4OX9M

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ox9M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ox9M02
4JV5M 1Z5BA 1J5EM 3U6CA 1HR0M 4PD2A 4DV1M 1MU5A 2F4VM 4X64M 3U6EA 3SAVA 2EA0A 1PJJA 2UUAM 4DR2M 4MB7A 3J81S 3J80S 4AQYM 4LF4M 2UXCM 4DV7M 1K3WA 4JI3M 4JI4M 1IBMM 2OPFA 3SAUA 4JI8M 3GP1A 3U6LA 1HNZM 1KFVA 1Z5CA 2F5QA 4PCZA 3U6QA 4LF9M 4DR7M 1N32M 3A46A 3GPYA 1L2BA 4LF5M 1I94M 3VK7A 4X62M 4NXNM 4JI6M 4DR6M 2ZM6M 1MX0A 3JR5A 3SATA 4DV5M 3U6MA 3GPXA 4JI2M 1TDZA 2UUBM 4K0KM 1Z5AA 4YY3M 1XMQM 4DV4M 3T1YM 2HHHM 2VQFM 1L2DA 5ITXA 5IT9S 4YHHM 3JAMS 3J7AS 4DUYM 3SBJA 1FJGM 5FLXS 2ZBKB 4LF8M 2UXDM 2F5SA 2E5LM 3SAWA 5IWAM 3GO8A 4DUZM 5ITQA 2UU9M 3TWMA 1R2YA 4JI1M 4B3SM 5A2QS 1Q3BA 2HKJA 2OQ4A 3U6DA 1L1TA 3GQ3A 1IBKM 4JYAM 4NRVA 2UUCM 3SARA 3GQ4A 3U6OA 2XZUA 2Q2EB 4LFCM 4NRWA 4OX9M 4DR1M 4B3RM 4LFBM 2F5OA 3GQ5A 1L2CA 4DR5M 4LFAM 4G4QA 4G4NA 4GKJM 2UXBM 4X65M 5LMUM 3T1HM 4DV6M 1N33M 5ITUA 4JI5M 3U6PA 2XZFA 4DV2M 1HNXM 3U6SA 4X66M 2VQEM 1XNQM 4NXMM 1Z59A 3A45A 1R2ZA 4JI7M 3DOAA 4DV3M 2F5PA 1NNJA 2F5NA 3SASA 5BR8M 1HNWM 1L1ZA 4GKKM 3TWLA 4DV0M 1XMOM 1PM5A 4B3MM 4PDIA 3OTOM 5ITXE 4G4RA 5ITTA 1PJIA 4LF7M 3A42A 4DR3M 1XNRM 3W0FA 5ITRA 1K82A 4DR4M 1TDHA 3JR4A 3GPPA 1XC8A 1EE8A 4CISA 4PDGA 1IBLM 5ITYA 1N34M 4LF6M 4B3TM 3C58A 4G4OA 4JI0M 1Q39A 4ITQA 1K3XA 3TWKA 3VK8A 4KHPM 1Q3CA 5LMNM 3GPUA 1N36M
chains in the Genus database with same CATH superfamily
4JV5M 1HR0M 2KXEA 1EFUB 3M0EA 4X64M 4B7GA 1XXHA 3SAVA 4AG6A 1L8QA 2EA0A 2UUAM 3SHFA 3KVWA 1IXRC 4M0DA 1I4WA 4LF4M 2O5RA 2LVAA 5IREB 1TH2A 2UXCM 2W82A 4DV7M 3LQRA 4UN2B 1IBMM 5IZ7D 4IBCA 3SYLA 4JI8M 3T38A 1HNZM 3GLFB 3D8LA 1MJGM 3GRVA 7CATA 5GKNA 2DAKA 3RGSA 2I7PA 3HJQA 4P17A 3VLFB 1PJSA 1V92A 3GLGA 4LF5M 4X62M 1XWIA 2V6ZM 4LRSA 1N33M 4DR6M 3CF2A 2Z4RA 2ZM6M 2CV1A 3ZCBB 1XXHE 3I4YA 4YY3M 4DV4M 2HHHM 2P5TA 2VQFM 4RNAA 2DNAA 4F1IA 1W5TA 2LH0A 2CEAA 2R4EA 4RF1A 3SHGB 1IXSA 2DHYA 4YHHM 3GLIE 2R46A 2LVQD 1IN5A 1J7KA 2QP9X 2QBYB 4BBAA 4LF8M 3GLGE 3W68A 2R62A 1G71A 5IWAM 5EXSA 4DUZM 3RFWA 2UU9M 1V34A 3QAUA 3E21A 4W5WA 3GLHB 4NSRA 1R2YA 2VF8A 5A2QS 4QNRA 3BOSA 4MGZE 1IN6A 3Q8GA 1T43A 1DGHA 1R6BX 2WSEF 2K9DA 3KP0E 1IBKM 3GQ3A 2APLA 5EXXA 4OU7A 1ZMWA 4RF0A 3HHZA 1WIVA 2MH8A 3C3EA 4GEWA 3GQ4A 3U6OA 2Q2EB 2XZUA 4B3RM 3F92A 4IBFA 4LFBM 2MJ5B 4GITA 3HU2A 2X8AA 4FWHA 2F5OA 1KYIA 3MK6A 4G4QA 4GKJM 3M7GA 1ZAEA 2DVWB 4GRIA 2N35A 4EIWA 1GJTA 3U6PA 4L4UA 5EP2A 2KNVA 3GLIB 3EIHA 2LTUA 5EXPA 1OIZA 5FTJA 3PNVA 4X66M 2VQEM 2KNZA 1YE9A 1IN4A 3SFZA 3T1HM 2XFTA 4DV3M 1OFHA 2DWLA 3SASA 1NHGC 2ERCA 4L16A 3HHXA 1L1ZA 4TUWA 2KNAA 1UM8A 3B9PA 1QANA 3GRUA 3E46A 3FKEA 3J2PB 3J7BA 4PDIA 3OTOM 3T15A 4M9ZA 2CHGA 2R45A 4G3OA 4GC5A 2LXEA 1IY2A 4LF7M 4BB9A 4DBGB 2ZANA 2CE7A 3BBZA 3TE6A 3CF6E 3B89A 5ITRA 4QOZC 3R8FA 3FRHA 1HT2E 1IXZA 3HGIA 4OVZB 1K82A 4M0WA 3QWLA 4CGYB 3HU3A 1Q02A 2G5GX 4MH0E 1QZEA 3K2LA 1W5SA 2LVNC 3B7ZA 1G41A 1IBLM 4AW4A 3FUWA 4KODA 4B3TM 2DWMA 4G4OA 3K92A 1K3XA 1QYRA 3PNYA 3KS8A 4Z8XA 1N36M 5EQTA 3U6CA 4AKHA 3FUXA 4Z6YA 4DV1M 5EP3A 4IBKA 5KQDA 2CV0A 3MMPA 2XF3A 5JI2E 1E9SA 1HQCA 2H5XA 3HY5A 5KQ8A 1HQYE 2BNKA 5H37D 3TL4X 2MR9A 1K3WA 3KOXE 4MGIE 4ANRA 5DNYA 3E9SA 4PT5A 3SAUA 4KLNA 3I04M 4L6V6 4MM3B 2L09A 3U6QA 4LF9M 2YFQA 3IECA 3A46A 4LJ6A 3LCUA 3GPYA 2QPAA 1SXJA 2BJWA 2YQZA 2XEPA 1MX0A 3AFHA 5E26A 1QZMA 4L15A 1TDZA 4K0KM 1GABA 3PXGA 1F4IA 3HZJA 3FD9A 1G3IA 2XFSA 3GRRA 2DENA 4GHLA 1PGYA 4GMQA 1OAIA 3SBJA 1WXQA 4GC9A 2FFJA 1N77A 4I5SA 4B7FA 3CGWA 3FUUA 4NL4H 4FCVA 5FTMA 3KOWE 5KPZA 3H4JA 3GRYA 1GL6A 3VDPA 3AKZA 4JI1M 5FTNA 5KO3A 1JR3A 1UFZA 3TQSA 4S12A 2OQ4A 3U6DA 2JY8A 1L1TA 4AI6A 4ZPXA 5DYIA 3SC3A 3D8BA 4REZA 3RE8A 1G59A 1X37A 3FTCA 2DI0A 3FE3A 4OX9M 4DR1M 1H6UA 2DHRA 3U5ZB 2HWJA 2A5YB 5EP1A 8CATA 4IBBA 4IBGA 1G8PA 2BWEA 1GL7A 4G4NA 1DO2A 1Z6TA 5EJCA 4X65M 5LMUM 2JWSA 3ZH9B 4F2LA 5ITUA 4DV6M 1HJPA 3NWLA 4M9SA 2HAKA 