3C3EA

Crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei in complex with fo and gdp. northeast structural genomics consortium target mar46
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
305
structure length
305
Chain Sequence
MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb
source organism Methanosarcina mazei go1
molecule tags Transferase
molecule keywords 2-phospho-L-lactate transferase
total genus 82
structure length 305
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 2.7.8.28: 2-phospho-L-lactate transferase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.240 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 CofD-like domain 3c3eA02
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 3c3eA01
2P0YA 3C3EA 3C3DA 3CGWA
chains in the Genus database with same CATH superfamily
5P8WA 1JIJA 4MVYA 3HJBA 5IG2A 2GZ3A 3KEOA 5HIAA 3G2MA 1K92A 4YO7A 1LLQA 2WTNA 3IHKA 1BS2A 1S8AA 3FYSA 3GJXC 3JPWA 1VA4A 4CT0A 2OESA 1BYUA 1WV1A 4CISA 3NGLA 2VHJA 3ROTA 4NOJA 3TGWA 2MJ5B 2BUBA 2NSLA 4XIYA 2HLDA 3V4OA 4OLAA 3CVOA 1MEJA 3OHMA 3K1AB 5EWLB 1JH8A 1EE8A 2QRNA 1LU9A 3F4KA 5JI3E 1P77A 3ZCQA 1DFGA 3HUUA 1VKRA 3CE6A 3LLSA 3PEYA 1JSRA 1IG0A 3V80A 5KNCA 2R2GA 3WLNA 2ZRHA 4R8MA 1DT5A 1OASA 1SUIA 2F3UA 4HXEB 1BH6A 3LKBA 2X2PA 3PQ6A 4PAWA 1EU1A 3FG9A 2AHMA 1EWYA 3P0HA 1PZFA 3IP3A 4JWTA 3S81A 5A2QS 1GG9A 4XPIA 3CRW1 1HDIA 1RFLA 4GX2A 4L4YA 2YVQA 4RVOA 4LJLA 1BQEA 4ZO4A 1Z6AA 2OZVA 1SEPA 2IU6A 1C9EA 3LC2O 4GIBA 1E5QA 1SH7A 3R8FA 1U5AA 3DGFC 3OTGA 1CLUA 2ZYGA 3OZTA 1US8A 4L6V6 1W5SA 2P2ZA 3PYXA 3EVAA 1CUAA 1TQ8A 2D2XA 2UZAA 4I50F 4QRIA 4F12A 1NJ2A 1SHTX 5K4GA 1DFIA 3A9SA 3GZTB 3G7SA 4WW0A 2WKSA 4JMLA 2O23A 3BEDA 4FZRA 4BRUA 2ZGVA 3C5HA 2QR2A 5AIAA 5CU7A 1ANKA 2QUAA 1A76A 2EIHA 1Z36A 2BL4A 4R2JA 2QEQA 3VKHA 3NT5A 4LPSA 2TECE 4GBMA 4GEGA 2EP5A 3SQDA 4CG0A 5LYJB 3AXTA 3IH5A 3QKSB 1G0NA 3RVDA 1SZJG 4E08A 3GLHB 1IVYA 1UM8A 2PT9A 3OX4A 5TS2A 2NYVA 4DADA 1JX6A 3EARA 3F73A 3WJ1A 4XUGB 1WSDA 2JHFA 3LH5A 1UMDB 1ZRHA 3B9RA 2W4QA 3EAFA 3HADA 3QEMA 4LHSA 2GD6A 1YQEA 3RLFA 4DMHA 2QUJA 3CR8A 4W9NC 4E5UA 1NJFA 3GLGA 2QQEA 4P7JA 4OW0A 2V6ZM 5JI2E 4FJ2A 5DSTA 1NM5C 4C3UA 4HFMA 2WPNA 2QG4A 1QZEA 3FWPA 3THYA 2HLHA 3BFKA 2G6BA 1UDXA 3EMKA 4BRZA 4ES6A 2XE4A 3RUDA 4HVCA 1X8XA 2CNLA 2W9XA 4PYJA 1GA1A 2R1TA 2ORED 4YV0A 1W49A 1NN5A 4XQCA 2AW5A 1RD4A 2PT6A 2Q07A 2NSHA 4DQ0A 4DUPA 2QJFA 3NM5A 2C4UA 2X5OA 4D9MA 5D85A 2VT3A 4TMTA 2R751 3EVTA 3FN4A 1A4UA 5IP5A 5EJ5A 2B5OA 3L25A 2PD4A 3OLWA 4U6QA 3EZ6A 4XM0A 2CL0X 2OXCA 4OUDB 1XI2A 2R1ZA 4PXAA 4MINA 5CNKA 1Z8FA 1ECFA 2I6XA 3B60A 2VDLB 1XELA 5KI6A 1ECBA 3FSGA 3NLLA 2VG8A 1GU0A 1FRNA 2FQWA 4JJEA 3YASA 2CBZA 3VR4H 2JLBA 2YDYA 3WL5A 1MJGM 1KBOA 4Y2VA 5AVZA 1MP0A 1XCOA 5H5JA 2ODTX 1Y8QA 1MOQA 2RC6A 4B6FA 2GF2A 4DLPA 5K8IA 3IBFA 4PD2A 1OOEA 3SF8A 4A8JB 1SCIA 3BSWA 3SXJA 2GEVA 3OEED 1ENYA 4EH1A 1N5LA 1M2OA 1VHQA 3LUKA 3V55A 4JJ7A 3F2VA 1TYZA 1YSCA 4RCVA 3LD9A 1VRVA 2EDAA 2R97A 4TL6A 2G76A 4EMUA 5IKEA 3ZHUA 1JHAA 1N5RA 2H9IA 3JQFC 2YWXA 1QTRA 3NYWA 3QVWA 4OQQA 3UUFA 4AKSA 5L4NA 5E26A 5FWDA 4W1SA 1ODJA 2UU9B 2PVPA 4K9OA 3VZRA 1HNWB 3P1JA 4FWTA 4C5BA 2ZM5A 1RYMA 1VI6A 1GFIA 1XNRM 4KR0A 2GN8A 2WMDA 4N03A 2CNWD 2ZU6A 1MOSA 4YJFB 5B2ZA 4X1YA 3AJEA 2K6BA 3DMYA 3OJ0A 1TC1A 1ZH4A 1RLOA 2DVMA 3IPCA 5A4MS 4X66B 2ZBPA 3LZ6A 1J8VA 3GPIA 3DFKA 2O0LA 4TSRA 1BRMA 1KXZA 2OY0A 4BKPA 2I91A 3LAWA 5LXTF 3C6YA 3HV2A 1FX0A 1X7HA 3B51X 4G4JA 2Q3CA 1PR6A 1L5NA 2NUPA 3QF7A 3KWJA 2JY7A 3ZGZA 5FPKA 4IBOA 4IMJB 1FDWA 4DDWA 2UXDB 2C98A 2GSDA 1SKUA 5KWVA 3H9EO 4TVSA 1OI4A 4PZDA 1NUAA 1Z56C 1AVTA 3SAUA 4WI1A 3HEMA 4EHKA 3J81A 4CMCA 2VXBA 2IYZA 3GDOA 4LHWA 1VG8A 4MS3A 1C1XB 3I6YA 1X94A 3EVZA 4PS0A 4Q48A 3TTSA 5C8DA 1PG5A 1CVIA 3AM1A 2AH5A 3R7DA 3CW9A 3RC9A 2XT6A 2IUSA 3K5HA 2QTZA 5A03A 1IRIA 5HW0A 2WDPA 1K4MA 1IOLA 3I9OA 5FFNA 1TMOA 1A9ZA 1B3BA 5TMDA 2NVUB 4B6JA 4MH0E 1AGNA 4CIXA 5CGZA 1N7GA 2W6ID 1DWQA 1D0VA 5TRTA 1TCBA 4EGAA 1XQXA 1YULA 3U4QB 2OV4A 3R3ZA 1II8B 1P8AA 3ORFA 4Y8VA 2VOJA 4ZXPA 1T5DX 3QTBA 4BFXA 1WG8A 4BZWA 1S2DA 1QV7A 3QAUA 3CUSA 4C20A 2YS6A 3CIFA 4HUQB 1RVV1 4JBWA 2OGTA 1S02A 3IO3A 3NUZA 4KDRA 3RS0A 1NOIA 3SIRA 4GM1A 3A70A 3F7TA 7YASA 5IHXA 4B3TM 3FRHA 3RUCA 1PDWA 4XCVA 5IJAA 4BAZA 2JLVA 2P3LA 2VHQA 4FC7A 4FSHA 5AYVA 4C03A 1W94A 1ISPA 2EJTA 3ONFA 2I4RA 4FR5A 3JR7A 2JZNA 1P2GA 2K87A 3UJHA 4CEJA 1L2BA 1QK5A 4D4KA 3L7MA 3ONWA 3QWIA 2WF5A 2PMWB 2L19A 3CZ4A 3KD3A 2RK3A 1FW6A 3L4KA 1N8TA 1Q1NA 1Q7EA 3BGWA 2VYVA 3DTNA 4KQKA 4ZOBA 1D2NA 2WICA 4LECA 4LCEA 3M7IA 1M8JA 1Z34A 2OK8A 1GQOA 3ABSB 1NE2A 2OXEA 1QCZA 5ANRB 3NYIA 4RZXA 3U7FB 1QYRA 4NJEB 1LF5A 4PSDA 4Y6QA 2A5DA 3FFAA 3K4QA 1E5DA 1OILA 3RH0A 1L6IA 1G21E 1SIOA 2GM5A 4MROA 2FZ4A 5H83A 2Q2VA 1R15A 4CMGA 2VHCA 5IT9S 2ZXFA 3G0OA 3KTOA 3O8LA 5DEIA 1WR1B 2G3QA 1BHSA 2VBCA 4IIEA 5K3FA 5I51A 2A9FA 2QX7A 4RAQA 1JA9A 3T7EA 4IBDA 4QU8A 1LNSA 3H3JA 3VYSB 1P80A 4EY3A 1XUOA 4Q9HA 5ALTA 1ZIOA 3VR3D 4E32A 1JFFB 1QH9A 2O05A 2PX0A 5KYNA 1OGIA 1PQPA 3DQPA 3F6SA 3QTTA 1V45E 4HNVA 2ATCA 1E6WA 3OX3A 3HDJA 2QLTA 1WZCA 3HYTA 