4OX9M

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ox9M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ox9M02
4G4NA 4DUYM 2UUAM 1PJIA 3U6PA 1PJJA 4B3RM 4X65M 4K0KM 4JI5M 3SARA 1FJGM 2F5NA 1R2YA 1Z5CA 3TWLA 4DV2M 1EE8A 4DV7M 4NRWA 5IT9S 3J80S 3VK7A 2VQEM 3A42A 4NXMM 1TDHA 5LMUM 4DV4M 4PD2A 3DOAA 3U6LA 2UXBM 3TWKA 1N34M 4LFAM 1N36M 2F5PA 1R2ZA 3U6QA 4KHPM 1Q39A 1HNZM 4JYAM 2XZFA 4LF4M 4X64M 1MX0A 5ITYA 1L2DA 4DR6M 3SATA 4ITQA 4LF5M 2UXDM 3W0FA 3SAWA 1TDZA 4DR5M 3GPXA 4NXNM 4JI6M 3TWMA 1N32M 3GPUA 1Z59A 5LMNM 4PCZA 1HNXM 1Z5AA 4JI0M 3VK8A 1IBKM 4X62M 5A2QS 3GQ4A 4JI4M 1IBLM 4GKJM 2VQFM 1XMQM 1KFVA 2ZM6M 5ITTA 3SBJA 5ITXA 1XMOM 1MU5A 4G4QA 4DR4M 4DV1M 3U6SA 4G4OA 2OQ4A 4DV0M 2ZBKB 5ITXE 5ITRA 2F4VM 1Q3BA 4GKKM 2UUBM 4PDIA 4YHHM 3A46A 2HKJA 2UUCM 4LF9M 3JR4A 4DR2M 2Q2EB 2UXCM 4OX9M 1PM5A 4B3SM 4DR7M 1HNWM 4LFCM 3GPYA 1J5EM 1L2CA 4JV5M 3J81S 3GQ5A 4LF8M 1I94M 2XZUA 1XNQM 3GPPA 3C58A 4DUZM 3JR5A 4MB7A 3U6OA 2UU9M 4LF6M 5ITQA 3A45A 3T1YM 1Q3CA 1XNRM 4CISA 1N33M 4JI8M 5IWAM 2E5LM 3SASA 2F5SA 4AQYM 3GQ3A 4NRVA 1K82A 3SAVA 4YY3M 4B3MM 3U6CA 4X66M 4LFBM 3SAUA 1HR0M 4B3TM 4DR3M 3J7AS 4JI7M 1L1ZA 4DV6M 4LF7M 5ITUA 2F5OA 3OTOM 1IBMM 1L1TA 4PDGA 2F5QA 5FLXS 3GO8A 1K3WA 1K3XA 3JAMS 4JI3M 1XC8A 2HHHM 4JI1M 3T1HM 3U6DA 2OPFA 1Z5BA 4DR1M 5BR8M 4G4RA 2EA0A 3U6EA 3U6MA 4DV3M 1L2BA 3GP1A 1NNJA 4DV5M 4JI2M
chains in the Genus database with same CATH superfamily
1ZMVA 4DUYM 3T6PA 3HU1A 3KVWA 5EXXA 3U6PA 2ZTDA 3FTFA 3Q8XA 3AKZA 3T38A 3ZC7B 4NL4H 2XF3A 2XEPA 4MH0E 2V6ZM 1PJTA 4WURA 1SG9A 3BOSA 1IN5A 2L7HA 4M9XA 1GLNA 1SXJB 1G71A 4GMQA 3J80S 1DO0A 5KPZA 5BPVA 2QBYB 3FE3A 3QWLA 2VQEM 3A42A 4IBBA 1VEGA 4DV4M 4NXMM 4LJ5A 2CV1A 2CEAA 2Y0QA 1IY1A 4FWHA 3AJIB 4RF1A 3TWKA 1OKSA 4AZFA 2JY8A 1N36M 2F5PA 2LHGA 4BBAA 1CUKA 1GL7A 5KPRA 4JYAM 3I04M 4LF4M 1NV8A 1TGUA 4DBGB 4Y28F 1QAOA 3SATA 1R4GA 3L29A 2KNVA 4B7GA 3W0FA 3U61B 3NWLA 4PT5A 1TF0B 5EQTA 2H5XA 4IBEA 3VKHA 3TWMA 1LV7A 2R65A 1QZMA 2RGHA 3I01M 3DZDA 4PCZA 3GRUA 1Z5AA 1J7KA 5A2QS 3GQ4A 2LVPC 4IBFA 1C7YA 1EIJA 4CGYB 3GRYA 1H6UA 4GKJM 3I4VA 1R7RA 5E26A 5EP4A 2VQFM 4JN6A 3HWSA 5ITTA 2C9CA 1YLAA 4LY6A 4D81A 1PJSA 4D80A 1HT2E 4G4QA 1IXZA 2EJSA 3T15A 2DI0A 1D0KA 1JR3A 1PJQA 4L16A 2O25A 1Q3BA 3PNVA 4FCVA 3UMMA 4LRTA 1OIPA 2KRUA 4YHHM 1JR3E 1AIPC 2UUCM 3JR4A 2LNHC 4QOZC 1TH2A 4OX9M 1XXHB 2GQFA 2DWZB 4LRSA 4LFCM 3GPYA 5FTJA 1L2CA 4JV5M 1E9SA 2BJWA 1T6OA 2XZUA 3E46A 2ERCA 3C58A 1IQPA 3U6OA 3KOWE 4B08A 4LF6M 4CHTB 4OU7A 2YR0A 2LXEA 4NSOB 4I8OA 2G8LA 4QNRA 4AW4A 1MJGM 1ORYB 3K2LA 3FUTA 1QANA 1DGHB 1JR3D 2JZ1A 4JI8M 4GHLA 2XFSA 5IWAM 3HHWA 2O01F 4IBKA 1DO2A 2KDLA 1K82A 3SAVA 3K9PA 1OQYA 3LCUA 3SMSA 5L8RF 3J27B 1WHCA 1YUBA 4M9SA 1L1ZA 1DGGA 4L15A 2QQ8A 2F5OA 4GC9A 3GRRA 3OTOM 4LJ4A 3LQQA 3ZQJA 1TH3A 2LTUA 4L4UA 3GLFA 1XC8A 5F3WA 3VFDA 1OFIA 2DHRA 2LVQD 3HX3A 2FOIC 3LMMA 2VDBB 1IN4A 2DWNA 1A5TA 1NY5A 2HAKA 1WGNA 3FUUA 3GLFE 3RE8A 3GP1A 1NNJA 3D8LA 3KOZE 3LCVB 3FYDA 2DVWB 3B89A 3IG5A 3GLGB 4MGHA 5FSWA 2C96A 3IHPA 3UK6A 1PJJA 1E32A 1T3TA 2R46A 3C9PA 4X65M 3AOGA 4LJ7A 2CV2A 1GABA 4P16A 2FS1A 1R2YA 1NNUC 3HKPA 3TWLA 1EE8A 4IJFA 5KPTA 4DV7M 1QDTA 1NHWC 4B7FA 2FFJA 5DYIA 1VDLA 2XSZD 3K1JA 3PFIA 2JY7A 3NBXX 1QZEA 1NJGA 1G8PA 2X49A 3HGIA 4OVZB 2DWLA 2Y21A 4IBCA 4PD2A 5C1BA 3U6LA 3KOYE 3ZCBB 2BJVA 3AV0A 4LFAM 5EP3A 7CATA 2DWMA 3U6QA 4KHPM 1HNZM 4MM3B 1XHBA 4M9ZA 3SYLA 2R44A 3KXEC 3KS4A 5ITYA 2V1UA 4DR6M 3U60B 4LF5M 3IECA 1HQYE 5DYGA 2W82A 2KZUA 1TDZA 2MJ5B 1VG5A 5FTKA 4GC5A 3GPUA 2K6BA 2MH8A 3MHVC 4JI4M 1TTEA 3AOEC 4X62M 3U5ZA 3M7GA 3RFWA 2QNJA 3J7BA 3GLIB 1G4AE 4QOSA 4KLNA 2ZM6M 1QVRA 2BWEA 2O5RA 1RU3A 3UJNA 1D0MA 3FKEA 3MMPA 3B9PA 3K8ZA 1EFUB 3VLFB 4DV1M 1QAQA 2D7HA 2APLA 3AFHA 2ZBKB 3FYCA 3CF0A 2UUBM 2DZLA 1R5LA 3E4RA 2NQ8C 4LJ9A 2X4AA 2L4EA 1QUTA 2HKJA 3A46A 1D2NA 2BNKA 2UXCM 2DXIA 1W5SA 2OOAA 1N75A 2FH0A 1IXSA 2KNAA 1GO5A 1NHGC 