4OX9M

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ox9M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ox9M02
2F5OA 1K82A 3U6QA 4MB7A 5FLXS 1N36M 1Q3BA 1K3WA 4DV2M 2F4VM 1HNXM 4DUZM 4X66M 3T1YM 4JI3M 4DR5M 1N32M 4NXNM 4DV0M 4DV1M 5IWAM 1K3XA 4G4OA 2VQFM 3OTOM 3GQ5A 1IBKM 1XNQM 5ITRA 4OX9M 1L2BA 4LF8M 4B3MM 1FJGM 4DR1M 3SAWA 1J5EM 1MU5A 1L1ZA 4NRVA 4DV7M 4G4RA 3T1HM 3JR5A 2UXCM 4DV5M 4KHPM 3JR4A 2F5SA 4NRWA 4JI6M 1Q39A 5ITUA 4AQYM 4LFAM 1L1TA 2ZM6M 3VK8A 1PM5A 3U6OA 4JI4M 4DV6M 4JI0M 2XZUA 3GO8A 3U6SA 1NNJA 2F5NA 4DR4M 4JV5M 1HNZM 4LF4M 1XMQM 1L2CA 2E5LM 5BR8M 4JI5M 3DOAA 5ITXE 1TDHA 1Z59A 2OQ4A 1N34M 4GKKM 3J81S 3SAVA 1IBLM 2F5PA 2UUCM 2UXBM 5A2QS 4JYAM 3C58A 1IBMM 4LF5M 4YHHM 4LF6M 3A45A 5LMNM 3GPYA 2ZBKB 4G4NA 1EE8A 4DUYM 1MX0A 3U6PA 4DR7M 3J7AS 2F5QA 3W0FA 1HNWM 4JI8M 1PJJA 2EA0A 3U6EA 4JI2M 3VK7A 2UXDM 5ITTA 2HHHM 2VQEM 1XC8A 4YY3M 4DV4M 5ITXA 5IT9S 1R2YA 4DV3M 3GQ3A 3JAMS 3GPUA 3J80S 4B3TM 4X65M 3U6MA 4JI1M 1PJIA 3GP1A 3SARA 4PDGA 2UU9M 4LF9M 1TDZA 1L2DA 5ITQA 1Q3CA 1Z5AA 3GPPA 4DR2M 3U6CA 1I94M 3SAUA 4NXMM 4LFBM 3SATA 5ITYA 4LFCM 3TWMA 4CISA 4ITQA 1XNRM 1HR0M 1R2ZA 1Z5CA 2XZFA 2UUAM 3TWLA 4X64M 4JI7M 4X62M 3SBJA 4K0KM 2HKJA 3GQ4A 3SASA 4LF7M 3A46A 4GKJM 1Z5BA 2UUBM 4PD2A 4B3RM 2Q2EB 3U6DA 4DR6M 3A42A 3U6LA 1XMOM 4PCZA 5LMUM 1KFVA 4B3SM 3GPXA 2OPFA 1N33M 4PDIA 4DR3M 4G4QA 3TWKA
chains in the Genus database with same CATH superfamily
3J27B 1IN7A 4FWGA 3J2PB 4MM3B 2F5OA 3LVVA 5EQTA 2GQFA 1JR3E 4FCTA 4MB7A 3T15A 2LNHC 3HU3A 4LJ5A 1NSFA 3UZUA 2LVNC 3LCVB 4NL4H 1K3WA 1HQCA 1TH4A 1IY1A 2K0BX 4DV2M 1XHBA 2F4VM 1VG5A 2GNOA 5L8RF 1N32M 5KQDA 5EP2A 2C9CA 2DKLA 2QHOB 3FKEA 8CATA 1HJPA 3KOYE 4R71A 2XSZD 2ZAMA 1SG9A 1OKSA 2RKOA 1XB2B 3FE3A 3QYBA 1RU3A 3B7QA 2YNMD 4IBDA 5FLXS 3GQ5A 3IHPA 1NV8A 4QOSA 4LF8M 4LY6A 4QHTA 4R7GA 4G6ZA 2KNZA 2RRUA 3K9PA 5IREB 3T38A 3T1HM 2KNAA 1PGYA 3JR5A 2UXCM 3JR4A 3U5ZB 4NRWA 4IIWA 3FUTA 2LVAA 1NY5A 2YQZA 3FD9A 4BBAA 4AQYM 2ZM6M 3VK8A 1PM5A 3U6OA 3GLFB 4JI0M 2CHQA 4DV6M 3U6SA 2A5YB 2O01F 2XF3A 2F5NA 4BLCA 1VEGA 1XXHE 4FWDA 2FH0A 3GRUA 2DAEA 4LJAA 3FUXA 3TQSA 1N34M 3MK6A 3SHGB 3L29A 2HAKA 1GL6A 1QYRA 3M6AA 4AG5A 4B7HA 1X37A 1R7RA 1T3TA 1YSYA 2JY8A 1TH2A 2KRKA 2YFQA 3HJSA 1IBLM 2UUCM 5FTNA 4NSOB 4A3VB 4JYAM 4F1IA 4IJEA 2OO9A 2DHRA 3LW5F 2QBYA 2CV1A 2WZJA 1G3IA 3GPYA 2ZBKB 2R0IA 5LMNM 2I7NA 4G4NA 2Y21A 2APLA 1D0LA 3NBIA 3KOZE 3HHWA 4DUYM 2FOIC 4ANRA 4L16A 2QZ4A 2Z7JA 2BJWA 3W0FA 1CUKA 3FUWA 4GC9A 1PJJA 4KLNA 4CGYB 4FVMA 2XFTA 1P3QQ 3VK7A 2UXDM 3ZH9B 3KP0E 5ITTA 2VQEM 1NV9A 1MN3A 1PJQA 3H4JA 2CHVA 4DV4M 2DVWB 4CHTB 1AUAA 1ZAEA 3I4VA 2KNVA 1KSFX 2J7OA 4B3TM 4L6V6 4MGHA 4DBGB 2QBYB 4HLQA 1WIVA 1TTEA 1EFUB 3E4RA 3KDSE 1UFZA 1TDZA 3AL0C 3HJ8A 2L4EA 3FRHA 3ZC7B 1Q3CA 1Z5AA 3FYDA 1GABA 3GPPA 4OVZB 2YR0A 3BXWA 4NXMM 3K1JA 2CP8A 1QAQA 1GJTA 3A98B 3AKZA 2JWSA 4ITQA 3ZCBB 1QQWA 3GRRA 4BB9A 1DO2A 3PNYA 2WSFF 1OFIA 2UUAM 2KRUA 3GRVA 5EP4A 4M9SA 1IXSA 1GO5A 3TL4X 1TH3A 3W68A 2XLJA 4X62M 2K47A 2DZOB 4JXJA 3H4MA 2BNKA 3T6PA 2KXEA 4GKJM 2ZTDA 2DI0A 2RGHA 4PD2A 3K9OA 3PXGA 3U6LA 4B3SM 3J7BA 3GPXA 1A5TA 4OVZA 2HWJA 2L4FA 2G3QA 3IG8A 1IXZA 4R3DA 2BWBA 4IBBA 2CV0A 1Q3BA 1Y8GA 2FFJA 1C1KA 3SHFA 1L8QA 1V33A 5EP1A 1H6UA 5FTKA 2R44A 1YE9A 3KSXA 4LJ6A 4JI3M 3ZQJA 4NXNM 4DR5M 2B3TA 3FTFA 4AKHA 3KW6A 3KOXE 2DAMA 3E21A 1SXJA 4IBCA 4IJFA 3SYLA 1IFYA 2EKFA 3W67A 4DV0M 2R45A 2DHYA 3HWSA 5IWAM 1R5LA 1K3XA 3AOGA 2O5RA 5EJCA 4D81A 1WGLA 3L28A 3KFUG 2M60A 4FD2A 5EXSA 5H37D 2G5GX 3RE8A 4B3MM 2JY7A 3SAWA 3GLHA 1SXJC 1L1ZA 4L4UA 4OW0A 2VDBB 2J5YA 3D8BA 4I4LA 2W82A 4LFAM 1L1TA 3I51A 2CWBA 3GO8A 1NNJA 1NHGC 3D8LA 3HU2A 4LF4M 1XMQM 4NOOB 2X4AA 2R46A 1T43A 2OQ4A 3L2AA 1QZEA 1SXJD 1DGFA 2LBCA 1D0MA 5FSWA 3J81S 1ZMVA 1I4WA 2R18A 1GJSA 4W5WA 2UXBM 1IY0A 1YUBA 4Z8XA 5A2QS 4GMQA 3GLIE 3LMMA 4LCBA 4IBIA 4NC6A 3IG5A 2C96A 2V1UA 1EE8A 1OIPA 4IBGA 2LHGA 2QSFX 