3C3EA

Crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei in complex with fo and gdp. northeast structural genomics consortium target mar46
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
305
structure length
305
Chain Sequence
MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMKELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLSSLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPITSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFERLGCHASRADTLMTSTEKSKELAEIVVQAFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-phospho-L-lactate transferase
publication title Molecular insights into the biosynthesis of the f420 coenzyme.
pubmed doi rcsb
source organism Methanosarcina mazei go1
molecule tags Transferase
total genus 82
structure length 305
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 2.7.8.28: 2-phospho-L-lactate transferase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01933 UPF0052 Uncharacterised protein family UPF0052
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.240 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 CofD-like domain 3c3eA02
3.40.50.10680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CofD-like domains 3c3eA01
3C3EA 2P0YA 3C3DA 3CGWA
chains in the Genus database with same CATH superfamily
2Q1TA 2EO2A 4GSKA 2HJRA 2JCXA 5KHLB 1KVSA 4MHTA 4RXMA 4M6WA 3UXEA 2G4LA 4BVBA 3RVNA 4IICA 2IXDA 3AFHA 4W5HA 5I8PA 2VZ8A 1KGSA 5BYAA 1OLXA 1YRLA 1FU7A 1FFXA 3K6RA 1HKHA 1P74A 2BRUC 5KQ8A 4O4IA 3EXHA 3KKLA 4ZANA 1C9YA 1EE2A 1MO4A 4QQRA 4OUDA 5B7QA 4QHSA 5HR5A 3D7SA 5C5DA 4MV7A 4IBGA 4OB8A 5T64A 3BT7A 4KCGA 1GRNA 5FV4A 3P26A 4TTIA 3KWLA 5AKHA 2OCPA 5CFRA 1IHDA 3EN0A 1HRKA 1AG9A 3MT0A 3DAPA 4K03A 2KLBA 2F1IA 2WU8A 4QIHA 4TLMB 1D4ZA 3IMGA 1RVV1 1UXJA 2YVUA 3EVEA 1INLA 4D9NA 3HK2A 4NG5A 1FX0B 2QTRA 1XC8A 5E1DA 4V03A 1J2EA 4ISBA 1RLMA 1U8AA 5ESDA 5KNDD 2I3DA 4R8RA 4LOJA 2Q5LA 1RLJA 3EGXB 4L9RA 1JHDA 1A0OA 4ESHA 2OO5A 2DZDA 4MVJP 2X9QA 5DEOA 5H4GA 3LKDA 3Q1KA 4DLKA 2QZSA 3KHKA 5CR9A 1TDJA 3ESDA 2DAPA 1YZQA 3PQ2A 2FZLA 2AD1A 4IMIB 2DPGA 5CB4F 4CT0A 3REGA 3K2IA 3PUZA 5JANA 1WPQA 1RKUA 1T2AA 2DCMA 2YBEA 3NHBA 2I3BA 4HUQA 1MQSA 1VRWA 2G5PA 4RK1A 4X1YB 1VZ3A 4BRZA 3L1KA 3NIGB 5TGTA 2CL5A 1NVAA 3F6CA 3O4GA 4IEEA 5AKEA 1EDDA 1P1RA 2TYSB 2D7CA 3IAS1 3NUQA 1SQGA 2JANA 4GOJA 1E58A 3EEBA 1FP7A 2C2GA 2BLLA 2ECKA 3NNDA 2D7DA 3TEMA 1G7SA 1UBRS 1ADCA 1JAYA 2EFYA 3GJYA 2G6TA 4X1IB 4MW9A 4OHFA 4JZYA 3THXA 2ZWVA 3KJFA 4GR4A 4M86A 2Z95A 2VJMA 2WUFA 5ADVA 4IFBA 1Z16A 3ZHVA 5K0BA 1FNSA 1BX3A 4AF7A 4R8KA 2YV3A 3QKWA 1SUWA 2L2DA 3NTUA 4W82A 2QQEA 4YRTA 4JI3B 2I03A 1Q3TA 1XTPA 5K8LA 2K7ZA 3DKIA 3OQ1A 4IINA 3ANLA 5LJLA 1WKCA 2ZCVA 5TMDA 1RJFA 5TGDA 1ACLA 4OFZA 4FFPA 4FYVA 4ND3A 4WLUA 1WPXA 3MK31 1UBFA 3H9UA 4JGIA 1FSGA 1CHDA 3IUMA 4CKCB 2JJYA 4AN1A 1PDOA 3JZMA 4QECA 3MB5A 3SI7A 1P0CA 2D5CA 4I2VA 2VDBB 1IHYA 2CW5A 3Q9UA 4O4JB 2QD2A 3S4YA 2PL3A 1VP9A 4HAVA 3K1ZA 3CZCA 2NNWB 2YDXA 2G3QA 5A4IS 1VP3A 4U7WA 1LSOA 3U39A 1P3DA 1G2OA 3TG2A 4IZIA 5IUNC 1QHEA 1WV1A 2AN1A 4ACAA 4ZYYA 1AOXA 5E3JA 1KEVA 4HQ6A 2Z1MA 3ED5A 3OC0A 4IDQA 4FFOA 5F7XA 2ZB7A 3Q8MA 3HR7A 1GZHB 3WYNA 4QYMA 3F1LA 2ERCA 4BJ3A 2DUUA 3MTGA 3GBSA 1GL9B 3I52A 4WXPA 2Q0SA 3NW9A 1SVMA 2FSVC 4HNQA 4EYQA 4DCSA 4QUIA 2O0KA 2I62A 4FCWA 5J1TB 2V7BA 1DXHA 5I4BA 2NM0A 3OWXA 1YE8A 3K53A 1JIKA 3NOXA 3DXZA 5H16A 3KXPA 3EGDA 5K8VA 3LP6A 3SEQA 4BFYA 2NTJA 3DC7A 1MN3A 4RHEA 4RVSA 2LIPA 4DR2B 3I9LA 2ZBGA 1C7RA 2FMFA 4P4SB 4A2PA 4REQB 4EJSA 3AZPA 3OWHA 4W8GA 5ERGB 2Q5HA 3EDMA 4KHZA 4IBBA 4JVLA 1DJOA 2A2ZA 2RH5A 3EUFA 2Y20A 4UDNA 3FGPA 1GQQA 3GLGE 4GT1A 1GL6A 1Z15A 3ZS8A 2VC2B 2K2QB 1OFIA 3V46A 2PLAA 1UADA 2W11A 1CDEA 2FSHA 1M8PA 4XPZA 4F5DA 2ZAGA 2VHWA 1V7CA 1WZNA 1HNWB 4IV5A 4IR7A 4ZI7A 4DLVA 2R00A 5HZKA 1JDNA 4QO8A 4OSOA 4HN2A 2Q41A 1FNMA 3HBFA 3C6BA 1JKFA 3CF4A 1J70A 1W4LA 1RDFA 2Q28A 1I6WA 3VOSA 4CF6A 2Z1NA 4KHPM 4ES6A 2P2LA 5LR6A 1QWOA 2Q9BA 3WLKX 1EWQA 4HI0E 3W2IA 2B7CA 4FGSA 5HF6A 1T5SA 1IQRA 3GQBB 4WCFC 4X7PA 3WS7A 3ZVMA 3JD0A 3K35A 4I5SA 4E08A 3A9UA 4JLBA 4DANA 2ZZNA 1AQYA 1OLOA 1R6TA 4YGXB 2PYIA 3WLQA 5TX7A 2HHJA 2VDQB 3BGSA 1PFWA 4YCDA 2YS7A 2CHQA 3HO8A 2D0DA 2P4EA 1I3LA 1OMOA 4OQYA 3MJFA 4HDRA 4OH1A 2YWXA 3TZLA 1FYVA 4ZOEA 5B30A 4R1PA 3B36A 1YRQA 4UDXX 5FUXA 5B2ZA 4ZJYA 4KGXA 3QFTA 1L4GA 3T1TA 2EQBA 3H1AA 2X2EA 4E5YA 4EBBA 4YRMA 2JAQA 3FIUA 4G5YA 3V8VA 1GYQA 1JLSA 2JB9A 4LE2A 1RCTE 1V45E 5F7JA 3TD2A 3DF9A 5BQFA 2OWDA 3FCSB 3MAGA 1TD1A 1VSQA 1UMDA 2WF8A 3C41J 4AO6A 4MUJA 3PNPA 2A4MA 4PO1A 5FNVF 1UBNA 2J31A 4JN6A 5DB4A 2YWDA 3LUGA 4UCFA 3MF4A 4B9AA 4UHFA 4KE7A 2PZAA 4MRAA 2L09A 3H13A 4NBNA 2EG5A 1YBAA 4O25A 2ATCA 4DV7M 1EUCA 3NBMA 3RGGA 1JLRA 3JQDA 3QXCA 1DGBA 1WZ2A 1MPXA 1MA3A 1U1IA 4RLHA 4O4LF 4BBJA 1Z29A 3N6RA 4MQFA 3D1VA 3OH8A 2B2NA 3IB3A 2IDZA 4QG7A 3W67A 3C3AA 1TIPA 4YJHA 2PZBA 3N2LA 4UATA 3FCXA 521PA 2J8ZA 4TS1A 3RRYA 4QEDA 2BFEB 3OPQA 5E0OA 2YHIB 2R7MA 2JZ1A 1YZVA 5AK4A 1N36M 2YCLA 2AHRA 3IKVA 2FGJA 4H4DA 1W59A 3TSZA 4B80A 4G4OA 121PA 4G67A 5AOBA 3LVWA 3IS3A 1SC6A 3I73A 1YOBA 4BEWA 4B6RA 2JJ2D 1SOUA 2IDKA 3MEQA 3N2IA 