2KEBA 3LVVA 4JI5M 1HNXM 2ZAOA 1TF0B 3U6SA 1XNQM 4HL4A 4NXMM 1NJFA 3A45A 1R2ZA 4JI7M 1VQ1A 2FH0A 3L25A 2YNMD 2F5NA 5L8RF 1P3QQ 2CP8A 2Z7JA 1ZMUA 2X49A 4R71A 4LJ4A 5DYGA 3EIEA 1E9RA 5ITTA 1JB0F 1WR1B 1PJIA 4R7GA 2JXNA 3AOEA 2WSFF 4LJAA 2C9OA 3H4MA 4DR3M 1XXHB 1XNRM 3DFZA 4II7A 2J7NA 4FWGA 3HHWA 3AV0A 2FOIC 2QENA 3VKHA 1ZV1A 2BJVA 2CUZA 1GO5A 3GPPA 1EE8A 4CISA 3TPZA 3AL0C 1D0KA 1OFIA 4L8RC 1TTEA 2JY7A 3KSJA 5ITYA 4IBEA 4NOOB 1OQYA 3U61B 4ITQA 2R4JA 2ZAMA 3KSXA 2CHVA 4QHTA 4KHPM 4LG2A 1TH3A 1IFYA 2Y20A 4I8OA 3CF0A 1ORYB 4CIZA 3GLGB 3K9PA 3MJ5A 4KT0F 2MROB 3HWSA 4M9XA 4OW0A 1Z5BA 1D2NA 2L2DA 3HJ8A 4PD2A 1DV0A 2M5ZA 3U60A 3U6EA 3QYEA 2Y21A 1D0MA 2GQFA 4XBOA 1XB2B 3FRIA 4MB7A 2L7HA 3J80S 4AQYM 1QQWA 1SG9A 3SMPA 2O01F 1NY5A 2KRKA 2JY6B 4I81A 4Q7JA 3WHLA 1XHBA 1V33A 4JI3M 4CJ6A 1IXSB 5FTLA 4JI4M 4GHAA 1WGLA 1IN8A 2DXIA 4XGIA 2Z4SA 1KFVA 5KPRA 2HL7A 2KA6B 3KOZE 1T3TA 4PCZA 1SXJD 1C1KA 4AKGA 1I94M 3LCVB 3IHPA 3HX3A 2JZ0A 1VG5A 1IY0A 3JR5A 2CRUA 3I4VA 4DV5M 3U6MA 3SATA 1ZQ9A 2UUBM 2FS1A 1HT1E 1XMQM 1DGHB 1CUKA 2K6BA 3UMMA 5ITXA 4LZJA 5IT9S 4IIWA 3KP1E 3JAMS 1IM2A 2LHCA 4IBIA 1FJGM 3GLFA 3L28A 1S3SA 2FE8A 5FLXS 1JQJC 4JN6A 4RKUF 1GKIA 2JZ1A 2V1CA 3HHYA 2NQ8C 4XK8F 3GO8A 2LBCA 4LY6A 5ITQA 1IN7A 1NY6A 2HCBA 2D7EA 3W0LB 4AKIA 1JR3D 1N78A 2DZNB 3KFUG 4BLCA 2ZTCA 3UZUA 1Q3BA 1ZMVA 1QAOA 2HKJA 3QYBA 4A3VB 3FTEA 3AJIB 4JYAM 3LMMA 4NRVA 2I7NA 2UUCM 3CTWB 3SARA 1QUTA 5C18A 4LFCM 1GVNA 3GLFE 1EIJA 4AG5A 2ZTDA 3GQ5A 2DAGA 2QBYA 2KZSA 2L6OA 2CWBA 2JNHA 2LWXA 3K1JA 1OAOC 3THGA 2JUJA 4LFAM 1NJGA 2UXBM 2BWBA 1SXJC 2R18A 2R44A 2XGNA 3B7QA 2XZFA 2O25A 4DV2M 2C9CA 3E4RA 4IBJA 1SXJE 1PJTA 2JY5A 3GLHA 1NHWC 3FTDA 2EO2A 4GIPA 4R3DA 3W67A 2RKOA 3FTFA 2F5PA 1WJ7A 2J5YA 2OO9A 2XSZD 3MHVC 5BR8M 1QUSA 2DAIA 4WP2A 2C5RA 4GKKM 3C3DA 1D0LA 3L26A 1BVSA 2LVPC 1XMOM 3NBIA 3B7NA 4G4RA 1IQPA 3KDSE 5C1BA 2DWZB 2KW0A 2J7OA 1KSFX 4B7HA 3W0FA 2WZJA 4FWDA 4LJ7A 4WW0A 4WURA 3PFIA 4DR4M 1VEJA 3GLIA 3U61A 2L7IA 1T6OA 3DZDA 3GLHE 3ZQJA 4PDGA 1AUAA 4CHTB 3LVWA 3I51A 3FYCA 3KW6A 1N34M 4IJEA 1YSYA 2XH9A 4LJ5A 3C58A 4JI0M 1Q39A 3RGPA 2V1UA 1TH4A 3TWKA 1JR3E 2QZ4A 2JA2A 1Q3CA 2C98A 2JP7A 1WHCA 3FUTA 4QOSA 5LMNM 1SXJB 1J5EM 4FCWA 2L4FA 4HEOA 1GJSA 2XSZA 3V76A 1MU5A 3VKGA 1R7RA 4LJ8A 2QNJA 3ZC7B 2KZUA 3L29A 4FCTA 5FTKA 2F4VM 2DAMA 1WGNA 3LQQA 4MGKE 3UJNA 1PJJA 4MGYE 5BPVA 2C99A 2KHHA 3UGJA 3J81S 4DR2M 3HKPA 1DGBA 3IG8A 1VEGA 1NV9A 1QAQA 2G3QA 4OVZA 1OJLA 2CV2A 3UK6A 1AIPC 1OTRA 4LZZA 2OPFA 3VFDA 1DGFA 4P16A 3I01M 3GP1A 3U6LA 3LW5F 5DFLA 4Y28F 4D82A 1N75A 1Z5CA 2F5QA 5FSWA 1N32M 4B08A 3M6AA 1E94E 2K47A 1L2BA 2FNAA 2X4AA 3VK7A 1NV8A 2RGOA 4NXNM 4JI6M 2DKLA 1DO0A 2KRUA 4I4LA 2L4EA 2G8LA 2D7GA 2VDBB 2VF7A 3L2AA 5F3WA 3GPXA 4JI2M 3AOEC 2DAEA 3AOGA 1RU3A 1PRBA 1Z5AA 2VIIA 3T1YM 2CHQA 5E6JA 1L2DA 3HJSA 4L78A 3FUVA 2MGWA 3ILKA 1QDRA 3C9PA 3J7AS 1NO1A 1NSFA 3BXWA 4DUYM 1VDLA 3B74A 2DZOB 4LGYA 2R65A 3Q8XA 2ZBKB 1NVMA 1QAMA 2EKFA 2UXDM 2M60A 2F5SA 3KOYE 1R4GA 4JXJA 1LV7A 3SAWA 2GNOA 2R0IA 4LJ9A 2E5LM 4D80A 2B3TA 4D81A 3TWMA 2WSCF 2D7HA 1R5LA 3WHKA 5JI3E 5KPTA 4B3SM 1YLAA 4NC6A 4LRTA 3T6PA 4MGHA 3KXEC 4FW9A 1TR8A 4IBDA 2R6FA 2EKKA 4NRWA 2LHGA 4AZFA 1MN3A 2OOBA 3KS4A 4KO8A 1C7YA 2Y0TA 2AHMA 4DR5M 4FD2A 1L2CA 2Z8YM 4LGMA 2EJSA 4NSOB 1IY1A 1QDTA 1OIPA 2OOAA 2XLJA 1G4AE 1LTMA 1PJQA 2QCUA 3K9OA 1Z59A 1A5TA 1E32A 1NNUC 1OKSA 1QVRA 1J09A 1Y8GA 3DOAA 2QQ8A 3PVSA 2Z3XA 1NNJA 4IJFA 3IG5A 1HNWM 2DZLA 1YUBA 2DWNA 5EP4A 4HLQA 3TWLA 4DV0M 4B3MM 1PM5A 2RRUA 2KDLA 5ITXE 4QNMA 1VDDA 1DGGA 1GLNA 2QHOB 3U5ZA 3L27A 2EUCA 3NBXX 3VDUA 4LCBA 3A42A 2LVOC 3A98B 3J27B 5EXTA 2H1RA 3U60B 3DA1A 3K8ZA 2K0BX 3HU1A 3SYKA 1TDHA 3FYDA 3JR4A 2YR0A 2LNHC 1XC8A 2RGHA 4G6ZA 3SMSA 3R9XB 2QSFX 2CFOA 4LF6M 4GH9A 2C96A 4FVMA 1FNNA 3VK8A 3GPUA 1TGUA 4DR7M 1VEKA 4QHSA 2Y0QA
chains in the Genus database with same CATH topology