5KPZA 4GH9A 2LWXA 1C7YA 1IM2A 1ZV1A 2H1RA 1WHCA 1Q02A 1W5TA 4KODA 4LGYA 3AJIB 2CFOA 2WSEF 1AIPC 1NVMA 1VQ1A 4L8RC 3CGWA 1VDLA 4JN6A 2JY5A 4OU7A 3CF0A 2ZTCA 4I5SA 3HKPA 2R6FA 1F4IA 3QAUA 1ZMWA 1OAOC 1WXQA 1LV7A 3B7ZA 3GQ3A 3GPUA 1DGBA 4LZJA 4KT0F 3VDUA 4X65M 3HY5A 2LVOC 1IN6A 1PJIA 3F92A 3GP1A 4PDGA 2J7NA 2XSZA 2QNJA 2VIIA 1R6BX 3VKGA 4CIZA 3BBZA 2DZLA 4RF0A 4FCWA 3U6CA 1HQYE 4GRIA 4LFCM 4CISA 1D0KA 3I4YA 3U60A 2Y20A 1LTMA 2CRUA 1NJFA 3AV0A 5JI3E 1E94E 2R4EA 2LVQD 1EIJA 2P5TA 1GVNA 2X49A 4XK8F 2ERCA 3U61B 2HKJA 2FNAA 3SASA 3SYKA 2DZNB 4Q7JA 4B3RM 2D7HA 2Q2EB 3NBXX 2VF8A 2KDLA 2CV2A 1G4AE 4M0DA 2DAIA 2QP9X 3FUUA 3V76A 2ZAOA 4IBFA 4DR3M 4B7FA 2Z4SA 3U6QA 1N36M 2VF7A 2DWNA 1QZMA 4I8OA 2DWMA 1DGGA 4X66M 4M9ZA 3T1YM 2KEBA 3I04M 2C5RA 4L78A 3QYEA 2MJ5B 2M5ZA 3GLIB 1YLAA 1IBKM 5F3WA 1G59A 4B08A 5ITRA 4OX9M 5BPVA 4FWHA 2L7HA 2NQ8C 1JB0F 3QWLA 3GRYA 2FE8A 1FJGM 4ZPXA 3UK6A 5FTJA 1J5EM 4AKGA 1QVRA 2X8AA 4NSRA 1OFHA 3KVWA 3HGIA 1QAMA 4MGIE 3HJQA 1NY6A 1R4GA 3CF6E 5DNYA 1HT2E 3Q8GA 4AZFA 2AHMA 1L2CA 3MJ5A 5GKNA 1G71A 3DOAA 1VEJA 5ITXE 4JI5M 1TDHA 3EIHA 3BOSA 2E5LM 1XXHB 3DFZA 3IECA 1GL7A 3U5ZA 2D7GA 4MGYE 3GLFE 4HEOA 2G8LA 1D2NA 3HU1A 1IBMM 3NWLA 4LF5M 1DGHA 5JI2E 3AFHA 4QOZC 2L6OA 4D82A 3B74A 4LJ4A 3SC3A 2KZSA 2JUJA 4LJ7A 1NO1A 1MX0A 1ZMUA 5DYGA 1PRBA 2JA2A 2OOBA 4LJ8A 2LHCA 2XFSA 4I81A 3J7AS 1IN5A 1WJ7A 2F5QA 2MR9A 2XGNA 4JI8M 2MGWA 1QDTA 1VDDA 1QUTA 4QNMA 2DWLA 5E26A 3SMSA 5KQ8A 2HHHM 2O25A 3FUVA 4LG2A 3RGPA 4AG6A 3UGJA 1N75A 3R8FA 1GKIA 5ITXA 3FTEA 4RNAA 3VKHA 5FTMA 2CEAA 2JZ0A 2Y0QA 4QHSA 3JAMS 3J80S 1DGHB 2DAKA 3K2LA 3U6MA 4JI1M 4FCVA 4GIPA 3B7NA 3GLGA 2RGOA 2Z8YM 3GLGE 5IZ7D 3SARA 4LF9M 3L25A 1L2DA 5C18A 1OQYA 1JQJC 1ZQ9A 4G4OA 4DR2M 1ORYB 1T6OA 4IBKA 3RFWA 2BWEA 3HHXA 3SATA 2KW0A 2R62A 1NHWC 5ITYA 4AKIA 1HT1E 4LZZA 1XNRM 1HR0M 2I7PA 1Z5CA 4GHLA 2EJSA 3UJNA 4WP2A 2WSCF 2V1CA 3TWLA 3AOEC 4Y28F 1QAOA 1TGUA 1G41A 2Y0TA 4LGMA 4UN2B 3SBJA 3GQ4A 4K0KM 4LRSA 4LF7M 3A46A 1TR8A 1OJLA 2CE7A 3KSJA 4DR6M 3A42A 3HHYA 2DWZB 1KFVA 1XWIA 3DZDA 2DENA 3L26A 3GLHB 2OPFA 2LTUA 5E6JA 4PDIA 3SAUA 1QUSA 4G4QA 3TWKA 2R65A 1V34A 5DYIA 1K82A 1KYIA 4FW9A 4AW4A 1DV0A 3C3DA 3MHVC 1J09A 2K9DA 4P16A 1NNUC 3M7GA 3THGA 3FTCA 4DUZM 1HNXM 4P17A 3GLGB 1JR3D 4XGIA 2QQ8A 4LJ9A 5EXTA 4G3OA 2DAGA 2EO2A 3PVSA 4S12A 5FTLA 3HHZA 1SXJB 5EXXA 4DV1M 1OAIA 2Z3XA 2FS1A 2V6ZM 1GLNA 3UMMA 3OTOM 2VQFM 1IQPA 4WW0A 1XNQM 4KO8A 4MGKE 1L2BA 1SXJE 3M0EA 3RGSA 1W5SA 3WHKA 4GC5A 4DR1M 2XEPA 1MU5A 3E46A 2L09A 4NRVA 1WGNA 4DV7M 4G4RA 4GITA 4GHAA 4DV5M 3LQRA 4KHPM 2CUZA 1J7KA 2F5SA 2JXNA 4JI6M 2LVPC 3CF2A 1Q39A 4D80A 3L27A 5ITUA 3K8ZA 4II7A 4JI4M 1MJGM 2XZUA 2XH9A 5DFLA 4DR4M 4JV5M 1HNZM 3FTDA 1WR1B 2CHGA 3C3EA 4RF1A 3K92A 4REZA 1S3SA 4Z6YA 5BR8M 1Z59A 4GKKM 3SAVA 1XXHA 4L15A 3SFZA 3CTWB 2F5PA 3LQQA 2L2DA 5EP3A 5KPRA 3SMPA 3W0LB 1V92A 4M9XA 2C9OA 4IBJA 3VFDA 3C58A 3B89A 3E9SA 2QENA 3EIEA 3LVWA 4YHHM 2HL7A 3A45A 4F2LA 1VEKA 4LF6M 3R9XB 7CATA 2DXIA 4LRTA 2R4JA 2H5XA 3PFIA 3U6PA 4DR7M 4QNRA 4TUWA 1E32A 2JY6B 2EUCA 4MGZE 3B9PA 1HNWM 2MROB 4IBEA 2QPAA 2EA0A 1E9RA 2C99A 1TF0B 3U6EA 4JI2M 1IXRC 1XC8A 1Z6TA 3TPZA 1E9SA 1IN4A 2HCBA 1OTRA 2D7EA 1G8PA 5C1BA 4YY3M 1DO0A 3VDPA 4RKUF 2OOAA 3KOWE 4XBOA 2LH0A 1PJTA 1IXSB 1IN8A 3WHLA 2KA6B 4DV3M 1R2YA 5IT9S 3DA1A 4HL4A 5KPTA 2JNHA 2C98A 3LCUA 2UU9M 4B7GA 4PT5A 3MMPA 3ILKA 3KP1E 3GLHE 3HX3A 5ITQA 2N35A 1N78A 1FNNA 1JR3A 2MH8A 4MH0E 4CJ6A 1I94M 2JZ1A 3FRIA 2KZUA 2KHHA 4LFBM 3TE6A 1NJGA 3KS8A 3HZJA 3VLFB 3TWMA 2LXEA 1R2ZA 2XZFA 4AI6A 1IY2A 3I01M 1QDRA 5EXPA 1N77A 1QANA 4WURA 4X64M 2Z4RA 3FYCA 5KO3A 4JI7M 3AOEA 3C9PA 3KS4A 1PJSA 4GEWA 3GLFA 3GLIA 2L7IA 3U61A 4EIWA 1Z5BA 2UUBM 2DNAA 3U6DA 1XMOM 1OIZA 2EKKA 2BJVA 1UM8A 2QCUA 4M0WA 4PCZA 5LMUM 3U60B 1BVSA 2K6BA 3Q8XA 1N33M 2JP7A 3KXEC 3PNVA 2ZANA
chains in the Genus database with same CATH topology
