3IJ5A 1F17A 3P94A 1ENZA 2Q99A 3AINA 5B7PA 1E2JA 3NVAA 3FDZA 1YQDA 1P0PA 4WKPA 3TW8A 1P7PA 4ZARA 2YJGA 1KZ1A 2Q5HA 1JSZA 2NSYA 2L19A 4NARA 3SBDA 2P7IA 1EA7A 3ZX5A 1UKAA 3TTYA 3OF5A 1WUIS 3TS1A 2FLVA 2ZYWX 5ICEA 4E4RA 1RKBA 1C80A 3BREA 3K2EA 3D0QA 3O03A 3LVBA 1VLZA 4FN5A 4UW9A 2DVMA 1HV8A 1DBWA 2FUG6 3N6RA 1NOJA 4C9BA 5I7AA 3R24A 5ANRB 1KFJB 2PYDA 1XMQB 1GTVA 2WDZA 4LGVA 3SZGA 2WRZA 1LI7A 3RLFA 2JIZA 5C8YA 3BSYA 3T9DA 1GGVA 2VDUE 3T6PA 1KJNA 1GKYA 5G0WA 2FLKA 1WXXA 1Z6XA 4D41A 4QXOA 2FUKA 3R7DA 1IBSA 4IKEA 4PNEA 1Y3HA 3PD0A 1MTOA 3AYXB 2FZEA 5JMPA 4XBOA 2ZR8A 4NECA 1OAKA 2P9YA 4QOEA 4YRCA 3ZWKA 3U4QA 3C3JA 3V4ZA 5JDIA 3B8EA 3DOHA 3RNOA 4AULA 3W79A 5IEBA 3EDRA 3HPRA 2C5FA 4EJ2A 1CRLA 5CT6A 2HCBA 2CXUA 1D1PA 3UAXA 1OC2A 2G1KA 3QRWA 4IOJA 1JIUA 4MVJA 4XGNA 1QYCA 3IKJA 2D0OB 2Z30A 4RF2A 4JZYA 3KZOA 2PRJA 4X1KA 2ZYHA 4M8NE 3DZJA 2MT9A 3LLUA 2Q5QA 2VT6A 3JQ9C 4NU8X 5A9TA 4AFNA 3V4SA 5EQJB 4ZO6A 3QQ5A 1TKAA 2BR5A 3IAAA 1SG9A 3HVUA 2E0IA 5BOSA 5FJJA 2A5FA 2YWRA 3AM3A 1BCRA 2NZWA 3QJGA 4MTLA 5IT4A 1PQYA 5CDHA 3FZQA 4YAEA 4BLOA 3PWSA 1TVKB 3RFTA 3WLHA 4B43A 1M34A 4LFCM 1QUTA 4RH3A 4FEEA 1R12A 3O3MB 3HKDA 2QW8A 3DHWC 2HYDA 4ZV4A 3N1UA 1S3GA 5HCNA 2H18A 1X1QA 3GFFA 4DLUA 4ZT6A 5L40A 3PD1A 2Z8YM 1KZ4A 3VKHA 4GR4A 4AT1A 4F8JA 2IHJA 5GKNA 1Q92A 5KNBH 4BNJA 3ZE1B 1AKVA 5T3UA 1VOTA 2DAKA 2JL1A 3T9BA 2J3MA 4NSRA 4EUFA 1MPXA 4S24A 5U4QA 3QVOA 4TLLB 5KHOC 1G2QA 1NDUA 3NIGB 4AN4A 4BVJA 4AJ2A 3K2BA 4B6EA 3GPXA 3VOAA 2I2FA 3NQ41 3TVTA 2JJ2A 1R8YA 3TB6A 4QBIA 1P2SA 3KOMA 2I2AA 1WVIA 3TAUA 4ZJYA 3C3MA 4XJSA 2NSLA 4Y30A 2D2EA 4INJA 5TQJA 3TN7A 5LQCA 1SBZA 1JMYA 3RSSA 2YHIB 5CLGA 3BGVA 1GN8A 4YEDA 4N7BA 4Y6PA 1N5DA 1Y6JA 4G1VA 2O7QA 3IH5A 3DE4X 4LHYA 1X1TA 1T5TA 2G9NA 3EXHB 4GPD1 5E95A 4YA6A 2XYRA 3R5KA 1WIWA 3REFA 2H1LA 4P22A 4HAXA 5DMXA 5LZ8A 3PC2A 2F5QA 4CM8B 1DQPA 1W19A 4DY6A 5H68A 3E8XA 2Q4DA 1SG0A 4MGHA 4ND6A 2VPPA 4KT0F 2A3NA 3GT7A 3A4NA 3CR8A 4CKBB 1V6CA 5HFAA 3F4LA 4IXMA 1SN7A 3FMIA 2LVOC 3EY4A 4HNUA 4MICA 3JYOA 2OMEA 4BLSA 4XIGS 5I4CA 1UOPA 5BYKA 2BI7A 2C20A 2RBEA 1I7DA 1DWPA 1W581 3WP0A 3M5WA 2F1RA 4E7PA 1ZUNA 2C4TA 1QRDA 3MRVA 4N7JA 1M83A 2VAWA 4RACA 4OUDB 3LFHA 1R5BA 4Q48A 4IDBA 1L8AA 4WVFA 1P19A 3D7MA 3H0EA 1GNVA 2ZJ4A 2CWDA 2ZSBA 3SR4A 2HXYA 5GP1A 5K0CA 4HH4A 2A14A 4Q9LA 2I7TA 3PZBA 5JOQA 3B7NA 5CURA 5EJ7A 4GKBA 2A9RA 3QMVA 2IYUA 1P7YA 3KVNA 1XNQB 5AVVA 3OCWA 4O4HF 1FX1A 3U1TA 1EQAA 3HE3A 4AY3A 1PWXA 2JGDB 4CCYB 3ZHYA