4JV5M 1HR0M 2KXEA 3M0EA 4X64M 4B7GA 1XXHA 3SAVA 4AG6A 1L8QA 2EA0A 2UUAM 3SHFA 3KVWA 1IXRC 4M0DA 1I4WA 4LF4M 2O5RA 5IREB 1TH2A 2UXCM 2W82A 4DV7M 3LQRA 1IBMM 5IZ7D 4IBCA 3SYLA 3T38A 1HNZM 3GLFB 3D8LA 3GRVA 7CATA 5GKNA 3RGSA 2I7PA 3HJQA 3VLFB 3GLGA 4LF5M 4X62M 1XWIA 2V6ZM 4LRSA 4DR6M 3CF2A 2Z4RA 2ZM6M 2CV1A 3ZCBB 3I4YA 4YY3M 4DV4M 2HHHM 2P5TA 2VQFM 4RNAA 1W5TA 2LH0A 2CEAA 2R4EA 4RF1A 3SHGB 4YHHM 2R46A 1IN5A 1J7KA 2QP9X 2QBYB 4BBAA 4LF8M 2R62A 5IWAM 5EXSA 4DUZM 3RFWA 2UU9M 3QAUA 4W5WA 3GLHB 4NSRA 1R2YA 5A2QS 4QNRA 3BOSA 4MGZE 1IN6A 1DGHA 1R6BX 3KP0E 1IBKM 3GQ3A 4OU7A 5EXXA 4RF0A 3HHZA 3GQ4A 3U6OA 2XZUA 2Q2EB 4B3RM 4LFBM 4IBFA 4GITA 3HU2A 2X8AA 4FWHA 2F5OA 1KYIA 3MK6A 4G4QA 4GKJM 3M7GA 1ZAEA 2DVWB 4GRIA 4EIWA 3U6PA 4L4UA 5EP2A 3GLIB 3EIHA 5EXPA 5FTJA 4X66M 3PNVA 2VQEM 1YE9A 1IN4A 3SFZA 2XFTA 4DV3M 1OFHA 2DWLA 3SASA 1NHGC 2ERCA 4L16A 3HHXA 1L1ZA 4TUWA 1UM8A 3B9PA 1QANA 3GRUA 3FKEA 3J2PB 3J7BA 4PDIA 3OTOM 3T15A 4M9ZA 2CHGA 2R45A 4GC5A 2LXEA 1IY2A 4LF7M 4BB9A 2ZANA 2CE7A 3TE6A 3CF6E 5ITRA 4QOZC 3R8FA 1HT2E 1IXZA 3HGIA 4OVZB 1K82A 4M0WA 3QWLA 4CGYB 3HU3A 2G5GX 4MH0E 3K2LA 1W5SA 1G41A 1IBLM 4AW4A 3FUWA 4KODA 4B3TM 2DWMA 4G4OA 3K92A 1K3XA 1QYRA 3PNYA 3KS8A 4Z8XA 1N36M 5EQTA 3U6CA 4AKHA 3FUXA 4Z6YA 4DV1M 5EP3A 4IBKA 5KQDA 2CV0A 2XF3A 5JI2E 1E9SA 1HQCA 5KQ8A 1HQYE 2BNKA 5H37D 3TL4X 1K3WA 3KOXE 4MGIE 5DNYA 3SAUA 3E9SA 4PT5A 4KLNA 4MM3B 2L09A 3U6QA 4LF9M 2YFQA 3A46A 4LJ6A 3GPYA 2QPAA 1SXJA 2BJWA 2YQZA 2XEPA 1MX0A 3AFHA 5E26A 1QZMA 4L15A 1TDZA 4K0KM 3PXGA 3FD9A 1G3IA 2XFSA 3GRRA 4GHLA 3SBJA 4GMQA 1WXQA 4GC9A 2FFJA 1N77A 4I5SA 4B7FA 3FUUA 4NL4H 4FCVA 5FTMA 3KOWE 5KPZA 3GRYA 1GL6A 3VDPA 3AKZA 4JI1M 5FTNA 5KO3A 1JR3A 4AI6A 3TQSA 4S12A 2OQ4A 3U6DA 1L1TA 4ZPXA 5DYIA 3SC3A 3D8BA 4REZA 3RE8A 1G59A 1X37A 3FTCA 4OX9M 4DR1M 1H6UA 2DHRA 3U5ZB 5EP1A 2A5YB 8CATA 4IBBA 4IBGA 1G8PA 1GL7A 4G4NA 1DO2A 1Z6TA 5EJCA 4X65M 5LMUM 3ZH9B 5ITUA 4DV6M 3T1HM 1N33M 3NWLA 4JI5M 4M9SA 2KEBA 3LVVA 1HNXM 2ZAOA 3U6SA 1XNQM 4HL4A 4NXMM 1NJFA 3A45A 1R2ZA 4JI7M 3L25A 2YNMD 2F5NA 2Z7JA 2X49A 4LJ4A 5DYGA 3EIEA 1E9RA 5ITTA 1PJIA 4R7GA 3AOEA 4LJAA 3H4MA 2C9OA 4DR3M 1XXHB 1XNRM 3DFZA 4II7A 2J7NA 4FWGA 3HHWA 3AV0A 2FOIC 2QENA 3VKHA 2BJVA 2CUZA 3GPPA 1EE8A 4CISA 3TPZA 3AL0C 1OFIA 4L8RC 3KSJA 5ITYA 4IBEA 4NOOB 3U61B 4ITQA 2R4JA 2ZAMA 3KSXA 2CHVA 4QHTA 4KHPM 4LG2A 1TH3A 2Y20A 4I8OA 3CF0A 1ORYB 3GLGB 3MJ5A 4OW0A 3HWSA 4M9XA 1Z5BA 1D2NA 3HJ8A 4PD2A 2M5ZA 3U60A 3U6EA 2Y21A 4XBOA 4MB7A 2L7HA 3J80S 4AQYM 1QQWA 3SMPA 1NY5A 2KRKA 4I81A 3WHLA 1XHBA 4JI3M 4JI4M 5FTLA 1IXSB 4GHAA 1IN8A 2DXIA 4XGIA 2Z4SA 1KFVA 5KPRA 2HL7A 2KA6B 3KOZE 1T3TA 4PCZA 1SXJD 1C1KA 4AKGA 1I94M 1IY0A 3JR5A 3I4VA 4DV5M 3SATA 3U6MA 1ZQ9A 2UUBM 1HT1E 1XMQM 1DGHB 3UMMA 5ITXA 4LZJA 5IT9S 4IIWA 3KP1E 3JAMS 1IM2A 4IBIA 1FJGM 3GLFA 3L28A 1S3SA 2FE8A 5FLXS 1JQJC 4JN6A 1GKIA 2V1CA 3HHYA 2NQ8C 3GO8A 4LY6A 5ITQA 1IN7A 1NY6A 2HCBA 2D7EA 3W0LB 4AKIA 1JR3D 1N78A 2DZNB 3KFUG 4BLCA 3UZUA 1Q3BA 2HKJA 1QAOA 4A3VB 3FTEA 3AJIB 4JYAM 3LMMA 4NRVA 2I7NA 2UUCM 3CTWB 3SARA 5C18A 4LFCM 1GVNA 4AG5A 3GQ5A 2QBYA 2KZSA 2L6OA 3K1JA 3THGA 2LWXA 4LFAM 1NJGA 2UXBM 1SXJC 2R18A 2XGNA 2XZFA 4DV2M 2C9CA 3E4RA 4IBJA 1SXJE 3GLHA 1NHWC 3FTDA 2EO2A 4GIPA 3FTFA 2RKOA 2F5PA 5BR8M 2XSZD 3MHVC 2C5RA 4GKKM 3L26A 1XMOM 3NBIA 4G4RA 1IQPA 3KDSE 5C1BA 2DWZB 2KW0A 2J7OA 1KSFX 4B7HA 3W0FA 4FWDA 4LJ7A 4WW0A 4WURA 3PFIA 4DR4M 3GLIA 3U61A 2L7IA 3DZDA 4PDGA 4CHTB 3LVWA 3I51A 3FYCA 3KW6A 1N34M 4IJEA 1YSYA 2XH9A 4LJ5A 3C58A 4JI0M 1Q39A 3RGPA 2V1UA 1TH4A 3TWKA 2QZ4A 2JA2A 1Q3CA 2C98A 3FUTA 4QOSA 5LMNM 1J5EM 4JI8M 1SXJB 4FCWA 2XSZA 1MU5A 3VKGA 1R7RA 4LJ8A 3ZC7B 2F4VM 2KZUA 3L29A 4FCTA 5FTKA 3LQQA 4MGKE 3UJNA 1PJJA 4MGYE 5BPVA 2C99A 3UGJA 3J81S 4DR2M 3HKPA 1DGBA 3IG8A 4OVZA 2CV2A 1QAQA 1OJLA 3UK6A 4LZZA 2OPFA 3VFDA 1DGFA 4P16A 3GP1A 3U6LA 4D82A 1N75A 1Z5CA 2F5QA 5FSWA 1N32M 4B08A 3M6AA 1E94E 2K47A 1L2BA 2FNAA 2X4AA 3VK7A 2RGOA 