3J27B 1IN7A 4FWGA 3J2PB 4MM3B 2F5OA 3LVVA 5EQTA 4FCTA 3UZUA 4MB7A 5FLXS 3T15A 2LNHC 3HU3A 4LJ5A 1NSFA 4NL4H 1K3WA 1HQCA 1TH4A 1IY1A 4DV2M 1XHBA 2F4VM 1N32M 5KQDA 5EP2A 2C9CA 8CATA 3FKEA 3KOYE 2XSZD 2ZAMA 2RKOA 4G4OA 2YNMD 4IBDA 3GQ5A 4QOSA 4LF8M 4LY6A 4QHTA 4R7GA 4G6ZA 5IREB 3T38A 3T1HM 3JR5A 2UXCM 3JR4A 3U5ZB 4NRWA 4IIWA 3FUTA 2YQZA 1NY5A 3FD9A 4BBAA 4AQYM 2ZM6M 3VK8A 1PM5A 3U6OA 3GLFB 4JI0M 2CHQA 4DV6M 3U6SA 2A5YB 2F5NA 2XF3A 4BLCA 4FWDA 3GRUA 4LJAA 3FUXA 3TQSA 1N34M 3MK6A 3SHGB 3L29A 1GL6A 1QYRA 3M6AA 4AG5A 4B7HA 1X37A 1R7RA 1T3TA 1YSYA 1IBLM 1TH2A 2KRKA 2YFQA 3HJSA 2UUCM 5FTNA 4NSOB 4A3VB 4JYAM 4IJEA 2QBYA 2CV1A 5LMNM 1G3IA 3GPYA 2ZBKB 2I7NA 4G4NA 2Y21A 3NBIA 3KOZE 3HHWA 4DUYM 2FOIC 4L16A 2QZ4A 2Z7JA 2BJWA 3W0FA 3FUWA 4GC9A 1PJJA 4KLNA 4CGYB 4FVMA 2XFTA 3VK7A 2UXDM 3ZH9B 3KP0E 5ITTA 2VQEM 2CHVA 4DV4M 2DVWB 4CHTB 1ZAEA 3I4VA 1KSFX 2J7OA 4B3TM 4MGHA 2QBYB 4HLQA 3E4RA 3KDSE 1TDZA 3AL0C 3HJ8A 3ZC7B 1Q3CA 1Z5AA 3FYDA 3GPPA 4OVZB 2YR0A 4NXMM 3K1JA 3A98B 1QAQA 3AKZA 4ITQA 3ZCBB 1QQWA 3GRRA 4BB9A 1DO2A 3PNYA 2UUAM 1OFIA 2KRUA 3GRVA 5EP4A 4M9SA 3TL4X 1TH3A 2XLJA 4X62M 2K47A 2DZOB 4JXJA 3H4MA 2BNKA 2KXEA 4GKJM 2RGHA 4PD2A 3PXGA 3U6LA 4B3SM 3J7BA 3GPXA 4OVZA 3IG8A 1IXZA 4R3DA 4IBBA 2CV0A 1Q3BA 2FFJA 1C1KA 3SHFA 1L8QA 5EP1A 1H6UA 5FTKA 1YE9A 3KSXA 4LJ6A 4JI3M 4DR5M 4NXNM 4AKHA 3FTFA 3KW6A 3KOXE 1SXJA 4IBCA 4IJFA 3SYLA 4DV0M 2R45A 3HWSA 5IWAM 1K3XA 3AOGA 2O5RA 5EJCA 4D81A 3L28A 3KFUG 2M60A 4FD2A 5EXSA 5H37D 2G5GX 3RE8A 4B3MM 3SAWA 3GLHA 1SXJC 1L1ZA 4L4UA 4OW0A 3D8BA 4I4LA 2W82A 4LFAM 1L1TA 3I51A 3GO8A 1NNJA 1NHGC 3D8LA 3HU2A 4LF4M 1XMQM 4NOOB 2X4AA 2R46A 2OQ4A 3L2AA 1SXJD 1DGFA 3J81S 5FSWA 1I4WA 2R18A 4W5WA 2UXBM 1IY0A 1YUBA 4Z8XA 5A2QS 4GMQA 3LMMA 4LCBA 4IBIA 3IG5A 2C96A 2V1UA 1EE8A 4IBGA 5KPZA 4GH9A 2LWXA 1IM2A 2H1RA 1W5TA 4KODA 4LGYA 3AJIB 2CFOA 1NVMA 4L8RC 4JN6A 4OU7A 3CF0A 4I5SA 3HKPA 3QAUA 1WXQA 1LV7A 3GQ3A 3GPUA 1DGBA 4LZJA 3VDUA 4X65M 1IN6A 1PJIA 3GP1A 4PDGA 2J7NA 2XSZA 2VIIA 1R6BX 3VKGA 4RF0A 4FCWA 3U6CA 1HQYE 4GRIA 4LFCM 4CISA 3I4YA 3U60A 2Y20A 1NJFA 3AV0A 5JI3E 1E94E 2R4EA 2P5TA 1GVNA 2X49A 2ERCA 3U61B 2HKJA 2FNAA 3SASA 3SYKA 2DZNB 4B3RM 2D7HA 2Q2EB 2CV2A 1G4AE 4M0DA 2QP9X 3FUUA 4DR3M 2ZAOA 4IBFA 4B7FA 2Z4SA 3U6QA 1N36M 2DWNA 1QZMA 4I8OA 2DWMA 1DGGA 4X66M 4M9ZA 3T1YM 2KEBA 2C5RA 4L78A 2M5ZA 3GLIB 1IBKM 5F3WA 1G59A 4B08A 5ITRA 4OX9M 5BPVA 4FWHA 2L7HA 2NQ8C 3QWLA 3GRYA 2FE8A 1FJGM 4ZPXA 3UK6A 5FTJA 1J5EM 4AKGA 1QVRA 2X8AA 4NSRA 1OFHA 3KVWA 3HGIA 1QAMA 4MGIE 3HJQA 1NY6A 3CF6E 5DNYA 1HT2E 4AZFA 2AHMA 1L2CA 3MJ5A 5GKNA 3DOAA 5ITXE 4JI5M 1TDHA 3EIHA 3BOSA 1XXHB 3DFZA 1GL7A 3U5ZA 2D7GA 4MGYE 2G8LA 1D2NA 3HU1A 1IBMM 3NWLA 4LF5M 1DGHA 5JI2E 3AFHA 4QOZC 2L6OA 4D82A 4LJ4A 3SC3A 2KZSA 4LJ7A 1MX0A 5DYGA 2JA2A 4LJ8A 2XFSA 4I81A 3J7AS 1IN5A 2F5QA 2XGNA 4JI8M 1VDDA 4QNMA 2DWLA 5E26A 3SMSA 5KQ8A 2HHHM 4LG2A 3FUVA 3RGPA 4AG6A 3UGJA 1N75A 3R8FA 1GKIA 5ITXA 3FTEA 4RNAA 3VKHA 5FTMA 2CEAA 4QHSA 2Y0QA 3JAMS 3J80S 1DGHB 3K2LA 3U6MA 4JI1M 4FCVA 4GIPA 3SARA 3GLGA 2RGOA 4LF9M 3L25A 5IZ7D 1L2DA 5C18A 1JQJC 1ZQ9A 4DR2M 1ORYB 4IBKA 3RFWA 3HHXA 3SATA 2KW0A 2R62A 1NHWC 5ITYA 4AKIA 1HT1E 4LZZA 1XNRM 1HR0M 2I7PA 1Z5CA 4GHLA 3UJNA 3TWLA 2V1CA 3AOEC 1QAOA 1TGUA 1G41A 2Y0TA 4LGMA 3SBJA 4K0KM 3GQ4A 4LRSA 4LF7M 3A46A 1OJLA 2CE7A 3KSJA 4DR6M 3A42A 3HHYA 2DWZB 1KFVA 1XWIA 3DZDA 3L26A 3GLHB 2OPFA 5E6JA 4PDIA 3SAUA 4G4QA 3TWKA 2R65A 5DYIA 1K82A 1KYIA 4FW9A 4AW4A 3MHVC 1J09A 4P16A 1NNUC 3M7GA 3THGA 3FTCA 4DUZM 1HNXM 3GLGB 1JR3D 4XGIA 5EXTA 4LJ9A 2EO2A 3PVSA 4S12A 5FTLA 3HHZA 1SXJB 5EXXA 4DV1M 2Z3XA 2V6ZM 1GLNA 3UMMA 3OTOM 2VQFM 1IQPA 4WW0A 1XNQM 4KO8A 4MGKE 1L2BA 1SXJE 3M0EA 3RGSA 1W5SA 3WHKA 4GC5A 4DR1M 2XEPA 1MU5A 2L09A 4NRVA 4DV7M 4G4RA 4GHAA 4GITA 4DV5M 3LQRA 4KHPM 2CUZA 1J7KA 2F5SA 4JI6M 3CF2A 1Q39A 4D80A 3L27A 5ITUA 3K8ZA 4II7A 4JI4M 2XZUA 2XH9A 4DR4M 4JV5M 1HNZM 3FTDA 2CHGA 2E5LM 4RF1A 4Z6YA 3K92A 4REZA 