3BXWA 1VDDA 2C9OA 5H37D 3J81S 3L25A 1OIZA 2OOBA 4II7A 3JR5A 1P3QQ 3EIHA 5C18A 2JNHA 1Q3CA 5GKNA 1FNNA 4JXJA 4UN2B 2M5ZA 2CWBA 2LHCA 1IY0A 4CISA 3LVVA 1N33M 3PVSA 3W0LB 2JUJA 2CE7A 2CHQA 3FUXA 2RGOA 3GQ3A 3H4MA 3H4JA 4YY3M 4NSRA 4HLQA 3UZUA 5KO3A 4AG5A 3U6CA 1GJSA 4IJEA 2CHVA 4B3TM 3CF2A 1F4IA 4AG6A 4LF7M 5ITUA 1GKIA 2YQZA 3FRHA 4GITA 3TQSA 1PRBA 4PDGA 2V1CA 2KZSA 4GEWA 4GH9A 5FLXS 4I81A 3HHYA 1JQJC 3GO8A 1K3WA 2QBYA 4F1IA 2HHHM 3HJSA 2CHGA 1YSYA 4GHAA 1SXJE 3WHKA 4DR1M 5BR8M 3U6EA 3U6MA 2R62A 2QENA 4IBGA 1L2BA 5IT9S 3SHFA 4AKGA 4DV5M 4IBDA 1Q02A 2UUAM 4R7GA 5FTMA 3E9SA 1WJ7A 2Y0TA 3FTEA 1OFHA 4JI5M 2HCBA 3SARA 2VIIA 4M0WA 1FJGM 2F5NA 3DA1A 3GLHA 3VDPA 3QYEA 3HHXA 1G41A 4DV2M 4NRWA 3KOXE 4XK8F 2KA6B 3A98B 3TL4X 3GLHE 2LVOC 5EJCA 3V76A 1LTMA 2CP8A 2MROB 3VK7A 4AI6A 2LVAA 4RNAA 3SFZA 1TDHA 5LMUM 1SXJC 3UGJA 1X37A 3I51A 2HL7A 2JA2A 2QSFX 3DOAA 4QHTA 3THGA 1IFYA 3E21A 2J5YA 3B7QA 4MGIE 1R2ZA 4LG2A 1VQ1A 1Q39A 2EKKA 2XZFA 1ZQ9A 2CFOA 4L78A 3ILKA 4XBOA 2L7IA 2ZTCA 3SHGB 2LVNC 3FRIA 3SAWA 4AKHA 2QHOB 4LGYA 2EO2A 4MGZE 4HEOA 3GPXA 4JI6M 2M60A 1ZAEA 5DFLA 4HL4A 4LZJA 1DV0A 3U5ZB 4QNMA 3AOEA 1IN8A 1XXHA 1HNXM 1IBKM 3VK8A 4Z8XA 3M6AA 4KT0F 1IBLM 1XXHE 5KQDA 3M0EA 2CRUA 4L6V6 1XMQM 3KSXA 1KFVA 5EP2A 5ITXA 3TPZA 2L09A 4MGYE 5IREB 1DGFA 1OAIA 3KDSE 1XMOM 1IM2A 4DR4M 1OTRA 3U6SA 4G4OA 2OQ4A 4WP2A 4ZPXA 5ITXE 1DGHA 2EUCA 5ITRA 2R18A 2MR9A 2F4VM 3B7ZA 4PDIA 1HQCA 2P5TA 2XGNA 2Q2EB 2Z7JA 1IXRC 3FTDA 2R4EA 3FUWA 3HZJA 1PGYA 4A3VB 4B3SM 3SMPA 2X8AA 3L2AA 1UM8A 1QQWA 1J5EM 2DENA 1Y8GA 1MN3A 1OAOC 1I4WA 2I7NA 3VDUA 1WXQA 3CGWA 5IZ7D 3GQ5A 1XNQM 3GPPA 2KW0A 4DUZM 4F2LA 1ZMWA 4MB7A 1YE9A 5ITQA 3A45A 2KEBA 3W68A 5EXPA 2YFQA 1VEKA 3J2PB 1GJTA 2AHMA 2I7PA 1J09A 2N35A 2ZANA 4B7HA 3GLGA 3SASA 3QYBA 2D7EA 2XH9A 2QCUA 1QUSA 3IG8A 4FWGA 2WZJA 1QAMA 4G6ZA 5EXSA 1TR8A 3D8BA 1G3IA 4X66M 3GLGE 4B3MM 4LFBM 1HR0M 2WSFF 3KP1E 4DR3M 4LGMA 4JI7M 3J7AS 2DKLA 4NC6A 5EXTA 3PXGA 4DV6M 3R9XB 2DAEA 2BWBA 2MGWA 2VF8A 3NBIA 1IBMM 2JP7A 3HJ8A 2KHHA 3TE6A 1L1TA 8CATA 3R8FA 2F5QA 5JI2E 4EIWA 1Z6TA 4JI3M 4MGKE 4W5WA 3WHLA 4BB9A 1QDRA 2J7NA 4JI1M 2J7OA 4OVZA 3U6DA 4TUWA 2OPFA 1Z5BA 4G4RA 4LCBA 4DV3M 4ITQA 4XGIA 3HJQA 4JI2M 2Z4SA 4LZZA 2R6FA 3FD9A 4G4NA 2WSCF 2ZAOA 1PJIA 4GIPA 1HT1E 2DZOB 2OO9A 3L26A 1NJFA 1T43A 3LQRA 5DNYA 1V33A 2L6OA 2EKFA 3GLHB 2HWJA 3KW6A 1TH4A 4FCTA 3SC3A 1ZV1A 4B3RM 4K0KM 3SYKA 2JZ0A 1Z5CA 4FD2A 3LW5F 5E6JA 2CUZA 4IIWA 2LBCA 3CTWB 4FWDA 4AKIA 4WW0A 1N78A 1HJPA 1JB0F 2Z3XA 1BVSA 1G59A 3HU2A 2B3TA 3PNYA 5JI3E 4D82A 3GLFB 1SXJA 4ANRA 1NV9A 2QZ4A 4OW0A 2JWSA 2DNAA 2G3QA 4CIZA 3HY5A 2Y20A 1OJLA 3AL0C 3RGSA 3GLIA 2C99A 2XFTA 3GRVA 4LJAA 1AUAA 1N77A 1N34M 2FNAA 3HU3A 3ZH9B 5KQ8A 3KFUG 3HHZA 4S12A 3GLIE 3MK6A 4FW9A 1D0LA 1DGBA 1S3SA 1MX0A 2L2DA 2YNMD 4IBIA 2Z4RA 4X64M 1L2DA 4NOOB 3C3DA 3VKGA 2UXDM 2KRKA 3B7NA 4M0DA 2JY6B 2R0IA 3L28A 3FTCA 2UXBM 4DR5M 2C98A 4NXNM 3BBZA 3K9OA 3U61A 1N32M 1E94E 1R6BX 1Z59A 4P17A 1NY6A 5LMNM 3U60A 1UFZA 1C1KA 1NVMA 3QAUA 4I4LA 4JI0M 4R3DA 1IN7A 1SXJD 1XB2B 2LWXA 3L27A 3CF6E 2D7GA 3KSJA 3W67A 2WSEF 4G3OA 4KO8A 3KP0E 1KYIA 2R4JA 2LH0A 3EIEA 3SBJA 3KS8A 2VF7A 3RGPA 1MU5A 3C3EA 1IN6A 1WR1B 2K47A 2G5GX 2JY5A 2R45A 1IY2A 2H1RA 2QP9X 3B74A 3I4YA 4R71A 4DV0M 4L8RC 4GKKM 3DFZA 2CV0A 2RKOA 2C5RA 4LF9M 2DAIA 2ZAMA 4DR2M 3K92A 5FTLA 3LVWA 1PM5A 2JXNA 3MJ5A 2KNZA 4DR7M 1E9RA 1HNWM 2K0BX 2XSZA 4RF0A 1ZMUA 3FUVA 4Z6YA 4LF8M 1I94M 2QPAA 1V34A 2A5YB 2RRUA 1KSFX 2UU9M 1NSFA 4BLCA 5EP1A 1WGLA 2L4FA 3T1YM 1XNRM 2FE8A 4Q7JA 4CJ6A 1W5TA 4LJ8A 2DHYA 2E5LM 4QHSA 2DAGA 2Z8YM 2F5SA 2K9DA 4LJ6A 4AQYM 4NRVA 2XLJA 4FCWA 4KODA 2DAMA 3F92A 1L8QA 2DZNB 2KXEA 3SAUA 1VEJA 1NO1A 4RKUF 1IXSB 1GVNA 4GRIA 2GNOA 1GL6A 1XWIA 4IBJA 1K3XA 3Q8GA 3JAMS 4REZA 2DAKA 4FVMA 3T1HM 1QYRA 2EA0A 4I5SA 1V92A 5FTNA 1WIVA
chains in the Genus database with same CATH topology