2BFBB 5ITQA 1JW9B 2FP4B 2IXFA 4QRDA 5LMUB 3BS4A 2P11A 4YRLA 5LMNB 1BEUB 4BQIA 4YCNA 2X8JA 1OWMA 4NULA 3GPLA 3BORA 2AFHE 1R9MA 4C05A 3A4YA 1YE9A 4DB4A 2GA8A 3PQDA 4JR1A 2RGOA 4RKWA 3GRUA 2WA1A 5LZ8A 5IJ0A 2NYAA 2PNJA 1H2BA 2B21A 3M1IA 2BHNA 4HLQB 5FQNA 2IYFA 5EVCA 2FN9A 1F0PA 1RRMA 4IBJA 1J0EA 1HSZA 2GD1O 2HJGA 2RGAA 4RV4A 4DXDA 5JJLA 1QK3A 1V4VA 1VJDA 3QPCA 2XYQA 5DM70 1C4WA 4F45A 1I5EA 4CXMA 4AWXA 1TTQB 2SICE 3UY4A 1I51A 2QU7A 4ZYWA 2QN2A 3PDJA 2IF2A 3I1IA 5CLHA 3GPBA 4G1MB 4HP8A 1TTEA 1VJRA 2YWGA 2AEFA 2D4AA 5LCXA 1WLYA 1GTMA 2B5VA 2Q1SA 4X45A 3PNVA 5FUXA 2P90A 3DCIA 5DLYA 4AN0A 4EHFA 4EP1A 1G5TA 1LRLA 1X1EA 5KQSA 1TLLA 4GH5A 1KU0A 1Z45A 1WXQA 2NZJA 4U2CA 2EJSA 3S1AA 1CPYA 2I8LA 1J70A 2ZFUA 1W59A 2FY8A 3B6ZA 2VUSA 3A6ZA 3L02A 3OURA 4HYEA 3CU5A 5J3JA 4KQ9A 1QDUA 4R1SA 4OI2A 4DHWA 1BOFA 1WX1A 1XF9A 3MPUA 3OE7D 3P9NA 4KK4A 1AKUA 1TECE 4IGEA 1H6CA 5BN1A 1XNHA 3GHHA 1LY1A 3PGMA 4Q9JA 2HK9A 1Q3KA 2I9KA 3UBTA 1EWVA 2IHBA 1KR2A 1K82A 1SQ5A 2W83A 2QN1A 4PV7A 3UK0A 1UQTA 1LSJA 1XN1A 2ZRDA 2ZUBA 3JALA 2FOIC 5K0NA 1HORA 1DEHA 1V5EA 3ONVA 4FOLA 4LYYA 4MR9B 521PA 3ZD9A 1DX9A 3CT4A 4F92B 1PJ2A 1NNSA 3RHSA 3JZIA 2WZQA 3BGIA 3ONNA 1C8LA 1RYEA 4IX9A 1X1QA 3N0RA 4HZIA 4P31A 3LT1A 4K6GA 2BMDA 1QP0A 3GEGA 2X1VA 3P20A 1II9A 1NIPA 4HL6A 1NP3A 2C7VA 4KRGA 1YD7A 3G5AA 3R0ZA 4O8CA 4Q21A 4QEZA 2NO9A 3KW6A 2J5KA 3EQ8A 5F1KA 1A77A 4UASA 3JYQA 3X44A 2ZBKB 3IAS1 3KHKA 3RFUA 4X61A 4QARA 3UWOA 2W98A 3BE5A 2V03A 5TQJA 5HIIA 1L7PA 3H8WA 1MRSA 4XQ0A 5ITZB 1J33A 3GCDA 3IJPA 4KWCA 1OX4A 4HDRA 4TXNA 5DIFA 3T5GA 5KOJA 5JTUA 1MN3A 5FYDA 1XA3A 2OAQ1 4QG3A 3LT2A 1A8HA 1JFVA 1FZQA 1TM1E 2P1RA 1HT0A 3WQQA 1H4TA 3R5JA 4O1HA 2OM2A 5CJJA 4AROA 5DI3A 5KPDA 5K2OA 4IJQA 1H2FA 2FW6A 2JZ0A 2R6AA 3ZKWA 5LPNA 1Y8GA 3M33A 1ABEA 2O0HA 4DRYA 3UFXB 4G0OA 2FWBA 4RACA 2J5QA 4UPEA 2ID8A 3MT0A 1JDJA 3EHDA 1P61B 3KB6A 4MEJA 1G55A 1MGOA 4JB0A 2RGEA 4XB1A 1GZUA 4XSGA 4A1OA 1KDTA 1IHUA 3DT8A 5AM1A 4PXSA 1FNDA 1N75A 1FNBA 1DO8A 2ZIAA 2GKSA 3NVMB 4KWTA 2YJZA 3UJ6A 3K2QA 4L8GA 1QKKA 2WSCF 1DE0A 5BY2A 1X7WA 1U4OA 2R79A 3W2FA 3O21A 3U40A 1YR2A 1AJEA 3I2IA 4OD0A 1CY4A 4XQEA 4TL8A 2P5TB 3DAOA 3PNQA 1YDEA 4D0GA 1KRXA 4UM9D 2HA5A 3OBIA 4N6OA 5BR4A 3PFNA 4IP0A 4ZARA 3LP5A 4Q4AB 5D5PA 3DV9A 3NVAA 4QYTA 4B79A 1CXZA 1MENA 1QHHB 3GFSA 3BVPA 4YK7A 2A2ZA 3R3SA 3SSAA 3TWOA 2V6FA 1P1JA 4WXRA 4B09A 1KK1A 4KQWA 4HBZA 1RZ3A 4OB6A 1R0XA 4P4GA 4C7MA 3GT7A 3QVGB 2YBDA 3NBXX 2IVZA 1UC8A 4RXMA 3WSVA 1CNEA 4R7TA 3ROPA 1AS3A 3BAFA 4GC5A 4J75A 3V2HA 3I8SA 1AMOA 4OQXA 4ZCSA 4NOLA 3ZGOA 1M7BA 2GBLA 3DLIA 3WGJA 4R01A 5J59A 5HQJA 1U5BB 2JGDB 3N70A 1V1JA 3ZCSA 2PKEA 3UH0A 1NJGA 3I8XA 3OJXA 5BWCA 2OBXA 3R5HA 4KNYA 3VDQA 4RZ2A 2VPIA 1GLNA 1WW8A 4HVAA 1OX5A 1BVSA 2NU7A 4FSDA 5MN6A 3A14A 1YZGA 2XTAA 1P6XA 1RKXA 1Y1TA 4AMGA 5LFAA 2BFAA 4QT0A 1QQBA 4RHTA 1ESNA 3I45A 4M9RA 1P2UA 4ZT5A 1CKEA 4CN9A 5A4KA 5H16A 3M1AA 4WL0A 1KMIY 3A7DA 4LGMA 1BA3A 1OLUB 3KKPA 1JUDA 3P9QA 2I3ZA 1DIAA 4XQ9A 2IKSA 5D1NA 4OBWA 1X92A 3QENA 5DI9A 3IRVA 4IDAA 3DA8A 2M32A 3SF8B 4A8JA 1V4BA 5EZYB 1X1SA 2IKQA 1U3CA 3DJYA 2HSJA 4ZVTA 4DNPA 2C2GA 1PLJA 2X9VA 3OC0A 1LBEA 3QUBA 4JOCA 1TI7A 1K7YA 5DN6D 1HJPA 4Z2YA 1GNPA 1V16B 3GGSA 3SYRA 1DRWA 3PGKA 1XNQM 3KPUA 2P9JA 4QJ5A 3TINA 4LTNA 2VWPA 3B12A 1GPBA 1SBHA 1FFHA 4JR2A 3UCFA 3AJRA 2JH3A 1Q3TA 2DKFA 2FH5B 2MSCB 1KJJA 3OPQA 2HMVA 4IILA 4O2LA 5DLDA 5A05A 4L8VA 3EEYA 1FMFA 3ZGLA 2PDAA 2NAFA 3KR9A 4YJ3B 3ER9A 2NTYC 3VNBA 1TKBA 3HB9A 3MS4A 1IBLB 4HT3B 4A91A 3C8DA 3MD0A 5AVKA 4H7FA 4G2TA 1KZ6A 1RM0A 4EGCB 3DCYA 4CDMA 3IMCA 3Q8KA 5IFKA 3ZHQA 2J3LA 3FB1A 2ISCA 2QMEA 3BD9A 4K6MA 1GR1A 1Q83A 2Q4OA 3GWZA 3M4JA 3USES 4ZCRA 1KDYA 1GKYA 1BX1A 2A9PA 2QNJA 4TMWA 3KFUG 3AEQB 1BG6A 4BFYA 4C87A 4F3RA 2FFBA 3D8SA 4V0SA 3GZNA 3G13A 1JB9A 3NHFA 1PT8A 3FDIA 4EG8A 5ALVA 1EP9A 3TQOA 1Q12A 5HUQA 3WK4A 3UAZA 4RMGA 1RLUA 2FPKA 1T3SA 1YC2A 1AKWA 2G5PA 3QV1A 2WKQA 4OHWA 2EBHX 1ELOA 1Y9AA 4CT5A 7ADHA 3Q4GA 3BX1A 3CISA 4HLNA 2GRAA 1C1XA 1ZUHA 4PG8A 1GKKA 3O1JC 3TM4A 3UG6A 1W96A 2ZPTX 4CQNA 1HE1C 3O4GA 2QVYX 1JHVA 3PXXA 2H5EA 3F7MA 2YY5A 4HUJA 2C29D 1P81A 2QB5A 4B6PA 2FPPA 3NTXA 2PLFA 3P45A 3SKXA 1I7DA 1E2LA 3EVDA 5HX7A 2D62A 4EPRA 3H04A 1S1MA 4QDOA 4BO2A 4Z3DA 3TZ6A 4KYUA 7MHTA 3JQ8A 3R77A 4F9TA 2BEUB 4D45A 4L28A 4LG1A 3ID6C 2RG1A 2WT4A 1SPBS 2J4FA 1OVGA 1KOLA 2C7RA 2GRUA 3JQQA 4KUGA 4E7OA 1RXIA 1NJ5A 2BMFA 1NF8A 4R9VA 4FR2A 1NOKA 3GVPA 1L5MA 4BFTA 1SUEA 1E6EA 4DPMA 3EGCA 4WLVA 2F1HA 1CQXA 1Y4AE 2QJWA 1IQPA 3RAJA 4W7HA 2Z5FA 1MC4A 4RCZA 1HL7A 3VX3A 4HN4B 5HGXA 3FX2A 5C8YB 2MMCA 2VA9A 3U6BA 4UCQA 1X1BA 1E1CA 3T5AA 3E3LA 2FG5A 1E2MA 3W05A 3GPPA 4NRWA 4FINA 1Z74A 4O2AF 3LO5A 5BSVA 2X6QA 4LYFA 3EXHB 2V6IA 3NBKA 2AZXA 5D7BA 3G5LA 4PCZA 2O54A 3DT6A 1EFUB 3GJQA 1ORHA 3LP8A 3W8EA 5AVSA 4AG3A 2BUCA 4HLUA 1I4TD 4IG9A 4ECAA 1M6EX 3BXXA 4RZUA 1EVKA 2VPWA 3BULA 4JUBA 1NBIA 3H7IA 1ORVA 3ADPA 1UPBA 3V9PA 2D7DA 3MT7A 5ADUS 4FUTA 3CLSD 4BPBA 2M1ZA 2BGGA 4DW8A 5C1PA 5JNTA 4L4XA 1NVXQ 5BUCA 5IJ0B 3DULA 3DONA 1MC5A 3JZDA 1OI2A 2AEMA 1M10A 4Q82A 2P2SA 1ICIA 1NAIA 2EERA 2G04A 1EK2A 3HCRA 