1S3SA 5BR8M 1Z59A 4GKKM 3SAVA 1XXHA 4L15A 3SFZA 3CTWB 2F5PA 3LQQA 5EP3A 5KPRA 3SMPA 3W0LB 4M9XA 2C9OA 4IBJA 3VFDA 3C58A 3E9SA 3EIEA 2QENA 3LVWA 4YHHM 2HL7A 3A45A 4LF6M 3R9XB 7CATA 2DXIA 4LRTA 2R4JA 3PFIA 3U6PA 4DR7M 4QNRA 4TUWA 1E32A 4MGZE 2EUCA 3B9PA 1HNWM 4IBEA 2QPAA 2EA0A 1E9RA 2C99A 3U6EA 4JI2M 1IXRC 1XC8A 1Z6TA 3TPZA 1E9SA 1IN4A 2HCBA 5C1BA 2D7EA 1G8PA 4YY3M 1DO0A 3VDPA 4XBOA 3KOWE 2LH0A 1IXSB 3WHLA 1IN8A 1R2YA 2KA6B 4DV3M 5IT9S 3DA1A 4HL4A 5KPTA 2C98A 2UU9M 4B7GA 4PT5A 3ILKA 3KP1E 5ITQA 1N78A 1FNNA 1JR3A 4MH0E 1I94M 2KZUA 4LFBM 3TE6A 1NJGA 3KS8A 3VLFB 3TWMA 2LXEA 1R2ZA 2XZFA 4AI6A 1IY2A 5EXPA 1N77A 1QANA 4WURA 4X64M 2Z4RA 3FYCA 5KO3A 4JI7M 3AOEA 3KS4A 3GLFA 3U61A 3GLIA 2L7IA 4EIWA 1Z5BA 2UUBM 3U6DA 1XMOM 4M0WA 2BJVA 1UM8A 2QCUA 4PCZA 5LMUM 3U60B 3Q8XA 1N33M 2DHRA 3KXEC 3PNVA 2ZANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5O A;  1K82 A;  3U6Q A;  4MB7 A;  5FLX S;  1N36 M;  1Q3B A;  1K3W A;  4DV2 M;  2F4V M;  1HNX M;  4DUZ M;  4X66 M;  3T1Y M;  4JI3 M;  4DR5 M;  1N32 M;  4NXN M;  4DV0 M;  4DV1 M;  5IWA M;  1K3X A;  4G4O A;  2VQF M;  3OTO M;  3GQ5 A;  1IBK M;  1XNQ M;  5ITR A;  4OX9 M;  1L2B A;  4LF8 M;  4B3M M;  1FJG M;  4DR1 M;  3SAW A;  1J5E M;  1MU5 A;  1L1Z A;  4NRV A;  4DV7 M;  4G4R A;  3T1H M;  3JR5 A;  2UXC M;  4DV5 M;  4KHP M;  3JR4 A;  2F5S A;  4NRW A;  4JI6 M;  1Q39 A;  5ITU A;  4AQY M;  4LFA M;  1L1T A;  2ZM6 M;  3VK8 A;  1PM5 A;  3U6O A;  4JI4 M;  4DV6 M;  4JI0 M;  2XZU A;  3GO8 A;  3U6S A;  1NNJ A;  2F5N A;  4DR4 M;  4JV5 M;  1HNZ M;  4LF4 M;  1XMQ M;  1L2C A;  2E5L M;  5BR8 M;  4JI5 M;  3DOA A;  5ITX E;  1TDH A;  1Z59 A;  2OQ4 A;  1N34 M;  4GKK M;  3J81 S;  3SAV A;  1IBL M;  2F5P A;  2UUC M;  2UXB M;  5A2Q S;  4JYA M;  3C58 A;  1IBM M;  4LF5 M;  4YHH M;  4LF6 M;  3A45 A;  5LMN M;  3GPY A;  2ZBK B;  4G4N A;  1EE8 A;  4DUY M;  1MX0 A;  3U6P A;  4DR7 M;  3J7A S;  2F5Q A;  3W0F A;  1HNW M;  4JI8 M;  1PJJ A;  2EA0 A;  3U6E A;  4JI2 M;  3VK7 A;  2UXD M;  5ITT A;  2HHH M;  2VQE M;  1XC8 A;  4YY3 M;  4DV4 M;  5ITX A;  5IT9 S;  1R2Y A;  4DV3 M;  3GQ3 A;  3JAM S;  3GPU A;  3J80 S;  4B3T M;  4X65 M;  3U6M A;  4JI1 M;  1PJI A;  3GP1 A;  3SAR A;  4PDG A;  2UU9 M;  4LF9 M;  1TDZ A;  1L2D A;  5ITQ A;  1Q3C A;  1Z5A A;  3GPP A;  4DR2 M;  3U6C A;  1I94 M;  3SAU A;  4NXM M;  4LFB M;  3SAT A;  5ITY A;  4LFC M;  3TWM A;  4CIS A;  4ITQ A;  1XNR M;  1HR0 M;  1R2Z A;  1Z5C A;  2XZF A;  2UUA M;  3TWL A;  4X64 M;  4JI7 M;  4X62 M;  3SBJ A;  4K0K M;  2HKJ A;  3GQ4 A;  3SAS A;  4LF7 M;  3A46 A;  4GKJ M;  1Z5B A;  2UUB M;  4PD2 A;  4B3R M;  2Q2E B;  3U6D A;  4DR6 M;  3A42 A;  3U6L A;  1XMO M;  4PCZ A;  5LMU M;  1KFV A;  4B3S M;  3GPX A;  2OPF A;  1N33 M;  4PDI A;  4DR3 M;  4G4Q A;  3TWK A; 
#chains in the Genus database with same CATH topology
 3J27 B;  1IN7 A;  4FWG A;  3J2P B;  4MM3 B;  2F5O A;  3LVV A;  5EQT A;  2GQF A;  1JR3 E;  4FCT A;  4MB7 A;  3T15 A;  2LNH C;  3HU3 A;  4LJ5 A;  1NSF A;  3UZU A;  2LVN C;  3LCV B;  4NL4 H;  1K3W A;  1HQC A;  1TH4 A;  1IY1 A;  2K0B X;  4DV2 M;  1XHB A;  2F4V M;  1VG5 A;  2GNO A;  5L8R F;  1N32 M;  5KQD A;  5EP2 A;  2C9C A;  2DKL A;  2QHO B;  3FKE A;  8CAT A;  1HJP A;  3KOY E;  4R71 A;  2XSZ D;  2ZAM A;  1SG9 A;  1OKS A;  2RKO A;  1XB2 B;  3FE3 A;  3QYB A;  1RU3 A;  3B7Q A;  2YNM D;  4IBD A;  5FLX S;  3GQ5 A;  3IHP A;  1NV8 A;  4QOS A;  4LF8 M;  4LY6 A;  4QHT A;  4R7G A;  4G6Z A;  2KNZ A;  2RRU A;  3K9P A;  5IRE B;  3T38 A;  3T1H M;  2KNA A;  1PGY A;  3JR5 A;  2UXC M;  3JR4 A;  3U5Z B;  4NRW A;  4IIW A;  3FUT A;  2LVA A;  1NY5 A;  2YQZ A;  3FD9 A;  4BBA A;  4AQY M;  2ZM6 M;  3VK8 A;  1PM5 A;  3U6O A;  3GLF B;  4JI0 M;  2CHQ A;  4DV6 M;  3U6S A;  2A5Y B;  2O01 F;  2XF3 A;  2F5N A;  4BLC A;  1VEG A;  1XXH E;  4FWD A;  2FH0 A;  3GRU A;  2DAE A;  4LJA A;  3FUX A;  3TQS A;  1N34 M;  3MK6 A;  3SHG B;  3L29 