1JQ3A 2EW8A 3MTQA 1CEYA 4NXNB 3E3NA 1RHRA 1WQ4A 3IEIA 3FB4A 2DT5A 4M1ZA 3FYDA 1PJAA 3C8ZA 2GCOB 3BX1A 3J27B 3MCWA 4LOIA 3OFSA 2HFJA 1RNLA 1CQJB 2CZQA 4H7FA 3ZU2A 3A25A 1VJCA 3RYFA 3SAVA 1ZBDA 3DLBA 3GZTB 3PU6A 3ODGA 1WTCA 1T3LA 3GLGB 4LZZA 3FX2A 1CYEA 4QEZA 3CLSD 3HP4A 2ZWIA 4RJJA 1V8ZA 4QVKA 1QPZA 4C0KA 1JHPA 2ZM6B 4XK8F 1ABFA 1A8PA 3ZZ0A 3TSWA 4JYBA 3NCTA 3V4FA 1I2CA 1T5DX 3FTQA 4HX2A 3X1YA 2PFGA 2P9BA 3MS4A 3IG5A 4CTNA 1NXTA 2FW6A 4NBVA 3E6AA 1WNTA 2YHSA 4RFLA 4BKQA 1PWEA 1TMGE 3BMQB 3MGBA 2A58A 1LPPA 4CIYA 1I3KA 3VUEA 1KK0A 2IBMA 1JQDA 2C5EA 1IY0A 3DE1X 1ND6A 2QX9A 4NZMA 4OOEA 1JILA 3ANSA 4FEEA 4DYDA 1JWBB 3KYCB 4B73A 2VJNA 5D7NA 4PC2A 4ID3A 4QGHA 4WNCA 1FVFA 1GR0A 4QGBA 3NEJA 4ZO6A 3UJ8A 2GD0A 1MJNA 4LDQA 3LF2A 2R6ZA 2VDRB 1ZV1A 2CHUA 1JZSA 1XMOM 3GWGA 1T1GA 4E6PA 5IWAB 3HCDA 3GDOA 1IM5A 1PJZA 2PJUA 5BW8A 1ZL0A 2ORVA 2C42A 3V1NA 2K87A 4F6LA 3EQ7A 4LYGA 4FLMA 1JSLA 1JSCA 4EVQA 1S7GA 3UGTA 3O1LA 2X40A 4ZK2A 4HQRA 1BKDR 3IT2A 4Z9BA 3PQFA 4TQ9A 1TF2A 2TMDA 5U9CA 4DCTA 4XDZA 2IGTA 2Z2YA 3F0TA 1DIAA 3QG1A 5HJ2A 2JJ2A 1HMYA 3QPWA 4OQ4A 1KETA 4YPVA 1G4AE 2X8WA 2GGSA 4MMYB 3IP5A 1ZISA 4NENA 3VZRA 2Q3JA 3SPXA 2JCVA 1YR6A 1IBSA 4P17A 1MQ9A 1X9GA 4XWWA 2GA8A 1JFFA 3QM1A 2BJWA 4Q02A 1EVZA 2NX2A 4ZXFA 2IP2A 3VFDA 2UU9M 2X0EA 1W1WA 3CX7A 3EFOB 3J81k 4YRCA 3TOXA 4BBAA 1I7PA 2EL9A 3S29A 1UEXC 2OXRA 3AWDA 3CH7A 2VJQA 5GVRA 1UP6A 4E3WA 1HNXM 1OFTA 4BJ6A 4UZFA 4EARA 4DKXA 4DR6B 3I62A 1QDTA 3B60A 3VOAA 4YI3A 1EDZA 1UOOA 2HIAA 3RM3A 3DBHA 4JODA 3IR6A 2ZTUA 2QGNA 1YIDA 2QD4A 4LJYA 4QSMA 5CTAA 1P3JA 4L8GA 3EY4A 2ZUFA 4AY6A 2PLRA 2HYIC 1Z47A 2YV2A 1TQ4A 4D43A 2H5LA 2JEYA 1L9XA 3C74A 4CQLA 2FI1A 2QNBA 2PFKA 1HWYA 4EHLA 4C4ZA 4AY3A 4F4JA 3NANA 4MLZA 4ZPXA 2A14A 4DSTA 2YZ7A 1EG7A 1HYGA 3U7IA 3FUTA 2A0WA 2QX6A 3H5TA 3AEUA 4ZDIA 4X8LA 3E7WA 3KVVA 1GSAA 2EKDA 3QPDA 2KXEA 3I2GA 2C7BA 4OK6A 3T9BA 1PEKE 1UZLA 3H6HA 4LGMA 1J1ZA 3S8EA 2XWPA 5PNTA 5KHOC 2GQFA 3AW8A 2YWCA 3AVPA 1QQ5A 4DC1A 2FUNB 4YQFA 4ZO8A 3KP1A 4DAEA 1OX6A 1ZEJA 4LWQA 3QF4A 5EPEA 2UV8A 1KYIA 3DKRA 3CLHA 1JG4A 2WY2D 3HWX1 3AJAA 3KYIB 1YL6A 3WK7A 4MYSA 3OTWA 3E8MA 3OVMA 3GPIA 1A97A 3PUYA 1DKMA 4ZO9A 5CA1F 4LRSA 1J06A 1SOAA 1L4HA 1VE1A 2R8RA 1ORDA 1OYVA 2Z2JA 3ENWA 2FRDA 5FTNA 5TLSA 1T1RA 3TVYA 1ZNZA 4ZRNA 2QVGA 1DG1G 2K47A 4HEJA 3B8HA 5ITYA 1FYEA 2E85A 1V92A 5EHQA 4ZIRA 4HTAA 5CT5A 4DARA 3O1HB 1K8XB 3B20A 1NSYA 3D4OA 1J33A 4DIMA 1LY1A 3AR9A 3FE2A 2HPAA 4EVRA 1K97A 4ASUD 5TPZD 3UPUA 2ALJA 1Z2CA 4BBPA 3B1JA 3C7DB 3HJUA 1TM5E 1MNQA 3DKVA 3RTDA 1KARA 5EP3A 2XLBA 2ONKA 4Z53A 3TUJC 3IUPA 4LRQA 5JXJA 2JFWA 1IJFA 4WCVA 2Q6VA 1VZ2A 5B3AA 3DNFA 3L1UA 2BFBA 2LBCA 1KVUA 4KXFB 1RPJA 3X43A 1DRVA 4W6ZA 2GXSA 2OC4A 1XEWY 2WYOA 4N0EA 1G8KA 4UAVA 4FDVA 4J8PA 4Z1OA 4JI6B 2DAGA 2PT9A 1QZEA 3PIIA 4DR4B 4OW0A 1JLMA 4IIHA 2FUG6 4W1RA 1JFSA 2CNNA 3MTDA 4B43A 3LXRA 4KQ1A 4N39A 3LH5A 3I6QA 2G9RA 4B3MM 1IAVA 4N0MA 1XVTA 3JAMS 1NN5A 1Q0ZA 4NYIR 2X1VA 3T7TA 3T7AA 3H9CA 1HORA 3HL4A 2Q3FA 4HMOA 1TH3A 3GROA 4ZZ2A 1DUSA 4QTTB 2BI8A 4LF9B 1PM5A 1WMAA 1OFGA 4D4GA 4M7PA 1JG1A 3G0IA 1KI3A 2GZSA 1U4NA 1QB7A 3B1ZA 1SG6A 1GYRA 1FFCA 3MT8A 5CG1A 2YJZA 1HFEL 5CVJA 1QCZA 4PDGA 1JR2A 2IK8A 3FCAA 1NVTA 4YRIA 3BQNB 2GZHA 2X8BA 4QDTA 2X49A 3FKEA 3K9FC 2I7PA 3SZMA 5H3LA 3JASB 3BE8A 3S55A 3CRMA 3Q11A 3N39C 4K9DA 1GQ2A 1NY5A 2WUGA 5E4YA 4ZRDA 1ZD1A 1U0JA 4CFZA 1Q39A 4AMVA 4AKGA 2AEMA 3K2EA 3S2SA 5J5VA 4ZQFA 4ASUA 3K70B 5ILOA 1T6NA 4U9IS 4IGFA 3RO7A 1VBFA 2BVNA 2P6OA 5TQ0B 3E5RA 4KO3S 1YQQA 1ODCA 4ETMA 5P8WA 3X1ZA 3BK7A 2XUJA 1Q0RA 4LN1A 3G0DA 4Q4AA 4V1CB 4XKJA 3WQHA 4TLCA 2VOEA 1L2DA 4DJTA 3N2NA 2YJGA 1K8ZB 3BBZA 4HZGA 2NU9B 3LPAA 1DTWA 4OQFA 1WCYA 1Y8ZA 1YFZA 4TV9F 3V4SA 3JWEA 3OZSA 5KNDH 1FOEB 4U3JB 3RGSA 3FTPA 2UUBM 3JSXA 2J85A 1FS6A 4WVLA 4EG3A 1BJTA 3ANMA 3CG4A 3U7QB 1NM5A 2DSTA 3T61A 3RSSA 1D0KA 1H05A 3HGQA 1TYEB 1UEJA 3HCWA 1IOWA 3OX2A 2WEKA 1KI8A 4BVKA 1FDVA 4MLDA 5DW0A 3ORHA 1P9LA 3F92A 3R7SA 1L7OA 3QWLA 2RGDA 4XJXA 4HDNA 2OAQ1 1XWWA 1IZZA 1XZMA 5CIWA 5GZ3A 2OHIA 1AKMA 3R1IA 1QP8A 4URFA 2C5SA 1EFTA 3EMVA 3AR2A 1KMCA 2ZZKA 4KEAA 4OGFA 3EYAA 4LG2A 3I8XA 5LWHA 1V5FA 4PSCA 3TGWA 3GNTA 4RABA 2XMZA 4V0NA 1Z9BA 1UDRA 4QL3A 1Y1QA 5TMEA 3TLEA 5G0VA 2P35A 3EC2A 1OXKB 4LNUA 3RRMA 4KXVA 4LHVA 3OMWA 4A0RA 5NLLA 3SEFA 3Q7IA 3K8QA 5CVEA 4EDHA 5ECDA 1K9SA 1O0SA 1YQTA 2EW1A 1Z4NA 3BBPA 3HA2A 2FCAA 4JAVC 1GSHA 5HRUA 2J30A 3ENKA 4G4SO 5JBQA 5JSZA 4HO1X 4TYPA 3OZVA 3WLEA 4P4NA 2ZWPA 1XKQA 3JZAA 2PZMA 1RYNA 3K1TA 2PO7A 3IEPA 3A05A 5M7EA 5FL3A 3TWOA 1MUUA 5F7OA 3RC9A 4G4JA 4RTLA 2QD5A 2IIBA 5M04A 1JJVA 2F3QA 3EMKA 2O5RA 2Q3CA 4NC9A 2NPFA 3QLEA 4DMKA 3OTOM 3DGFC 4WKGA 1O77A 5EHIA 5DSZA 1M2VA 4LHSA 1TQHA 1WB6A 4LEIA 2EYUA 3CW2A 3DMYA 2HJ9A 4FWGA 2OGWA 3JQ8B 1DQPA 3KSZO 2X5NA 4TWAA 1DHTA 5J4KA 3PUWA 3ELDA 2P1ZA 1ST3A 1VBMA 1UKYA 4MP8A 4FVTA 2JLBA 2BF7A 1ISGA 5GGXA 5BY2A 4NDNE 1FP4B 2GZDA 1DX4A 5BV7A 4KV9A 4QU0A 1F2TB 4G3OA 1MF7A 3VI3B 5FH9A 3ADDA 4JBYA 4M1KA 3RYIA 4MR7A 2O2ZA 5B2EA 4BB0A 3O8QB 1MH1A 2PXAA 1R0SA 3K0AB 4Y2JA 1O8BA 4IV0A 1EA7A 3LX6A 4E32A 2CVPA 3MQ4A 2YBDA 4ZI5A 1V5GA 2HPVA 4GMDA 3OOSA 4WBNF 3B5IA 3K73O 1QH8A 4JEUA 3CR7A 