4NXNM 4JI6M 4I4LA 1DO0A 2KRUA 3L2AA 2G8LA 2D7GA 5F3WA 3GPXA 4JI2M 3AOEC 3AOGA 2VIIA 1Z5AA 3T1YM 2CHQA 5E6JA 1L2DA 3HJSA 4L78A 3FUVA 3ILKA 3J7AS 1NSFA 4DUYM 2DZOB 4LGYA 2R65A 3Q8XA 2ZBKB 1NVMA 1QAMA 2UXDM 2M60A 2F5SA 3KOYE 3SAWA 4JXJA 1LV7A 2E5LM 4LJ9A 4D80A 4D81A 3TWMA 2D7HA 3WHKA 5JI3E 5KPTA 4B3SM 4LRTA 4MGHA 3KXEC 4FW9A 4IBDA 4NRWA 4AZFA 3KS4A 4KO8A 2Y0TA 2AHMA 4DR5M 4FD2A 1L2CA 4LGMA 4NSOB 1IY1A 2XLJA 1G4AE 2QCUA 1Z59A 4R3DA 1E32A 1NNUC 1QVRA 3DOAA 1J09A 3PVSA 2Z3XA 1NNJA 4IJFA 3IG5A 1HNWM 2DWNA 1YUBA 5EP4A 4HLQA 3TWLA 4DV0M 4B3MM 1PM5A 5ITXE 4QNMA 1VDDA 1DGGA 1GLNA 3U5ZA 3L27A 2EUCA 3VDUA 3U60B 4LCBA 3J27B 3A42A 3A98B 5EXTA 2H1RA 3DA1A 3K8ZA 3HU1A 3SYKA 1TDHA 3FYDA 3JR4A 2YR0A 2LNHC 1XC8A 2RGHA 4G6ZA 3SMSA 3R9XB 2CFOA 4LF6M 4GH9A 2C96A 4FVMA 1FNNA 3VK8A 3GPUA 1TGUA 4DR7M 4QHSA 2Y0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 M;  1Z5B A;  1J5E M;  3U6C A;  1HR0 M;  4PD2 A;  4DV1 M;  1MU5 A;  2F4V M;  4X64 M;  3U6E A;  3SAV A;  2EA0 A;  1PJJ A;  2UUA M;  4DR2 M;  4MB7 A;  3J81 S;  3J80 S;  4AQY M;  4LF4 M;  2UXC M;  4DV7 M;  1K3W A;  4JI3 M;  4JI4 M;  1IBM M;  2OPF A;  3SAU A;  4JI8 M;  3GP1 A;  3U6L A;  1HNZ M;  1KFV A;  1Z5C A;  2F5Q A;  4PCZ A;  3U6Q A;  4LF9 M;  4DR7 M;  1N32 M;  3A46 A;  3GPY A;  1L2B A;  4LF5 M;  1I94 M;  3VK7 A;  4X62 M;  4NXN M;  4JI6 M;  4DR6 M;  2ZM6 M;  1MX0 A;  3JR5 A;  3SAT A;  4DV5 M;  3U6M A;  3GPX A;  4JI2 M;  1TDZ A;  2UUB M;  4K0K M;  1Z5A A;  4YY3 M;  1XMQ M;  4DV4 M;  3T1Y M;  2HHH M;  2VQF M;  1L2D A;  5ITX A;  5IT9 S;  4YHH M;  3JAM S;  3J7A S;  4DUY M;  3SBJ A;  1FJG M;  5FLX S;  2ZBK B;  4LF8 M;  2UXD M;  2F5S A;  2E5L M;  3SAW A;  5IWA M;  3GO8 A;  4DUZ M;  5ITQ A;  2UU9 M;  3TWM A;  1R2Y A;  4JI1 M;  4B3S M;  5A2Q S;  1Q3B A;  2HKJ A;  2OQ4 A;  3U6D A;  1L1T A;  3GQ3 A;  1IBK M;  4JYA M;  4NRV A;  2UUC M;  3SAR A;  3GQ4 A;  3U6O A;  2XZU A;  2Q2E B;  4LFC M;  4NRW A;  4OX9 M;  4DR1 M;  4B3R M;  4LFB M;  2F5O A;  3GQ5 A;  1L2C A;  4DR5 M;  4LFA M;  4G4Q A;  4G4N A;  4GKJ M;  2UXB M;  4X65 M;  5LMU M;  3T1H M;  4DV6 M;  1N33 M;  5ITU A;  4JI5 M;  3U6P A;  2XZF A;  4DV2 M;  1HNX M;  3U6S A;  4X66 M;  2VQE M;  1XNQ M;  4NXM M;  1Z59 A;  3A45 A;  1R2Z A;  4JI7 M;  3DOA A;  4DV3 M;  2F5P A;  1NNJ A;  2F5N A;  3SAS A;  5BR8 M;  1HNW M;  1L1Z A;  4GKK M;  3TWL A;  4DV0 M;  1XMO M;  1PM5 A;  4B3M M;  4PDI A;  3OTO M;  5ITX E;  4G4R A;  5ITT A;  1PJI A;  4LF7 M;  3A42 A;  4DR3 M;  1XNR M;  3W0F A;  5ITR A;  1K82 A;  4DR4 M;  1TDH A;  3JR4 A;  3GPP A;  1XC8 A;  1EE8 A;  4CIS A;  4PDG A;  1IBL M;  5ITY A;  1N34 M;  4LF6 M;  4B3T M;  3C58 A;  4G4O A;  4JI0 M;  1Q39 A;  4ITQ A;  1K3X A;  3TWK A;  3VK8 A;  4KHP M;  1Q3C A;  5LMN M;  3GPU A;  1N36 M; 
#chains in the Genus database with same CATH topology
 4JV5 M;  1HR0 M;  2KXE A;  1EFU B;  3M0E A;  4X64 M;  4B7G A;  1XXH A;  3SAV A;  4AG6 A;  1L8Q A;  2EA0 A;  2UUA M;  3SHF A;  3KVW A;  1IXR C;  4M0D A;  1I4W A;  4LF4 M;  2O5R A;  2LVA A;  5IRE B;  1TH2 A;  2UXC M;  2W82 A;  4DV7 M;  3LQR A;  4UN2 B;  1IBM M;  5IZ7 D;  4IBC A;  3SYL A;  4JI8 M;  3T38 A;  1HNZ M;  3GLF B;  3D8L A;  1MJG M;  3GRV A;  7CAT A;  5GKN A;  2DAK A;  3RGS A;  2I7P A;  3HJQ A;  4P17 A;  3VLF B;  1PJS A;  1V92 A;  3GLG A;  4LF5 M;  4X62 M;  1XWI A;  2V6Z M;  4LRS A;  1N33 M;  4DR6 M;  3CF2 A;  2Z4R A;  2ZM6 M;  2CV1 A;  3ZCB B;  1XXH E;  3I4Y A;  4YY3 M;  4DV4 M;  2HHH M;  2P5T A;  2VQF M;  4RNA A;  2DNA A;  4F1I A;  1W5T A;  2LH0 A;  2CEA A;  2R4E A;  4RF1 A;  3SHG B;  1IXS A;  2DHY A;  4YHH M;  3GLI E;  2R46 A;  2LVQ D;  1IN5 A;  1J7K A;  2QP9 X;  2QBY B;  4BBA A;  4LF8 M;  3GLG E;  3W68 A;  2R62 A;  1G71 A;  5IWA M;  5EXS A;  4DUZ M;  3RFW A;  2UU9 M;  1V34 A;  3QAU A;  3E21 A;  4W5W A;  3GLH B;  4NSR A;  1R2Y A;  2VF8 A;  5A2Q S;  4QNR A;  3BOS A;  4MGZ E;  1IN6 A;  3Q8G A;  