A;  2HAK A;  1GL6 A;  1QYR A;  3M6A A;  4AG5 A;  4B7H A;  1X37 A;  1R7R A;  1T3T A;  1YSY A;  2JY8 A;  1TH2 A;  2KRK A;  2YFQ A;  3HJS A;  1IBL M;  2UUC M;  5FTN A;  4NSO B;  4A3V B;  4JYA M;  4F1I A;  4IJE A;  2OO9 A;  2DHR A;  3LW5 F;  2QBY A;  2CV1 A;  2WZJ A;  1G3I A;  3GPY A;  2ZBK B;  2R0I A;  5LMN M;  2I7N A;  4G4N A;  2Y21 A;  2APL A;  1D0L A;  3NBI A;  3KOZ E;  3HHW A;  4DUY M;  2FOI C;  4ANR A;  4L16 A;  2QZ4 A;  2Z7J A;  2BJW A;  3W0F A;  1CUK A;  3FUW A;  4GC9 A;  1PJJ A;  4KLN A;  4CGY B;  4FVM A;  2XFT A;  1P3Q Q;  3VK7 A;  2UXD M;  3ZH9 B;  3KP0 E;  5ITT A;  2VQE M;  1NV9 A;  1MN3 A;  1PJQ A;  3H4J A;  2CHV A;  4DV4 M;  2DVW B;  4CHT B;  1AUA A;  1ZAE A;  3I4V A;  2KNV A;  1KSF X;  2J7O A;  4B3T M;  4L6V 6;  4MGH A;  4DBG B;  2QBY B;  4HLQ A;  1WIV A;  1TTE A;  1EFU B;  3E4R A;  3KDS E;  1UFZ A;  1TDZ A;  3AL0 C;  3HJ8 A;  2L4E A;  3FRH A;  3ZC7 B;  1Q3C A;  1Z5A A;  3FYD A;  1GAB A;  3GPP A;  4OVZ B;  2YR0 A;  3BXW A;  4NXM M;  3K1J A;  2CP8 A;  1QAQ A;  1GJT A;  3A98 B;  3AKZ A;  2JWS A;  4ITQ A;  3ZCB B;  1QQW A;  3GRR A;  4BB9 A;  1DO2 A;  3PNY A;  2WSF F;  1OFI A;  2UUA M;  2KRU A;  3GRV A;  5EP4 A;  4M9S A;  1IXS A;  1GO5 A;  3TL4 X;  1TH3 A;  3W68 A;  2XLJ A;  4X62 M;  2K47 A;  2DZO B;  4JXJ A;  3H4M A;  2BNK A;  3T6P A;  2KXE A;  4GKJ M;  2ZTD A;  2DI0 A;  2RGH A;  4PD2 A;  3K9O A;  3PXG A;  3U6L A;  4B3S M;  3J7B A;  3GPX A;  1A5T A;  4OVZ A;  2HWJ A;  2L4F A;  2G3Q A;  3IG8 A;  1IXZ A;  4R3D A;  2BWB A;  4IBB A;  2CV0 A;  1Q3B A;  1Y8G A;  2FFJ A;  1C1K A;  3SHF A;  1L8Q A;  1V33 A;  5EP1 A;  1H6U A;  5FTK A;  2R44 A;  1YE9 A;  3KSX A;  4LJ6 A;  4JI3 M;  3ZQJ A;  4NXN M;  4DR5 M;  2B3T A;  3FTF A;  4AKH A;  3KW6 A;  3KOX E;  2DAM A;  3E21 A;  1SXJ A;  4IBC A;  4IJF A;  3SYL A;  1IFY A;  2EKF A;  3W67 A;  4DV0 M;  2R45 A;  2DHY A;  3HWS A;  5IWA M;  1R5L A;  1K3X A;  3AOG A;  2O5R A;  5EJC A;  4D81 A;  1WGL A;  3L28 A;  3KFU G;  2M60 A;  4FD2 A;  5EXS A;  5H37 D;  2G5G X;  3RE8 A;  4B3M M;  2JY7 A;  3SAW A;  3GLH A;  1SXJ C;  1L1Z A;  4L4U A;  4OW0 A;  2VDB B;  2J5Y A;  3D8B A;  4I4L A;  2W82 A;  4LFA M;  1L1T A;  3I51 A;  2CWB A;  3GO8 A;  1NNJ A;  1NHG C;  3D8L A;  3HU2 A;  4LF4 M;  1XMQ M;  4NOO B;  2X4A A;  2R46 A;  1T43 A;  2OQ4 A;  3L2A A;  1QZE A;  1SXJ D;  1DGF A;  2LBC A;  1D0M A;  5FSW A;  3J81 S;  1ZMV A;  1I4W A;  2R18 A;  1GJS A;  4W5W A;  2UXB M;  1IY0 A;  1YUB A;  4Z8X A;  5A2Q S;  4GMQ A;  3GLI E;  3LMM A;  4LCB A;  4IBI A;  4NC6 A;  3IG5 A;  2C96 A;  2V1U A;  1EE8 A;  1OIP A;  4IBG A;  2LHG A;  2QSF X;  5KPZ A;  4GH9 A;  2LWX A;  1C7Y A;  1IM2 A;  1ZV1 A;  2H1R A;  1WHC A;  1Q02 A;  1W5T A;  4KOD A;  4LGY A;  3AJI B;  2CFO A;  2WSE F;  1AIP C;  1NVM A;  1VQ1 A;  4L8R C;  3CGW A;  1VDL A;  4JN6 A;  2JY5 A;  4OU7 A;  3CF0 A;  2ZTC A;  4I5S A;  3HKP A;  2R6F A;  1F4I A;  3QAU A;  1ZMW A;  1OAO C;  1WXQ A;  1LV7 A;  3B7Z A;  3GQ3 A;  3GPU A;  1DGB A;  4LZJ A;  4KT0 F;  3VDU A;  4X65 M;  3HY5 A;  2LVO C;  1IN6 A;  1PJI A;  3F92 A;  3GP1 A;  4PDG A;  2J7N A;  2XSZ A;  2QNJ A;  2VII A;  1R6B X;  3VKG A;  4CIZ A;  3BBZ A;  2DZL A;  4RF0 A;  4FCW A;  3U6C A;  1HQY E;  4GRI A;  4LFC M;  4CIS A;  1D0K A;  3I4Y A;  3U60 A;  2Y20 A;  1LTM A;  2CRU A;  1NJF A;  3AV0 A;  5JI3 E;  1E94 E;  2R4E A;  2LVQ D;  1EIJ A;  2P5T A;  1GVN A;  2X49 A;  4XK8 F;  2ERC A;  3U61 B;  2HKJ A;  2FNA A;  3SAS A;  3SYK A;  2DZN B;  4Q7J A;  4B3R M;  2D7H A;  2Q2E B;  3NBX X;  2VF8 A;  2KDL A;  2CV2 A;  1G4A E;  4M0D A;  2DAI A;  2QP9 X;  3FUU A;  3V76 A;  2ZAO A;  4IBF A;  4DR3 M;  4B7F A;  2Z4S A;  3U6Q A;  1N36 M;  2VF7 A;  2DWN A;  1QZM A;  4I8O A;  2DWM A;  1DGG A;  4X66 M;  4M9Z A;  3T1Y M;  2KEB A;  3I04 M;  2C5R A;  4L78 A;  3QYE A;  2MJ5 B;  2M5Z A;  3GLI B;  1YLA A;  1IBK M;  5F3W A;  1G59 A;  4B08 A;  5ITR A;  4OX9 M;  5BPV