4J0GA 5AKXA 2NP6A 1XCPA 1WXHA 4RVFA 2VF2A 4GVXA 1CQJA 1IZ0A 1DAHA 2PUHA 2DF8A 4G1UC 3RKRA 3AP1A 3VI4B 1A8IA 4DDHA 2HQBA 4IS3A 2ZLBA 1Z37A 2QROA 2XKAA 3BBPA 2GNOA 1G6KA 1H8HA 1RKUA 1HDRA 2A3NA 1VTKA 3OLYA 4H6XA 4HNHA 4Z0HO 1N2HA 1TA9A 2BFBA 1O2DA 3MJCA 4QFMA 5SY9A 4EITA 3B3QA 1AXEA 1GAWA 2E18A 1BXGA 4R05A 1BXGB 2N1BA 1JU4A 3C48A 3OCXA 1RHRA 2LVNC 2J0VA 4I99A 2C94A 1ZGJA 4Q4DA 3HNOA 3EZ2A 4G97A 3ZCUA 2HJRA 2QUHA 2BHSA 4KAXA 2BFFB 2PL9A 2G8NA 1E69A 1IAQA 1VA5A 2QG9A 3L4SO 4LMAA 4O4HB 3WNQA 1KH2A 4QOSA 4HWSA 4WKGA 1CF4A 5FPYA 5A2GA 1C30A 4YAWA 3GLIA 2AG5A 3QF4B 2A1TR 2DOKA 5BSEA 1UMBA 2YL2A 4CI0B 2H3EA 4FYHA 3O94A 4REQA 5DH9A 3RJ5A 5CD9A 1NMEA 1ZNYA 2V98A 4HSEA 3GBPA 2JC3A 2QM8A 5JS1A 1CYDA 2BFOA 3VTZA 2VYFA 3C5VA 2ZT5A 2VYNA 4UAVA 1YL5A 2HU5A 1Z68A 4C0XA 3T7CA 3WZ2A 4QVIA 2OD9A 1KPIA 2G08A 1ZUD1 2BKAA 4MMXB 1UXKA 3QQPA 4F4HA 3I9NA 1TF0B 2HJ9A 5CDTA 3KPWA 4G8JA 4RULA 1DJOA 4JLBA 2PR7A 1FK8A 1NULA 3HJ8A 3W6PA 2CMHA 4DMFA 4S1VA 1H8ED 1XRMA 3GCWA 1M6HA 3GV0A 1YTUA 3OIGA 4LF8B 3CJRA 3GP3A 1Y34E 1G5IA 3SATA 4XK8F 2EFDB 2HPVA 3R5SA 4GS5A 1Y3IA 4OOEA 1Q7BA 5AXBA 3O8BA 4N5LA 5DN9A 3EPPA 4Y2JA 5F3DA 3V1UA 3R4VA 2O8DB 3CVJA 3SM3A 2REQB 1OX4B 4HDRB 5I9TA 4DLTA 4EUSA 1KYWA 1NW9B 3ROFA 4JLNA 3Q7TA 1BX3A 1MT3A 2QIPA 3K9WA 3QJYA 3QPWA 3DA1A 5DOVA 2P67A 2J30A 3P7MA 5EKDA 5FBRB 1IXRC 1G9SA 3RV4A 3A37A 4B6EA 2PBLA 3CSUA 1ZESA 1CG6A 3TE7A 4BVKA 2MTBA 3O4IA 3KOZE 2C2BA 1F2UA 3NVDA 2XB9A 4R9NA 4AF8A 3OM9A 1MO6A 2WZCA 4C0AC 3FKQA 4RLHA 2OLKA 2QN7A 3HU5A 1MOZA 4URWR 2N46A 2XF2A 1PV2A 3GGGA 2AX4A 4FK8A 1QQ5A 2GOYA 1K8ZB 2R3SA 4Y2RA 2FX2A 4ABTA 1XHLA 2OXRA 2VKQA 2YVUA 1YQDA 2JBAA 1QGAA 1JEOA 4B3MM 4R9UC 4B6GA 5JARA 4UJ5A 1KZ4A 3HY3A 5CXSA 1JDZA 4ZXFA 1D7OA 1SB9A 3QW4B 3UPUA 4OK6A 3A6PC 2DHYA 5C1BA 1XJCA 1KJWA 2W6IA 4IYRA 3WIEA 5LIRA 3DLBA 4C4YA 3O82A 1N0UA 3RFCA 3IT2A 5ALOA 4PO1A 3WGIA 3LE8A 3EF1A 2DKOA 1GWNA 3B7NA 2ZRAA 3ND7A 4EHNA 1NMXA 2Q5HA 3F71A 4RHXA 2XZUA 3GA5A 4G8DA 2J3KA 1PFWA 1A4IA 2FXIA 4HGQA 4ZVPA 2IDMA 5IN4A 1FU4A 2Z6AA 5BN5B 4BCCA 2AX3A 2Z5GA 4OBEA 4CTNA 3ZWMA 4AMBA 4B3JA 1NBOA 2ZJ5A 3U6SA 3LW7A 2O8BA 3EY4A 4LMPA 2XUKA 4KIUA 3BBLA 1N3BA 4CODB 4EB0A 5I47A 3AF5A 1ZHFA 1T2VA 2PSDA 5FTLA 5I9BA 4FD3A 3ROGA 2Q3LA 1QTQA 1JG3A 1BVUA 3UVEA 2P6MA 4BQFA 1M8KA 3IT0A 3SG0A 2QL7A 1QS0B 3PGVA 4XVQA 1LS6A 4L27A 2JS7A 4P93A 4CF7A 1GZDA 1EFLA 5DW0A 2Z04A 1EYZA 5LLDA 1T5HX 2RHMA 5HRUA 3WVNA 5I48A 2QVGA 2YS7A 3UWMA 1ZPDA 2AZTA 2B69A 3G9XA 4ZZ1A 4LRSA 1G1AA 1WBDA 3EZYA 3PXAA 3PXEA 3RJ9A 4H1HA 1K7XB 5LJLA 4RBNA 2HT1A 1RJ9B 3O2NA 3QQ5A 6AT1A 2ZWMA 1KAGA 1OAOA 5M5BA 3KEMA 4I5DA 3KZOA 3Q8GA 4TVKA 4DMMA 5JS8A 1JIVA 4LY9A 2HMWA 2X14A 3DEFA 3VNAA 2UUCB 1Y5MA 1Y8RA 2I62A 3FJOA 3H4VA 2VWQA 2XNJA 2ZIFA 3RPEA 3WLPA 5FFMA 5EUMA 4OP2A 2WFZA 1DC3A 1SO8A 3EMBA 3KVOA 3O83A 5F7ZA 4DUGD 1LW7A 1YDMA 2JH8A 2F6RA 1PFYA 4M7PA 5KVQA 5IJXA 4R1QA 3UV7A 2BGNA 4UBLA 2IHNA 2GZAA 2WJJA 2Y27A 3L46A 4D57A 3L7JA 1WY7A 5C1IA 2YWEA 2ZTMA 3IR7A 1P73A 3K2BA 3GRRA 3JQGB 4RH1A 4J94A 1GVHA 4WZ6A 3FOCA 4FZ3A 4RFLA 4RMNA 5KCMA 5KVSA 2W0SA 4W5JA 4PDGA 1KOGA 5J40A 5T6BA 4TLLB 3RAPR 2XOEA 4HQOA 5DI3B 3ZNPA 2B6HA 3GWGA 4F7WA 2YV3A 1TU3A 2C8VA 4JYBA 4LE2A 4RMJA 1E1RA 5HF9A 4ARZA 1ENOA 1BX0A 2HKIA 3G2JA 1Q95A 4YLYA 1OTHA 5DTIA 4FCTA 2QR5A 4U5XA 1GU7A 4F4CA 3AJIB 4JEIA 4XD2A 1V1MA 1IMOA 3SEFA 4E7PA 1VDZA 2KBEA 1MXFA 3COVA 4MKHA 1ES9A 1ND5A 5IEJA 2CXTA 3IPXA 3E15A 4MPTA 4X1YB 2ZETA 1J4AA 2J45A 3MTIA 2AFIE 3AUXA 5C4MA 3UZUA 4BO4A 3IDAA 3NV9A 3H0EA 3SJZA 2FW7A 2N3ZA 4JLSA 5JD4A 2VJAA 2FMTA 2UUCM 2E21A 4Q7JA 3W04A 4UN2B 1A5SB 3V1YA 2GAJA 2NZ2A 3ZNNA 4C4ZA 1GAXA 4WH0A 1PR0A 1OC4A 1GT91 2SKEA 4QYMA 5EJCA 4XLTA 1P5RA 3C98A 4JC5A 3LBAA 3BDAA 5E9AA 3R23A 4HNSA 4ZOLF 5JRDS 3RARA 1U8YA 4KXLA 4IH1A 3UB4A 3N6RA 1H0SA 4PU0A 2JEOA 2PZAA 1YZUA 3KBOA 1C9YA 2DBQA 3URMA 1CNMA 1MV8A 1T9HA 3HL0A 4DC9A 5CAEA 1FFAA 2LKDA 3ZE9A 3E7XA 1QZXA 5HRCA 3FOZA 1I10A 1W75A 4G8BA 5GQSA 3MBKA 3OICA 4GGOA 4B4VA 5BT8A 5DNUA 3ETGA 3NHBA 3KV1A 3FFBA 4I1IA 3RLIA 3MF4A 5AVXA 4LDZA 1HYBA 4W63A 3V7WA 3GDGA 3LUJA 4FMPA 5M2QA 1EWRA 2C7OA 3LBYA 2RBEA 3QUQA 2Y20A 3KRTA 1TKRA 1UOOA 4FT2A 5SV2A 3RJMA 5IF3A 2PQ0A 2H63A 1ZMRA 1UPCA 3DFZA 1TM5E 2C57A 1J9ZA 3O4RA 3OQVA 1RWOA 3GQBA 3PSHA 4IEEA 4MVJE 5FA8A 3PJFA 4CUKA 3LIIA 3CWQA 2A57A 2QGFA 4M1YA 4UBJA 4E1BA 4JYPA 4DMRA 4G63A 3F6RA 3K6KA 2F1JA 1U9CA 1WO8A 4JT9A 3ZKWB 2IYAA 1YUBA 1Q0SA 2I1QA 5JYEA 5HKAA 4CL2A 4XX0A 5BQ3A 4JLDA 4YA6A 5DNCA 4YDQA 2X5XA 3WNDA 3GLQA 4FHZA 1YOVA 2WLSA 4ZHQA 2Q8PA 1TCAA 2WF7A 3B1ZA 3HYCA 3M9LA 4DJDC 1CU1A 3EIXA 3E46A 1W29A 4QHTA 4TMFA 1HNNA 3ZJTA 4DUGA 3THYB 4AS2A 2CF5A 1ONSA 4INZA 3DL7A 4L02A 2F8TA 1K3UB 2G0NA 2IHKA 2PX4A 1TDHA 4V0ME 3TAXA 4DYDA 1X3SA 4FM9A 1KYTA 1W47A 4LRYA 4FFWA 4TT3D 3SZOA 3AKCA 4L4UA 5BOSA 4RKFA 2ZE7A 4DCVA 4M1TA 2NO1A 2QZ9A 5DBHX 2A9QA 4LNUB 2BMAA 1Z2EA 4LTDA 3ZD8A 2EEZA 4H18A 3MPOA 1HQCA 1WZEA 3ZPXA 1B26A 2DI0A 2AOXA 2HMTA 1AK1A 1J8QA 4YFVA 3W8RA 3ZQ4A 1JHQA 1FMTA 2QQ0A 3LDHA 4PYLA 3T7RA 3W1VA 5KMGA 3U6PA 1TB4A 1LQTA 3WB0A 2HB6A 5EXXA 2R7NA 4G84A 4Q1FA 5L8VA 2WTUA 3RAFC 1UPUA 1UBGA 2Q8QA 