1T43 A;  1DGH A;  1R6B X;  2WSE F;  2K9D A;  3KP0 E;  1IBK M;  3GQ3 A;  2APL A;  5EXX A;  4OU7 A;  1ZMW A;  4RF0 A;  3HHZ A;  1WIV A;  2MH8 A;  3C3E A;  4GEW A;  3GQ4 A;  3U6O A;  2Q2E B;  2XZU A;  4B3R M;  3F92 A;  4IBF A;  4LFB M;  2MJ5 B;  4GIT A;  3HU2 A;  2X8A A;  4FWH A;  2F5O A;  1KYI A;  3MK6 A;  4G4Q A;  4GKJ M;  3M7G A;  1ZAE A;  2DVW B;  4GRI A;  2N35 A;  4EIW A;  1GJT A;  3U6P A;  4L4U A;  5EP2 A;  2KNV A;  3GLI B;  3EIH A;  2LTU A;  5EXP A;  1OIZ A;  5FTJ A;  3PNV A;  4X66 M;  2VQE M;  2KNZ A;  1YE9 A;  1IN4 A;  3SFZ A;  3T1H M;  2XFT A;  4DV3 M;  1OFH A;  2DWL A;  3SAS A;  1NHG C;  2ERC A;  4L16 A;  3HHX A;  1L1Z A;  4TUW A;  2KNA A;  1UM8 A;  3B9P A;  1QAN A;  3GRU A;  3E46 A;  3FKE A;  3J2P B;  3J7B A;  4PDI A;  3OTO M;  3T15 A;  4M9Z A;  2CHG A;  2R45 A;  4G3O A;  4GC5 A;  2LXE A;  1IY2 A;  4LF7 M;  4BB9 A;  4DBG B;  2ZAN A;  2CE7 A;  3BBZ A;  3TE6 A;  3CF6 E;  3B89 A;  5ITR A;  4QOZ C;  3R8F A;  3FRH A;  1HT2 E;  1IXZ A;  3HGI A;  4OVZ B;  1K82 A;  4M0W A;  3QWL A;  4CGY B;  3HU3 A;  1Q02 A;  2G5G X;  4MH0 E;  1QZE A;  3K2L A;  1W5S A;  2LVN C;  3B7Z A;  1G41 A;  1IBL M;  4AW4 A;  3FUW A;  4KOD A;  4B3T M;  2DWM A;  4G4O A;  3K92 A;  1K3X A;  1QYR A;  3PNY A;  3KS8 A;  4Z8X A;  1N36 M;  5EQT A;  3U6C A;  4AKH A;  3FUX A;  4Z6Y A;  4DV1 M;  5EP3 A;  4IBK A;  5KQD A;  2CV0 A;  3MMP A;  2XF3 A;  5JI2 E;  1E9S A;  1HQC A;  2H5X A;  3HY5 A;  5KQ8 A;  1HQY E;  2BNK A;  5H37 D;  3TL4 X;  2MR9 A;  1K3W A;  3KOX E;  4MGI E;  4ANR A;  5DNY A;  3E9S A;  4PT5 A;  3SAU A;  4KLN A;  3I04 M;  4L6V 6;  4MM3 B;  2L09 A;  3U6Q A;  4LF9 M;  2YFQ A;  3IEC A;  3A46 A;  4LJ6 A;  3LCU A;  3GPY A;  2QPA A;  1SXJ A;  2BJW A;  2YQZ A;  2XEP A;  1MX0 A;  3AFH A;  5E26 A;  1QZM A;  4L15 A;  1TDZ A;  4K0K M;  1GAB A;  3PXG A;  1F4I A;  3HZJ A;  3FD9 A;  1G3I A;  2XFS A;  3GRR A;  2DEN A;  4GHL A;  1PGY A;  4GMQ A;  1OAI A;  3SBJ A;  1WXQ A;  4GC9 A;  2FFJ A;  1N77 A;  4I5S A;  4B7F A;  3CGW A;  3FUU A;  4NL4 H;  4FCV A;  5FTM A;  3KOW E;  5KPZ A;  3H4J A;  3GRY A;  1GL6 A;  3VDP A;  3AKZ A;  4JI1 M;  5FTN A;  5KO3 A;  1JR3 A;  1UFZ A;  3TQS A;  4S12 A;  2OQ4 A;  3U6D A;  2JY8 A;  1L1T A;  4AI6 A;  4ZPX A;  5DYI A;  3SC3 A;  3D8B A;  4REZ A;  3RE8 A;  1G59 A;  1X37 A;  3FTC A;  2DI0 A;  3FE3 A;  4OX9 M;  4DR1 M;  1H6U A;  2DHR A;  3U5Z B;  2HWJ A;  2A5Y B;  5EP1 A;  8CAT A;  4IBB A;  4IBG A;  1G8P A;  2BWE A;  1GL7 A;  4G4N A;  1DO2 A;  1Z6T A;  5EJC A;  4X65 M;  5LMU M;  2JWS A;  3ZH9 B;  4F2L A;  5ITU A;  4DV6 M;  1HJP A;  3NWL A;  4M9S A;  2HAK A;  2KEB A;  3LVV A;  4JI5 M;  1HNX M;  2ZAO A;  1TF0 B;  3U6S A;  1XNQ M;  4HL4 A;  4NXM M;  1NJF A;  3A45 A;  1R2Z A;  4JI7 M;  1VQ1 A;  2FH0 A;  3L25 A;  2YNM D;  2F5N A;  5L8R F;  1P3Q Q;  2CP8 A;  2Z7J A;  1ZMU A;  2X49 A;  4R71 A;  4LJ4 A;  5DYG A;  3EIE A;  1E9R A;  5ITT A;  1JB0 F;  1WR1 B;  1PJI A;  4R7G A;  2JXN A;  3AOE A;  2WSF F;  4LJA A;  2C9O A;  3H4M A;  4DR3 M;  1XXH B;  1XNR M;  3DFZ A;  4II7 A;  2J7N A;  4FWG A;  3HHW A;  3AV0 A;  2FOI C;  2QEN A;  3VKH A;  1ZV1 A;  2BJV A;  2CUZ A;  1GO5 A;  3GPP A;  1EE8 A;  4CIS A;  3TPZ A;  3AL0 C;  1D0K A;  1OFI A;  4L8R C;  1TTE A;  2JY7 A;  3KSJ A;  5ITY A;  4IBE A;  4NOO B;  1OQY A;  3U61 B;  4ITQ A;  2R4J A;  2ZAM A;  3KSX A;  2CHV A;  4QHT A;  4KHP M;  4LG2 A;  1TH3 A;  1IFY A;  2Y20 A;  4I8O A;  3CF0 A;  1ORY B;  4CIZ A;  3GLG B;  3K9P A;  3MJ5 A;  4KT0 F;  2MRO B;  3HWS A;  4M9X A;  4OW0 A;  1Z5B A;  1D2N A;  2L2D A;  3HJ8 A;  4PD2 A;  1DV0 A;  2M5Z A;  3U60 A;  3U6E A;  3QYE A;  2Y21 A;  1D0M A;  2GQF A;  4XBO A;  1XB2 B;  3FRI A;  4MB7 A;  2L7H A;  3J80 S;  4AQY M;  1QQW A;  1SG9 A;  3SMP A;  2O01 F;  1NY5 A;  2KRK A;  2JY6 B;  4I81 A;  4Q7J A;  3WHL A;  1XHB A;  1V33 A;  4JI3 M;  4CJ6 A;  1IXS B;  5FTL A;  4JI4 M;  4GHA A;  1WGL A;  1IN8 A;  