4DUYM 3HU1A 3KVWA 5EXXA 3U6PA 3FTFA 3Q8XA 3AKZA 3T38A 3ZC7B 4NL4H 2XF3A 2XEPA 4MH0E 2V6ZM 4WURA 3BOSA 1IN5A 2L7HA 4M9XA 1GLNA 1SXJB 3J80S 4GMQA 5KPZA 1DO0A 2QBYB 5BPVA 3QWLA 2VQEM 3A42A 4IBBA 4NXMM 4DV4M 4LJ5A 2CV1A 2CEAA 2Y0QA 1IY1A 4FWHA 3AJIB 4RF1A 3TWKA 4AZFA 1N36M 2F5PA 4BBAA 1GL7A 5KPRA 4JYAM 4LF4M 1TGUA 3SATA 1QAOA 3L29A 4B7GA 3W0FA 3U61B 3NWLA 4PT5A 5EQTA 4IBEA 3VKHA 3TWMA 1LV7A 2R65A 1QZMA 2RGHA 3DZDA 4PCZA 3GRUA 1Z5AA 1J7KA 5A2QS 3GQ4A 4IBFA 4CGYB 3GRYA 1H6UA 4GKJM 3I4VA 1R7RA 5E26A 5EP4A 2VQFM 4JN6A 3HWSA 5ITTA 2C9CA 4LY6A 4D81A 4D80A 1HT2E 4G4QA 1IXZA 3T15A 1JR3A 4L16A 1Q3BA 3PNVA 4FCVA 3UMMA 4LRTA 2KRUA 4YHHM 2UUCM 3JR4A 2LNHC 4QOZC 1TH2A 4OX9M 1XXHB 2DWZB 4LRSA 4LFCM 3GPYA 5FTJA 1L2CA 4JV5M 1E9SA 2BJWA 2XZUA 2ERCA 3C58A 1IQPA 3U6OA 3KOWE 4B08A 4LF6M 4CHTB 4OU7A 2YR0A 2LXEA 4NSOB 4I8OA 2G8LA 4QNRA 4AW4A 1ORYB 3K2LA 3FUTA 1QANA 1DGHB 1JR3D 4JI8M 4GHLA 2XFSA 5IWAM 3HHWA 4IBKA 1DO2A 1K82A 3SAVA 3SMSA 3J27B 1YUBA 4M9SA 1L1ZA 1DGGA 4L15A 2F5OA 4GC9A 3GRRA 3OTOM 4LJ4A 3LQQA 1TH3A 1XC8A 4L4UA 3GLFA 5F3WA 3VFDA 1OFIA 2DHRA 2FOIC 3LMMA 1IN4A 2DWNA 1NY5A 3FUUA 3RE8A 3GP1A 1NNJA 3D8LA 3KOZE 3FYDA 2DVWB 3IG5A 3GLGB 4MGHA 5FSWA 2C96A 3UK6A 1PJJA 1E32A 1T3TA 2R46A 4X65M 3AOGA 4LJ7A 2CV2A 4P16A 1R2YA 1NNUC 3HKPA 3TWLA 1EE8A 4IJFA 5KPTA 4DV7M 1NHWC 4B7FA 2FFJA 5DYIA 2XSZD 3K1JA 3PFIA 3HGIA 1NJGA 1G8PA 2X49A 2DWLA 4OVZB 2Y21A 4IBCA 4PD2A 5C1BA 3U6LA 3KOYE 3ZCBB 2BJVA 3AV0A 4LFAM 5EP3A 7CATA 2DWMA 3U6QA 4KHPM 1HNZM 4MM3B 1XHBA 4M9ZA 3SYLA 3KXEC 3KS4A 5ITYA 2V1UA 4DR6M 3U60B 4LF5M 1HQYE 5DYGA 2W82A 2KZUA 1TDZA 5FTKA 4GC5A 3GPUA 3MHVC 4JI4M 3AOEC 4X62M 3U5ZA 3M7GA 3RFWA 3J7BA 3GLIB 1G4AE 4QOSA 4KLNA 2ZM6M 1QVRA 2O5RA 3UJNA 3FKEA 3B9PA 3K8ZA 3VLFB 4DV1M 1QAQA 2D7HA 3FYCA 2ZBKB 3AFHA 3CF0A 2UUBM 3E4RA 2NQ8C 4LJ9A 2X4AA 3A46A 2HKJA 1D2NA 2BNKA 2UXCM 2DXIA 1W5SA 1N75A 1NHGC 5H37D 1VDDA 2C9OA 3J81S 3L25A 4II7A 3JR5A 3EIHA 5C18A 1Q3CA 5GKNA 1FNNA 4JXJA 2M5ZA 4CISA 1IY0A 1N33M 3LVVA 3PVSA 3W0LB 2CE7A 2CHQA 3FUXA 2RGOA 3GQ3A 3H4MA 4YY3M 4NSRA 4HLQA 3UZUA 5KO3A 4AG5A 3U6CA 4IJEA 2CHVA 4B3TM 3CF2A 4AG6A 4LF7M 5ITUA 1GKIA 2YQZA 4GITA 3TQSA 4PDGA 2V1CA 2KZSA 4GH9A 5FLXS 2QBYA 4I81A 3HHYA 1JQJC 3GO8A 1K3WA 2HHHM 3HJSA 2CHGA 1YSYA 4GHAA 1SXJE 3WHKA 4DR1M 5BR8M 3U6EA 3U6MA 2R62A 2QENA 4IBGA 1L2BA 5IT9S 3SHFA 4AKGA 4DV5M 4IBDA 2UUAM 4R7GA 5FTMA 3E9SA 2Y0TA 3FTEA 1OFHA 4JI5M 2HCBA 3SARA 2VIIA 4M0WA 1FJGM 2F5NA 3DA1A 3GLHA 3VDPA 4DV2M 3HHXA 1G41A 4NRWA 3KOXE 2KA6B 3A98B 3TL4X 5EJCA 3VK7A 4AI6A 4RNAA 3SFZA 1TDHA 5LMUM 1SXJC 3UGJA 1X37A 3I51A 2HL7A 2JA2A 3DOAA 4QHTA 3THGA 4MGIE 1R2ZA 4LG2A 1Q39A 2XZFA 1ZQ9A 2CFOA 4L78A 3ILKA 4XBOA 2L7IA 3SHGB 3SAWA 4AKHA 4LGYA 2EO2A 4MGZE 3GPXA 4JI6M 2M60A 1ZAEA 4HL4A 4LZJA 3U5ZB 4QNMA 3AOEA 1IN8A 1XXHA 1HNXM 1IBKM 3VK8A 4Z8XA 3M6AA 1IBLM 5KQDA 3M0EA 1XMQM 3KSXA 1KFVA 5EP2A 5ITXA 3TPZA 2L09A 4MGYE 5IREB 1DGFA 3KDSE 1XMOM 4DR4M 1IM2A 3U6SA 4G4OA 2OQ4A 4ZPXA 5ITXE 1DGHA 2EUCA 5ITRA 2R18A 2F4VM 4PDIA 1HQCA 2P5TA 2XGNA 3FUWA 2Q2EB 1IXRC 2Z7JA 2R4EA 3FTDA 4A3VB 4B3SM 3SMPA 2X8AA 3L2AA 1UM8A 1QQWA 1J5EM 3VDUA 2I7NA 1I4WA 3GQ5A 1WXQA 5IZ7D 1XNQM 3GPPA 2KW0A 4DUZM 4MB7A 1YE9A 5ITQA 3A45A 2KEBA 5EXPA 2YFQA 3J2PB 2AHMA 2I7PA 1J09A 4B7HA 2ZANA 3GLGA 3SASA 2D7EA 2XH9A 2QCUA 3IG8A 4FWGA 1QAMA 4G6ZA 5EXSA 3D8BA 4B3MM 1G3IA 4X66M 4LFBM 1HR0M 3KP1E 4DR3M 4LGMA 4JI7M 3J7AS 5EXTA 3PXGA 4DV6M 3R9XB 3NBIA 1IBMM 3HJ8A 3TE6A 1L1TA 2F5QA 8CATA 3R8FA 5JI2E 4EIWA 1Z6TA 4JI3M 4MGKE 4W5WA 3WHLA 4BB9A 4JI1M 2J7NA 4TUWA 2J7OA 4OVZA 3U6DA 2OPFA 1Z5BA 4G4RA 4LCBA 4DV3M 4ITQA 4XGIA 3HJQA 4JI2M 2Z4SA 4LZZA 3FD9A 4G4NA 2ZAOA 1PJIA 4GIPA 1HT1E 2DZOB 3L26A 1NJFA 3LQRA 5DNYA 3U60A 2L6OA 3GLHB 3KW6A 3SC3A 1TH4A 4FCTA 4B3RM 4K0KM 3SYKA 1Z5CA 4FD2A 5E6JA 2CUZA 4IIWA 3CTWB 4FWDA 4AKIA 4WW0A 1N78A 1G59A 2Z3XA 3HU2A 5JI3E 3PNYA 4D82A 3GLFB 1SXJA 2QZ4A 4OW0A 3AL0C 2Y20A 1OJLA 3RGSA 3GLIA 2C99A 2XFTA 3GRVA 