1BS9A 4BP3A 3O4HA 2Z3ZA 1T6XA 4ZOCA 1ONPA 2XZTA 3OPNA 5CIYA 2XRMA 4BTVA 2MSKA 4FNMA 5KVAA 1RPNA 4F2PA 1WOMA 4E2FA 4Y2QA 3RUIA 1PI3A 2PVCA 2JFWA 3WZMA 3JSXA 2AE1A 3FGOA 4IV0A 2L2QA 3VTKA 2Q1UA 2QX9A 2EW2A 4D82A 3STXA 3FTQA 3FYUA 2O20A 4DUZB 2L7IA 4ZT6A 3GLRA 5JYDA 5E6SA 4AF7A 2ECQA 2OGWA 5FNVF 2BKLA 4QHSA 2X0FA 3HB0A 4GMXA 2A9KA 1RXCA 3JQAA 4CM1A 4M8IA 1MHPA 4P16A 1CDOA 3TNJA 4B3IA 1CUWA 3OFKA 4AJ2A 2GJ8A 4UBMA 5NULA 4BB0A 3WX0A 5CH5A 5L3SA 4IIBA 1KK0A 3AIOA 4IZHA 3KQHA 1QE3A 5C3MA 2ZQ5A 3P0FA 2ZUCA 2ZIEA 4CEIA 2C92A 1ZK0A 2RCNA 5C2JB 3QA9A 2Q4EA 1RZUA 1W4CA 2O2JA 3C39A 4M0CA 1WRBA 2IW3A 4J6EA 1HE8B 4JJ6A 2YWHA 1RBYA 5K6TA 1RM5A 1VSVA 1VHJA 2J9FA 4DLKA 4BXOB 4PFSA 1W36B 1YR6A 2RB4A 1DGQA 1HFWA 2LCFA 4FS3A 1PNVA 1VLQA 1QH0A 2OFOA 4N5DA 5CLGA 3H4TA 2D7EA 1KVRA 1U1IA 2YWRA 4JROA 3HR4A 2H4XA 4MIEA 2QMQA 2JVKA 1VSQA 2B2NA 3PUHA 4MCIA 4ZZ3A 5DGCA 5ECYA 3H83A 1T1RA 2AQHA 3A6HA 2HK7A 3AT1A 1Z5BA 1E3SA 4LQLA 3VR4A 2IPNA 5J4LA 1AV6A 4NAHA 1KAHA 4Y2HA 3CFYA 3TLBA 3FNHA 4G0MA 1FL9A 3IG5A 3DD5A 4DV5B 2Q49A 3A2LA 3ST7A 1QQAA 2X6TA 2EATA 2I6QA 3TIVA 4WJLA 2Y21A 5IFLA 3ESDA 4JI0M 1G19A 1LBIA 4LG2A 3PJEA 1R7RA 2QWXA 4KBFA 3JD3A 1R9GA 1YI0A 4R9SA 1TAGA 2NTVA 2GHIA 3MFYA 3RDPA 2JI7A 5AOBA 5H82A 3U56A 1HETA 4A03A 1B6TA 5E3IA 1BMDA 2YRWA 4NJMA 4TTTS 5BSTA 3CNNA 3L77A 2YZ7A 4EHIA 1Z0AA 2WIKA 5TXGA 5JPCA 4FXPA 3BWMA 1B7GO 1FX0B 3U44A 1TW2A 1Q19A 5T67A 1I4OA 2ISSD 1DOHA 4LE1A 4WKBA 2BAGA 2J5XA 1NFQA 3TIGA 1IUNA 1L5HB 1XGKA 5F2NA 1O77A 1ESZA 3MZ0A 2BWEA 3GAMA 2LZ0A 4HXYA 2BGKA 5BPVA 5DBEX 4WNCA 3T54A 4HX5A 3UUEA 5CFLA 3FWYA 5KOHB 4P0QB 2PRZA 4QEDA 2H2FA 3PL1A 4CQLB 1X0VA 4C1BA 1TK3A 4BQSA 3O0TA 5KOYA 4I9FA 4CQMD 2AN5A 5IVHA 2YIMA 5AIBA 1VDDA 2I6GA 3AV3A 2IPMA 3IKMB 3NXKA 3SICE 2QY9A 4D81A 2QTFA 2D0OB 4M9XA 4QXMA 4CVNA 1DC4A 1EINA 4MVJH 4ZI7B 3OQOA 1JQLB 1H2ZA 3MFQA 4ZICA 5J63A 5FLXA 2ZJOA 4HQLA 1Z16A 2R8BA 4X6UA 2RJ3A 3W6ZA 3GJ3A 4EI2A 1GEEA 2R96A 2AVNA 4PAQA 4HRVA 1T3TA 1FE8A 1V9CA 2VTKA 3D0RA 5CHEA 1L7XA 4KHZA 1TEXA 2EYUA 2ZSEA 3F1KA 4B43A 1NC3A 3ZE7A 3F49S 1GJRA 2ENWA 1JLLB 2H1IA 4NDAA 3GFQA 4ZIRB 1W73A 5HWSA 2VOEA 3QUSA 1BE8A 3LPMA 1HWYA 1FW8A 3HCWA 2HK8A 5DNYB 3EOAI 3NOOA 1ZMBA 1ZGAA 2IX9A 5L4SA 5LP1A 1HE3A 3BD6A 4TMXA 4UMDA 2HMAA 3C2QA 5B7QA 2VNJA 5CK4A 1WMFA 3ER6A 1Q84A 1C30B 3ZQJA 3LPLA 5EN4A 3RHFA 1QPGA 3SAWA 1O6GA 1Y4SA 2GEDA 3A6KA 4E5MA 1X9IA 3HP1A 1PQWA 4OX9B 4YUWA 3E8MA 2K2QB 1V71A 2IE8A 4PY2A 2ZRNA 1LSSA 1K5GA 2AKAB 1XTIA 3A04A 1OSNA 4KG7A 4RK1A 3HXLA 4DSUA 2FDRA 1QKIA 4R84A 2W6NA 4MIKA 4URFA 4EKEA 1ZQ1A 2O2HA 4DR7M 4TXMA 3EGXB 4RIEA 1GABA 1H5NA 2FOLA 1DHTA 1GO2A 5FB3A 2LVBA 2GPYA 3PQ8A 4ZYXA 1E9VA 2DVWB 3IVAA 1GRCA 2VT6A 3FVQA 2ECOA 2B25A 3R7WA 2N35A 2JFNA 3GAFA 3J7AS 2CHEA 2DYKA 4BWVA 2D7GA 4HGOA 3DW1X 4K6KA 5JXHA 2D2FA 4IUBS 1KETA 2IEIA 1Q7TA 3B6IA 3K72B 2YOFA 2Q7DA 3NTRA 3X1MA 3LGAA 4G0WA 2IU3A 4JUDX 2AC4A 1DC6A 1RKBA 2IWRA 3T0GA 1JVSA 1ACJA 4JT2A 2GESA 1M8FA 4PG7A 1PQUA 3NANA 1V9SA 2VNIA 3T1QA 4S12A 1UXJA 5JU6A 3KDSE 4JYAB 1G20B 4UD2A 2GD2A 2IS6A 3N2GA 1YZFA 3NU1A 1BXZA 4I6EA 4OQDA 1TLFA 2X9LA 5ALEA 4EY5A 2V5VA 1YA4A 1Z18A 4URZR 1BQ4A 2XAAA 2P77A 3I4FA 3F6CA 4K6CA 4GSLA 2ETXA 1L5RA 4R1OA 4X8MA 3WLIA 3ZLBA 4BQOA 4CTKA 3OCUA 3U4HA 5J4YA 5A02A 4RZQA 1XPUA 5I7SA 4RFVA 1HH4A 1WVMA 2PFSA 2VJPA 3DUWA 4NX2A 3RRZA 2G8LA 1YRAA 1ZN8A 4GI5A 2B35A 4F2HA 1OMOA 3DOIA 3JWGA 2I4OA 1EM8A 3NETA 4NCHA 4OKNA 2FPWA 1CDDA 3ZV4A 3UXMA 3L1JA 5KOJB 1Z8NA 2AEEA 1G98A 4EYQA 1T0PA 2IPOA 3AP3A 3ENQA 4FGJA 3QKIA 1MAWA 4RVSA 5FLEX 4DR5B 2BEJA 1BW9A 1ODSA 1YWGO 1NKVA 2R5WA 3GROA 1I30A 5ALNA 3VHXB 3ORRA 3HHWA 3REQA 4Z4GA 1IN7A 2ZKIA 3ZWWA 3CR3C 2XKKA 2QMUA 1SVKA 2Q7XA 3E21A 3JW8A 1GL7A 2I7DA 3T99A 3MT8A 1TCCA 4EY8A 4PBSA 3IILA 4MW6A 4AY5A 1T1SA 3A4TA 4E11A 2PKWA 5IARA 1H93A 3QU4A 4MP3A 2XUZA 3PITA 3FNEA 2X8LA 2W2LD 1PS0A 1J2YA 2HX1A 3RSGA 1XA0A 2NYUA 1P2BA 3CR7A 2GT1A 3KUKA 3MWLA 5ESRA 1O7JA 4NNOA 3PWTA 5AW6A 3FKSA 3IQXA 4K26A 1T9GS 4N0EA 4GDMA 3GFGA 3V7FA 2PUBA 1JDVA 3NRJA 2V6MA 3DP9A 3U1VA 1Z73A 3QGMA 1GLGA 2Q3BA 3RK4A 4HLQA 4AX8A 4DARA 3SHGB 1WJGA 4UEQA 1T36B 2QNRA 5KDLA 5TMBA 2HPHA 2I78A 2WAXA 3LKVA 2GFQA 4XRRA 1RPZA 4MITA 4WBNB 3WHPA 1N6PA 3D6HA 1R66A 3VDPA 2AF3C 2VRCA 2GEKA 1JPJA 3BFXA 1FXSA 4Y3UA 3BMNA 3VA7A 3A7EA 2OA0A 3G0BA 4NOKA 4H7EA 1N2EA 3PF8A 5CLLA 1Y4ZA 4UBNA 2O5EA 1P4SA 1OIZA 3SEAA 3D3EA 2XT0A 1J00A 2JIQA 5JVDA 3V4PB 5K0ZA 1HTTA 2PTGA 4H7JA 1KTVA 2WJYA 1YIOA 3GT4A 1TO2E 2QK4A 3ABOB 5ILQA 3RVPA 1E0SA 1P0MA 4KQJA 2W2MA 3L9WA 3WWOA 1DUSA 1E9AA 2J3MA 3GF4A 3P0JA 1WGLA 1QCCA 5LZ2A 3H5WA 3B7PA 5KKNB 4DQVA 3DF7A 3DLCA 3KSBC 4RK5A 1J25A 2W8ZA 2A78A 2O50A 1Z38A 3BBZA 2RHLA 3O91A 4OFBA 1E94E 1KDOA 2PWYA 3SLKA 1CUCA 1Z0SA 3HZRA 7ABPA 3WO0A 3WNZA 2XRZA 1OKKA 2PKYX 3DZKA 2RHHA 5F76A 1DIHA 1L1RA 4JI5M 1QOZA 3KKEA 4QTTB 5AW8A 4Q05A 1DX4A 2GK7A 1DB3A 2NLOA 5JZSA 3SHFA 4TUYA 4UU0A 4AG6A 5F1YA 5LU8A 1A8UA 1KR5A 4YY3M 4IGIA 2ZJ6A 5FPSA 3LHFA 1ZMXA 2J9XB 2JA1A 3CC8A 4BV3A 4LZZA 2BR5A 5HF8A 3ZD7A 1U1DA 4I9GA 4JODA 1QRAA 4CIYA 2HWUA 3B48A 4IS2A 3OQPA 2JIRA 3SC2A 4YH1A 3SU8A 1EFRD 2RHOA 4YQEA 