A;  4FWH A;  2L7H A;  2NQ8 C;  1JB0 F;  3QWL A;  3GRY A;  2FE8 A;  1FJG M;  4ZPX A;  3UK6 A;  5FTJ A;  1J5E M;  4AKG A;  1QVR A;  2X8A A;  4NSR A;  1OFH A;  3KVW A;  3HGI A;  1QAM A;  4MGI E;  3HJQ A;  1NY6 A;  1R4G A;  3CF6 E;  5DNY A;  1HT2 E;  3Q8G A;  4AZF A;  2AHM A;  1L2C A;  3MJ5 A;  5GKN A;  1G71 A;  3DOA A;  1VEJ A;  5ITX E;  4JI5 M;  1TDH A;  3EIH A;  3BOS A;  2E5L M;  1XXH B;  3DFZ A;  3IEC A;  1GL7 A;  3U5Z A;  2D7G A;  4MGY E;  3GLF E;  4HEO A;  2G8L A;  1D2N A;  3HU1 A;  1IBM M;  3NWL A;  4LF5 M;  1DGH A;  5JI2 E;  3AFH A;  4QOZ C;  2L6O A;  4D82 A;  3B74 A;  4LJ4 A;  3SC3 A;  2KZS A;  2JUJ A;  4LJ7 A;  1NO1 A;  1MX0 A;  1ZMU A;  5DYG A;  1PRB A;  2JA2 A;  2OOB A;  4LJ8 A;  2LHC A;  2XFS A;  4I81 A;  3J7A S;  1IN5 A;  1WJ7 A;  2F5Q A;  2MR9 A;  2XGN A;  4JI8 M;  2MGW A;  1QDT A;  1VDD A;  1QUT A;  4QNM A;  2DWL A;  5E26 A;  3SMS A;  5KQ8 A;  2HHH M;  2O25 A;  3FUV A;  4LG2 A;  3RGP A;  4AG6 A;  3UGJ A;  1N75 A;  3R8F A;  1GKI A;  5ITX A;  3FTE A;  4RNA A;  3VKH A;  5FTM A;  2CEA A;  2JZ0 A;  2Y0Q A;  4QHS A;  3JAM S;  3J80 S;  1DGH B;  2DAK A;  3K2L A;  3U6M A;  4JI1 M;  4FCV A;  4GIP A;  3B7N A;  3GLG A;  2RGO A;  2Z8Y M;  3GLG E;  5IZ7 D;  3SAR A;  4LF9 M;  3L25 A;  1L2D A;  5C18 A;  1OQY A;  1JQJ C;  1ZQ9 A;  4G4O A;  4DR2 M;  1ORY B;  1T6O A;  4IBK A;  3RFW A;  2BWE A;  3HHX A;  3SAT A;  2KW0 A;  2R62 A;  1NHW C;  5ITY A;  4AKI A;  1HT1 E;  4LZZ A;  1XNR M;  1HR0 M;  2I7P A;  1Z5C A;  4GHL A;  2EJS A;  3UJN A;  4WP2 A;  2WSC F;  2V1C A;  3TWL A;  3AOE C;  4Y28 F;  1QAO A;  1TGU A;  1G41 A;  2Y0T A;  4LGM A;  4UN2 B;  3SBJ A;  3GQ4 A;  4K0K M;  4LRS A;  4LF7 M;  3A46 A;  1TR8 A;  1OJL A;  2CE7 A;  3KSJ A;  4DR6 M;  3A42 A;  3HHY A;  2DWZ B;  1KFV A;  1XWI A;  3DZD A;  2DEN A;  3L26 A;  3GLH B;  2OPF A;  2LTU A;  5E6J A;  4PDI A;  3SAU A;  1QUS A;  4G4Q A;  3TWK A;  2R65 A;  1V34 A;  5DYI A;  1K82 A;  1KYI A;  4FW9 A;  4AW4 A;  1DV0 A;  3C3D A;  3MHV C;  1J09 A;  2K9D A;  4P16 A;  1NNU C;  3M7G A;  3THG A;  3FTC A;  4DUZ M;  1HNX M;  4P17 A;  3GLG B;  1JR3 D;  4XGI A;  2QQ8 A;  4LJ9 A;  5EXT A;  4G3O A;  2DAG A;  2EO2 A;  3PVS A;  4S12 A;  5FTL A;  3HHZ A;  1SXJ B;  5EXX A;  4DV1 M;  1OAI A;  2Z3X A;  2FS1 A;  2V6Z M;  1GLN A;  3UMM A;  3OTO M;  2VQF M;  1IQP A;  4WW0 A;  1XNQ M;  4KO8 A;  4MGK E;  1L2B A;  1SXJ E;  3M0E A;  3RGS A;  1W5S A;  3WHK A;  4GC5 A;  4DR1 M;  2XEP A;  1MU5 A;  3E46 A;  2L09 A;  4NRV A;  1WGN A;  4DV7 M;  4G4R A;  4GIT A;  4GHA A;  4DV5 M;  3LQR A;  4KHP M;  2CUZ A;  1J7K A;  2F5S A;  2JXN A;  4JI6 M;  2LVP C;  3CF2 A;  1Q39 A;  4D80 A;  3L27 A;  5ITU A;  3K8Z A;  4II7 A;  4JI4 M;  1MJG M;  2XZU A;  2XH9 A;  5DFL A;  4DR4 M;  4JV5 M;  1HNZ M;  3FTD A;  1WR1 B;  2CHG A;  3C3E A;  4RF1 A;  3K92 A;  4REZ A;  1S3S A;  4Z6Y A;  5BR8 M;  1Z59 A;  4GKK M;  3SAV A;  1XXH A;  4L15 A;  3SFZ A;  3CTW B;  2F5P A;  3LQQ A;  2L2D A;  5EP3 A;  5KPR A;  3SMP A;  3W0L B;  1V92 A;  4M9X A;  2C9O A;  4IBJ A;  3VFD A;  3C58 A;  3B89 A;  3E9S A;  2QEN A;  3EIE A;  3LVW A;  4YHH M;  2HL7 A;  3A45 A;  4F2L A;  1VEK A;  4LF6 M;  3R9X B;  7CAT A;  2DXI A;  4LRT A;  2R4J A;  2H5X A;  3PFI A;  3U6P A;  4DR7 M;  4QNR A;  4TUW A;  1E32 A;  2JY6 B;  2EUC A;  4MGZ E;  3B9P A;  1HNW M;  2MRO B;  4IBE A;  2QPA A;  2EA0 A;  1E9R A;  2C99 A;  1TF0 B;  3U6E A;  4JI2 M;  1IXR C;  1XC8 A;  1Z6T A;  3TPZ A;  1E9S A;  1IN4 A;  2HCB A;  1OTR A;  2D7E A;  1G8P A;  5C1B A;  4YY3 M;  1DO0 A;  3VDP A;  4RKU F;  2OOA A;  3KOW E;  4XBO A;  2LH0 A;  1PJT A;  1IXS B;  1IN8 A;  3WHL A;  2KA6 B;  4DV3 M;  1R2Y A;  5IT9 S;  3DA1 A;  4HL4 A;  5KPT A;  2JNH A;  2C98 A;  3LCU A;  2UU9 M;  4B7G A;  4PT5 A;  3MMP A;  3ILK A;  3KP1 E;  3GLH E;  3HX3 A;  5ITQ A;  2N35 A;  1N78 A;  1FNN A;  1JR3 A;  2MH8 A;  4MH0 E;  4CJ6 A;  1I94 M;  2JZ1 A;  3FRI A;  2KZU A;  2KHH A;  4LFB M;  3TE6 A;  1NJG A;  3KS8 A;  3HZJ A;  3VLF B;  3TWM A;  2LXE A;  1R2Z A;  2XZF A;  4AI6 A;  1IY2 A;  3I01 M;  1QDR A;  5EXP A;  1N77 A;  1QAN A;  4WUR A;  4X64 M;  2Z4R A;  3FYC A;  5KO3 A;  4JI7 M;  3AOE A;  3C9P A;  3KS4 A;  1PJS A;  4GEW A;  3GLF A;  3GLI A;  2L7I A;  3U61 A;  4EIW A;  1Z5B A;  2UUB M;  2DNA A;  3U6D A;  1XMO M;  1OIZ A;  2EKK A;  2BJV A;  1UM8 A;  2QCU A;  4M0W A;  4PCZ A;  5LMU M;  3U60 B;  1BVS A;  2K6B A;  3Q8X A;  1N33 M;  2JP7 A;  3KXE C;  3PNV A;  2ZAN A; 