4LJAA 1N77A 1N34M 2UXBM 2FNAA 3HU3A 3ZH9B 5KQ8A 3KFUG 3HHZA 4S12A 3MK6A 4FW9A 1S3SA 1DGBA 2YNMD 1MX0A 4IBIA 4X64M 1L2DA 2Z4RA 4NOOB 3VKGA 2UXDM 2KRKA 4M0DA 3L28A 3FTCA 4DR5M 2C98A 4NXNM 3U61A 1N32M 1E94E 1R6BX 1Z59A 5LMNM 1NY6A 1C1KA 1NVMA 3QAUA 4I4LA 4JI0M 4R3DA 1IN7A 1SXJD 2LWXA 3L27A 3CF6E 2D7GA 3KSJA 4KO8A 3KP0E 1KYIA 2R4JA 2LH0A 3EIEA 3SBJA 3KS8A 3RGPA 1MU5A 1IN6A 2K47A 2G5GX 2R45A 1IY2A 2H1RA 2QP9X 3I4YA 4DV0M 4L8RC 4GKKM 3DFZA 2CV0A 2RKOA 2C5RA 4LF9M 2ZAMA 4DR2M 3K92A 5FTLA 3LVWA 1PM5A 3MJ5A 4DR7M 1E9RA 1HNWM 2XSZA 4RF0A 3FUVA 4Z6YA 4LF8M 1I94M 2QPAA 2A5YB 1KSFX 2UU9M 1NSFA 4BLCA 5EP1A 3T1YM 1XNRM 2FE8A 1W5TA 4LJ8A 2E5LM 4QHSA 2F5SA 4LJ6A 4AQYM 4NRVA 2XLJA 4FCWA 4KODA 1L8QA 2DZNB 2KXEA 3SAUA 1IXSB 1GVNA 4GRIA 1GL6A 1XWIA 4IBJA 1K3XA 3JAMS 4REZA 4FVMA 3T1HM 1QYRA 2EA0A 4I5SA 5FTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4N A;  4DUY M;  2UUA M;  1PJI A;  3U6P A;  1PJJ A;  4B3R M;  4X65 M;  4K0K M;  4JI5 M;  3SAR A;  1FJG M;  2F5N A;  1R2Y A;  1Z5C A;  3TWL A;  4DV2 M;  1EE8 A;  4DV7 M;  4NRW A;  5IT9 S;  3J80 S;  3VK7 A;  2VQE M;  3A42 A;  4NXM M;  1TDH A;  5LMU M;  4DV4 M;  4PD2 A;  3DOA A;  3U6L A;  2UXB M;  3TWK A;  1N34 M;  4LFA M;  1N36 M;  2F5P A;  1R2Z A;  3U6Q A;  4KHP M;  1Q39 A;  1HNZ M;  4JYA M;  2XZF A;  4LF4 M;  4X64 M;  1MX0 A;  5ITY A;  1L2D A;  4DR6 M;  3SAT A;  4ITQ A;  4LF5 M;  2UXD M;  3W0F A;  3SAW A;  1TDZ A;  4DR5 M;  3GPX A;  4NXN M;  4JI6 M;  3TWM A;  1N32 M;  3GPU A;  1Z59 A;  5LMN M;  4PCZ A;  1HNX M;  1Z5A A;  4JI0 M;  3VK8 A;  1IBK M;  4X62 M;  5A2Q S;  3GQ4 A;  4JI4 M;  1IBL M;  4GKJ M;  2VQF M;  1XMQ M;  1KFV A;  2ZM6 M;  5ITT A;  3SBJ A;  5ITX A;  1XMO M;  1MU5 A;  4G4Q A;  4DR4 M;  4DV1 M;  3U6S A;  4G4O A;  2OQ4 A;  4DV0 M;  2ZBK B;  5ITX E;  5ITR A;  2F4V M;  1Q3B A;  4GKK M;  2UUB M;  4PDI A;  4YHH M;  3A46 A;  2HKJ A;  2UUC M;  4LF9 M;  3JR4 A;  4DR2 M;  2Q2E B;  2UXC M;  4OX9 M;  1PM5 A;  4B3S M;  4DR7 M;  1HNW M;  4LFC M;  3GPY A;  1J5E M;  1L2C A;  4JV5 M;  3J81 S;  3GQ5 A;  4LF8 M;  1I94 M;  2XZU A;  1XNQ M;  3GPP A;  3C58 A;  4DUZ M;  3JR5 A;  4MB7 A;  3U6O A;  2UU9 M;  4LF6 M;  5ITQ A;  3A45 A;  3T1Y M;  1Q3C A;  1XNR M;  4CIS A;  1N33 M;  4JI8 M;  5IWA M;  2E5L M;  3SAS A;  2F5S A;  4AQY M;  3GQ3 A;  4NRV A;  1K82 A;  3SAV A;  4YY3 M;  4B3M M;  3U6C A;  4X66 M;  4LFB M;  3SAU A;  1HR0 M;  4B3T M;  4DR3 M;  3J7A S;  4JI7 M;  1L1Z A;  4DV6 M;  4LF7 M;  5ITU A;  2F5O A;  3OTO M;  1IBM M;  1L1T A;  4PDG A;  2F5Q A;  5FLX S;  3GO8 A;  1K3W A;  1K3X A;  3JAM S;  4JI3 M;  1XC8 A;  2HHH M;  4JI1 M;  3T1H M;  3U6D A;  2OPF A;  1Z5B A;  4DR1 M;  5BR8 M;  4G4R A;  2EA0 A;  3U6E A;  3U6M A;  4DV3 M;  1L2B A;  3GP1 A;  1NNJ A;  4DV5 M;  4JI2 M; 
#chains in the Genus database with same CATH topology
 1ZMV A;  4DUY M;  3T6P A;  3HU1 A;  3KVW A;  5EXX A;  3U6P A;  2ZTD A;  3FTF A;  3Q8X A;  3AKZ A;  3T38 A;  3ZC7 B;  4NL4 H;  2XF3 A;  2XEP A;  4MH0 E;  2V6Z M;  1PJT A;  4WUR A;  1SG9 A;  3BOS A;  1IN5 A;  2L7H A;  4M9X A;  1GLN A;  1SXJ B;  1G71 A;  4GMQ A;  3J80 S;  1DO0 A;  5KPZ A;  5BPV A;  2QBY B;  3FE3 A;  3QWL A;  2VQE M;  3A42 A;  4IBB A;  1VEG A;  4DV4 M;  4NXM M;  4LJ5 A;  2CV1 A;  2CEA A;  2Y0Q A;  1IY1 A;  4FWH A;  3AJI B;  4RF1 A;  3TWK A;  1OKS A;  4AZF A;  2JY8 A;  1N36 M;  2F5P A;  2LHG A;  4BBA A;  1CUK A;  1GL7 A;  5KPR A;  4JYA M;  3I04 M;  4LF4 M;  1NV8 A;  1TGU A;  4DBG B;  4Y28 F;  1QAO A;  3SAT A;  1R4G A;  3L29 A;  2KNV A;  4B7G A;  3W0F A;  3U61 B;  3NWL A;  4PT5 A;  1TF0 B;  5EQT A;  2H5X A;  4IBE A;  3VKH A;  3TWM A;  1LV7 A;  2R65 A;  1QZM A;  2RGH A;  3I01 M;  3DZD A;  4PCZ A;  3GRU A;  1Z5A A;  1J7K A;  5A2Q S;  3GQ4 A;  2LVP C;  4IBF A;  1C7Y A;  1EIJ A;  4CGY B;  3GRY A;  1H6U A;  4GKJ M;  3I4V A;  1R7R A;  5E26 A;  5EP4 A;  2VQF M;  4JN6 A;  3HWS A;  5ITT A;  2C9C A;  