1RMYA 4KE9A 2WC1A 1YR7A 2VCEA 3DT9A 2HXYA 5KBYA 2D54A 1LW6E 5DLYA 3K4QA 1DMSA 5HTKA 4JX8A 2Q6IA 2X77A 4F9TA 3A1WA 2HMSA 3AHDA 4Z9XA 2AW5A 5CCBA 1JG6A 4YJ3B 3KBBA 5KX5A 1TKBA 3HLYA 3RK4A 3ECAA 4PLZA 4BEJA 2QIOA 4QVGA 5KOIA 4ZU3A 3ZUPA 3KZ1E 5FDFA 2LWIA 3MTAA 4KW7A 4ZCLA 1R37A 4NZNA 1BJRE 3A2KA 1K86A 4BMPB 2VQEB 4GMFA 2YWFA 1WCXA 5KNCH 4RAOA 2WFLA 3RARA 1T9AA 1E6WA 3IILA 5CT8A 5AM5A 4BMDA 1I7DA 1QM5A 1MEJA 2ZUVA 2HCJB 3D3NA 3PGA1 1Z35A 2G09A 4F2WA 4YFVA 2H2IA 1GT91 4LGVA 1K7XB 1YV9A 2G5GX 5BNFA 3LC1O 1WPRA 2Q8QA 1WF6A 4L78A 2Z6UA 4W99A 5CPFA 5IN5A 5EJ6A 3PGLA 3DG9A 3KPVA 1IUOA 3RQIA 1JU3A 1EESA 1V8FA 4DA4A 4ARUA 1PGQA 1XMJA 4GE0A 1EXNA 1G71A 1SFRA 1Y3HA 3HADA 3PT5A 3K8ZA 4DXDA 4EEKA 4C6TB 5EFZA 3HNPA 4ND1A 2J41A 4DPLA 2V6IA 1L5LA 2LVNC 1R6BX 4LF7M 1DG9A 1C7QA 3LCRA 3PIDA 2ICAA 1W6UA 2KW0A 2HSZA 2XBLA 7ADHA 3R7AA 2P2SA 4XUEA 4CGZA 1WB4A 2J3DA 4JI8M 3D43A 3DAFA 3N1UA 1EVYA 3K0FA 4IILA 4KL8S 3AESB 1J6UA 3CWZA 2P5YA 3B78A 2IXBA 3L7CA 4NIMA 2P6NA 4M0WA 3GGJA 1K6EA 4OQZA 1RM0A 4MIOA 3UK1A 3B3GA 1ID8A 3I5AA 3V8PA 4B3GA 3N3BC 1AS3A 5B4UA 2F5QA 1XJ0A 3B7ZA 2BCEA 2CZGA 3OJLA 3QLVA 4RVHA 3K0EA 3B7QA 3TW0A 2NZUG 3LIPA 1CP2A 2EJSA 5JFOA 1JIUA 4Y6QA 4CE6A 3BC1A 2Q21A 1VSTA 1ZS9A 1TCAA 1MRSA 3PD7A 4U2BA 1P6UA 2QI9F 1P7CA 2D1FA 4MOWA 3WE7A 1D4AA 3HHZA 4K87A 4RSRA 1LPMA 2OZVA 4I5EA 1RSZA 2WSSD 4FR0A 1E4VA 1R8JA 2SCUB 1C0EA 3IA7A 5L53A 2RDMA 4KRGA 2H4XA 1MJFA 5BRNA 4DLPA 4OQDA 4ZEWA 1W85A 4OQPA 3T0IA 5BR8B 3N76A 4B74A 1PAUA 1E0KA 3QH4A 4G4SP 5IARA 2CXXA 5EAIA 2YN2A 3IHLA 3NOOA 4DBLC 4DQUA 4X6LA 4M22A 4UVIA 3RF7A 5F3RA 3O03A 5GJVC 2NT4A 1TTHA 4E2WA 3VDPA 3E23A 1A95A 3AERA 5TPWA 1XU7A 4XGRA 4U2DA 3W34A 5K0GA 3NBZC 1QUSA 1Y89A 4P3NA 1E79D 3QXSA 1J1IA 2LVPC 1Z18A 2FUG1 4UU7A 1LJ8A 4A1FA 4JZKA 2QLJA 2AMVA 4TWBA 3N87A 1Z07A 4CU2A 1UOEA 5CB4B 3ASYA 2DWZB 1L3CA 3HDGA 1K2WA 3BZUA 3UYLA 1JQEA 5A0TA 1RQPA 2PK3A 1I2AA 4UMDA 1AGNA 2OCLA 2VRCA 4FHGA 4LBZA 3RAFC 3CWQA 4M1OA 1SQ6A 4CJ6A 1UL1X 1I5OA 1U99A 2Y68A 2QRHA 2WUWE 3GRVA 1HTWA 3GLSA 2IEZA 5HGXA 3SWWA 3C14C 1Q92A 4MUYA 4CMEC 1L7PA 5CRIA 4RHYA 5EJEA 5JFTA 4V3BA 3RFWA 2GUGA 3G2LA 3BGDA 4HVLA 4MQMA 1HR0B 1XLTA 1ABEA 3K2BA 3DPSA 4HWPA 4M37A 1NQOA 2ZDHA 1IVYA 1RVDA 1V5IA 2R4UA 4BATA 1A5SB 1XA3A 3ZC3A 1PYOA 2HEGA 3LY9A 1LSSA 4GPBA 3TQFA 2PRKA 2LCFA 2ISCA 1E4EA 4DV5M 3RS4A 2QRMA 1SBHA 3PWTA 3OG9A 1N9GB 3CF6R 4L72A 3HX3A 2BONA 4Z4HA 3CPJB 5AJVB 1QX4A 3I39X 3KWFA 3DFUA 2Q0QA 2GWRA 2HY7A 5AUNB 3ECSA 2BFPA 2HRCA 3S28A 3FR8A 2AZXA 1XMQB 3L3BA 2AN4A 3VVBA 4KQGA 4JNCA 5DM60 5AOAA 5I3CA 1WZCA 1PU2A 4G5HA 5JSUA 3DAGA 1GQYA 4QREA 4FE7A 2VK4A 3GIWA 3KJIA 5B1SA 1UF9A 1PRYA 4FIZA 3PQ5A 3AVYA 2JZCA 3Q5DA 4FT4A 4BC0A 5LKRA 1E2KA 2OA0A 4XIYA 2E4VA 1A72A 3HXTA 5K3AA 4B6SA 3RAEC 3KT6A 4UTZA 2B78A 3RODA 4B5LA 4B3TM 2WQZA 1E79A 4ENUA 5FWXB 3GP5A 5A1JA 2I2FA 1L4KA 5ALZA 3VPAA 1D09A 3UCXA 2EFDB 3TTXA 1BOOA 5HIIA 2JGNA 3BXZA 1YH3A 1YQXA 4MGIE 3X2SA 3S0JA 3K3PA 1Z2PX 1ZK2A 2HJHA 1OLUB 3KR2A 3ZWNA 1IOVA 4NL4H 5C1DA 3VU1A 4FYKA 5G0TA 5J63A 4CFYA 3RUIA 3W6ZA 1CY1A 4C6SA 2M1ZA 3CNEA 2HSGA 1NAHA 2QLLA 2P8JA 4F2PA 3NGLA 2N0SA 4B3RB 1UKCA 2X0IA 1EE8A 3VUFA 1MIOA 5FF9A 4MRMA 1P4AA 5CXQA 2BMFA 4HXGA 3SC3A 3CS3A 1YHNA 4PX2A 1CV2A 4TYWA 5DYYA 2P41A 4RKFA 1NA5A 3TLKA 5AM4A 2J3LA 2Q9UA 4EPYA 2A5FA 1T5OA 5KYKA 5DTEA 1N77A 2ZREA 3AMVA 1WLSA 1DC3A 1SAYA 4GZMA 4BVGA 4GI1A 3VBCA 4YONB 2F9LA 1VKJA 4TKMA 2DETA 1G7CA 4ZT2A 3DB1A 3FDXA 1GJRA 1NLZA 5F33A 4KXMA 2O20A 2KDLA 3WBFA 4P4TA 2JHFA 4NI5A 3BJIC 2J0UA 2EZUA 3OHSX 2FWPA 3W78A 4RQBA 5FIUA 3GRAA 4Y2XA 4GNKA 1G6HA 4KFRA 4JUDX 3TKAA 3GO4A 3OCYA 5ECYA 4GX0A 3F6EX 1HTBA 1J1UA 3RHZA 5ICGA 1B41A 2EARA 3W9YA 2H1RA 3OZXA 3R9IA 5DNYB 4UZEA 1Y80A 5ADHA 1V1MB 2IUSA 3U60A 4R1TA 1G17A 4OG2A 4M4SA 4E5UA 3M1LA 4DV0B 5IDVA 1IUNA 4MI9A 3GRUA 1CY4A 2CGEA 3PNQA 5JCZA 2NXJA 1WETA 1G8FA 4KSBA 3W4JA 2Y8EA 4TKVA 4MW0A 1JLLB 5EPOA 3L6RA 1G5HA 3TWLA 2X0DA 3HC7A 2GM4A 2AS0A 4YCJA 1OQAA 2QB5A 1KQPA 3R3XA 5EFOA 4BV2A 4C07A 3DC2A 2XTNA 9LDBA 2OCBA 3JR4A 3QXHA 4Z2YA 3PCTA 4ZOLF 3ILSA 4CMIB 3EXFB 3EDRA 5KVAA 4YP0A 1TC2A 3UFXB 3I64A 1V8BA 1OXTA 4KVAA 4BKUA 2DTDA 2O50A 3ZE7A 2ZTSA 1ZRHA 4BTVA 5K0NA 4R2IA 4F5EA 1PJ3A 1O6GA 1GA4A 2VK1A 1R0CA 3OD5A 4B7CA 3C8HA 4DBVO 3TG8A 3DDWA 3WV5A 4UAJA 1FMTA 2O6HA 3KSMA 5DXAA 3USCS 2JWSA 2IU6A 4PZ9A 4PHTA 3GEIA 4FMBB 1ZGGA 5BQ5A 1TMOA 2PA3A 4NWIA 3AM4A 5D00A 2R1VB 2FW1A 2X1MA 4GX5A 2PIAA 2YC2C 4E6EA 4B6JA 2D2IA 1F12A 3KQHA 3EPJA 1X2EA 4YRSA 3TYXA 1F6BA 4DQ0A 2BRUA 1XWFA 3IHKA 3ZV6A 4F86A 2V6FA 1VJ0A 5FNVB 4O2LA 2RONA 4Y18A 2NVWA 4PEVA 3RW9A 1M6EX 3EQZA 1H94A 1UP7A 2EJCA 3EEOA 1MJHA 3IMFA 3G1UA 1ZVJA 4O2BA 1L7NA 2ZYWX 2GRAA 1B16A 5EI5A 3WG9A 3EVGA 1QIFA 2CYAA 2YOFA 3QUSA 2ST1A 1KEEB 1W4BA 3L02A 3FD8A 2O57A 3PR1A 4O4LB 2Y0DA 1P45A 2FWMX 4U7PB 1UINA 4UAUA 3QXXA 4G1CA 3U6OA 3OCUA 1OPXA 4X90A 4RDIA 4O1HA 5SZJA 1Z0SA 2AJBA 2RGHA 2QMEA 4EHJA 3V2HA 2H63A 3CVXA 3KE8A 2GJAA 3D1JA 2WFMA 4WEOA 1K92A 2G0TA 2C00A 3H6GA 5CMLA 3RNOA 3S44A 4QRDA 1JHZA 3F97A 4K9PA 3DFZA 1QGYA 1AH2A 1ZVMA 1MN6A 1BQ3A 1B8OA 2IEAA 2P75A 4M0EA 2JLSA 3BWMA 4KMRA 1R2QA 3ZHUA 3RAJA 4CG3A 3MRXA 2ZJ8A 4AYWA 1Z06A 1QDUA 1H6BA 