3MB8A 2I2AA 1IEQA 2JJ1D 5DBGA 4KNWA 4B5LA 4AZWA 3U3RA 4DBLC 3O0DA 4NDZA 1ADBA 1Z12A 4OVKA 2PT7A 2BWJA 2D1SA 2O4UX 4U7JA 1HDXA 1R9NA 1E58A 1U2QA 3F98A 2KLBA 1N2GA 3THGA 1K7CA 5MHTA 1K2VN 2NXJA 2QT0A 3VO9A 1VBKA 2HA0A 3V1TC 1DTWB 3AERA 1GQQA 1PJ3A 3OZDA 4CLXA 4E31A 2YHUA 3QWLA 1E1LA 2DWPA 4WBSA 3SX0A 1XE3A 2OWEA 3TXXA 3QVUA 2AGVA 3NMUF 1KK3A 4B4KA 1T3LA 3TN7A 1OXMA 2J7PD 2RB5A 2XYGA 1OZ0A 1JDBB 3D2LA 5AHOA 4DBZA 3PKJA 3QXSA 3R4CA 4XM1A 3G0DA 5J5AA 4C2AA 2IZ7A 3GPDG 1QOPB 3FHCB 4B7FA 1T2AA 4MKFA 5KQ8A 3MOIA 5G4LA 4L6AA 4YT2A 3GGPA 5EJ6A 4TV9F 4YAOA 1O57A 1CHDA 5CDFE 3BCHA 4LV5B 3EQ9A 4L0CA 2VQSA 3CLTC 1ZHOA 5HZKA 3Q2OA 2CNWA 2OCAA 4FFMA 2Y93A 5KO3A 1NZDA 1W88B 3F8TA 3LQ4A 3HU2A 1F2TA 1U2EA 1WCIB 2OGUA 4YMWA 3UAYA 4U00A 4RTOA 4IFTA 3RADC 5AI8A 2F43A 1KQNA 3IT1A 4ZA2A 1U11A 1PFQA 5HSGA 1EPUA 2I6TA 3CVVA 2AW3A 1RIIA 1X1AA 1VJTA 5CCDA 1ZL2A 2QUBA 4RY2A 2DQSA 2PKQO 2WWFA 2Q5QA 1MNQA 3EQ2A 4QLAA 2X4DA 1TIPA 2X0KA 5T4BA 2ZUEA 2P40A 5C8YF 3PX2A 2Z1NA 1OFUX 3VC1A 1YAJA 5KHOC 2CBXA 4PZPA 2XYHA 4JK3A 1F6BA 5DGTA 4LF8M 3KQSA 4B3DA 3BJEA 4CIZA 1IFXA 5L3SB 1JGTA 1LK0A 4ARUA 2AWOA 3JR3A 3F5MA 3K0KA 3F5SA 2XUOA 4ZAFA 4AKTA 3IA2A 3C0KA 1G4UR 4H2DA 1PNQA 1KYIA 3P52A 4QD3A 4EY6A 1VB5A 1ZGHA 4XDGA 5BR8M 3R9XA 1JZSA 1CSEE 4UUQA 2O7NA 4Y2SA 3ZUGA 5B53A 4ER7A 5JS6A 5TMPA 2CLSA 3UMYA 5TPZA 4HF7A 3M6VA 2WT9A 1VDMA 3N8KA 1EA7A 3H11B 4HPJB 4PLHA 4TKUB 4TKVB 1WETA 1LDYA 2OO5A 5JDCA 5KQMA 1HMYA 1XDZA 4V03A 2JGDA 5KQDA 1XDSA 1L8QA 1W5TA 4Z53A 3T5BA 4YXWD 4J2HA 1JAYA 3GO8A 4NCBA 4NNJA 2PSSA 3KAPA 1O08A 3ORSA 3WLRA 1OW3B 1P4HA 2EKKA 3EXEA 3IPLA 4XQGA 3B85A 2OFFA 1IIBA 1NR7A 4DLWA 3KE8A 2WLTA 1FFXB 1ODCA 4II7A 3I4CA 3KWMA 1U1GA 4GOXA 4EMBA 1T34A 1FDVA 2BSXA 4QNMA 1ZAKA 4QUBA 4KUEA 2WQ6A 3GNSA 1U90A 2G09A 3DXXA 2G9ZA 3L7YA 2BM9A 4DT1B 3O8RA 4HNGA 2XQIA 1KI4A 3O8DA 3HBNA 1A98A 3K09C 4MB6A 3W5CA 3FMGA 1OQYA 4UTXA 3JQRA 2E4UA 3IE0A 2KM1A 4MH0R 1JZQA 3VHRA 4EB6A 4PR3A 3SCZA 5KTSA 3T4UA 3GJ0A 4B85A 1W36C 1WB4A 2N47A 1M0WA 2O4CA 3N58A 2D6FA 1FDSA 4XOUA 1XMQB 1OR8A 2EWMA 1GJTA 1XXHA 4IDBA 3HMQA 3UJPA 3HXQA 5AVWA 1A1VA 2MHCA 2J3JA 2QYHA 4B2IA 2NZYA 1Z2AA 2JH9A 2JP7A 2FX5A 2VIIA 3BSSA 1SCUB 4TV9B 1KDVA 2RGBA 3RRBA 4R8KA 2R8YA 5REQB 3Q0TA 1NVMA 1V2GA 4YDSA 5B2EA 2ZS7A 1SURA 3RSLA 4IDGA 3M5PA 2Q9CA 3FLBA 2BDUA 2JGFA 3H6KA 1UWVA 3L82B 2H7VA 3TJMA 1CUFA 3EDQA 3QOXA 4YDRA 3KK0A 5FNVA 4DXHA 2IVFA 1NBMA 1TJ3A 5E7MA 4MARA 4RF1A 1HKUA 2RGGA 5FTWA 4B7ZA 2X7XA 3ZJYA 2YOGA 1G63A 4E30A 4YUAA 2DJ5A 3D3WA 5JXIA 1P9RA 1RWWA 2BFDA 1TK9A 3E35A 4HYYA 3ZOKA 4U7HA 1M9NA 5E4FA 1VHTA 5DNYA 1IU9A 3GEHA 4R68A 1HURA 4XSVA 5HF6A 4DEYA 2DAKA 1EX9A 2DWUA 3ZHSA 2EBUA 1V1RB 3T15A 4RTMA 2EKPA 2EP7A 2WQ7A 4FFVA 4F3TA 3H84A 2CJFA 5F98A 4C0LA 5FL7D 3M3HA 3FETA 3LX5A 1U9IC 3MGCA 1C7QA 4KOAA 2OOAA 1K7EB 1FFGA 1XNGA 1QGUB 2CVHA 2VHTA 4RFSB 4RFSA 2X15A 4YCMA 4EJ6A 1DG9A 2AJ8A 3T1HB 1QX3A 3GUVA 2Z8YM 1EAYA 2CLIB 4GSYA 4KH1A 3KFVA 4RYLA 1E1CB 5MFPA 3ESQA 1JIQA 1U8AA 1ZIXA 2BZ0A 4B34A 4NCAA 3K73O 5DM60 4KH0A 3L7OA 1QV6A 1QPBA 4LVUA 3V1MA 1PVDA 1XRQA 1RRFA 1Z5CA 4KO2S 1A95A 1NXWA 1YVDA 1QRUA 3OE1A 2GI4A 4IBCA 3FTFA 4J9UE 3OH8A 3AVVA 1SVOA 3HG7A 2CKDA 3VUFA 1ODLA 1SWVA 4CEHB 4RK0A 5IEBA 5E6SB 3CPHA 2RHCA 4L9SA 1XXHB 3C45A 4HAOA 4OI4A 1XQYA 5KTMA 5GIPE 5AK4A 2MGWA 1GCOA 2DWCA 3U6DA 4DUYB 4GKJB 3JVIA 4UTRA 5CYPA 4C30A 1LUAA 1YAHA 1XSEA 1CJCA 3A4VA 3PR2B 4C21A 1PR4A 3CMCO 1M34A 3E27A 4BMZA 1U0BB 1KVTA 3E7WA 2MINB 4HTAA 4RHYA 5LB4A 5YASA 4GC9A 1ULSA 1XCJA 4YV2A 1ZI8A 2E89A 4NNPA 4A8HA 4PCLA 5EVJA 3D3JA 2R6DA 4DBGB 3COYA 1GQYA 3DB2A 4X97A 3B20A 2ONYA 4KIGA 2GZSA 5KNCH 3UKJA 2WWWA 4DAEA 1EDBA 1WHTB 3QMMA 1ZXBA 4OHKA 1FRQA 4KZPA 4ZFNA 3I52A 3HPRA 4FEGA 1ZS9A 1YQWA 3FHOA 2B20A 3SEQA 4TRJA 5FFFA 3E4CA 3W7VA 3LQ2A 4MLPA 2CW5A 1ENPA 4U7WA 3RR2A 4PIPA 4Y9SA 2P65A 4OJNA 5L3QB 1AGXA 5FBQB 3L0IB 2O7QA 3AU9A 1CUZA 1L6RA 4BTEA 1SWWA 4KWHA 4BB9A 1P7ZA 1OLXB 4LFCM 1NU8A 2DQYA 3I5AA 5CB8A 1NP6A 1S2IA 1POWA 1SD2A 3SQNA 4ARBA 4ASUD 1JG2A 3WZLA 5BMOA 4FWHA 3W6OA 5FOTA 1EK5A 3I01M 3M7GA 1BKDR 1O6CA 3F74A 4G5FA 4UHFA 3R7SA 4EENA 1B76A 1JEYB 2A84A 2FWPA 3PEWA 4TT8A 2CMFA 5JMOA 1U8TA 4E09A 3RFTA 3K1AA 4FNOA 1N6LA 2Y2UA 2P41A 1QAMA 4Q1AA 1PVVA 1U8EA 5EWLA 5EHXA 2VRNA 1A7UA 2A0XA 2G7MC 1I2BA 1MH9A 5IZ7D 2WFMA 2X23A 3AU8A 3CPJB 1RQLA 1QGED 1W4ZA 4NE7A 3VR6A 3FYDA 1EP3B 2WHRA 4CM8A 1V3TA 5I6DA 2QTVA 1RYZA 3GPYA 2WHPB 1TAQA 1QQTA 1ZSYA 5GZ3A 4ZC8A 2NW6A 5CR9A 1RACA 3FJ1A 4H7IA 4ZZ2A 4DQUA 1PDVA 1U8CB 2JIDA 3SKVA 2EGGA 4JBIA 3BK1A 4D0SA 1R4NA 5HILA 1MVOA 1I9GA 1JQEA 1ZQ9A 4EB3A 4NOOB 4DB2A 2C61A 1V5WA 2XLBA 3K8QA 4UCWA 1UBOS 2WU3A 4HQNA 4YBRA 3Q9LA 5FWYB 2EG5A 1GGMA 3CONA 3ZWVA 1GAJA 5C5EA 1G8AA 3ZK8A 3GJ6A 2BP7A 2AMVA 4RQBA 1VJCA 1R6DA 2YWBA 1VLHA 2PQ6A 3HDQA 4DMGA 1F8UA 3AETB 3H16A 1Z59A 4J29A 1XZAA 4WA8A 2JGLA 3OT5A 3INTA 1WZIA 4Z7QB 3I4LA 4WWHA 3Q3VA 1MD9A 2ZJ2A 2EJBA 3R3UA 4LCBA 4KIWA 3E22B 3NTOA 3IMKA 5EHNA 3C14C 1J0CA 3GFVA 3IT3A 4JHXA 2JIPA 1AZWA 4OJMX 3W8NA 2QUZA 2R1UA 4DJFC 4MS4A 3RW9A 4B3GA 1THZA 1VHWA 4H35A 1IBMM 3OQNA 2VJOA 2ZVJA 5IM5A 3B7QA 3DAYA 5DK4A 5DSZA 