1YLA A;  4LY6 A;  4D81 A;  1PJS A;  4D80 A;  1HT2 E;  4G4Q A;  1IXZ A;  2EJS A;  3T15 A;  2DI0 A;  1D0K A;  1JR3 A;  1PJQ A;  4L16 A;  2O25 A;  1Q3B A;  3PNV A;  4FCV A;  3UMM A;  4LRT A;  1OIP A;  2KRU A;  4YHH M;  1JR3 E;  1AIP C;  2UUC M;  3JR4 A;  2LNH C;  4QOZ C;  1TH2 A;  4OX9 M;  1XXH B;  2GQF A;  2DWZ B;  4LRS A;  4LFC M;  3GPY A;  5FTJ A;  1L2C A;  4JV5 M;  1E9S A;  2BJW A;  1T6O A;  2XZU A;  3E46 A;  2ERC A;  3C58 A;  1IQP A;  3U6O A;  3KOW E;  4B08 A;  4LF6 M;  4CHT B;  4OU7 A;  2YR0 A;  2LXE A;  4NSO B;  4I8O A;  2G8L A;  4QNR A;  4AW4 A;  1MJG M;  1ORY B;  3K2L A;  3FUT A;  1QAN A;  1DGH B;  1JR3 D;  2JZ1 A;  4JI8 M;  4GHL A;  2XFS A;  5IWA M;  3HHW A;  2O01 F;  4IBK A;  1DO2 A;  2KDL A;  1K82 A;  3SAV A;  3K9P A;  1OQY A;  3LCU A;  3SMS A;  5L8R F;  3J27 B;  1WHC A;  1YUB A;  4M9S A;  1L1Z A;  1DGG A;  4L15 A;  2QQ8 A;  2F5O A;  4GC9 A;  3GRR A;  3OTO M;  4LJ4 A;  3LQQ A;  3ZQJ A;  1TH3 A;  2LTU A;  4L4U A;  3GLF A;  1XC8 A;  5F3W A;  3VFD A;  1OFI A;  2DHR A;  2LVQ D;  3HX3 A;  2FOI C;  3LMM A;  2VDB B;  1IN4 A;  2DWN A;  1A5T A;  1NY5 A;  2HAK A;  1WGN A;  3FUU A;  3GLF E;  3RE8 A;  3GP1 A;  1NNJ A;  3D8L A;  3KOZ E;  3LCV B;  3FYD A;  2DVW B;  3B89 A;  3IG5 A;  3GLG B;  4MGH A;  5FSW A;  2C96 A;  3IHP A;  3UK6 A;  1PJJ A;  1E32 A;  1T3T A;  2R46 A;  3C9P A;  4X65 M;  3AOG A;  4LJ7 A;  2CV2 A;  1GAB A;  4P16 A;  2FS1 A;  1R2Y A;  1NNU C;  3HKP A;  3TWL A;  1EE8 A;  4IJF A;  5KPT A;  4DV7 M;  1QDT A;  1NHW C;  4B7F A;  2FFJ A;  5DYI A;  1VDL A;  2XSZ D;  3K1J A;  3PFI A;  2JY7 A;  3NBX X;  1QZE A;  1NJG A;  1G8P A;  2X49 A;  3HGI A;  4OVZ B;  2DWL A;  2Y21 A;  4IBC A;  4PD2 A;  5C1B A;  3U6L A;  3KOY E;  3ZCB B;  2BJV A;  3AV0 A;  4LFA M;  5EP3 A;  7CAT A;  2DWM A;  3U6Q A;  4KHP M;  1HNZ M;  4MM3 B;  1XHB A;  4M9Z A;  3SYL A;  2R44 A;  3KXE C;  3KS4 A;  5ITY A;  2V1U A;  4DR6 M;  3U60 B;  4LF5 M;  3IEC A;  1HQY E;  5DYG A;  2W82 A;  2KZU A;  1TDZ A;  2MJ5 B;  1VG5 A;  5FTK A;  4GC5 A;  3GPU A;  2K6B A;  2MH8 A;  3MHV C;  4JI4 M;  1TTE A;  3AOE C;  4X62 M;  3U5Z A;  3M7G A;  3RFW A;  2QNJ A;  3J7B A;  3GLI B;  1G4A E;  4QOS A;  4KLN A;  2ZM6 M;  1QVR A;  2BWE A;  2O5R A;  1RU3 A;  3UJN A;  1D0M A;  3FKE A;  3MMP A;  3B9P A;  3K8Z A;  1EFU B;  3VLF B;  4DV1 M;  1QAQ A;  2D7H A;  2APL A;  3AFH A;  2ZBK B;  3FYC A;  3CF0 A;  2UUB M;  2DZL A;  1R5L A;  3E4R A;  2NQ8 C;  4LJ9 A;  2X4A A;  2L4E A;  1QUT A;  2HKJ A;  3A46 A;  1D2N A;  2BNK A;  2UXC M;  2DXI A;  1W5S A;  2OOA A;  1N75 A;  2FH0 A;  1IXS A;  2KNA A;  1GO5 A;  1NHG C;  3BXW A;  1VDD A;  2C9O A;  5H37 D;  3J81 S;  3L25 A;  1OIZ A;  2OOB A;  4II7 A;  3JR5 A;  1P3Q Q;  3EIH A;  5C18 A;  2JNH A;  1Q3C A;  5GKN A;  1FNN A;  4JXJ A;  4UN2 B;  2M5Z A;  2CWB A;  2LHC A;  1IY0 A;  4CIS A;  3LVV A;  1N33 M;  3PVS A;  3W0L B;  2JUJ A;  2CE7 A;  2CHQ A;  3FUX A;  2RGO A;  3GQ3 A;  3H4M A;  3H4J A;  4YY3 M;  4NSR A;  4HLQ A;  3UZU A;  5KO3 A;  4AG5 A;  3U6C A;  1GJS A;  4IJE A;  2CHV A;  4B3T M;  3CF2 A;  1F4I A;  4AG6 A;  4LF7 M;  5ITU A;  1GKI A;  2YQZ A;  3FRH A;  4GIT A;  3TQS A;  1PRB A;  4PDG A;  2V1C A;  2KZS A;  4GEW A;  4GH9 A;  5FLX S;  4I81 A;  3HHY A;  1JQJ C;  3GO8 A;  1K3W A;  2QBY A;  4F1I A;  2HHH M;  3HJS A;  2CHG A;  1YSY A;  4GHA A;  1SXJ E;  3WHK A;  4DR1 M;  5BR8 M;  3U6E A;  3U6M A;  2R62 A;  2QEN A;  4IBG A;  1L2B A;  5IT9 S;  3SHF A;  4AKG A;  4DV5 M;  4IBD A;  1Q02 A;  2UUA M;  4R7G A;  5FTM A;  3E9S A;  1WJ7 A;  2Y0T A;  3FTE A;  1OFH A;  4JI5 M;  2HCB A;  3SAR A;  2VII A;  4M0W A;  1FJG M;  2F5N A;  3DA1 A;  3GLH A;  3VDP A;  3QYE A;  3HHX A;  1G41 A;  4DV2 M;  4NRW A;  3KOX E;  4XK8 F;  2KA6 B;  3A98 B;  3TL4 X;  3GLH E;  2LVO C;  5EJC A;  3V76 A;  1LTM A;  2CP8 A;  2MRO B;  3VK7 A;  4AI6 A;  2LVA A;  4RNA A;  3SFZ A;  1TDH A;  5LMU M;  1SXJ C;  3UGJ A;  