5JSFA 2C2KA 4LBVA 3KUKA 4NBLA 5EWJB 3NX4A 1RAEA 1DQZA 3OCWA 4R71A 2ZB3A 4HGZA 1CQWA 1MO2A 1UBEA 1MQAA 1VHJA 2ABWA 4D9JA 5LC1A 2B1GA 5TC4A 1XN1A 4RMHA 1RKVA 3DMRA 3KXIA 2W6OA 4HMQA 1K6MA 3O7MA 2A57A 2W6ZA 1JVSA 3X2EA 5ADWA 1TLTA 4D0LB 5C7YA 2DBYA 3K0SA 2P2CA 4DSAA 1N6HA 4OYHA 5C7IO 1SVWA 1P4JA 4J91A 4MYTA 3QPAA 1N5JA 3LMKA 3ZLBA 1ZIXA 1PJRA 1N0IA 3OPVA 4MO2A 5FBQB 4K6KA 2IP1A 5JRJA 4ZQBA 2HT1A 2I2AA 3J80S 3IMKA 2X9LA 2QVZX 3EWSA 3IUNA 4OI2A 4D79A 5I9BA 2LD4A 1OU0A 1NJSA 3ZTWA 3AJEA 4MDYA 2JLWA 2R18A 1HYHA 3F3KA 3N0TA 2VPIA 1LC0A 4QULA 1KQGA 1ZK1A 4MKFA 1O54A 4NTZA 4TS9A 1XZLA 1YR1A 2HLPA 2ZYTX 1WDKA 1OWPA 3PNSA 3DT8A 5FP0A 5HIKA 3PDIA 3GAAA 4JDPA 2G5CA 3KKQA 4EO4A 3GJ5A 3H5IA 1CUCA 4EFDA 2N1MA 2HCRA 3R74A 4PC6A 4HWRA 2FMUA 1ZJ4A 2I9KA 2VKTA 4M8IA 1VMDA 4RV4A 4L9WA 3SZ3A 4O5AA 4PW0A 2IHNA 3E4CA 5E2BA 4YJGA 3S1SA 5FJJA 2ZIXB 4Q3NA 2I8AA 4KWHA 1ZN7A 2RB5A 4Q9NA 4EI9A 5HIMA 2VO1A 1N9ZA 1ADFA 2C7PA 3SF0A 3A4YA 3V6LA 5CVCA 4RKYA 1QBKC 3T7CA 3NOQA 5FI0B 2ZRMA 3GLIB 4QYSA 3Q7TA 2W4QA 2RGAA 2YS6A 4HS4A 2IY8A 3PZBA 4C5CA 5AW0A 3KWMA 3F8WA 3MHVC 1D07A 3OQPA 3D5TA 1THZA 3KDSE 1A9OA 2YCBA 4V0RA 4KPUA 3FPSA 1KYYA 1RRPA 4A0GA 1FJHA 4U7FA 1EK2A 2E87A 3PL5A 3UAVA 2XX3A 1H2EA 4J7CA 2IBSA 2JI4A 4O6VA 2FSVA 4OLBA 1D4FA 1O03A 3UB2A 2PGJA 4E88A 5FEMA 1JUDA 4GHLA 3LQQA 1FQWA 2YV4A 1XCOA 2ZI4A 1JKIA 1QGED 3FDJA 2PSJA 3RR2A 2HHHB 2PCLA 4YMWA 3TL3A 1P4HA 3KU1A 3REFA 3SICE 5ITWA 1GPDG 1OASA 2GZ1A 4BRSA 5BPVA 4MUAA 3OZTA 3QUQA 3CIFA 5G4KA 5CW2A 3IDSA 3S7ZA 3E7PA 2MYPA 5JXIA 3TFWA 1PV4A 5DNCA 4TL7A 3ZQKA 4IJFA 4UD6A 4YAIA 3T5CA 2R7KA 4G0VA 4JJ7A 4QOZC 2ZJZA 1QFZA 4LY3A 3B2NA 1NN1A 2VCHA 3E9ZA 3QSGA 2OAEA 4IIEA 1X13A 1K7SN 2R2AA 3UMVA 1F5NA 3T3EA 1DFIA 1DDIA 4WFJA 4P7FA 4HLDA 3DPUA 1C4OA 1EAYA 2BGIA 4M49A 5F2EA 3SBXA 3WNQA 1BHO1 2AEEA 4ZGGA 1GDDA 1C9DB 4EAAA 3ITKA 1IN5A 2G1UA 5CLIA 3WYFA 4YRDA 4P32A 5ALPA 4NMLA 4RVFA 3ZK9A 5G40A 4ALLA 5BSHA 1AN0A 5EGSA 1K7YA 2YXLA 3TOSA 1L7AA 3TINA 5L7YA 1OYWA 2CNOA 1ZKDA 1U0FA 1TM7E 2H29A 4IIWA 4FFRA 1L5MA 1GLVA 4NBSA 2AUMA 3SXJA 4ZVRA 3T9CA 2W4MA 3TLZA 3WWZA 2FY8A 3HCBA 3P0RA 4RY2A 4WCFA 3UQYS 3BK2A 4JQOA 5A05A 3QE4A 2AUTA 3CMCO 2HDWA 2VQDA 1T2CA 2FKNA 1KJIA 1NVKA 3LVRE 2ADFA 1QX3A 3AT1A 4P7GA 2FPMA 1X39A 1KTVA 1MR3F 2VDKB 5LP6C 4DLYA 4TT8A 2AOUA 4TROA 1GPMA 2JZ0A 1GZ4A 4JI1B 1E2DA 2Q4RA 2FEXA 3OIGA 5CA1B 1PDVA 4WDRA 2OV8A 3LNTA 1TM2A 2X4GA 3QFRA 3FTFA 3DV0B 1E9RA 4UVGA 1JHYA 3PWKA 1BCRB 2FUKA 4LJSA 4WV3A 3R3WA 2OPFA 1J42A 1E3IA 3O91A 4CM6A 2RK6A 4BJHB 2WTUA 2G9NA 4N5LA 4P08A 1KVTA 3KWJA 3BULA 4UNSA 1V5WA 3IURA 2Z4RA 3ANXA 1XHLA 3OF5A 3RAGA 3N9IA 1R4AA 4FEYA 3KV1A 3QOXA 2RG7A 4ENRA 5C18A 2GERA 3A4VA 4DWOA 4PRKA 3TRFA 4ZPJA 3VJRA 3WGMA 1X0XA 4DR7B 3EHEA 1LV7A 4RJTA 4BNIA 5D87A 3AXSA 5IXJA 1Y6QA 3DTYA 2JHAA 1GUDA 3GPDG 2IHZA 3RPEA 2OBFA 3HKEA 4PZYA 3VDXA 1KHTA 4WRRA 4JOBA 3CN9A 1CF9A 4J0JA 5A02A 5KYYA 1XRNA 4D98A 4Y9SA 1GNSA 2FPOA 5HBRA 4BGDA 4I1VA 4MS3A 2VWQA 3KSAC 3Q7PA 4Z9YA 1G3QA 4RU1A 5CU7A 4RH0A 1I13A 3SQNA 1ANKA 3HYSA 3LRXA 1Z6PA 2ZUDA 1VLJA 2QQ5A 3HYNA 3F49S 3EPKA 9GPBA 3EIXA 3GWZA 1H3FA 5JC8A 4GPAA 4L5YA 1VG9B 1N2BA 4XVRA 2JHGA 1I24A 1R6UA 3PVSA 2XUZA 1TA9A 1Y7PA 2MU1A 7CATA 1C1YA 2CXRA 3U26A 5LMUM 2ZROA 4C5BA 3SJZA 3IP8A 3ZCTA 4EIWA 3TZKA 4EEZA 4DDVA 3U4AA 4HWKA 4CEJA 2CDBA 5FQOA 1J8MF 1DKNA 3RF6A 3GN2A 4CV2A 5HDBB 4YQZA 2ZLBA 3C24A 2Q8PA 2HJWA 5EWLA 5K3EA 1PZXA 1TVKA 2XGSA 1EINA 4CQJA 1M1YA 3O4HA 5KWSA 3PTZA 4OKIA 2R65A 3KK0A 4XYBA 4LDZA 2WP8J 2HNKA 4NCNA 2A92A 4ODIA 2BMJA 5AVYA 3VLFB 3KUDA 4MV4A 1UXHA 3R7DA 1M0WA 4R0MA 1AUAA 1TH4A 4H0CA 2DHYA 2IYPA 4Q37A 3TXAA 2H08A 3DULA 1VL2A 3H7AA 2OP1A 1OBFO 3ZHOA 2HRQA 5CJ2A 1GAWA 5EKTA 3MMXA 3ZQ6A 3U4QA 1COWD 4IUDS 3P9IA 4YRJA 1VFPA 4TX1A 4IDDA 2O54A 1J5XA 2X9VA 1ZKMA 2ZKIA 2XQJA 1KOFA 1ZJZA 5JIBA 2B36A 4NJOA 3PR3A 3GBVA 3UBMA 1P1FA 1UMBA 2CVZA 4OXRA 2J6CA 1SHTX 3ZJYA 3JVIA 2HKJA 1JKXA 3Q0TA 5EP1A 4PIVA 1XZJA 3DD5A 2JGMA 4X7BA 2L42A 2W8ZA 3CQ9A 2BGGA 5GOZA 1K8RA 4TV9B 5E6RB 4NE7A 2FFHA 3W79A 1PW7A 4QRHA 1T9HA 1G8AA 2Z4TA 3FZEA 1OAOC 2H5JA 1NYTA 5CGZA 3RI3A 1OH8A 1Z5AA 3GAMA 5IJAA 4PBTA 1SVSA 3VPDA 4YN3A 2ZFUA 4YV1A 3EW7A 1R66A 3HCNA 1NF9A 3OJFA 4MROA 3ZZ1A 3KDAA 4F06A 5F1KA 3UK2A 4BVAA 2RD2A 2NUTA 5LDDC 1NX6A 8ADHA 3RU7A 1JZQA 1ACMA 3GFRA 4M8KA 2JLYA 3V7UA 3L7AA 4J49A 3EVDA 3WNDA 5EZ6B 1RU3A 2WIFA 3HGIA 4BMNA 1VSVA 1EX1A 4MV0A 1B14A 1YAHA 3TI9A 2A0FA 2I29A 3G0GA 5ES3A 2EHJA 4O08A 1IYZA 3KG2A 2FF7A 3DOCA 1RS0A 3GCDA 2IPLA 1ZUNB 3E1KA 5IH3A 3FAZA 3T8YA 4I46A 2NAPA 4BNKA 4CIZA 2HF8A 2DVMA 2BBOA 1TPZA 4WK2B 3EFBA 4R1UA 5EQJB 1QHXA 3VI4B 5K03A 3DFFA 4PZUA 1G3MA 1JHOA 2QUHA 5AUOB 2UUCM 2D5LA 2WD8A 4Z5XA 1E99A 1PGJA 3JVUA 3P5BA 2QPAA 1QP0A 3JARA 5JASA 3AO0B 4J7UA 4BFZA 4C0QC 1GAEO 3OX1A 3DCNA 2NZ8A 5AJZA 1JEYB 2ZJ5A 2X4AA 4HS9A 3M4JA 2GN6A 3D54D 2W71A 3DL0A 5CP8A 3PGJA 2ZU6A 2HT6A 1C3OA 1U1DA 1COWA 1F0PA 1WCIB 1OWNA 4L57A 1SBTA 2Z8YA 4KR7A 2IVFA 3DTVA 1ZU5A 2PUFA 1Y9DA 1ZNQO 5HILA 1O2DA 3H2JA 2ILTA 2WJ3A 4QUGA 1JP7A 1YJCA 1YI0A 1Y7IA 2CNKA 1F60A 4JI5B 3URKA 3MMNA 4Y3UA 3TSCA 1XVLA 2HLHA 1UDXA 3S1LA 2ZVPX 2DX7A 4CYMA 1OE0A 3ZJ5A 4K6CA 1I2ZA 3G68A 5FI1B 3IIIA 