2DXI A;  4XGI A;  2Z4S A;  1KFV A;  5KPR A;  2HL7 A;  2KA6 B;  3KOZ E;  1T3T A;  4PCZ A;  1SXJ D;  1C1K A;  4AKG A;  1I94 M;  3LCV B;  3IHP A;  3HX3 A;  2JZ0 A;  1VG5 A;  1IY0 A;  3JR5 A;  2CRU A;  3I4V A;  4DV5 M;  3U6M A;  3SAT A;  1ZQ9 A;  2UUB M;  2FS1 A;  1HT1 E;  1XMQ M;  1DGH B;  1CUK A;  2K6B A;  3UMM A;  5ITX A;  4LZJ A;  5IT9 S;  4IIW A;  3KP1 E;  3JAM S;  1IM2 A;  2LHC A;  4IBI A;  1FJG M;  3GLF A;  3L28 A;  1S3S A;  2FE8 A;  5FLX S;  1JQJ C;  4JN6 A;  4RKU F;  1GKI A;  2JZ1 A;  2V1C A;  3HHY A;  2NQ8 C;  4XK8 F;  3GO8 A;  2LBC A;  4LY6 A;  5ITQ A;  1IN7 A;  1NY6 A;  2HCB A;  2D7E A;  3W0L B;  4AKI A;  1JR3 D;  1N78 A;  2DZN B;  3KFU G;  4BLC A;  2ZTC A;  3UZU A;  1Q3B A;  1ZMV A;  1QAO A;  2HKJ A;  3QYB A;  4A3V B;  3FTE A;  3AJI B;  4JYA M;  3LMM A;  4NRV A;  2I7N A;  2UUC M;  3CTW B;  3SAR A;  1QUT A;  5C18 A;  4LFC M;  1GVN A;  3GLF E;  1EIJ A;  4AG5 A;  2ZTD A;  3GQ5 A;  2DAG A;  2QBY A;  2KZS A;  2L6O A;  2CWB A;  2JNH A;  2LWX A;  3K1J A;  1OAO C;  3THG A;  2JUJ A;  4LFA M;  1NJG A;  2UXB M;  2BWB A;  1SXJ C;  2R18 A;  2R44 A;  2XGN A;  3B7Q A;  2XZF A;  2O25 A;  4DV2 M;  2C9C A;  3E4R A;  4IBJ A;  1SXJ E;  1PJT A;  2JY5 A;  3GLH A;  1NHW C;  3FTD A;  2EO2 A;  4GIP A;  4R3D A;  3W67 A;  2RKO A;  3FTF A;  2F5P A;  1WJ7 A;  2J5Y A;  2OO9 A;  2XSZ D;  3MHV C;  5BR8 M;  1QUS A;  2DAI A;  4WP2 A;  2C5R A;  4GKK M;  3C3D A;  1D0L A;  3L26 A;  1BVS A;  2LVP C;  1XMO M;  3NBI A;  3B7N A;  4G4R A;  1IQP A;  3KDS E;  5C1B A;  2DWZ B;  2KW0 A;  2J7O A;  1KSF X;  4B7H A;  3W0F A;  2WZJ A;  4FWD A;  4LJ7 A;  4WW0 A;  4WUR A;  3PFI A;  4DR4 M;  1VEJ A;  3GLI A;  3U61 A;  2L7I A;  1T6O A;  3DZD A;  3GLH E;  3ZQJ A;  4PDG A;  1AUA A;  4CHT B;  3LVW A;  3I51 A;  3FYC A;  3KW6 A;  1N34 M;  4IJE A;  1YSY A;  2XH9 A;  4LJ5 A;  3C58 A;  4JI0 M;  1Q39 A;  3RGP A;  2V1U A;  1TH4 A;  3TWK A;  1JR3 E;  2QZ4 A;  2JA2 A;  1Q3C A;  2C98 A;  2JP7 A;  1WHC A;  3FUT A;  4QOS A;  5LMN M;  1SXJ B;  1J5E M;  4FCW A;  2L4F A;  4HEO A;  1GJS A;  2XSZ A;  3V76 A;  1MU5 A;  3VKG A;  1R7R A;  4LJ8 A;  2QNJ A;  3ZC7 B;  2KZU A;  3L29 A;  4FCT A;  5FTK A;  2F4V M;  2DAM A;  1WGN A;  3LQQ A;  4MGK E;  3UJN A;  1PJJ A;  4MGY E;  5BPV A;  2C99 A;  2KHH A;  3UGJ A;  3J81 S;  4DR2 M;  3HKP A;  1DGB A;  3IG8 A;  1VEG A;  1NV9 A;  1QAQ A;  2G3Q A;  4OVZ A;  1OJL A;  2CV2 A;  3UK6 A;  1AIP C;  1OTR A;  4LZZ A;  2OPF A;  3VFD A;  1DGF A;  4P16 A;  3I01 M;  3GP1 A;  3U6L A;  3LW5 F;  5DFL A;  4Y28 F;  4D82 A;  1N75 A;  1Z5C A;  2F5Q A;  5FSW A;  1N32 M;  4B08 A;  3M6A A;  1E94 E;  2K47 A;  1L2B A;  2FNA A;  2X4A A;  3VK7 A;  1NV8 A;  2RGO A;  4NXN M;  4JI6 M;  2DKL A;  1DO0 A;  2KRU A;  4I4L A;  2L4E A;  2G8L A;  2D7G A;  2VDB B;  2VF7 A;  3L2A A;  5F3W A;  3GPX A;  4JI2 M;  3AOE C;  2DAE A;  3AOG A;  1RU3 A;  1PRB A;  1Z5A A;  2VII A;  3T1Y M;  2CHQ A;  5E6J A;  1L2D A;  3HJS A;  4L78 A;  3FUV A;  2MGW A;  3ILK A;  1QDR A;  3C9P A;  3J7A S;  1NO1 A;  1NSF A;  3BXW A;  4DUY M;  1VDL A;  3B74 A;  2DZO B;  4LGY A;  2R65 A;  3Q8X A;  2ZBK B;  1NVM A;  1QAM A;  2EKF A;  2UXD M;  2M60 A;  2F5S A;  3KOY E;  1R4G A;  4JXJ A;  1LV7 A;  3SAW A;  2GNO A;  2R0I A;  4LJ9 A;  2E5L M;  4D80 A;  2B3T A;  4D81 A;  3TWM A;  2WSC F;  2D7H A;  1R5L A;  3WHK A;  5JI3 E;  5KPT A;  4B3S M;  1YLA A;  4NC6 A;  4LRT A;  3T6P A;  4MGH A;  3KXE C;  4FW9 A;  1TR8 A;  4IBD A;  2R6F A;  2EKK A;  4NRW A;  2LHG A;  4AZF A;  1MN3 A;  2OOB A;  3KS4 A;  4KO8 A;  1C7Y A;  2Y0T A;  2AHM A;  4DR5 M;  4FD2 A;  1L2C A;  2Z8Y M;  4LGM A;  2EJS A;  4NSO B;  1IY1 A;  1QDT A;  1OIP A;  2OOA A;  2XLJ A;  1G4A E;  1LTM A;  1PJQ A;  2QCU A;  3K9O A;  1Z59 A;  1A5T A;  1E32 A;  1NNU C;  1OKS A;  1QVR A;  1J09 A;  1Y8G A;  3DOA A;  2QQ8 A;  3PVS A;  2Z3X A;  1NNJ A;  4IJF A;  3IG5 A;  1HNW M;  2DZL A;  1YUB A;  2DWN A;  5EP4 A;  4HLQ A;  3TWL A;  4DV0 M;  4B3M M;  1PM5 A;  2RRU A;  2KDL A;  5ITX E;  4QNM A;  1VDD A;  1DGG A;  1GLN A;  2QHO B;  3U5Z A;  3L27 A;  2EUC A;  3NBX X;  3VDU A;  4LCB A;  3A42 A;  2LVO C;  3A98 B;  3J27 B;  5EXT A;  2H1R A;  3U60 B;  3DA1 A;  3K8Z A;  2K0B X;  3HU1 A;  3SYK A;  1TDH A;  3FYD A;  3JR4 A;  2YR0 A;  2LNH C;  1XC8 A;  2RGH A;  4G6Z A;  3SMS A;  3R9X B;  2QSF X;  2CFO A;  4LF6 M;  4GH9 A;  2C96 A;  4FVM A;  1FNN A;  3VK8 A;  3GPU A;  1TGU A;  4DR7 M;  1VEK A;  4QHS A;  2Y0Q A; 