3TKYA 4A6XA 4BX0A 5KDOA 4C7OA 1CJMA 3DZCA 2TMGA 3MW8A 3ROXA 3VR5A 1MU0A 3IXMA 4FX5A 1BHQ1 2AG8A 3HX3A 1U8UA 3CRVA 3MINA 3VPBA 1U9YA 1F8FA 4B3XA 5D00A 3DDHA 3MWDA 2FSFA 3CX6A 5FULA 5GAJA 3TQHA 1NXQA 3ZCRA 2VDKB 4EPTA 1XD9A 4QELA 4S1OA 5BR7A 1LZLA 2IK8A 2BONA 2PIDA 2VTVA 4I36A 4JJGA 4Q0MA 4TKLA 3RS2A 3TD2A 5A6VA 3E2MA 4AY6A 5CCEA 2BN4A 2WAOA 2PUJA 3L0ZA 2V6GA 4HNAA 3QPVA 4HNAB 4R0VA 4MMYB 1X37A 1GM5A 4GDFA 2A7XA 2F5PA 1VLMA 1O9GA 2HNAA 4EVSA 4KC0A 2WY2D 3WA7A 1K89A 4X5OA 3ZJUA 5BSGA 2ZJAA 4KO4S 2QZ4A 1NNLA 1V11B 2I4NA 2NQTA 2BWBA 4LW8A 1AZLA 2D8AA 2FGKA 2XE8A 1J7JA 1Q0UA 1ZJJA 1Z4JA 4HTFA 5TEWA 4E2YA 5BW4A 5FWYA 5ENZA 5KKCA 4HFRA 1FEZA 1KJQA 3SHOA 1KL7A 2B8EA 2GWRA 5L95A 2I7PA 4DDTA 2R6ZA 3BMNB 3BYZA 4DNOA 1TH3A 1O96A 4R71A 2BF7A 1IBMB 3IEVA 1YS2X 1LJLA 3X0DA 4EQ6A 3QHQA 5DYYA 1OAIA 2WT8A 4J4BA 1GG2A 1NP7A 3FOBA 3PQ2A 4ZCQA 1PJLA 1W48A 1F12A 3H65A 1O9HA 1TAHA 3AF4A 3RVNA 3T7JA 1IY0A 2XKJE 1BA2A 3BD8A 3DTVB 1AKVA 4AN1A 3HJNA 2FPXA 1J56A 3H9CA 2G40A 1SN7A 4UULA 4ENPA 3NWPA 4BUCA 4AJ9A 1G4HA 2QRQA 2R62A 1PJBA 1ZGGA 1XZBA 3IAS6 3N2IA 3LSTA 1T91A 2QUKA 3I0ZA 5GY7A 3UHOA 2VRCD 1BSVA 1KKUA 3DNFA 3K9PA 3CE9A 3ZDQA 1BGVA 2O06A 1PJ4A 3PD0A 421PA 3DZ8A 4RGBA 4EEZA 3B1JA 3T5PA 4NJOA 4UOQA 3RTEA 2HFKA 2I2BA 2PGJA 4IHJA 2QD4A 2YVLA 2GJSA 4JI3M 4WKCA 4DR3B 4PNEA 3OLXA 3JAWA 2XDAA 2E85A 5E6RB 5ICGA 2JJ2A 1EXMA 3T0IA 1VXOA 2H17A 4GPBA 1FTYA 3PDUA 2Z08A 3L7IA 3HCCA 1PHPA 2HUNA 3FTPA 3SC2B 5FX2A 3FWNA 5JSKA 1ODFA 2H1VA 3BJIC 3MWFA 4C6HA 5DNWA 5GGYA 1R16A 3ANLA 2REOA 1GRNA 3GEIA 1QJCA 3DOFA 2XY4A 3H2JA 4TWIA 3UIEA 4DLYA 5K4HA 2J7PA 2CHGA 1W35A 4GXNA 4A8JC 3TKLA 3DAPA 3GUZA 4KI0A 3ZGVA 1F0KA 2VL7A 3L0CA 3CNLA 1OBHA 1SG6A 1Y33E 2IHJA 3D8NA 2HWYA 4MW9A 4CLOA 1QQ7A 3LVRE 2H29A 1XYVA 4P4TA 2TMYA 4RTJA 2FWJA 2QD5A 2YN2A 1MC8A 2PUTA 2PLWA 3F8WA 3P9IA 2UYYA 2JRCA 3TI9A 2ODAA 1A9SA 1ZSVA 1NI4B 5FLXS 1P33A 3FVWA 1A2KC 1ULTA 2OD7A 2D3WA 1MQ9A 3HEAA 4XWKA 4PWZA 1VJ1A 4ZI7A 3LF2A 1Y6FA 5TPWA 2O57A 1R2YA 4MW7A 4ZVKA 4F9FA 3CVYA 1FQOA 3AUYA 3EVFA 1NTRA 2DBYA 5K0TA 2IIVA 2PX5A 3KYDA 4IPTA 1N7IA 2G77B 3RGSA 3OCZA 4K1LA 4DY6A 2GXQA 2GZHA 3P9XA 2PXCA 1CUHA 2JNHA 4X8LA 2GHQA 2JLWA 3IUJA 4LJRA 3GXOA 4Z9XA 3K0FB 4MQLA 1VCNA 2E5WA 1MX1A 2FRDA 1NYLA 4DR7B 2GB4A 1F51E 3PHLA 1PLLA 1U1FA 4L73A 3MJSA 2ERYA 1X7GA 1KRHA 3O8OA 3PXUA 2G9UA 4R2XA 5F2OA 3M70A 5BV2P 5KCZA 4KR2A 3R6GA 3EOBI 4E5YA 1OLSB 2ZYWX 4QDZA 4JELA 2VP2A 4BZXA 4ZCTA 3RVBA 3I5XA 4FE4A 3ZXSA 4RJ2A 1JR3A 4W9RA 2NSYA 4YJFA 4DV4B 1IVSA 1IZZA 4M6WB 1UWKA 2XGOA 3B3AA 4J1NA 1C0LA 2OXIA 5IHPA 4S04A 3FCOA 1NM5A 1R0RE 5JAUA 4C7BA 1YKSA 1QIKA 5JT1A 4UVHA 2GK3A 1DKLA 1JQ3A 3DYIA 4ZZ0A 3L1IA 1UT8A 5KWEA 1X7ZB 2HIHA 2C5LA 3HABA 1NR1A 5TQ2A 4DHEA 3OIVA 1QH8A 4L5JA 1XHBA 1UIRA 3GJSA 1BC5A 3KXKA 5FA5A 5LOVA 5K0GA 2QQ8A 1K86A 4QUGA 5FAKA 3ERCA 1N5KA 4HNQA 2HC9A 3FJYA 4DMLA 1DBPA 1VHLA 4GMDA 3CRQA 3SZUA 2F7SA 1LD3A 1BDBA 1QE5A 1L2CA 1JKFA 2B4TO 3GRZA 3G2HA 4DM4A 4ND8B 4XCXA 4W9MC 1CF9A 2KRKA 2CGEA 4DV0M 2OPHA 3VLFB 5FOWA 4LOAA 4RDCA 3KVYA 2ID7A 4FN5A 1Y6QA 1GDHA 2B1JA 5A5GA 3CEJA 2Q5CA 3JVEA 2E6KA 3VU3A 4CMAA 1HC7A 1U9IA 2D0DA 1UEJA 3EN0A 2JKVA 3CW2A 1UT5A 1DKRA 5DIZA 1Q0QA 4DIMA 3TJRA 4IIFA 1EVEA 4K86A 2ZT7A 3NEPX 3W4IA 4UUAA 2O3SA 3SMSA 5CH3A 2BKXA 4H0FA 4LJAA 4KIJA 5LDHA 3EZNA 1E4EA 3IKTA 1EIWA 4EKNB 2VJNA 4F4IA 4OH7A 2CHFA 3NB0A 2AXNA 5EZYF 3EPHA 2YICA 4OHVA 2KXEA 2H51A 1LTQA 2NXCA 2V45A 4DRXA 1PGQA 1MV5A 1K6EA 1H22A 2HNBA 3IUQA 2D54A 2Y6UA 4GLFA 3P97A 3PHCA 4Q7MB 1YQQA 1ZC3A 2YY6A 4LBVA 3TQFA 4DA9A 4JUAA 4P7FA 4ZGWA 2KE5A 4BNDA 1ZD5A 4JY7A 5J43A 5JH7B 3A25A 1M34E 1KAEA 4P5DA 4XYEA 3IE1A 1E3IA 2VUHB 2WA2A 1PX2A 2XUJA 3FVVA 4L16A 3NORA 4A23A 2ABWA 3AF6A 4FIDA 1QDTA 5L7WA 5GV7A 4Y2UA 1M83A 3AGPA 4EHJA 4DCJA 1J06A 1QFZA 1U0NA 4XB2A 1NRIA 4IX1A 1ZEJA 3LDAA 3GN2A 2CE7A 1BCRB 2X4GA 4MVJP 1T9DA 2WJIA 2GARA 4CM9D 2PZMA 5HKOA 2HMYB 2O8FA 1RCTE 2WYIA 5C1OA 1L5HA 2Q4RA 3RTCA 3AW9A 1IN4A 5F1OA 3KPJA 4MULA 4QUDA 4QWWA 4DQXA 2HAKA 1L3CA 4FE7A 4E5DA 1SXHA 4V0NA 2OV8A 4NMMA 3ELDA 4MV4A 4OM8A 2FVXA 2LHCA 1G2OA 1SCKA 4CG1A 1NVVR 2R8XA 2V4UA 3A2MA 1E9EA 5C31A 1AKQA 3NIGB 2LW7A 1BJRE 3ITEA 3O2SB 1SK8A 2WILA 1WF3A 3T1VA 2JZOA 3KYCB 1ZLYA 4HB4A 5AOVA 1HR0B 3ZLVA 3B3FA 3TTVA 5GZ6A 5MN5A 3WWZA 1IOWA 1IOZA 1OD6A 1TZBA 2NYRA 3NWBA 4JCOA 4Q66C 4TLMB 4EHAA 4OLJA 4ZT3A 5LN1A 2CK3A 4A27A 1RPJA 2FWNA 2XCSB 1Y5IA 3KJIA 1IIRA 3DZIA 1PIWA 3FUWA 2B2XA 2DWQA 2YMMA 4O5AA 5CT4A 3TLGB 4COOA 4AQYM 2JDIA 3UATA 4ITQA 5CGQB 4NICA 1KQGA 1W85A 1J5XA 4LF4B 3AI2A 1SUSA 3UMFA 2AG6A 4HPXB 4EBBA 1SZCA 3R6LA 4G01B 1A7AA 2VPZA 3RK0A 3DBHB 4LTMA 3QV2A 5J5CA 1VYHA 3C5CA 5B1YA 1Z4OA 3E5MA 4RTRA 4UBOA 5JEEA 2UVQA 3ZE6A 4LF7M 2BR4A 1OV6A 2PL5A 2XUAA 4IVPA 1FQWA 4A6PA 3D8TA 3QVXA 2CC2A 3G79A 1FSSA 2R66A 3I39X 4RHEA 1RLIA 4ZCLA 1NUSA 1UJ5A 2JL1A 4JP5A 3V4FA 3H2KA 1ZK2A 2A88A 1NVBA 3DEZA 3JALB 3PUWA 3E23A 2ZRQA 3U9TA 1U2DA 1WXDA 1ZD8A 1I6MA 4M38A 1QGDA 4XWTA 5TGZA 3W5HA 4ZMBA 2H2WA 3IDOA 3MMSA 1E7QA 1X8LA 2BR3A 2RE8A 3EGXA 3TECE 1E3DA 3ESBA 1LV7A 4A10A 2FE8A 1K2WA 4UNRA 1O9BA 3DMHA 3JQCA 5ICEA 5F3WA 1K6IA 