#chains in the Genus database with same CATH homology
 3J27 B;  1IN7 A;  4FWG A;  3J2P B;  4MM3 B;  2F5O A;  3LVV A;  5EQT A;  4FCT A;  3UZU A;  4MB7 A;  5FLX S;  3T15 A;  2LNH C;  3HU3 A;  4LJ5 A;  1NSF A;  4NL4 H;  1K3W A;  1HQC A;  1TH4 A;  1IY1 A;  4DV2 M;  1XHB A;  2F4V M;  1N32 M;  5KQD A;  5EP2 A;  2C9C A;  8CAT A;  3FKE A;  3KOY E;  2XSZ D;  2ZAM A;  2RKO A;  4G4O A;  2YNM D;  4IBD A;  3GQ5 A;  4QOS A;  4LF8 M;  4LY6 A;  4QHT A;  4R7G A;  4G6Z A;  5IRE B;  3T38 A;  3T1H M;  3JR5 A;  2UXC M;  3JR4 A;  3U5Z B;  4NRW A;  4IIW A;  3FUT A;  2YQZ A;  1NY5 A;  3FD9 A;  4BBA A;  4AQY M;  2ZM6 M;  3VK8 A;  1PM5 A;  3U6O A;  3GLF B;  4JI0 M;  2CHQ A;  4DV6 M;  3U6S A;  2A5Y B;  2F5N A;  2XF3 A;  4BLC A;  4FWD A;  3GRU A;  4LJA A;  3FUX A;  3TQS A;  1N34 M;  3MK6 A;  3SHG B;  3L29 A;  1GL6 A;  1QYR A;  3M6A A;  4AG5 A;  4B7H A;  1X37 A;  1R7R A;  1T3T A;  1YSY A;  1IBL M;  1TH2 A;  2KRK A;  2YFQ A;  3HJS A;  2UUC M;  5FTN A;  4NSO B;  4A3V B;  4JYA M;  4IJE A;  2QBY A;  2CV1 A;  5LMN M;  1G3I A;  3GPY A;  2ZBK B;  2I7N A;  4G4N A;  2Y21 A;  3NBI A;  3KOZ E;  3HHW A;  4DUY M;  2FOI C;  4L16 A;  2QZ4 A;  2Z7J A;  2BJW A;  3W0F A;  3FUW A;  4GC9 A;  1PJJ A;  4KLN A;  4CGY B;  4FVM A;  2XFT A;  3VK7 A;  2UXD M;  3ZH9 B;  3KP0 E;  5ITT A;  2VQE M;  2CHV A;  4DV4 M;  2DVW B;  4CHT B;  1ZAE A;  3I4V A;  1KSF X;  2J7O A;  4B3T M;  4MGH A;  2QBY B;  4HLQ A;  3E4R A;  3KDS E;  1TDZ A;  3AL0 C;  3HJ8 A;  3ZC7 B;  1Q3C A;  1Z5A A;  3FYD A;  3GPP A;  4OVZ B;  2YR0 A;  4NXM M;  3K1J A;  3A98 B;  1QAQ A;  3AKZ A;  4ITQ A;  3ZCB B;  1QQW A;  3GRR A;  4BB9 A;  1DO2 A;  3PNY A;  2UUA M;  1OFI A;  2KRU A;  3GRV A;  5EP4 A;  4M9S A;  3TL4 X;  1TH3 A;  2XLJ A;  4X62 M;  2K47 A;  2DZO B;  4JXJ A;  3H4M A;  2BNK A;  2KXE A;  4GKJ M;  2RGH A;  4PD2 A;  3PXG A;  3U6L A;  4B3S M;  3J7B A;  3GPX A;  4OVZ A;  3IG8 A;  1IXZ A;  4R3D A;  4IBB A;  2CV0 A;  1Q3B A;  2FFJ A;  1C1K A;  3SHF A;  1L8Q A;  5EP1 A;  1H6U A;  5FTK A;  1YE9 A;  3KSX A;  4LJ6 A;  4JI3 M;  4DR5 M;  4NXN M;  4AKH A;  3FTF A;  3KW6 A;  3KOX E;  1SXJ A;  4IBC A;  4IJF A;  3SYL A;  4DV0 M;  2R45 A;  3HWS A;  5IWA M;  1K3X A;  3AOG A;  2O5R A;  5EJC A;  4D81 A;  3L28 A;  3KFU G;  2M60 A;  4FD2 A;  5EXS A;  5H37 D;  2G5G X;  3RE8 A;  4B3M M;  3SAW A;  3GLH A;  1SXJ C;  1L1Z A;  4L4U A;  4OW0 A;  3D8B A;  4I4L A;  2W82 A;  4LFA M;  1L1T A;  3I51 A;  3GO8 A;  1NNJ A;  1NHG C;  3D8L A;  3HU2 A;  4LF4 M;  1XMQ M;  4NOO B;  2X4A A;  2R46 A;  2OQ4 A;  3L2A A;  1SXJ D;  1DGF A;  3J81 S;  5FSW A;  1I4W A;  2R18 A;  4W5W A;  2UXB M;  1IY0 A;  1YUB A;  4Z8X A;  5A2Q S;  4GMQ A;  3LMM A;  4LCB A;  4IBI A;  3IG5 A;  2C96 A;  2V1U A;  1EE8 A;  4IBG A;  5KPZ A;  4GH9 A;  2LWX A;  1IM2 A;  2H1R A;  1W5T A;  4KOD A;  4LGY A;  3AJI B;  2CFO A;  1NVM A;  4L8R C;  4JN6 A;  4OU7 A;  3CF0 A;  4I5S A;  3HKP A;  3QAU A;  1WXQ A;  1LV7 A;  3GQ3 A;  3GPU A;  1DGB A;  4LZJ A;  3VDU A;  4X65 M;  1IN6 A;  1PJI A;  3GP1 A;  4PDG A;  2J7N A;  2XSZ A;  2VII A;  1R6B X;  3VKG A;  4RF0 A;  4FCW A;  3U6C A;  1HQY E;  4GRI A;  4LFC M;  4CIS A;  3I4Y A;  3U60 A;  2Y20 A;  1NJF A;  3AV0 A;  5JI3 E;  1E94 E;  2R4E A;  2P5T A;  1GVN A;  2X49 A;  2ERC A;  3U61 B;  2HKJ A;  2FNA A;  3SAS A;  3SYK A;  2DZN B;  4B3R M;  2D7H A;  2Q2E B;  2CV2 A;  1G4A