1X37 A;  3I51 A;  2HL7 A;  2JA2 A;  2QSF X;  3DOA A;  4QHT A;  3THG A;  1IFY A;  3E21 A;  2J5Y A;  3B7Q A;  4MGI E;  1R2Z A;  4LG2 A;  1VQ1 A;  1Q39 A;  2EKK A;  2XZF A;  1ZQ9 A;  2CFO A;  4L78 A;  3ILK A;  4XBO A;  2L7I A;  2ZTC A;  3SHG B;  2LVN C;  3FRI A;  3SAW A;  4AKH A;  2QHO B;  4LGY A;  2EO2 A;  4MGZ E;  4HEO A;  3GPX A;  4JI6 M;  2M60 A;  1ZAE A;  5DFL A;  4HL4 A;  4LZJ A;  1DV0 A;  3U5Z B;  4QNM A;  3AOE A;  1IN8 A;  1XXH A;  1HNX M;  1IBK M;  3VK8 A;  4Z8X A;  3M6A A;  4KT0 F;  1IBL M;  1XXH E;  5KQD A;  3M0E A;  2CRU A;  4L6V 6;  1XMQ M;  3KSX A;  1KFV A;  5EP2 A;  5ITX A;  3TPZ A;  2L09 A;  4MGY E;  5IRE B;  1DGF A;  1OAI A;  3KDS E;  1XMO M;  1IM2 A;  4DR4 M;  1OTR A;  3U6S A;  4G4O A;  2OQ4 A;  4WP2 A;  4ZPX A;  5ITX E;  1DGH A;  2EUC A;  5ITR A;  2R18 A;  2MR9 A;  2F4V M;  3B7Z A;  4PDI A;  1HQC A;  2P5T A;  2XGN A;  2Q2E B;  2Z7J A;  1IXR C;  3FTD A;  2R4E A;  3FUW A;  3HZJ A;  1PGY A;  4A3V B;  4B3S M;  3SMP A;  2X8A A;  3L2A A;  1UM8 A;  1QQW A;  1J5E M;  2DEN A;  1Y8G A;  1MN3 A;  1OAO C;  1I4W A;  2I7N A;  3VDU A;  1WXQ A;  3CGW A;  5IZ7 D;  3GQ5 A;  1XNQ M;  3GPP A;  2KW0 A;  4DUZ M;  4F2L A;  1ZMW A;  4MB7 A;  1YE9 A;  5ITQ A;  3A45 A;  2KEB A;  3W68 A;  5EXP A;  2YFQ A;  1VEK A;  3J2P B;  1GJT A;  2AHM A;  2I7P A;  1J09 A;  2N35 A;  2ZAN A;  4B7H A;  3GLG A;  3SAS A;  3QYB A;  2D7E A;  2XH9 A;  2QCU A;  1QUS A;  3IG8 A;  4FWG A;  2WZJ A;  1QAM A;  4G6Z A;  5EXS A;  1TR8 A;  3D8B A;  1G3I A;  4X66 M;  3GLG E;  4B3M M;  4LFB M;  1HR0 M;  2WSF F;  3KP1 E;  4DR3 M;  4LGM A;  4JI7 M;  3J7A S;  2DKL A;  4NC6 A;  5EXT A;  3PXG A;  4DV6 M;  3R9X B;  2DAE A;  2BWB A;  2MGW A;  2VF8 A;  3NBI A;  1IBM M;  2JP7 A;  3HJ8 A;  2KHH A;  3TE6 A;  1L1T A;  8CAT A;  3R8F A;  2F5Q A;  5JI2 E;  4EIW A;  1Z6T A;  4JI3 M;  4MGK E;  4W5W A;  3WHL A;  4BB9 A;  1QDR A;  2J7N A;  4JI1 M;  2J7O A;  4OVZ A;  3U6D A;  4TUW A;  2OPF A;  1Z5B A;  4G4R A;  4LCB A;  4DV3 M;  4ITQ A;  4XGI A;  3HJQ A;  4JI2 M;  2Z4S A;  4LZZ A;  2R6F A;  3FD9 A;  4G4N A;  2WSC F;  2ZAO A;  1PJI A;  4GIP A;  1HT1 E;  2DZO B;  2OO9 A;  3L26 A;  1NJF A;  1T43 A;  3LQR A;  5DNY A;  1V33 A;  2L6O A;  2EKF A;  3GLH B;  2HWJ A;  3KW6 A;  1TH4 A;  4FCT A;  3SC3 A;  1ZV1 A;  4B3R M;  4K0K M;  3SYK A;  2JZ0 A;  1Z5C A;  4FD2 A;  3LW5 F;  5E6J A;  2CUZ A;  4IIW A;  2LBC A;  3CTW B;  4FWD A;  4AKI A;  4WW0 A;  1N78 A;  1HJP A;  1JB0 F;  2Z3X A;  1BVS A;  1G59 A;  3HU2 A;  2B3T A;  3PNY A;  5JI3 E;  4D82 A;  3GLF B;  1SXJ A;  4ANR A;  1NV9 A;  2QZ4 A;  4OW0 A;  2JWS A;  2DNA A;  2G3Q A;  4CIZ A;  3HY5 A;  2Y20 A;  1OJL A;  3AL0 C;  3RGS A;  3GLI A;  2C99 A;  2XFT A;  3GRV A;  4LJA A;  1AUA A;  1N77 A;  1N34 M;  2FNA A;  3HU3 A;  3ZH9 B;  5KQ8 A;  3KFU G;  3HHZ A;  4S12 A;  3GLI E;  3MK6 A;  4FW9 A;  1D0L A;  1DGB A;  1S3S A;  1MX0 A;  2L2D A;  2YNM D;  4IBI A;  2Z4R A;  4X64 M;  1L2D A;  4NOO B;  3C3D A;  3VKG A;  2UXD M;  2KRK A;  3B7N A;  4M0D A;  2JY6 B;  2R0I A;  3L28 A;  3FTC A;  2UXB M;  4DR5 M;  2C98 A;  4NXN M;  3BBZ A;  3K9O A;  3U61 A;  1N32 M;  1E94 E;  1R6B X;  1Z59 A;  4P17 A;  1NY6 A;  5LMN M;  3U60 A;  1UFZ A;  1C1K A;  1NVM A;  3QAU A;  4I4L A;  4JI0 M;  4R3D A;  1IN7 A;  1SXJ D;  1XB2 B;  2LWX A;  3L27 A;  3CF6 E;  2D7G A;  3KSJ A;  3W67 A;  2WSE F;  4G3O A;  4KO8 A;  3KP0 E;  1KYI A;  2R4J A;  2LH0 A;  3EIE A;  3SBJ A;  3KS8 A;  2VF7 A;  3RGP A;  1MU5 A;  3C3E A;  1IN6 A;  1WR1 B;  2K47 A;  2G5G X;  2JY5 A;  2R45 A;  1IY2 A;  2H1R A;  2QP9 X;  3B74 A;  3I4Y A;  4R71 A;  4DV0 M;  4L8R C;  4GKK M;  3DFZ A;  2CV0 A;  2RKO A;  2C5R A;  4LF9 M;  2DAI A;  2ZAM A;  4DR2 M;  3K92 A;  5FTL A;  3LVW A;  1PM5 A;  2JXN A;  3MJ5 A;  2KNZ A;  4DR7 M;  1E9R A;  1HNW M;  2K0B X;  2XSZ A;  4RF0 A;  1ZMU A;  3FUV A;  4Z6Y A;  4LF8 M;  1I94 M;  2QPA A;  1V34 A;  2A5Y B;  2RRU A;  1KSF X;  2UU9 M;  1NSF A;  4BLC A;  5EP1 A;  1WGL A;  2L4F A;  3T1Y M;  1XNR M;  2FE8 A;  4Q7J A;  4CJ6 A;  1W5T A;  4LJ8 A;  2DHY A;  2E5L M;  4QHS A;  2DAG A;  2Z8Y M;  2F5S A;  2K9D A;  4LJ6 A;  4AQY M;  4NRV A;  2XLJ A;  4FCW A;  4KOD A;  2DAM A;  3F92 A;  1L8Q A;  2DZN B;  2KXE A;  3SAU A;  1VEJ A;  1NO1 A;  4RKU F;  1IXS B;  1GVN A;  4GRI A;  2GNO A;  1GL6 A;  1XWI A;  4IBJ A;  1K3X A;  3Q8G A;  3JAM S;  4REZ A;  2DAK A;  4FVM A;  3T1H M;  1QYR A;  2EA0 A;  4I5S A;  1V92 A;  5FTN A;  1WIV A; 