1UZMA 1WOYA 4BNMA 4DOMA 3BWVA 1T8TA 1VCOA 3IQFA 3IQIX 5TMEA 4UOZA 5KYYB 2C7BA 4V2UA 4Z7OB 3F97A 1Y3FE 1NW6A 1OX6A 1R6UA 3AM3A 3F9RA 3HJCA 5BQXA 1SJ9A 2K0BX 3MCUA 4J1QA 4Z4HA 4MCJA 4ZI2A 3WMFA 4QUIA 2PUGA 2ZRPA 1PFUA 2A0WA 5T41A 3IP8A 3BZBA 2XMZA 4TWBA 3CURA 4MKIA 4R3UC 5ALKA 1J8DA 2EZ4A 5U1PA 3MILA 2I3GA 3H97A 3TOXA 1BVHA 3U48A 2ADOA 4MQFA 5G0UA 3VAYA 4RTSA 1BD3A 3LZDA 1D03A 1UT6A 5IC5A 3PPIA 3EE6A 3OJLA 4QOIA 1RXEA 2O5VA 4COKA 4UHKA 3DE7X 1OJ7A 4G4SO 3LMMA 1T9BA 1B0UA 1C3OA 1FYFA 1IQRA 2WYWA 3I04A 4R83A 4DCCA 4IOJA 4DVJA 2VYCA 3IEIA 4C2TA 4Z4IA 2DB3A 4GRAA 3DXYA 4UHDA 1NT2A 1UKYA 2Y77A 4PTLA 5BR8B 3W77A 3DCNA 3E70C 3Q7PA 4KN8A 4KGDA 2I7TA 1NY6A 2Y8EA 3Q0IA 3QW2A 5K51A 5A7HA 2BH9A 4LISA 4MYTA 4FFRA 1U0GA 3Q8WA 2L4EA 3W67A 2QLBA 4HTFB 5EIAA 1ABBA 5J9FA 4ZAYA 3I1FA 2HBQA 2G67A 1LPPA 3D7LA 4CKCA 1D5CA 1UK6A 1E98A 4PR0A 2WSEF 2O48X 1F0YA 4G3XA 2ADMA 2FZLA 4Q4AA 4A4DA 2ZAYA 5JSHA 2IH2A 1VIVA 1F4IA 2EX0A 4QQNA 4ZJPA 1KEWA 2X5NA 4D1YA 5AW3A 4CDRA 1TM2A 1U94A 5ISMA 2ZAIA 2F4VM 3DLPX 4BWFB 1FIUA 2NXNA 1SC6A 3DDZX 1G17A 3FMVA 3VJKA 3WV4A 1O0CA 4RTQA 1A9XB 4LJKA 4A6DA 4U2EA 3W5AA 2DWOA 3NDRA 3CTWB 4XW2A 2AN4A 1VEJA 2D1YA 1OUMA 3F4LA 2VPYA 3NBQA 1NXVA 1NUPA 2JY6B 3ANSA 3E81A 2HPAA 1EJ2A 2Y0PA 3F67A 1N4AA 5A5EA 5HS4A 4YP5A 2RIRA 1SMKA 4RCYA 1N2XA 1ZJZA 2Y0EA 4JC8A 2H92A 2WK1A 3X1JA 3WIBA 4A5OA 3TUZC 5COQA 3VO2A 3IQZA 2LR0A 4YV1A 4RGYA 4D4IA 4GBED 3D7KA 5F5NA 4QU9A 3IEUA 3J7BA 1XKTA 1ZXLA 4MA0A 5CVJA 3MJEA 5EPUA 5EI5A 4RTLA 5I4IA 5JNUA 1L5YA 3OWXA 2ZI5A 2ZRLA 3FAZA 1M7HA 3PR3A 2XD9A 1KMHB 2G36A 3FCXA 4G1CA 2A4MA 5IC6A 2CB0A 3W6UA 3BIXA 2JGRA 3E58A 1SKYB 3ZVNA 4NPCA 2C2KA 3NI2A 1F20A 3QXXA 1SIWA 1MUUA 2IS4A 1U28A 5BSKA 3CXRA 5DM2A 1Y6GA 1VPTA 1BO6A 3T8YA 5K05A 4U9IS 1THMA 1FUKA 2LCQA 5J4VA 2NU6A 1XV5A 2WIFA 5EJ4A 3TOSA 1IM8A 2ZYIA 1N9GA 2P62A 1DGHB 1R0KA 2DQKA 1FNCA 1JHDA 3SYLA 2UXDM 4NCJA 4A3SA 1P19A 2ZZKA 1MPXA 1TF5A 2Z9CA 4YHHM 4GOLD 2LUOA 3BGVA 1Q6ZA 3LSYA 4E46A 3U49A 3VOBA 4ZD6A 1OFTA 3ETHA 5E38A 1LNQA 1QQWA 3EEFA 4OXKA 2OB1A 5ALSA 5WRFA 2BFEB 1Y4DE 2BFEA 3MD9A 3MWGA 2ZWVA 3KOXA 3LMKA 2ZZMA 4FYXA 4IRMA 3VI3B 4NYMQ 3FHTA 4Q16A 2GKGA 3GOHA 3NS7A 2UXBM 5CFOA 1DPFA 1Z0UA 2HN9A 3QMVA 4UNSA 1Z5UA 1SXJD 1LSOA 1T0BA 1FDOA 5B6PA 3R6TA 2QW0X 3D31A 2R87A 3V8RA 3BHMA 3D9QX 3UV3A 5AHKA 2PZBA 4LDAA 4Q7QA 2W71A 5AUOB 1YDHA 3M4XA 4ND7A 3W90A 2QLMA 1GZHB 3TWMA 2Q5EA 1FY2A 3BDIA 4P83A 5CLFA 4O8ZA 3FTEA 3RJZA 5HKBA 2FLKA 1UOPA 1HT2E 3EIEA 1SQFA 2F8MA 3NYRA 1B73A 3HDGA 2G9NA 4DZZA 4EYKA 2JASA 2WHQA 4ZAZA 3GJ5A 1EJ6A 4L7QA 1WE2A 2EKQA 5DLPA 1PX0A 1UBKS 4F2WA 5E1MA 2X13A 2DAPA 5C9ZA 2MSNA 2PH7A 3AK4A 1CYEA 1YGYA 3IKLA 3EXIB 1MF7A 4LKOA 1T35A 1KI9A 2QRZA 4FKBA 4F06A 3TB4A 3HLKA 2YQ5A 2IY8A 4EUEA 4DDMA 1KYZA 1VMKA 2Q6KA 4AP5A 4DG8A 3EJWA 1DQRA 2FEMA 4F72A 5AM2A 1OFHA 3ZEIA 2Q2EB 3ZDCA 4GR4A 1M5RA 9MHTA 3HM2A 4CMIA 1P0FA 1JFLA 3TX6A 1WZ2A 1NF9A 1LGYA 3OJEA 3ZWPA 1GCIA 3EEBA 3SC6A 4NAUA 1CX9B 1ZIPA 1RLJA 2WU8A 2Q28A 3TQTA 2Z98A 5CW2A 5LC1A 3HY5A 4KOEC 2BOVA 2FE1A 4DA7A 4CTMA 1NE7A 2ZJBA 4PHHA 1WSBA 1KC3A 1MRNA 1A04A 3RSCA 1XP8A 3QK7A 4IRXA 1THGA 4L75A 2PRJA 3NIFB 4IOKA 3D6NB 2YINC 2CVFA 2PMFA 4D7AA 4X54A 1JLMA 2QD2A 3F96A 4QVKA 4EKDA 1S2NA 3GLSA 4B6SA 2K6GA 1BJTA 3G23A 1TM4E 2AZ4A 4AKGA 1A2QA 2GPAA 2XV1A 1EP1B 2L2DA 3C7CB 1KVUA 2A30A 1M2OB 2CF6A 1SKAA 3HACA 2LDXA 1NNEA 1AA9A 3QBEA 5D6NA 3ZE0B 2X2OA 3B1FA 4UATA 3R6WA 4D2IA 2I3AA 1AY0A 1A4XA 3N28A 1FBTA 4NV0A 4RD6A 2JFBA 5E6UB 4ZVUA 3NCHA 4TN5A 2XSZD 4QBHA 3D7RA 3THSA 2R8EA 5JDIC 1Q1GA 1NQUA 1A7KA 4D41A 4RD3A 2XMSA 3BUSA 3DO5A 3MUNA 4K9LA 3T61A 2DERA 2PZLA 1VEGA 3C24A 4WEQA 4TTJA 4XGIA 4LK3A 5BRNA 1AO3A 4IJVA 4C0JA 4GI7A 5A3JA 3MSCA 3ZJ4A 1PL8A 3BK2A 2B92A 4DR2B 1LXCA 2R4QA 1NXTA 2XUDA 2ZRMA 2F1KA 1I5RA 2GYYA 3ITDA 3KQPA 3R7LA 4DT1A 3T3GA 3TAUA 3MRTA 4K88A 5DBOA 3TMAA 4GP6A 4KRYA 4ZOLB 3RRNA 3DQZA 4QHYA 4H1UA 3ADKA 4XPZA 1BVYF 3FZNA 3P9RA 3I9FA 3UB3A 3CRNA 3FVRA 2YVAA 4W7SA 1O95A 4RZIA 5A4FS 2CDNA 3VO1A 3OLZA 5H3CA 2O3TA 4RK4A 2K47A 1K8XB 3HHEA 4K8RB 4R8LA 1G64A 1MX5A 2QMHA 5KYXB 3P71T 2VCYA 3LC1O 4OY3A 5K01A 3TGLA 2EZTA 2IBMA 3T9BA 4AG5A 1IONA 4IBFA 4JN6A 1A5ZA 1XCBA 4BMXA 5IANA 1PQYA 4EFNA 3H05A 1O97C 3HCDA 3IAEA 1YGPA 2JGJA 4QPCA 1Q50A 4Q9AA 5F52A 1DPGA 3T5TA 1T2DA 2Y4NA 3N6VA 1PDOA 1TR8A 4M1OA 3B6MA 4FILA 3G2LA 3FKEA 1UMBB 1UWCA 5TPWB 2AI3A 1PGNA 4D26A 1WCV1 3BXOA 2IC5A 1PK8A 3JYOA 2E0IA 1PJIA 2AZDA 3AL0C 1KARA 3KUDA 3QY0A 4WN9B 3S2UA 3R3HA 1QUSA 4PLYA 4M8NE 3VPHA 5IKXA 2HU7A 2XTNA 4WV3A 3HDTA 1QNLA 1M6VA 2B8JA 2XIQA 4OG2A 3KNZA 4DA4A 3CS3A 5K0SA 1YVUA 4OBXA 3HRKA 3SKYA 2ZSKA 3MLAA 3VPAA 2IITA 2DWZB 2OHOA 3HB1A 1OA1A 5I9MA 5LA6A 4BRSA 1A88A 2JD1A 2JJ8A 2AJLI 2Q4TA 1YBAA 2A1UB 2R6JA 2HEIA 2Y9MB 4R6XA 4W4TA 2EAUA 3HO8A 3O8OB 1JTVA 1GTVA 5LVAA 1Z2CA 1BNCA 1VG0B 4O4JB 3MBOA 4YIHA 2AMJA 1EUDB 3AR3A 4GOOD 4N8EA 5K0CA 1NSTA 2XNKA 3C1UA 3HB7A 3WLSA 1ZFNA 3M5DA 4WECA 3ONDA 1SC1A 4PPYA 2YHBA 1MQSA 2O25A 3ICCA 4P32A 4AIIA 4B31A 1RLMA 3R0QA 2O2SA 3TSCA 3I2HA 4QSHA 5JWHA 5CB4F 3QXHA 2EW1A 1GSAA 4NENA 3DDCA 4QE3A 4WXPA 2ZI3A 3DZHA 2J6HA 3N74A 