E;  4M0D A;  2QP9 X;  3FUU A;  4DR3 M;  2ZAO A;  4IBF A;  4B7F A;  2Z4S A;  3U6Q A;  1N36 M;  2DWN A;  1QZM A;  4I8O A;  2DWM A;  1DGG A;  4X66 M;  4M9Z A;  3T1Y M;  2KEB A;  2C5R A;  4L78 A;  2M5Z A;  3GLI B;  1IBK M;  5F3W A;  1G59 A;  4B08 A;  5ITR A;  4OX9 M;  5BPV A;  4FWH A;  2L7H A;  2NQ8 C;  3QWL A;  3GRY A;  2FE8 A;  1FJG M;  4ZPX A;  3UK6 A;  5FTJ A;  1J5E M;  4AKG A;  1QVR A;  2X8A A;  4NSR A;  1OFH A;  3KVW A;  3HGI A;  1QAM A;  4MGI E;  3HJQ A;  1NY6 A;  3CF6 E;  5DNY A;  1HT2 E;  4AZF A;  2AHM A;  1L2C A;  3MJ5 A;  5GKN A;  3DOA A;  5ITX E;  4JI5 M;  1TDH A;  3EIH A;  3BOS A;  1XXH B;  3DFZ A;  1GL7 A;  3U5Z A;  2D7G A;  4MGY E;  2G8L A;  1D2N A;  3HU1 A;  1IBM M;  3NWL A;  4LF5 M;  1DGH A;  5JI2 E;  3AFH A;  4QOZ C;  2L6O A;  4D82 A;  4LJ4 A;  3SC3 A;  2KZS A;  4LJ7 A;  1MX0 A;  5DYG A;  2JA2 A;  4LJ8 A;  2XFS A;  4I81 A;  3J7A S;  1IN5 A;  2F5Q A;  2XGN A;  4JI8 M;  1VDD A;  4QNM A;  2DWL A;  5E26 A;  3SMS A;  5KQ8 A;  2HHH M;  4LG2 A;  3FUV A;  3RGP A;  4AG6 A;  3UGJ A;  1N75 A;  3R8F A;  1GKI A;  5ITX A;  3FTE A;  4RNA A;  3VKH A;  5FTM A;  2CEA A;  4QHS A;  2Y0Q A;  3JAM S;  3J80 S;  1DGH B;  3K2L A;  3U6M A;  4JI1 M;  4FCV A;  4GIP A;  3SAR A;  3GLG A;  2RGO A;  4LF9 M;  3L25 A;  5IZ7 D;  1L2D A;  5C18 A;  1JQJ C;  1ZQ9 A;  4DR2 M;  1ORY B;  4IBK A;  3RFW A;  3HHX A;  3SAT A;  2KW0 A;  2R62 A;  1NHW C;  5ITY A;  4AKI A;  1HT1 E;  4LZZ A;  1XNR M;  1HR0 M;  2I7P A;  1Z5C A;  4GHL A;  3UJN A;  3TWL A;  2V1C A;  3AOE C;  1QAO A;  1TGU A;  1G41 A;  2Y0T A;  4LGM A;  3SBJ A;  4K0K M;  3GQ4 A;  4LRS A;  4LF7 M;  3A46 A;  1OJL A;  2CE7 A;  3KSJ A;  4DR6 M;  3A42 A;  3HHY A;  2DWZ B;  1KFV A;  1XWI A;  3DZD A;  3L26 A;  3GLH B;  2OPF A;  5E6J A;  4PDI A;  3SAU A;  4G4Q A;  3TWK A;  2R65 A;  5DYI A;  1K82 A;  1KYI A;  4FW9 A;  4AW4 A;  3MHV C;  1J09 A;  4P16 A;  1NNU C;  3M7G A;  3THG A;  3FTC A;  4DUZ M;  1HNX M;  3GLG B;  1JR3 D;  4XGI A;  5EXT A;  4LJ9 A;  2EO2 A;  3PVS A;  4S12 A;  5FTL A;  3HHZ A;  1SXJ B;  5EXX A;  4DV1 M;  2Z3X A;  2V6Z M;  1GLN A;  3UMM A;  3OTO M;  2VQF M;  1IQP A;  4WW0 A;  1XNQ M;  4KO8 A;  4MGK E;  1L2B A;  1SXJ E;  3M0E A;  3RGS A;  1W5S A;  3WHK A;  4GC5 A;  4DR1 M;  2XEP A;  1MU5 A;  2L09 A;  4NRV A;  4DV7 M;  4G4R A;  4GHA A;  4GIT A;  4DV5 M;  3LQR A;  4KHP M;  2CUZ A;  1J7K A;  2F5S A;  4JI6 M;  3CF2 A;  1Q39 A;  4D80 A;  3L27 A;  5ITU A;  3K8Z A;  4II7 A;  4JI4 M;  2XZU A;  2XH9 A;  4DR4 M;  4JV5 M;  1HNZ M;  3FTD A;  2CHG A;  2E5L M;  4RF1 A;  4Z6Y A;  3K92 A;  4REZ A;  1S3S A;  5BR8 M;  1Z59 A;  4GKK M;  3SAV A;  1XXH A;  4L15 A;  3SFZ A;  3CTW B;  2F5P A;  3LQQ A;  5EP3 A;  5KPR A;  3SMP A;  3W0L B;  4M9X A;  2C9O A;  4IBJ A;  3VFD A;  3C58 A;  3E9S A;  3EIE A;  2QEN A;  3LVW A;  4YHH M;  2HL7 A;  3A45 A;  4LF6 M;  3R9X B;  7CAT A;  2DXI A;  4LRT A;  2R4J A;  3PFI A;  3U6P A;  4DR7 M;  4QNR A;  4TUW A;  1E32 A;  4MGZ E;  2EUC A;  3B9P A;  1HNW M;  4IBE A;  2QPA A;  2EA0 A;  1E9R A;  2C99 A;  3U6E A;  4JI2 M;  1IXR C;  1XC8 A;  1Z6T A;  3TPZ A;  1E9S A;  1IN4 A;  2HCB A;  5C1B A;  2D7E A;  1G8P A;  4YY3 M;  1DO0 A;  3VDP A;  4XBO A;  3KOW E;  2LH0 A;  1IXS B;  3WHL A;  1IN8 A;  1R2Y A;  2KA6 B;  4DV3 M;  5IT9 S;  3DA1 A;  4HL4 A;  5KPT A;  2C98 A;  2UU9 M;  4B7G A;  4PT5 A;  3ILK A;  3KP1 E;  5ITQ A;  1N78 A;  1FNN A;  1JR3 A;  4MH0 E;  1I94 M;  2KZU A;  4LFB M;  3TE6 A;  1NJG A;  3KS8 A;  3VLF B;  3TWM A;  2LXE A;  1R2Z A;  2XZF A;  4AI6 A;  1IY2 A;  5EXP A;  1N77 A;  1QAN A;  4WUR A;  4X64 M;  2Z4R A;  3FYC A;  5KO3 A;  4JI7 M;  3AOE A;  3KS4 A;  3GLF A;  3U61 A;  3GLI A;  2L7I A;  4EIW A;  1Z5B A;  2UUB M;  3U6D A;  1XMO M;  4M0W A;  2BJV A;  1UM8 A;  2QCU A;  4PCZ A;  5LMU M;  3U60 B;  3Q8X A;  1N33 M;  2DHR A;  3KXE C;  3PNV A;  2ZAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...