#chains in the Genus database with same CATH homology
 4JV5 M;  1HR0 M;  2KXE A;  3M0E A;  4X64 M;  4B7G A;  1XXH A;  3SAV A;  4AG6 A;  1L8Q A;  2EA0 A;  2UUA M;  3SHF A;  3KVW A;  1IXR C;  4M0D A;  1I4W A;  4LF4 M;  2O5R A;  5IRE B;  1TH2 A;  2UXC M;  2W82 A;  4DV7 M;  3LQR A;  1IBM M;  5IZ7 D;  4IBC A;  3SYL A;  3T38 A;  1HNZ M;  3GLF B;  3D8L A;  3GRV A;  7CAT A;  5GKN A;  3RGS A;  2I7P A;  3HJQ A;  3VLF B;  3GLG A;  4LF5 M;  4X62 M;  1XWI A;  2V6Z M;  4LRS A;  4DR6 M;  3CF2 A;  2Z4R A;  2ZM6 M;  2CV1 A;  3ZCB B;  3I4Y A;  4YY3 M;  4DV4 M;  2HHH M;  2P5T A;  2VQF M;  4RNA A;  1W5T A;  2LH0 A;  2CEA A;  2R4E A;  4RF1 A;  3SHG B;  4YHH M;  2R46 A;  1IN5 A;  1J7K A;  2QP9 X;  2QBY B;  4BBA A;  4LF8 M;  2R62 A;  5IWA M;  5EXS A;  4DUZ M;  3RFW A;  2UU9 M;  3QAU A;  4W5W A;  3GLH B;  4NSR A;  1R2Y A;  5A2Q S;  4QNR A;  3BOS A;  4MGZ E;  1IN6 A;  1DGH A;  1R6B X;  3KP0 E;  1IBK M;  3GQ3 A;  4OU7 A;  5EXX A;  4RF0 A;  3HHZ A;  3GQ4 A;  3U6O A;  2XZU A;  2Q2E B;  4B3R M;  4LFB M;  4IBF A;  4GIT A;  3HU2 A;  2X8A A;  4FWH A;  2F5O A;  1KYI A;  3MK6 A;  4G4Q A;  4GKJ M;  3M7G A;  1ZAE A;  2DVW B;  4GRI A;  4EIW A;  3U6P A;  4L4U A;  5EP2 A;  3GLI B;  3EIH A;  5EXP A;  5FTJ A;  4X66 M;  3PNV A;  2VQE M;  1YE9 A;  1IN4 A;  3SFZ A;  2XFT A;  4DV3 M;  1OFH A;  2DWL A;  3SAS A;  1NHG C;  2ERC A;  4L16 A;  3HHX A;  1L1Z A;  4TUW A;  1UM8 A;  3B9P A;  1QAN A;  3GRU A;  3FKE A;  3J2P B;  3J7B A;  4PDI A;  3OTO M;  3T15 A;  4M9Z A;  2CHG A;  2R45 A;  4GC5 A;  2LXE A;  1IY2 A;  4LF7 M;  4BB9 A;  2ZAN A;  2CE7 A;  3TE6 A;  3CF6 E;  5ITR A;  4QOZ C;  3R8F A;  1HT2 E;  1IXZ A;  3HGI A;  4OVZ B;  1K82 A;  4M0W A;  3QWL A;  4CGY B;  3HU3 A;  2G5G X;  4MH0 E;  3K2L A;  1W5S A;  1G41 A;  1IBL M;  4AW4 A;  3FUW A;  4KOD A;  4B3T M;  2DWM A;  4G4O A;  3K92 A;  1K3X A;  1QYR A;  3PNY A;  3KS8 A;  4Z8X A;  1N36 M;  5EQT A;  3U6C A;  4AKH A;  3FUX A;  4Z6Y A;  4DV1 M;  5EP3 A;  4IBK A;  5KQD A;  2CV0 A;  2XF3 A;  5JI2 E;  1E9S A;  1HQC A;  5KQ8 A;  1HQY E;  2BNK A;  5H37 D;  3TL4 X;  1K3W A;  3KOX E;  4MGI E;  5DNY A;  3SAU A;  3E9S A;  4PT5 A;  4KLN A;  4MM3 B;  2L09 A;  3U6Q A;  4LF9 M;  2YFQ A;  3A46 A;  4LJ6 A;  3GPY A;  2QPA A;  1SXJ A;  2BJW A;  2YQZ A;  2XEP A;  1MX0 A;  3AFH A;  5E26 A;  1QZM A;  4L15 A;  1TDZ A;  4K0K M;  3PXG A;  3FD9 A;  1G3I A;  2XFS A;  3GRR A;  4GHL A;  3SBJ A;  4GMQ A;  1WXQ A;  4GC9 A;  2FFJ A;  1N77 A;  4I5S A;  4B7F A;  3FUU A;  4NL4 H;  4FCV A;  5FTM A;  3KOW E;  5KPZ A;  3GRY A;  1GL6 A;  3VDP A;  3AKZ A;  4JI1 M;  5FTN A;  5KO3 A;  1JR3 A;  4AI6 A;  3TQS A;  4S12 A;  2OQ4 A;  3U6D A;  1L1T A;  4ZPX A;  5DYI A;  3SC3 A;  3D8B A;  4REZ A;  3RE8 A;  1G59 A;  1X37 A;  3FTC A;  4OX9 M;  4DR1 M;  1H6U A;  2DHR A;  3U5Z B;  5EP1 A;  2A5Y B;  8CAT A;  4IBB A;  4IBG A;  1G8P A;  1GL7 A;  4G4N A;  1DO2 A;  1Z6T A;  5EJC A;  4X65 M;  5LMU M;  3ZH9 B;  5ITU A;  4DV6 M;  3T1H M;  1N33 M;  3NWL A;  4JI5 M;  4M9S A;  2KEB A;  3LVV A;  1HNX M;  2ZAO A;  3U6S A;  1XNQ M;  4HL4 A;  4NXM M;  1NJF A;  3A45 A;  1R2Z A;  4JI7 M;  3L25 A;  2YNM D;  2F5N A;  2Z7J A;  2X49 A;  4LJ4 A;  5DYG A;  3EIE A;  1E9R A;  5ITT A;  1PJI A;  4R7G A;  3AOE A;  4LJA A;  3H4M A;  2C9O A;  4DR3 M;  1XXH B;  1XNR M;  3DFZ A;  4II7 A;  2J7N A;  4FWG A;  3HHW A;  3AV0 A;  2FOI