1XZGA 1V96A 1W2GA 4H4CA 1WAMA 3JAKA 1OIWA 1U2SA 1Y7IA 3AG5A 3LVBA 2OR3A 2WWIA 3LNCA 1GGNA 1DLJA 1RQ2A 3I5MA 4ON9A 5I7WA 1HE2A 1U0FA 3N8DA 4O59O 4EUKA 4XWWA 2V1XA 4GG1A 4MEAA 2PX3A 1U1CA 2QQGA 4P36A 2DETA 1P5JA 2WD7B 3VSCA 4G09A 4YRDA 5FRDA 4EKGA 1N7HA 1EFRA 2B4AA 1L7NA 3FPBA 4YXWA 1XLTA 2HJSA 3O03A 3BCUA 1M72A 8CATA 2C2WA 4QOGA 2Q46A 3U2QA 4DNXA 2C4TA 3GN1A 3WMRA 4CMKA 4AY2A 3CUYA 3DUFA 1UJNA 1IN6A 2C3MA 4CCYA 1FTWA 2HXSA 5TGDA 4BFZA 3U60B 3LYUA 4FCVA 2HSGA 4KLRA 1BZYA 2H9YA 3MMPA 4W5WA 4TTVA 4TSFD 3PCRB 1PLKA 5FORA 1JQKA 4CGYA 2TMKA 4K87A 3HZJA 4I4TA 3WISA 4F1WA 3FKSD 2Q6VA 1K9SA 3GNTA 2R48A 4DS3A 2O5CA 3KOWE 1EUCB 4TKZA 5JQWA 1JQDA 4JFAA 1F2DA 1MR3F 1O4VA 3OTWA 4OFZA 4M8SA 3K30A 2YBEA 3ORQA 4V0MA 2X4IA 2Y1DA 3NFRA 5IN5A 3I2FA 5CVVA 5JZ9A 2OGZA 2VQDA 4BNGA 3RC8A 2QLLA 2Z95A 1AS0A 1GFWA 1NQVA 1RXUA 1YZ3A 2IYQA 4U7GA 2R4TA 3TL6A 4NQZA 3FD8A 1Z13A 4TV8F 4KQGA 3DXZA 4ESEA 3C3WA 4DWVA 3KZVA 4G9GA 3T6KA 4IVNA 4BNJA 1XK6A 3NNDA 1CBUA 4UBKA 2VO1A 2VNSA 1CVRA 2NQ2C 1ZGCA 2W2VA 3CCFA 4J0KA 1LJUA 4RGQA 2JD0A 4P33A 3UGQA 3WS7A 1EG2A 1T9ZA 1C4OA 1SD1A 1SUAA 2E37A 3KTDA 2ONKA 3PHJA 2DTDA 4CPDA 4U7TB 3WRYC 4CV0A 1UJ4A 4DN6A 1UDCA 3EZ9A 3NHJA 1G3UA 1WHSB 3QX9A 1WB6A 1WUIS 4QECA 3LUFA 4WSOA 4GPZA 2W2PA 2O52A 1L3IA 5BPFA 4AT1A 2GCOB 2XDYA 3OQJA 2O2IA 2OAEA 4R8SA 2QBYA 2FPIB 5CB6A 4L8RC 3IB6A 3UKOA 2B9VA 2J3IA 3AGQA 3AJ8A 3LVFO 4J0FA 3HA2A 2WYUA 3QU7A 2O8BB 5EP2A 4JI8M 2P9TA 2W6PA 5CRIA 5EZQA 3KL4A 3ZV7A 5JTTA 5CM9C 3WG9A 1PK9A 1BE1A 2PSHA 4RY8A 5JCOA 1FPQA 1SCJA 5KYYA 3MCVA 4GI3A 2R65A 2EW8A 1E62A 4QG7A 2PBRA 1KY5A 1E1MA 3MMXA 3TQRA 2P2CA 2FNAA 4EKYA 4B3SB 1L1EA 1D4FA 2DPGA 2V9PA 1C0EA 1X86B 3ANXA 1XWWA 1NXSA 4KU4A 4MJLA 4YRAA 2Y1OA 3KPYA 3OCYA 3BPSA 7MDHA 4CGYB 1ABFA 1S3SA 1U7ZA 3A3YA 3FB4A 4P2GA 4X7BA 3VXKA 2FHPA 3ABRB 1HFKA 2ONZA 5HJ5A 1N6KA 3S68A 4V3BA 1RYYA 3TIIA 3P9YA 3AM5A 1IYZA 4XD7D 1P4RA 1XTUA 3HVIA 3I9JA 4B0PA 1TIBA 2VTDA 3ISJA 2J5RA 3KKKA 4JVOA 1ZN7A 4OQEA 5GJVC 5L7YA 3BOSA 1LRJA 1MKYA 5TVKA 2I67A 4P8RA 3DEAA 1PL0A 4B3RM 2EJUA 5ITYA 1OV4A 3HYRA 4AZ3A 4DLVA 4KYTA 2QLNA 4H9GA 5HOQA 1XF1A 5M3BA 1GKUB 4RM2A 5NLLA 2JD2A 1LX6A 1L7DA 4HN9A 2VBFA 3E8SA 2C5EA 3S70A 4YRKA 4BP9A 3NHYA 1Q0HA 4FYVA 5LKAA 4JEHA 5TQ0B 5IAOA 3LQYA 2Z2IA 4P58A 2FDCA 3IHPA 1Z29A 3A1NA 3I2KA 1I24A 3AJDA 3M49A 4MYSA 3FLMA 2Q3MA 4ID3A 1GU1A 5DXJA 2ZIXB 4C3OB 2GHTA 1FLNA 2QN6A 2DT8A 3ZCXA 1VPEA 4H59A 3EWNA 2PJZA 3M82A 1L1QA 1LI4A 4JC4A 3QEMB 5DYIA 4GEKA 4A0QA 1DO2A 3KZMA 4WY2A 4F3CA 3B2NA 3W06A 5A7FA 4DV0B 4Z1MD 3JU3A 3WOVA 4MP8A 3WRWA 5AVTA 1U2ZA 4JYAM 2F3SA 2V58A 2XZFA 1ZK1A 1VKHA 4O4HF 1EX7A 1I2ZA 1EJBA 2NPFA 2FFQA 2WJZB 2JI8A 1E0DA 1WMDA 2QPLA 3O3OB 3OKPA 5JUWA 3O84A 3IOMA 4LY0A 1E99A 2IYRA 1DNPA 3WFIA 4MUIA 4GWGA 5HF5A 5AKIA 4Z5XA 4RYDA 3JWPA 1J49A 2X9QA 2H5LA 3HDVA 2BFDB 4QU5A 1YIDA 3D6VA 4NS1A 4DMUB 3OAAA 3OFSA 4MZXA 2VAWA 1D04A 1H5UA 4K7JA 3E48A 1G8HA 5KWSA 3T38A 4DLRA 3AR7A 1VMDA 4HMQA 1II0A 2X42A 4FW9A 2K5UA 2V9ZA 4FYPA 4C06A 1DAMA 1S8FA 2ZXEA 4QFDA 2GZDA 1XVIA 3L4BA 4I3GA 4P22A 4ZO6A 1XPOA 4OLHA 1QDRA 5EL0A 1YFKA 3EC1A 3KR2A 2MDTA 3HN7A 4CMJA 1DWPA 1KK2A 3UGJA 1YMVA 2A33A 2JK1A 3EVGA 3KJNA 4J03A 1J0BA 1EP2B 2AQ8A 3B5JA 1Y7PA 3L1UA 5LXTB 4KZKA 1UBSB 5CYFA 5FBKA 2FS1A 4P81A 1DX6A 3ZVLA 5CT8A 1CY8A 2GAOA 2CWBA 2IHTA 2VXOA 3QOWA 4UUNA 3H2SA 4JP2A 3AEYA 2P6RA 4QGAA 2JZ1A 3T5MA 1UOQA 2AMFA 4C4OA 5IZCA 1N7JA 2CL6X 3FFXA 5E9WA 4H4DA 1IHPA 3O93A 2X8JB 4FGUA 1YQUA 2O7SA 4EUFA 1E9RA 2WZBA 2XOKD 4CLEA 5BWBA 2IX3A 4O2AB 1E9BA 3QYBA 3U3KA 5BVHB 2Y1EA 2R1VB 5ED4A 1P75A 3CWCA 1VSBA 3DMPA 3Q8LA 1XMOM 3ZE1B 4BO7A 2XNDD 1MQAA 3IBGA 1QZMA 3A6EA 3NC4A 1N2SA 4D9EA 5B7PA 4NZMA 4TTRA 2FKAA 3K9HA 1C9KA 1K8QA 1SUWA 2V5UA 4CE6A 2AG1A 3KJQA 1HO3A 4PQFA 3ZWDA 4D8XA 1ACMA 1BU5A 1RBZA 5LP6B 1M2GA 1U3FA 3KSAC 1W5FA 3P2EA 2GUGA 4TUWA 2GF9A 3PF9A 4N5NA 4Y1RA 5FBVB 3DZBA 1VIAA 1ZNXA 5DNDA 1Z0IA 1P1IA 2RCYA 1X7DA 1U31A 4I55F 4IF6A 4PWYA 1TUGA 4F6LA 2EJVA 3MJHA 4QU0A 2EL7A 1Y9EA 3G5UA 4MRPA 4RO0A 3KV3O 1RNLA 3PGXA 5T8KA 3ZHTA 4DREA 1V0JA 2PEZA 3MXTA 3S2EA 4QYWA 2AEJA 5IH7A 3LA6A 1VG5A 3PHGA 1ZWKA 4YJHB 4N3CA 2XCOA 5DFLA 3GX1A 4FCCA 2I2XB 3BTSA 4BO5A 3KO8A 4V0RA 1QKJA 5KOHA 1HUQA 2XRYA 1ZN9A 3QSYA 1Q15A 2OSVA 1NRXA 3HCBA 4NPHA 4EHHA 4QGHA 1HT3A 5LL6P 3K32A 4MGIE 3PGLA 2E1RA 3WLMA 3ZJ5A 1UK7A 3L7BA 2LKCA 3AR2A 4NEQA 2UZ4A 2FSPA 3ZCBB 2Y1KA 2O6LA 4M6WA 4BV9A 4JV5M 4BNLA 4YAJA 3VBCA 4O2BA 4ZAVA 3QY9A 1R2QA 3OIWA 3KZ1E 2ZTCA 2Q5LA 4MDEA 4NJMB 2YJGA 1T9KA 3LKZA 3HJAA 1V39A 4K40A 2X49A 2IIBA 4I4NA 4QBFA 1JR3D 3SBDA 4B47A 1EFCA 5C0OE 1JTFA 3S5UA 4EJSC 1OVMA 1UOEA 2Z3XA 1K7FB 1WQ3A 3GJRA 4RIIA 3WL8A 4BVGA 1SOUA 2V7PA 5C80A 2GEJA 1A96A 4BJ5A 4OMDA 3J27B 2ATVA 1A9TA 1J20A 2OCYC 3K0FA 4Q1DA 3AHHA 3NT2A 5J1TB 3FCCA 3UMRA 4A0RA 3LK7A 4G5OA 1JA1A 2YW2A 4EL5A 5D5HA 4DILA 4Q93A 2OO5C 3P2KA 3P27A 2B3DA 4MUMA 4U1RA 5DYNA 3BSFA 4MI6A 2O01F 5A3VA 4CM4B 5K2MA 3SZRA 5L51A 4U2KA 4E07A 4M1WA 1ZRSA 1CFJA 2RGHA 4MR8B 4MR8A 5J5VA 1H0RA 1TUBB 3SBOA 3UANA 4BDTA 1XD2B 3J81S 1RBMA 1YBFA 2CXOA 2ZAGA 4PX9A 2V74B 2VYQA 4LN1A 2AOVA 1C3LA 4MO9A 3MERA 4PHCA