3VPBA 1J99A 4YREA 4J0HA 1J9ZA 1FP6A 3ISVA 5K3BA 3UHPA 1V7PC 2FZVA 4D41A 4YRFA 1X7ZA 4DSNA 4ZEVA 1YD7A 4WZBE 2X2PA 1NR5A 1WJGA 3OECA 1VRCA 1PJJA 1BRTA 4L2IA 1PTKA 4OFXA 4MVCA 1K0FA 3UWPA 3VKHA 4WBNB 4HDOB 1SXHA 3U56A 4I8OA 3PFGA 3CKYA 3NBQA 3L0DA 4US1R 3IAEA 4GF5A 3NASA 1PZFA 5I01A 5EE0A 2HD4A 2C2BA 2WG1A 3S1AA 4IJQA 1P4GA 1MNAA 2VHJA 3H11A 4QD3A 3IQXA 5TVKA 1QPGA 2QTBA 4EG5A 4ROTA 2FYTA 2HQSA 4D5GA 3A98B 4X7RA 3ZE8A 3BAFA 3RIHA 3IJRA 1XAGA 1VJRA 2E5FA 3E18A 4XTRA 2V7PA 2WD9A 2GH1A 2EZ8A 1RLOA 3IPRA 3B74A 2P0EA 3I34X 4B7UA 3CX8A 3BD6A 5JS7A 4RTSA 3RKSA 3SS8A 4G5OA 3W68A 4IXWA 4BUZA 1XNHA 3WGKA 3VDRA 1IHXA 1M2GA 2D6FA 2IOHA 3VO2A 4EGSA 3DZDA 1OSNA 3V97A 1T0PA 1IBRA 2PHZA 4ZQEA 4IAOA 1UKBA 3HWSA 3KJXA 3TMAA 3ROFA 3MTBA 2DAEA 4RKEA 2XMCA 5JATA 5ALQA 5ARBA 1IXSA 1YCGA 2XY4A 1NF2A 4JI0M 3GO8A 1SM4A 3O73A 4JH0A 4FE3A 4OTZA 4FKMA 4GW3A 4J0GA 3H84A 4G37A 3ENQA 5JNVA 4N6OA 3FPKA 5EKXA 3E22A 1E18A 4MARA 2EEPA 4GRDA 3HXKA 4MKRA 3EZ6A 4N01A 1SCQA 3LCVB 2WSFF 4UKDA 4XEUA 1GPBA 2OECA 1KORA 2G0AA 2FOXA 5L4LA 3OURA 2ZSIA 4GQBA 1NQAO 3H1FA 1TH2A 1TFRA 2R6HA 3RC1A 3HBMA 3K05A 4I5FA 1K5PA 5C2JB 4WACA 4LK3A 2HPZA 1Q2XA 3MCUA 3L9XA 3KSBC 2IS6A 3N7TA 4MK4A 3SDSA 1NVGA 1EYZA 3BF7A 4N5IX 1E2IA 2CLSA 1FNBA 1WTAA 5T7BA 1T9BA 1UC9A 3AHGA 5U1PA 1PL8A 3OUZA 1RRCA 2D2EA 3KOWA 5H8WA 4EI8A 3NDIA 1R6AA 3LW5F 1GTRA 1NNUC 1N0UA 4M3NA 3HL0A 4A16A 5JCXA 1C7ZA 4LRXA 4BLOA 1N2SA 3RYTC 3KSUA 4JJAA 1XN4A 1L7DA 2PKEA 4HZUB 5A9RA 3TPZA 3QVGB 2B6HA 3GYBA 5CJPA 5CNIA 1V4BA 2BFAA 2RAFA 2X5KO 1RYZA 4MS4A 2CP8A 3UMCA 3AU8A 3LRPA 5FV7A 1YK1A 5CM8B 2Z5LA 1BA3A 1RTKA 1TUIA 2NWQA 4EZIA 3RUHA 5ITXE 3ANYB 2BBTA 5HG0A 4ENVA 2G9QA 4ZODA 3P94A 4IZOA 3H0CA 5TT1A 2Q2NA 3FD9A 1E5QA 1X70A 5IAKA 2AKEA 3JYQA 1QLWA 3GXOA 4WZBB 3KB8A 1S9DA 2I1WA 5DHQA 3J81S 4BO4A 5IM5A 3AY6A 2EERA 3HA3A 2YWHA 3WNZA 2XDQA 1PS9A 4KPGA 2ZTLA 4Q24A 1I7SB 1AUVA 5CLLA 3DE6X 3T7SA 4C22A 4LZNA 3DHNA 2GT1A 2JBAB 1IQPA 2WYUA 2PN1A 4UEKA 1WLYA 3NC4A 2XUKA 3AEYA 1FDIA 1YFKA 4XWOA 3FKJA 3GQ3A 2FCRA 4NE9A 2ZJ2A 1Z45A 2JGDB 4B3CA 5HJEA 4AG6A 3VMFA 2JAPA 3FTEA 3MQ2A 4OL9A 3IQGX 1DGQA 1GNQA 1UPXA 1GN8A 2YYAA 1V2HE 3BH7A 1KRXA 2BNKA 3VYTB 4DIKA 5IZCC 2ID7A 5F77A 1E2UA 4ZWNA 4HTFA 1MFZA 4N3NA 4OJNA 4ZD6A 1ZESA 5GP1A 1Z74A 4M53A 3ILHA 4ZOAA 1XA0A 1GPYA 1U63A 3DW3X 3PYLA 3KDPA 1XZAA 2YMQA 5DP1A 4YY3B 5L3QB 2FQQA 5F1YA 1VE6A 3DNPA 2J3KA 4UVDA 5E4FA 2NQ8C 3DFIA 2IKSA 3NATA 3F5SA 3R8XA 3AF3A 2IZ6A 1NJ6A 1G5FA 4L7VA 1MVLA 5I9SA 2LKCA 2BDTA 1C41A 3CLRC 1T25A 4O2AF 3RIYA 3GJXC 3EC7A 4F8YA 1F48A 3UAWA 3BMNA 3C15C 4LF6M 2WIJA 3M2TA 4WLNA 1QGAA 3N5KA 2EGHA 2L4FA 4B6PA 4D82A 5KYXB 4FSDA 1PI3A 2BFDA 3NIFB 5H0IA 2WZJA 1BVRA 3GP3A 1L5OA 2ODPA 1O5IA 4JLSA 4RF3A 5HMMA 4J94A 2PH7A 3AF2A 4MKZA 5CURA 3T7JA 3B1YA 4FBGA 1X7DA 4L0QA 2NTNA 4LWOA 3WA6A 2Q8NA 1S1CA 3IOBA 2PZJA 3WL7A 2EKBA 1IN8A 3T5MA 2ARKA 3HDQA 2Z3ZA 1W30A 2R1ZA 2O7SA 3ZHTA 1TAQA 3VYWA 3OKAA 3O8RA 3R7WA 2MH8A 1JHVA 1QONA 2Q29A 1Z5WA 2E4AA 4LBWA 2DQ4A 2W8BB 2R8XA 1TGVA 3NFRA 1OWLA 1E9FA 2X7HA 3OQIB 4GICA 1GTJ1 1OTYA 3HDVA 4EJ6A 3ET5A 4XQ9A 3VZBA 3OLCX 4LGYA 1PG5A 2LVOC 1K7CA 3SASA 3U40A 4I4LA 2ZE6A 4WIAA 4N82A 1LX6A 2WWXA 2Z04A 1ZY2A 4QQKA 5AYVA 3LUPA 1SNYA 4JS0A 4DM3A 1RFLA 3ABZA 4WK4B 1A9SA 2B5VA 4YI5A 3I6ZA 2O7NA 1RACA 3T1HM 3KUXA 5LBUA 5A03A 1QIGA 2IODA 2CUZA 3PFWO 4NXMM 1JAIA 1JE1A 2QLMA 2EKKA 3L6BA 1VGRA 2D8AA 4G41A 2HQOA 1TYBE 3B5EA 3T52A 3PUIA 2UVPA 1CY0A 3BHJA 5TEVA 2DFDA 3TNYA 2YY6A 1MW8X 3KKZA 3ND8A 4OXIA 1LI7A 1NBEA 1R9NA 2IX9A 2LIVA 3MOIA 1Q1GA 3LPDA 3T9EA 5EMMA 1NASA 3L4KA 2OHJA 2NU7A 2FPGB 2XDAA 1QH1B 3KB1A 4KTTE 3KE9A 2FXIA 2VA8A 4ON9A 1CY8A 1FLAA 3T7RA 5K99A 1N1GA 1H0SA 1LBHA 2P5UA 2JFGA 1AUOA 4DUZB 5K3CA 1HDOA 1CF4A 1L1TA 1WP9A 3K5IA 1RWNA 1KZ9A 4AN4A 1SIBE 1L5QA 5B6IA 1U2DC 5DYWA 1X7XA 2IUUA 5IC5A 5FBZA 1J4AA 2QU8A 5ED0A 2PJDA 1ULUA 1BXRA 2WP0A 4E5VA 4G6ZA 3CINA 3L0ZA 3VU0A 2PXCA 5GKNA 3AUUA 5AJYA 1OROA 1MKYA 5DXJA 2G4CA 3GPLA 3KB6A 1UMCB 4I3FA 2W00A 3GT7A 1AKTA 1SK8A 5B58C 2EFJA 1Z5GA 3NHFA 4E5NA 4QGAA 4FOPA 3BA6A 1GCIA 1HL3A 4G4QA 4KK4A 5HFJA 4UU0A 2GEUA 5DTIA 2QRVA 3OE4A 3JWJA 1BFDA 2OB2A 4B81A 3I2IA 4CT4B 3VNAA 3GFFA 2VRCD 3JXEA 3AM5A 4ZOLB 5I4CA 1XVAA 2WABA 5DN9A 1M75A 2DBVO 4P83A 4B87A 1ZD9A 1QRTA 3AUFA 3U17A 4MQEA 1G21B 2PMCA 4RF1A 1CR2A 3NYQA 1F6DA 4TZ6A 1VMAA 3G9XA 4GP9A 1CUHA 1X7HA 1Q14A 4RFSA 1P5RA 2OHXA 4G8CA 1ECPA 2QJWA 4IX9A 1R6DA 2ZI5A 2FKAA 1GTMA 5L95A 3DHEA 3Q8KA 2PGLA 2FEOA 1H22A 4CKWB 4BQSA 2FW9A 1Z5VA 3BGIA 2DPLA 5KAMA 1G5QA 3KEGA 1Q17A 2HZBA 2JGIA 4N3CA 2ODWA 3SLRA 2Q50A 3ZVRA 4MCJA 4BNUA 4RKRA 5C8DA 3AHJA 4XVCA 3ZG6A 2PYDA 5DNAA 1YB5A 3CTPA 2VDUE 1RWXA 2LTAA 3AWIA 4PYNA 4K9MA 5JLAA 4GGMX 1JN0A 3O6VA 4Y1RA 1WVIA 2VP2A 1JDZA 4BMZA 1E1MA 4MEAA 4XSVA 5CB8A 4DTIA 3CZ5A 1P0QA 1QGUA 1RRGA 1T0BA 2QVCA 3ZCQA 5GADl 2GS9A 4Z4EA 3D5QA 3OUUA 3RREA 3ZX4A 4B6OA 3HM9A 2ES4A 6Q21A 1I80A 1NJGA 4EENA 3I1FA 3NYIA 1FF9A 2PSHA 3DVAA 3UC9A 1KXJA 4FDMA 2HZ7A 3WIDA 4AZ0B 4QLAA 3NEYA 4COOA 5KYGA 2HRBA 4P2BA 5AHRA 4RDHA 1OYOA 2R0QC 2PBRA 3LUDA 3NJRA 2BFOA 5CB6A 4FYMA 3PFIA 1U7HA 1EI9A 2FPRA 5B37A 1EAMA 2JIRA 3KYBA 4ZDJA 3W6OA 3UIEA 3C0KA 5AMXA 1G291 