#chains in the Genus database with same CATH homology
 4DUY M;  3HU1 A;  3KVW A;  5EXX A;  3U6P A;  3FTF A;  3Q8X A;  3AKZ A;  3T38 A;  3ZC7 B;  4NL4 H;  2XF3 A;  2XEP A;  4MH0 E;  2V6Z M;  4WUR A;  3BOS A;  1IN5 A;  2L7H A;  4M9X A;  1GLN A;  1SXJ B;  3J80 S;  4GMQ A;  5KPZ A;  1DO0 A;  2QBY B;  5BPV A;  3QWL A;  2VQE M;  3A42 A;  4IBB A;  4NXM M;  4DV4 M;  4LJ5 A;  2CV1 A;  2CEA A;  2Y0Q A;  1IY1 A;  4FWH A;  3AJI B;  4RF1 A;  3TWK A;  4AZF A;  1N36 M;  2F5P A;  4BBA A;  1GL7 A;  5KPR A;  4JYA M;  4LF4 M;  1TGU A;  3SAT A;  1QAO A;  3L29 A;  4B7G A;  3W0F A;  3U61 B;  3NWL A;  4PT5 A;  5EQT A;  4IBE A;  3VKH A;  3TWM A;  1LV7 A;  2R65 A;  1QZM A;  2RGH A;  3DZD A;  4PCZ A;  3GRU A;  1Z5A A;  1J7K A;  5A2Q S;  3GQ4 A;  4IBF A;  4CGY B;  3GRY A;  1H6U A;  4GKJ M;  3I4V A;  1R7R A;  5E26 A;  5EP4 A;  2VQF M;  4JN6 A;  3HWS A;  5ITT A;  2C9C A;  4LY6 A;  4D81 A;  4D80 A;  1HT2 E;  4G4Q A;  1IXZ A;  3T15 A;  1JR3 A;  4L16 A;  1Q3B A;  3PNV A;  4FCV A;  3UMM A;  4LRT A;  2KRU A;  4YHH M;  2UUC M;  3JR4 A;  2LNH C;  4QOZ C;  1TH2 A;  4OX9 M;  1XXH B;  2DWZ B;  4LRS A;  4LFC M;  3GPY A;  5FTJ A;  1L2C A;  4JV5 M;  1E9S A;  2BJW A;  2XZU A;  2ERC A;  3C58 A;  1IQP A;  3U6O A;  3KOW E;  4B08 A;  4LF6 M;  4CHT B;  4OU7 A;  2YR0 A;  2LXE A;  4NSO B;  4I8O A;  2G8L A;  4QNR A;  4AW4 A;  1ORY B;  3K2L A;  3FUT A;  1QAN A;  1DGH B;  1JR3 D;  4JI8 M;  4GHL A;  2XFS A;  5IWA M;  3HHW A;  4IBK A;  1DO2 A;  1K82 A;  3SAV A;  3SMS A;  3J27 B;  1YUB A;  4M9S A;  1L1Z A;  1DGG A;  4L15 A;  2F5O A;  4GC9 A;  3GRR A;  3OTO M;  4LJ4 A;  3LQQ A;  1TH3 A;  1XC8 A;  4L4U A;  3GLF A;  5F3W A;  3VFD A;  1OFI A;  2DHR A;  2FOI C;  3LMM A;  1IN4 A;  2DWN A;  1NY5 A;  3FUU A;  3RE8 A;  3GP1 A;  1NNJ A;  3D8L A;  3KOZ E;  3FYD A;  2DVW B;  3IG5 A;  3GLG B;  4MGH A;  5FSW A;  2C96 A;  3UK6 A;  1PJJ A;  1E32 A;  1T3T A;  2R46 A;  4X65 M;  3AOG A;  4LJ7 A;  2CV2 A;  4P16 A;  1R2Y A;  1NNU C;  3HKP A;  3TWL A;  1EE8 A;  4IJF A;  5KPT A;  4DV7 M;  1NHW C;  4B7F A;  2FFJ A;  5DYI A;  2XSZ D;  3K1J A;  3PFI A;  3HGI A;  1NJG A;  1G8P A;  2X49 A;  2DWL A;  4OVZ B;  2Y21 A;  4IBC A;  4PD2 A;  5C1B A;  3U6L A;  3KOY E;  3ZCB B;  2BJV A;  3AV0 A;  4LFA M;  5EP3 A;  7CAT A;  2DWM A;  3U6Q A;  4KHP M;  1HNZ M;  4MM3 B;  1XHB A;  4M9Z A;  3SYL A;  3KXE C;  3KS4 A;  5ITY A;  2V1U A;  4DR6 M;  3U60 B;  4LF5 M;  1HQY E;  5DYG A;  2W82 A;  2KZU A;  1TDZ A;  5FTK A;  4GC5 A;  3GPU A;  3MHV C;  4JI4 M;  3AOE C;  4X62 M;  3U5Z A;  3M7G A;  3RFW A;  3J7B A;  3GLI B;  1G4A E;  4QOS A;  4KLN A;  2ZM6 M;  1QVR A;  2O5R A;  3UJN A;  3FKE A;  3B9P A;  3K8Z A;  3VLF B;  4DV1 M;  1QAQ A;  2D7H A;  3FYC A;  2ZBK B;  3AFH A;  3CF0 A;  2UUB M;  3E4R A;  2NQ8 C;  4LJ9 A;  2X4A A;  3A46 A;  2HKJ A;  1D2N A;  2BNK A;  2UXC M;  2DXI A;  1W5S A;  1N75 A;  1NHG C;  5H37 D;  1VDD A;  2C9O A;  3J81 S;  3L25 A;  4II7 A;  3JR5 A;  3EIH A;  5C18 A;  1Q3C A;  5GKN A;  1FNN A;  4JXJ A;  2M5Z A;  4CIS A;  1IY0 A;  1N33 M;  3LVV A;  3PVS A;  3W0L B;  2CE7 A;  2CHQ A;  3FUX A;  2RGO A;  3GQ3 A;  3H4M A;  4YY3 M;  4NSR A;  4HLQ A;  3UZU A;  5KO3 A;  4AG5 A;  3U6C A;  4IJE A;  2CHV A;  4B3T M;  3CF2 A;  4AG6 A;  4LF7 M;  5ITU A;  1GKI A;  2YQZ A;  4GIT A;  3TQS A;  4PDG A;  2V1C A;  2KZS A;  4GH9 A;  5FLX S;  2QBY A;  4I81 