C;  2QEN A;  3VKH A;  2BJV A;  2CUZ A;  3GPP A;  1EE8 A;  4CIS A;  3TPZ A;  3AL0 C;  1OFI A;  4L8R C;  3KSJ A;  5ITY A;  4IBE A;  4NOO B;  3U61 B;  4ITQ A;  2R4J A;  2ZAM A;  3KSX A;  2CHV A;  4QHT A;  4KHP M;  4LG2 A;  1TH3 A;  2Y20 A;  4I8O A;  3CF0 A;  1ORY B;  3GLG B;  3MJ5 A;  4OW0 A;  3HWS A;  4M9X A;  1Z5B A;  1D2N A;  3HJ8 A;  4PD2 A;  2M5Z A;  3U60 A;  3U6E A;  2Y21 A;  4XBO A;  4MB7 A;  2L7H A;  3J80 S;  4AQY M;  1QQW A;  3SMP A;  1NY5 A;  2KRK A;  4I81 A;  3WHL A;  1XHB A;  4JI3 M;  4JI4 M;  5FTL A;  1IXS B;  4GHA A;  1IN8 A;  2DXI A;  4XGI A;  2Z4S A;  1KFV A;  5KPR A;  2HL7 A;  2KA6 B;  3KOZ E;  1T3T A;  4PCZ A;  1SXJ D;  1C1K A;  4AKG A;  1I94 M;  1IY0 A;  3JR5 A;  3I4V A;  4DV5 M;  3SAT A;  3U6M A;  1ZQ9 A;  2UUB M;  1HT1 E;  1XMQ M;  1DGH B;  3UMM A;  5ITX A;  4LZJ A;  5IT9 S;  4IIW A;  3KP1 E;  3JAM S;  1IM2 A;  4IBI A;  1FJG M;  3GLF A;  3L28 A;  1S3S A;  2FE8 A;  5FLX S;  1JQJ C;  4JN6 A;  1GKI A;  2V1C A;  3HHY A;  2NQ8 C;  3GO8 A;  4LY6 A;  5ITQ A;  1IN7 A;  1NY6 A;  2HCB A;  2D7E A;  3W0L B;  4AKI A;  1JR3 D;  1N78 A;  2DZN B;  3KFU G;  4BLC A;  3UZU A;  1Q3B A;  2HKJ A;  1QAO A;  4A3V B;  3FTE A;  3AJI B;  4JYA M;  3LMM A;  4NRV A;  2I7N A;  2UUC M;  3CTW B;  3SAR A;  5C18 A;  4LFC M;  1GVN A;  4AG5 A;  3GQ5 A;  2QBY A;  2KZS A;  2L6O A;  3K1J A;  3THG A;  2LWX A;  4LFA M;  1NJG A;  2UXB M;  1SXJ C;  2R18 A;  2XGN A;  2XZF A;  4DV2 M;  2C9C A;  3E4R A;  4IBJ A;  1SXJ E;  3GLH A;  1NHW C;  3FTD A;  2EO2 A;  4GIP A;  3FTF A;  2RKO A;  2F5P A;  5BR8 M;  2XSZ D;  3MHV C;  2C5R A;  4GKK M;  3L26 A;  1XMO M;  3NBI A;  4G4R A;  1IQP A;  3KDS E;  5C1B A;  2DWZ B;  2KW0 A;  2J7O A;  1KSF X;  4B7H A;  3W0F A;  4FWD A;  4LJ7 A;  4WW0 A;  4WUR A;  3PFI A;  4DR4 M;  3GLI A;  3U61 A;  2L7I A;  3DZD A;  4PDG A;  4CHT B;  3LVW A;  3I51 A;  3FYC A;  3KW6 A;  1N34 M;  4IJE A;  1YSY A;  2XH9 A;  4LJ5 A;  3C58 A;  4JI0 M;  1Q39 A;  3RGP A;  2V1U A;  1TH4 A;  3TWK A;  2QZ4 A;  2JA2 A;  1Q3C A;  2C98 A;  3FUT A;  4QOS A;  5LMN M;  1J5E M;  4JI8 M;  1SXJ B;  4FCW A;  2XSZ A;  1MU5 A;  3VKG A;  1R7R A;  4LJ8 A;  3ZC7 B;  2F4V M;  2KZU A;  3L29 A;  4FCT A;  5FTK A;  3LQQ A;  4MGK E;  3UJN A;  1PJJ A;  4MGY E;  5BPV A;  2C99 A;  3UGJ A;  3J81 S;  4DR2 M;  3HKP A;  1DGB A;  3IG8 A;  4OVZ A;  2CV2 A;  1QAQ A;  1OJL A;  3UK6 A;  4LZZ A;  2OPF A;  3VFD A;  1DGF A;  4P16 A;  3GP1 A;  3U6L A;  4D82 A;  1N75 A;  1Z5C A;  2F5Q A;  5FSW A;  1N32 M;  4B08 A;  3M6A A;  1E94 E;  2K47 A;  1L2B A;  2FNA A;  2X4A A;  3VK7 A;  2RGO A;  4NXN M;  4JI6 M;  4I4L A;  1DO0 A;  2KRU A;  3L2A A;  2G8L A;  2D7G A;  5F3W A;  3GPX A;  4JI2 M;  3AOE C;  3AOG A;  2VII A;  1Z5A A;  3T1Y M;  2CHQ A;  5E6J A;  1L2D A;  3HJS A;  4L78 A;  3FUV A;  3ILK A;  3J7A S;  1NSF A;  4DUY M;  2DZO B;  4LGY A;  2R65 A;  3Q8X A;  2ZBK B;  1NVM A;  1QAM A;  2UXD M;  2M60 A;  2F5S A;  3KOY E;  3SAW A;  4JXJ A;  1LV7 A;  2E5L M;  4LJ9 A;  4D80 A;  4D81 A;  3TWM A;  2D7H A;  3WHK A;  5JI3 E;  5KPT A;  4B3S M;  4LRT A;  4MGH A;  3KXE C;  4FW9 A;  4IBD A;  4NRW A;  4AZF A;  3KS4 A;  4KO8 A;  2Y0T A;  2AHM A;  4DR5 M;  4FD2 A;  1L2C A;  4LGM A;  4NSO B;  1IY1 A;  2XLJ A;  1G4A E;  2QCU A;  1Z59 A;  4R3D A;  1E32 A;  1NNU C;  1QVR A;  3DOA A;  1J09 A;  3PVS A;  2Z3X A;  1NNJ A;  4IJF A;  3IG5 A;  1HNW M;  2DWN A;  1YUB A;  5EP4 A;  4HLQ A;  3TWL A;  4DV0 M;  4B3M M;  1PM5 A;  5ITX E;  4QNM A;  1VDD A;  1DGG A;  1GLN A;  3U5Z A;  3L27 A;  2EUC A;  3VDU A;  3U60 B;  4LCB A;  3J27 B;  3A42 A;  3A98 B;  5EXT A;  2H1R A;  3DA1 A;  3K8Z A;  3HU1 A;  3SYK A;  1TDH A;  3FYD A;  3JR4 A;  2YR0 A;  2LNH C;  1XC8 A;  2RGH A;  4G6Z A;  3SMS A;  3R9X B;  2CFO A;  4LF6 M;  4GH9 A;  2C96 A;  4FVM A;  1FNN A;  3VK8 A;  3GPU A;  1TGU A;  4DR7 M;  4QHS A;  2Y0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...