1LJLA 4LMPA 1DAIA 4NQRA 5IT0A 2P3QA 4DR3B 4K28A 5JAQA 1QOZA 2J0VA 4DR1M 3IVGA 1QHNA 1I1QB 2OV2A 2HK6A 3DMHA 5D3QA 1YE9A 1CUAA 1AMNA 1UM8A 3O0DA 4LFAB 5T4FA 3KPUA 2AQ8A 5LP1A 1JA1A 4CMEA 3LKBA 1SUSA 2PWBA 1YZGA 2EFCB 3HRHA 1P6XA 1ZRNA 3U1BA 1U0HC 4QTUB 3OX3A 1SC9A 3T6PA 4U0JA 4JI7M 4G0OA 4BLVA 2UUAM 3SOZA 3BL6A 3MC1A 1LGYA 1Q3KA 5K0JA 1YDWA 4HEA1 3OQ6A 2A33A 1JWAB 2VHQA 3ZWXA 4DQDA 3K9QO 3I8SA 5EE3A 1JI3A 3WTBA 4IVPA 2BFCB 3HV2A 1JFLA 4UBIA 2QNRA 3I45A 4YP9A 3OF2A 4CGYB 4YJFA 5K4AA 1PL0A 1YK0A 1NULA 3BJMA 4ZVSA 2RHCA 4JGBA 2UZ1A 5F21A 3UMRA 1X38A 3CFYA 2W6MA 3E15A 3U5ZA 1OB2A 3MWEB 1IDN1 2PX5A 3HYTA 4BQPA 3FOEC 1A9YA 4CXMA 3LK7A 2C3OA 2EGGA 1E7YA 4EGCB 1AUQA 3HUDA 2GPAA 2QPTA 3WIBA 5ALFA 3B9PA 1Q0SA 3CWCA 1BFKA 3K9LA 4OHWA 1HQDA 2PLWA 1PNVA 4V39A 2VUUA 3AUKA 2NOAA 5AM0A 5AI4A 1VDDA 1NXVA 2WAXA 3QJYA 1NW4A 2CXHA 3DE2X 1D0IA 5HF8A 3TRDA 2XXAA 2WV7A 2A7QA 4G0NA 4RA9B 1OZFA 2WUEA 3RSZA 3ZHYA 5CDFE 4ZZ1A 4ZAXA 1R8YA 1L7RA 2MTBA 3W5SA 1SOMA 3H16A 3EGEA 3JX9A 4BZQA 1ZINA 1FYWA 1P2BA 2AFHE 2P6PA 4X41A 4EUFA 1DCFA 4FXOA 4NZ9A 1DWQA 5I7VA 3EA0A 2ASEA 2Q5JA 5JVDA 1VB3A 4DAOA 1X7WA 3A6GA 4R16A 3HUEA 3Q3EA 1MOZA 3L7YA 4F56A 1OXXK 4LMAA 2V65A 2GK3A 2V5UA 2XYGA 1JKJA 3DEIA 1PG0A 4RPHA 3MWKA 4RMJA 3R0ZA 3TL2A 1WDTA 1PGYA 3IJ5A 3HJHA 1VA4A 5JD3A 1O5TA 4DCUA 2GK7A 1SHLA 3RVBA 1U8EA 1ONPA 3G2HA 2DERA 4DGQA 3HTXA 3ZYZA 3ZW7A 5HM8A 4ND8A 5EC8A 4DIBA 1LWOA 3D4LA 2XKJE 2G8NA 4TMVA 3W90A 4Y1EA 3EY9A 1A2OA 3L1IA 1OBHA 1I0ZA 5G0SA 3W5IA 2QXUA 3F4KA 4X1OA 3W6NA 2E18A 1WIVA 5TGZA 5HUQA 4ARIA 1S6YA 2ZI3A 1SBNE 1YI8A 4QXRA 4NPAA 5CXUA 4NNPA 2GN9A 1ZMRA 2N47A 4RUKA 2Q1UA 3ZVLA 2DFVA 5JWHA 3IH5A 1RWVA 4RHUA 2R5FA 2WWRA 2NZJA 1EGMB 2JI7A 5F76A 1ORYB 3DEFA 5HS4A 4TSKA 2BW0A 4Q48A 3NYWA 4LXUA 1KO7A 3I23A 3EDQA 1JB0F 3SGLA 4ALMA 3MSXA 3B89A 1TT7A 4BLUA 1BMFA 5FPPA 4E14A 2FEKA 3ZU4A 2JCSA 3BWXA 5CBPB 4FFBA 4RANA 3G9QA 2COEA 2IZ7A 4JBIA 5BXQC 1Q21A 5I8WA 3NTQA 4XH9B 3HR4A 2MYTA 1SA0B 3LHIA 1H4TA 2VPPA 4XJSA 1GV1A 4BKPA 3W8FA 2OEPA 4LZJA 1FJGB 1A50B 3F7MA 1KO4A 5DYIA 3LU1A 2IFTA 1N6RA 5KQGA 4R1OA 4FOOA 1YR8A 4J3NA 4XGIA 3PRHA 3LLMA 5FBRB 4HN9A 4OMCA 4PYMA 4E5KA 5HJ7A 1L2BA 3N0VA 2P7IA 2QRNA 2OFOA 4FOTA 2NW6A 2NUBA 1UJBA 5E3IA 3IQDB 1RZUA 2GYYA 3GELA 2REQB 2ETVA 1QRAA 4WD3A 1C9NA 1ISSA 4WN3A 3EH2A 4PSKA 5CYOA 2O2IA 4AS3A 3GLIE 4FGUA 3PQDA 4LFCB 1W75A 3I32A 4RJIA 4DUYB 4NV1A 1SVOA 1P44A 2YMPA 2C8VA 4OD0A 2B8TA 3VNBA 3H2KA 1H66A 5KOHB 3I6YA 1QBGA 3BXWA 1JDPA 3B6IA 4FWBA 3B7PA 3ZHRA 4WUVA 2VIIA 2QRUA 5JD5A 1NG9A 3TL4X 1NUTA 4IIBA 3RRZA 4IRMA 2OAGA 4IGEA 1MPTA 3EIEA 4R8MA 4UCQA 4LJAA 2PV7A 1NW3A 3S2ZA 5EZSA 4CI0B 3AIKA 2AFHB 3A6HA 2X9NA 3WVNA 3FNIA 4MB7A 1FBTA 5DX8A 3G59A 3F3MA 3IFSA 2BC9A 3ZXUB 2O1SA 2XMSA 4ZJPA 2GHRA 4JY7A 1RI3A 2YWEA 5DZSA 4WPGA 4KPFC 3CRW1 1DEKA 3N86A 1HETA 1LPSA 3F4BA 3FETA 3FVQA 4JSYA 4YO8A 4RA6B 2WA1A 5EJIA 3L4JA 2FK7A 1NRJB 2RC6A 1ODFA 3F1KA 1ZAKA 2WE8A 4FN4A 2CL6X 3ZDBA 3THWB 2BMDA 2OO7A 3JW8A 3D7RA 3UJAA 3S27A 3NJ4A 5AHWA 5A3VA 3E4DA 2NN3C 4AYTA 3H75A 2B30A 4OI4A 1ISRA 1CUJA 1CX9B 2C4WA 3I1IA 1ML3A 1DIHA 3LE8A 4OJKA 1K6XA 3B7GA 3ORFA 2V58A 3D6FA 5IVHA 1OFHA 2FMHA 2WPNA 4XX0A 2VJYA 1E2EA 4S2EA 4XSHA 1GGEA 4ZQIA 2HHCA 2IWHA 2QTMA 1AIPC 3MTIA 1O0CA 4JXZA 5AW1A 4HLCA 1NF3A 3RS7A 1LDNA 3MBOA 3H18A 1QTIA 3HLKA 1TU4A 3QEJA 4C4OA 2FWIA 2OB1A 2ZTDA 1ULTA 4KPYA 5AKJA 5KO2A 2GAJA 4KOAA 2IV2X 3A1FA 1P1KA 4DIOA 4UAGA 2WSCF 4K9OA 1TTQB 1UWCA 1NMXA 3NHZA 1Q6ZA 4G36A 2DR3A 2CFSA 3C97A 1PF7E 3EW9A 3DDNA 4Q7JB 1E9SA 4AQ7A 3KSDO 2PLNA 1GGFA 3ZIAD 3HUUA 4PLVA 1CE8A 4P9NA 3K6JA 3NNNA 4RNCA 5EJFA 1QFJA 4RY8A 5A4JA 1SQFA 1NVDA 1L1FA 3DA1A 5T4EA 1O7JA 4JMLA 1DKOA 5JY6A 3A45A 2DKOA 3U6PA 3LK6A 2ZULA 4JIGA 1HYQA 1JFRA 5KOJA 3BVPA 3UK6A 3P96A 4WI1A 3OZUA 5BN3B 4B08A 1V3TA 3C16C 4HYQA 3VISA 2FXVA 2LDBA 3PC3A 1WIWA 5EHNA 3LWBA 2D8MA 4L5BA 4TZTA 1N1MA 2KRKA 2IYNA 1JIQA 1GCAA 3DZJA 2AG8A 3TN7A 3NXSA 4WK6A 3JAWA 1GFZA 3F9RA 3ZLTA 2FP3A 3L4SO 2KI5A 1YACA 2IEDA 2R6JA 4M9ZA 4LMRA 1DSSG 3FRHA 3QEOA 1XMIA 2WNSA 3GDGA 4XGKA 5BUQA 5EJAA 1P1HA 3DUWA 5DBGA 1USIA 4P82A 2GEDA 1BE8A 2W2KA 4CL8A 4WASA 3TKLA 2F62A 3CGWA 2F1KA 2DY1A 5DRYA 2R46A 3N5CA 2XPCA 1LNSA 5JPCA 4DCJA 4F3RA 3O84A 1KH1A 2XT6A 3WAKA 1VKZA 1C9KA 1O97C 4ZMBA 1SCUB 2XVAA 1AO0A 1KFBB 1D03A 3ZY3A 1HTTA 3DBLB 2E3JA 1AB6A 4H18A 1EB8A 1DINA 1NVWQ 2ZP1A 3E8SA 2JAWA 2JS7A 5CFQA 4RIHA 2Z1DA 5CH8A 3ZJUA 1FQKA 2FW7A 1JAXA 5LB4A 2B4YA 2P68A 3C87A 3GFPA 4WL0A 1H1DA 1OLSB 3F90A 5J4VA 4Q3AA 3N28A 4FXPA 4CPDA 1MOSA 5LQAA 4IG9A 1U3DA 1XQ1A 3PHLA 3ZIAA 4EG4A 4O1IA 2X5JO 4UU1A 1BXGB 2OXIA 4DE5A 1X92A 2C8JA 1I9CA 5L3SA 3ZXIA 3CM0A 2HUNA 1NJ5A 5KTTA 2WTEA 4I8DA 3UHOA 2VPQA 4L02A 1AXGA 3FKQA 5BNZA 3U19A 2L7IA 1MX0A 1CHNA 3DZIA 4HADA 6REQB 3HXPA 1TRKA 3WAGA 3R0JA 4KRFA 2B3TA 4CM4B 4HNVA 2VBFA 3FWPA 4AXBA 2JZNA 2AMFA 3IP1A 1IEXA 4N9QA 2PKYX 2P5TB 2FSPA 3HP7A 1B6SA 2XCUA 1BXKA 3MJCA 5LVAA 5T3YA 4IOKA 5JAIA 2SBTA 4GLOA 3I12A 1RJGA 1VPDA 1K75A 1ZCBA 3QQPA 3W5BA 2Q0HA 2A3RA 3KEOA 4KPEC 1PP4A 4DILA 4KQEA 2GRJA 4UCXA 3GH1A 5LZ7A 3H17A 1C8KA 2BTEA 1C1DA 5H1YA 2X41A 3ADOA 1T34A 4GE3A 3ABQB 1ZJ5A 3QU2A 3T1YB 2V3CC 1KYZA 4YEDA 3U1VA 