A;  3HHY A;  1JQJ C;  3GO8 A;  1K3W A;  2HHH M;  3HJS A;  2CHG A;  1YSY A;  4GHA A;  1SXJ E;  3WHK A;  4DR1 M;  5BR8 M;  3U6E A;  3U6M A;  2R62 A;  2QEN A;  4IBG A;  1L2B A;  5IT9 S;  3SHF A;  4AKG A;  4DV5 M;  4IBD A;  2UUA M;  4R7G A;  5FTM A;  3E9S A;  2Y0T A;  3FTE A;  1OFH A;  4JI5 M;  2HCB A;  3SAR A;  2VII A;  4M0W A;  1FJG M;  2F5N A;  3DA1 A;  3GLH A;  3VDP A;  4DV2 M;  3HHX A;  1G41 A;  4NRW A;  3KOX E;  2KA6 B;  3A98 B;  3TL4 X;  5EJC A;  3VK7 A;  4AI6 A;  4RNA A;  3SFZ A;  1TDH A;  5LMU M;  1SXJ C;  3UGJ A;  1X37 A;  3I51 A;  2HL7 A;  2JA2 A;  3DOA A;  4QHT A;  3THG A;  4MGI E;  1R2Z A;  4LG2 A;  1Q39 A;  2XZF A;  1ZQ9 A;  2CFO A;  4L78 A;  3ILK A;  4XBO A;  2L7I A;  3SHG B;  3SAW A;  4AKH A;  4LGY A;  2EO2 A;  4MGZ E;  3GPX A;  4JI6 M;  2M60 A;  1ZAE A;  4HL4 A;  4LZJ A;  3U5Z B;  4QNM A;  3AOE A;  1IN8 A;  1XXH A;  1HNX M;  1IBK M;  3VK8 A;  4Z8X A;  3M6A A;  1IBL M;  5KQD A;  3M0E A;  1XMQ M;  3KSX A;  1KFV A;  5EP2 A;  5ITX A;  3TPZ A;  2L09 A;  4MGY E;  5IRE B;  1DGF A;  3KDS E;  1XMO M;  4DR4 M;  1IM2 A;  3U6S A;  4G4O A;  2OQ4 A;  4ZPX A;  5ITX E;  1DGH A;  2EUC A;  5ITR A;  2R18 A;  2F4V M;  4PDI A;  1HQC A;  2P5T A;  2XGN A;  3FUW A;  2Q2E B;  1IXR C;  2Z7J A;  2R4E A;  3FTD A;  4A3V B;  4B3S M;  3SMP A;  2X8A A;  3L2A A;  1UM8 A;  1QQW A;  1J5E M;  3VDU A;  2I7N A;  1I4W A;  3GQ5 A;  1WXQ A;  5IZ7 D;  1XNQ M;  3GPP A;  2KW0 A;  4DUZ M;  4MB7 A;  1YE9 A;  5ITQ A;  3A45 A;  2KEB A;  5EXP A;  2YFQ A;  3J2P B;  2AHM A;  2I7P A;  1J09 A;  4B7H A;  2ZAN A;  3GLG A;  3SAS A;  2D7E A;  2XH9 A;  2QCU A;  3IG8 A;  4FWG A;  1QAM A;  4G6Z A;  5EXS A;  3D8B A;  4B3M M;  1G3I A;  4X66 M;  4LFB M;  1HR0 M;  3KP1 E;  4DR3 M;  4LGM A;  4JI7 M;  3J7A S;  5EXT A;  3PXG A;  4DV6 M;  3R9X B;  3NBI A;  1IBM M;  3HJ8 A;  3TE6 A;  1L1T A;  2F5Q A;  8CAT A;  3R8F A;  5JI2 E;  4EIW A;  1Z6T A;  4JI3 M;  4MGK E;  4W5W A;  3WHL A;  4BB9 A;  4JI1 M;  2J7N A;  4TUW A;  2J7O A;  4OVZ A;  3U6D A;  2OPF A;  1Z5B A;  4G4R A;  4LCB A;  4DV3 M;  4ITQ A;  4XGI A;  3HJQ A;  4JI2 M;  2Z4S A;  4LZZ A;  3FD9 A;  4G4N A;  2ZAO A;  1PJI A;  4GIP A;  1HT1 E;  2DZO B;  3L26 A;  1NJF A;  3LQR A;  5DNY A;  3U60 A;  2L6O A;  3GLH B;  3KW6 A;  3SC3 A;  1TH4 A;  4FCT A;  4B3R M;  4K0K M;  3SYK A;  1Z5C A;  4FD2 A;  5E6J A;  2CUZ A;  4IIW A;  3CTW B;  4FWD A;  4AKI A;  4WW0 A;  1N78 A;  1G59 A;  2Z3X A;  3HU2 A;  5JI3 E;  3PNY A;  4D82 A;  3GLF B;  1SXJ A;  2QZ4 A;  4OW0 A;  3AL0 C;  2Y20 A;  1OJL A;  3RGS A;  3GLI A;  2C99 A;  2XFT A;  3GRV A;  4LJA A;  1N77 A;  1N34 M;  2UXB M;  2FNA A;  3HU3 A;  3ZH9 B;  5KQ8 A;  3KFU G;  3HHZ A;  4S12 A;  3MK6 A;  4FW9 A;  1S3S A;  1DGB A;  2YNM D;  1MX0 A;  4IBI A;  4X64 M;  1L2D A;  2Z4R A;  4NOO B;  3VKG A;  2UXD M;  2KRK A;  4M0D A;  3L28 A;  3FTC A;  4DR5 M;  2C98 A;  4NXN M;  3U61 A;  1N32 M;  1E94 E;  1R6B X;  1Z59 A;  5LMN M;  1NY6 A;  1C1K A;  1NVM A;  3QAU A;  4I4L A;  4JI0 M;  4R3D A;  1IN7 A;  1SXJ D;  2LWX A;  3L27 A;  3CF6 E;  2D7G A;  3KSJ A;  4KO8 A;  3KP0 E;  1KYI A;  2R4J A;  2LH0 A;  3EIE A;  3SBJ A;  3KS8 A;  3RGP A;  1MU5 A;  1IN6 A;  2K47 A;  2G5G X;  2R45 A;  1IY2 A;  2H1R A;  2QP9 X;  3I4Y A;  4DV0 M;  4L8R C;  4GKK M;  3DFZ A;  2CV0 A;  2RKO A;  2C5R A;  4LF9 M;  2ZAM A;  4DR2 M;  3K92 A;  5FTL A;  3LVW A;  1PM5 A;  3MJ5 A;  4DR7 M;  1E9R A;  1HNW M;  2XSZ A;  4RF0 A;  3FUV A;  4Z6Y A;  4LF8 M;  1I94 M;  2QPA A;  2A5Y B;  1KSF X;  2UU9 M;  1NSF A;  4BLC A;  5EP1 A;  3T1Y M;  1XNR M;  2FE8 A;  1W5T A;  4LJ8 A;  2E5L M;  4QHS A;  2F5S A;  4LJ6 A;  4AQY M;  4NRV A;  2XLJ A;  4FCW A;  4KOD A;  1L8Q A;  2DZN B;  2KXE A;  3SAU A;  1IXS B;  1GVN A;  4GRI A;  1GL6 A;  1XWI A;  4IBJ A;  1K3X A;  3JAM S;  4REZ A;  4FVM A;  3T1H M;  1QYR A;  2EA0 A;  4I5S A;  5FTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...