2C5RA 5LP6A 4ZQHA 1H9CA 1HL7A 2HCBA 3GZNA 5L45A 3QELB 4EHIA 3QTBA 1PR1A 2ZSAA 4FYXA 2Z8YM 1SVIA 1J97A 1I5EA 5H68A 3HUTA 1E1RD 1WUKS 1N2XA 4R98A 1IY9A 3KUUA 2O23A 4PVCA 5A3JA 2G71A 1L5FA 2O2GA 4A8HA 2E4XA 4EOGA 5LFAA 2ADMA 4RJKA 4C03A 2O3UA 4N65A 1X1CA 3N2GB 3AB8A 3P2JA 2A9RA 3A9VA 4RJ2A 5JJ5A 1D04A 4LF8B 3E82A 4N0PA 2LV8A 1S96A 3I92A 1CR6A 3FMPB 2PE5A 3M4XA 1RBZA 4RX1A 3ROTA 2PT7A 1KPHA 3EXG2 2WQ7A 1EE1A 1BH2A 1KR5A 1GZDA 5CIYA 5HK9A 3LECA 1Z2EA 2Y1FA 1RZVA 3OIYA 3KETA 5BQXA 2IS1A 4MMXB 3W5JA 3CPSA 3ETDA 3QKRA 4B82A 1EG2A 3ETHA 2OHVA 4OLAA 1QQ7A 4JXKA 3JWPA 3PVZA 4AJKA 3L2OB 1I6MA 2FPPB 2H17A 3KL4A 2YHBA 1YUBA 4O2RA 1XZQA 4HFJA 2BM1A 2HM7A 1KZYC 3LL7A 1WXDA 1T6OA 4L75A 5K0TA 3LQRA 3RSLA 1UPCA 3GFQA 5K0ZA 5CM2Z 2EFEB 3GZ4A 4ABYA 4P7JA 4JT9A 5DV9A 4UUQA 2XQGA 2VXYA 4NX2A 1JG7A 2RAPA 1JNYA 1PT9A 1QS0A 2A1UB 2Q07A 2EQ5A 2ZPTX 2HQBA 4ARZB 3N8HA 1SCJA 3E9MA 1JDBB 4YNBA 4BFXA 4CLOA 1XUOA 2QMUA 2CL7X 1H6DA 3CX6A 3ABRB 2HBRA 3CIOA 4A2QA 4NJMA 5FTKA 3OSZA 2NVUB 1APBA 1RRMA 2Q3LA 5LUAA 1LDBA 1VL5A 1KJZA 1EXVA 1E1RA 3VNRA 3THYB 3GGOA 3R2JA 4HYYA 3OBBA 1F8YA 4QWMA 1E8MA 1P80A 1SUDA 2XZLA 2QIPA 3GLHB 3OHMA 3LQ4A 4J6FA 3E3LA 1YOVB 4ZP1A 3DTVD 1UC4B 1N6KA 1T5LA 3AOEC 1F9EA 1F38A 3EG9B 2J6HA 4ZALA 4ZU1X 2P4SA 2JKYA 3JZFA 2WU4A 3KEQA 3CRRA 4C3UA 2JA1A 1XZFA 3D81A 3JQ7A 2QMOA 4K2AA 1JQLB 3CEAA 3S5UA 2DZOB 5FQNA 3K31A 4BQFA 4ZMSA 4QC2A 4UJ3A 2A9VA 3HH8A 4IDGA 2BCJQ 2PUTA 1ZD5A 3I01A 3LDGA 1DJQA 2R2GA 3DUFB 3EZGA 2D62A 4XSGA 1UWKA 4BFSA 4G0YA 3CVYA 3DEYX 3II6X 3SAWA 3TTYA 4F9GA 3QVUA 2UUPA 5HF9A 4TGLA 3F4LA 2NO7A 3G7SA 2KNVA 1XRSB 1CIVA 1ZZGA 1RLUA 1W4RA 1M2JA 2C20A 1OAOA 1Q0PA 1U7ZA 4M1MA 1BDIA 4G0UA 5LJIA 4A7PA 3D3EA 3PFBA 2I1VB 2XMGA 3QE2A 1T1JA 1Z56C 2RARA 3H9EO 1XTZA 1O6ZA 3R0XA 5KPDA 3WLSA 4BMXA 3VYRB 3L43A 4IBOA 1DCTA 2EIXA 2GESA 1G3UA 1YULA 1S4MA 3VNVA 2F17A 4B40A 3WHKA 1QOQB 2YVLA 4BNMA 5JNSA 2IQIA 2FPKA 3G8DA 1C9JA 4ECAA 4TTPA 1UAAA 2ZIEA 5A4KA 4JL8A 3HMKA 1ESEA 4WURA 3RC7A 4KUGA 4H7EA 1XNRB 2RK4A 2UYCA 4EJ2A 4TXNA 2A1TR 1WBBA 4JD5A 4O2AB 1MTZA 4GOMD 4RK4A 5IYZF 4MQ4A 3ABOB 2FAXA 1NO1A 3G49A 4N41A 4TLDA 3VGJA 3TMYA 2Z58A 5LWQA 1CERA 3SVZA 3BZBA 3DR5A 3PF8A 2F2TA 4TXLA 2ECOA 1XOIA 1XCLA 4NE2A 3PDJA 1Z63A 3AVWA 4AG5A 5JT1A 1NUSA 5HWSA 3K7EA 5PGMA 5D3MA 1A9XB 4WXMA 4L22A 3NRCA 2XUOA 2J4FA 4AUKA 3SHTA 2NXNA 1DPFA 3IV7A 4BE7B 2IYVA 1E9EA 5REQB 1T4CB 3BWDD 2H48A 1OKSA 1GRQA 4MGIR 1GITA 3OPMA 1X1RA 4D97A 2IV3A 1GHTA 4PFQA 3PEEA 4OIFA 3BRQA 2G08A 1GSOA 1KAGA 3P2IA 4QSHA 1Z0AA 2WZBA 2J0EA 2EKLA 1GAQA 5KPTA 1M6VA 3W7BA 5AESA 2DUJA 4LYHA 4PZAA 3DW1X 1GVNA 3X1WA 1E5DA 3RSGA 1II9A 4Q0MA 1M7BA 2GQ0A 1ZRSA 3UWMA 5FYQA 1EWVA 1IDOA 4TQGA 4TUYF 4Q4HA 3AOGA 1V43A 5L6MB 5FRDA 4G81A 721PA 4X66M 3GV0A 3FFBA 4DRXB 3VZDA 3M5CA 2E4UA 4I5IA 4W63A 4X65M 3DLIA 2XYHA 1JALA 3FNBA 4G9EA 3V55A 3UHJA 1J25A 2W43A 5AKXA 1DQRA 3HV0A 3K72B 4RE5A 4HNUA 1LTMA 4C3OB 4HY3A 1ODKA 4CZ2A 1QZXA 4EW1A 3VOBA 4N7BA 5BVHA 1KDVA 1I10A 2FH5B 5J23A 2DM6A 2PVSA 1WSWA 4TTSA 5KU1A 4TS4A 2BEJA 4PLWA 1UT5A 3L01A 2HF2A 4AUNA 2CLDX 1U1EA 5EYPB 3SHQA 2VP4A 2PMFA 3F8TA 4NP6A 4M2LA 4OV6B 2AB0A 1AXRA 3WQQA 2ZUCA 4MGZE 2GAIA 4GI2A 4Y30A 5ALJA 2QM8A 4IYJA 5LQRA 1ZH4A 3FPAA 1D8AA 5ERXA 5SY6A 5CM9C 1V6SA 4KX3A 1BD3A 1H5UA 1JLHA 2GX6A 2QG9A 4HGNA 2VL7A 4UTNA 1WE2A 2ORIA 1XHEA 2J3EA 2Q62A 2Z2XA 3R8CA 4C87A 3H3XA 4MVJI 1OZGA 4EI7A 1T9KA 2LCIA 4GVXA 2C7QA 1NR1A 1GL3A 3IIJA 2J6BA 2P3OA 3I5MA 4JSRA 4ETIA 1U7DA 2VP9A 1KJWA 4GPD1 1UUFA 2G83A 4IWXA 4NBKA 3D7LA 2NAFA 3A58B 5TJ9A 2EP7A 2P62A 3C70A 5K0EA 3SNKA 1YHYA 1RHUA 3TO5A 3PRKE 1M1NA 3HWWA 2FMTA 3DD1A 5F5LA 2C4UA 1R74A 4OU5A 4GOLD 3JALB 5JJLA 1I33A 2AFVA 2LNDA 3RFVA 3TPFA 3OF3A 2VOJA 1PVVA 1ZITA 4L4SA 1LK5A 1G19A 2ACKA 5E8RA 2BGTA 4AYXA 3ORQA 1ISHA 2KYRA 1G9XA 3FUWA 3CVVA 3V4RA 1YMQA 4MQ5A 2C83A 1CU1A 4G23A 1W93A 2HAKA 4JV5M 3SATA 4HEA6 3FBTA 1YBMA 2GDJA 2GJKA 3NFYA 1Q1NA 4KBFA 2I34A 2Y99A 1DEAA 1ISFA 4LJ7A 5K8IA 2M6RA 1NNUA 2IYRA 2XNDD 5LLDA 3IHTA 2DUMA 3OA2A 5AI0A 4GUDA 2Y1CA 5D2CA 5ARDA 3CEPB 3CLRD 1AQIA 4DMRA 5AKYA 5KSPA 1ATIA 1HE2A 3RDPA 1II8A 5EXDA 3L0YA 5AI6A 2OZKA 3TQIA 2BFWA 4RACA 4IZ6A 4OM8A 4WWHA 2XRFA 4YT2A 3EVNA 2CB0A 4W8HA 2AZMA 5L4SA 4K3UA 4CKZA 3KOYE 4WECA 3KP0E 1TJPB 3FM9A 2Z09A 3Q8WA 3TFOA 5HZGA 1KS9A 2ZJOA 2QN6A 4EGQA 3ESYA 4BQOA 3CEJA 4R3NA 4RK6A 1Z34A 4JC4A 1N5OX 5E2AA 3DE0X 1JR4A 2F1JA 4D4KA 5JMPA 3ROGA 3TLAA 3JD3A 4QT0A 8ABPA 4EF5A 3U3ZA 4DRZA 4NEQA 3R77A 4J43A 1LK0A 1VI5A 2OGUA 4QOIA 2IYOA 3VM6A 1YE3A 3IHPA 5I7AA 4J3JA 5AVUA 3FLBA 2HA6A 5CCEA 3V8MA 2FPXA 3LOUA 4MVXA 1EM8A 1DG3A 4B2LA 3C3JA 1PEYA 3NC0C 4EITA 4RZ2A 4X64M 2NV0A 2H3HA 2HF7A 4ER0A 3DLTA 1AHNA 3QVJA 1PIWA 1IJKA 4E5DA 1ZMBA 3WL6A 3C6MA 1O9HA 3RU9A 3HN6A 2OD7A 2FZGA 1W48A 4II2A 4CDNA 2G8LA 1FRVA 1WKBA 5JCPA 3ZEIA 2ZYGA 3U7JA 5IZCA 1W87A 1A69A 4RESA 1JHMA 3MXOA 2PBLA 2P77A 2VXBA 5F23A 4UFOA 5LB2A 4K8OA 5AKGA 1THGA 2DQSA 4KQIA 4IIJA 5A7FA 5K7SA 1G21E 1KQNA 5G0WA 4BFTA 4N4AA 2JZOA 1QR6A 4IMJB 3GF4A 4I81A 2NQ8A 1XQVA 4AQYM 2D2FA 4CKBB 3MGKA 3WK9A 2XNDA 3DGEC 2CJWA 1UM9A 4Q21A 3ELUA 4KXUA 3ZBUA 5IPFA 1NPTO 4PQRA 4D3FA 3HGTA 5H9WA 3STWA 2B5OA 3HU5A 2DAIA 4MUGA 3OA0A 1R8XA 1YSYA 2VR1A 3W04A 1Y9JA 2IHYA 3PNYA 2DG2A 2OG1A 1DKPA 1KJ8A 4PYIA 2IS2A 2H92A 2J3HA 4HJRA 3VRHA 2PY6A 4PFKA 3EMDA 3B9BA 2CLEB 3Q3HA 5FX2A 2UVDA 2QZPA 4BYGA 5JH7A 4Z3OA 4D25A 3PDWA 4LDAA 1NVVQ 2GUWA 3K2LA 2MINB 4D99A 1GCOA 3FLEA 5CFPA 1X7GA 3WYDA 4QEKA 1PK7A 1NOJA 2XCTB 5JXHA 4R51A 1QYDA 4NMXB 4XX1A 4Y7CA 3ETJA 3QA3E 2ZUEA 4B84A 3HCAA 5FOWA 2CMHA 4G89A 5EIOA 3VTKA 4RHFA 3OKPA 3SM9A 4QYTA 3WWCA 3BTOA 3FROA 3R5TA 2C9BA 2Q3EA 3OC6A 5EP2A 2Q0XA 5DP2A 3SXUB 2JNHA 1RIIA 3ONFA 3ADKA 5JQGA 4H27A 1KI6A 3P9KA 3UJ9A 3B6KA 1F8GA 2SKEA 4OATA 3KLOA 7REQB 2KBEA 1MHTA 4AIIA 2MJ5B 3C8UA 4RMNA 2PVCA 1DAMA 3NH6A 1OVMA 3RTAA 1UAYA 1ECFA 5BSGA 2WT9A 3HDTA 3K0BA 5E1MA 4HDQB 1TJNA 2OD2A 3QYFA 2LHGA 3EZ2A 1LB1B 1EUDA 5E4TA 5GY7A 3M5PA 1B8NA 2B83A 3GFOA 4PNHA 2BP7B 1PZNA 1VHQA 3W77A 1OXSC 1J23A 4WTOA 4CMKA 4ALIA 4G9BA 3GJ3A 4QDZA 5F73A 1Y81A 2BMVA 2A0YA 4BQQA 4NSNA 3V76A 4CTOA 5INTA 5EINA 1HEIA 3HZRA 3UCFA 5LOVF 2ZITA 4XPIA 1FTGA 3PYXA 2XMQA 5KVQA 1XVUA 4KJXA 4FMPA 4M9RA 3W4IA 1FRFS 1AUPA 2J7OA 4PCAA 3IUYA 4LRTB 3H2IA 3KO8A 1DL5A 1XVIA 1K98A 3FZNA 1U2DA 2JRLA 1P7PA 1SHJA 1M74A 1RC1A 2VNKA 1IPEA 1DC7A 2F59A 3H04A 3N07A 1TA4A 3WMXA 5HKKA 2A9FA 2IHUA 5FCDA 5JEEA 4JL5A 4XEHA 1MO3A 4F7WA 1XZCA 5JNLA 1P9WA 5ALXA 3QMPA 1JDUA 4DLXA 4PX3A 2P7HA 1VPVA 1MXHA 3FWKA 4M83A 2HF9A 4Q05A 4NAHA 1QHHA 4UM7A 3JATB 1YBFA 4DG5A 4G09A 2I7NA 2QN8A 4A15A 4MWGA 4ZQCB 3TIIA 5I6DA 3EZ9A 3TIGA 3FPFA 3A6LA 1FTNA 2AG0A 1VGVA 4Q3EA 4AN0A 5M5BA 4OHCA 3OPXA 2D5IA 4PYOA 4AURA 2QZ4A 4MCIA 4BVEA 2WM2A 4JR2A 3OM8A 1Z38A 9ATCA 3ENZA 2D1SA 2A9OA 1E6EA 1QYXA 2WKRA 3R0IA 2HRRA 5EIWA 4V0LA 5JDCC 1PCXA 2FEWB 3DFKA 2N46A 4C88A 3AV3A 2B8EA 4E5PA 2FW8A 3OHPA 3QPBA 4M76B 2IQ5A 3CSUA 3WOVA 4EVIA 5E6JA 4PHGA 1WR8A 4MJXA 1J2RA 5KI6A 4AJOA 4YDHB 1P77A 4Y8VA 5A4DA 2I4TA 5LD2C 2W2LD 2MSNA 3TJZA 3EIFA 4ZO4A 3ICVA 2JH3A 1R8QA 1OIPA 2D7GA 3L5KA 3N2KA 4ZYLA 1TRHA 2XKKA 5CCDA 3WLTA 3KZVA 3M89A 1SD2A 1BN6A 3OCZA 1UJ5A 4NBWA 1H6AA 5IKOA 1SU6A 3GHYA 4CLEA 3W8RA 3RBZA 1IBCA 1P18A 4M46A 2R1UA 1F5SA 2YIJA 4F9FA 3A3YA 4NJEA 2XF8A 3IT1A 2PEYA 3TAUA 4DMUB 4IH4A 3AUTA 4HNGA 3ZTYA 3GK3A 4J1QA 3DSRA 3VR0A 3ST7A 1HSZA 3QPUA 1E4YA 4RHTA 3VA7A 1K5HA 5I9MA 1OXUA 4WJZA 2A59A 1XROA 4IRXA 1V7ZA 2H2HA 3DDSA 2EG9A 3RRBA 2GPSA 2HXGA 3B82A 1WQ1R 1XF1A 2A5JA 2C5FA 2C61A 4PG5A 3M6XA 3UW3A 2DFTA 1JXMA 1E2GA 3BB3A 2L7HA 3OSUA 4B4WA 1UKVY 4BO8A 4EQZA 3TDKA 3D3WB 1ORVA 1M2NA 1USKA 3CXRA 3RYHB 1NJFA 3AR8A 3G9ZA 3KM0A 2HIGA 4L6V6 4P98A 2AEFA 4S0XA 4JP8A 2VHYA 3S2IA 5FAKA 1Y8CA 1XPUA 4IO0A 3LF1A 4KXQA 2IPOA 3D8BA 4OI0A 1QANA 3LP8A 5BUCA 3SBDA 3QWBA 3GX1A 2YRWA 2GYUA 1F7VA 3ZDFA 4URXR 3D6HA 2CVOA 3G1WA 2AG1A 1P5FA 2O52A 1USVA 4J2TA 1MFPA 3CJQA 2AX3A 1GNLA 4UQLA 1N6NA 2HBZA 2W2LA 4L6CA 4QFMA 1OI3A 1SCDA 5K1ZA 4UNNA 5LPNA 4OHPA 1L7MA 1LW7A 3AQIA 1P2SA 2QTAA 3TEFA 4TS3A 4O0LA 4PHFA 4NV3A 4GH5A 4U7JA 1B73A 3C1UA 2ONZA 5B2FA 3OT4A 3KFXA 4F5YA 1VMKA 3WLMA 4PLPA 5D5QA 3OZCA 3HVIA 4NCBA 2A8YA 1JBEA 2C8KA 4R8LA 1XJWA 4NEGA 1VL0A 3NBXX 3KPWA 2HV8A 2VUTA 1ILEA 2G82A 2VHXA 3RFTA 4XQ0A 3PFNA 3PWZA 1D1QA 1UBSB 3DPIA 1D6MA 1OFUX 1D0LA 1F4PA 2WJIA 3CV3A 1O1YA 1EHYA 4TVKA 5FOSA 1AF4A 3AC0A 1YQEA 4IP0A 1NW9B 2F1OA 4JNKA 1BVYF 4G8JA 1BMFD 2WZCA 4RY9A 4AJPA 1L4YA 1PJ8A 4EY7A 4CR8A 1ODJA 3MAAC 4ENTA 4OU4A 1UZNA 4OMUA 5ICCA 2OZLB 1P4RA 2IPNA 4TN5A 3CBGA 4H7PA 3TQRA 3M9LA 4ABTA 3TVTA 4S12A 3FJYA 1V7QA 4UBLA 1RR6A 4KP7A 2BT4A 1QYIA 3HFSA 3A2LA 3V9PA 3EBPA 2QX7A 5DHFA 2LBPA 1RJ9A 1ENYA 3Q87B 5TF0A 2QS9A 3VPXA 2NO6A 3OTHA 1V41E 3KPJA 2N42A 1T36B 1ZONA 1IATA 1WXIA 7MHTA 3KR1A 3IEKA 3IE2A 4QPCA 5IEJA 3X2FA 3BM5A 3HYRA 4C0BA 1XA4A 1YDHA 1U5CA 3MOGA 4D44A 1H23A 2WM8A 3FMGA 4QO7A 3SX4A 4Y9TA 1J39A 1FK8A 4Q6WA 5DT9A 4HB2A 5AHXA 2AR0A 5DASA 4K6FA 2OHGA 4HRYA 1NOKA 4DEVA 2YZ2A 1BE6A 1HZZC 1U1FA 2GXAA 1XDSA 4IIDA 2ID4A 4TTRA 4Y98A 1ZCAA 1RWOA 3OEWA 4QODA 3RU3A 4ZREA 5C3UA 1OJ7A 2CD9A 3M6UA 1QRDA 1U3FA 2JFFA 4I19A 1UBTS 1VG5A 4CMBA 1MAVA 4M1QA 8GPBA 4CG1A 1A8UA 3UH0A 1Y0BA 4P4UA 4G2NA 4BO9A 2J9FA 1SCKA 4F4DA 1H0HA 5LYJA 1DGFA 2H9YA 2F64A 4TLEA 4FI3F 1T3SA 4LXYA 4FOSA 1NW8A 3T4XA 3PC2A 1Q77A 4HNSA 2VT2A 2G28A 3BS4A 6GPBA 2IZ5A 2X42A 3KVNA 3D0RA 4J76A 4IHJF 3EOBI 1YA8A 4PBRA 3GL9A 3ZCVA 3IC5A 4HNAB 2AE2A 3ZWOA 2CVHA 3WAJA 3Q8LA 4CU5A 4EG7A 1N0HA 4LPKA 4CT5A 3KZOA 1B3RA 1HDCA 2ATVA 1U0NA 2LNHC 3W8NA 2E4ZA 4ZA2A 3FNEA 4C4SA 3IBSA 4YAWA 2M6SA 2ZJ7A 4YECA 5JBNA 2LZ0A 4W9RA 3KKMA 4O29A 5JG7A 2WSEF 4FR2A 4KU4A 3RTGA 2Q9AA 3VSBA 2AZDA 1D5CA 2QROA 1HUQA 3D7KA 4A82A 1PZMA 4QRIA 4RNDB 5EJ2A 1PG2A 5FA5A 5BW5A 4OO3A 4PG6A 2Q1WA 1SXJB 3VKGA 2OMKA 2CMDA 1QHIA 4KVFA 1YRHA 5DLDA 4L3OA 2JY8A 2OV4A 3WR5A 3P2MA 4IL5A 3WBJA 1ZN9A 1JJBA 2XNCA 2O7VA 1KI4A 4EJMA 1UDBA 3N8DA 4HXYA 2BM8A 2QX4A 1PVOA 3AF6A 2AIRA 1HMPA 3DMFA 3EMBA 2VYQA 2QTHA 1YR3A 2RMKA 1T9ZA 2AVNA 3O9MA 2WWVD 3D64A 4KLAA 4R8SA 2H00A 3UENA 1QH9A 4LZAA 5COBA 3UPTA 2VRBA 4LIPD 2IYZA 4UM9D 4H3KB 2DECA 4RULA 4A03A 5ALEA 3R44A 5TMBA 3H0EA 3IDFA 3G0HA 4IPTA 3FCUB 3INNA 1W2HA 2OUKA 2O8FA 3SBOA 1CUYA 4YIHA 1T5HX 4PQFA 3AYZB 2F43A 3H1TA 5KWVA 2HJGA 3JR7A 4RF0A 4Q93A 3RYCB 4CW7A 4FW8A 3AJIB 2JY7A 1VPEA 4KIJA 2AW3A </