4OX9M

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
source organism Escherichia coli
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ox9M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ox9M02
2F5QA 1EE8A 3VK8A 2UXCM 1XMOM 1MU5A 3VK7A 4LF7M 4CISA 1L1TA 3U6OA 3SATA 3GPPA 4JYAM 3GPXA 4OX9M 2XZUA 3J81S 4B3RM 3JAMS 2VQFM 3A45A 3U6PA 5FLXS 3GQ5A 4GKJM 1R2ZA 1N32M 3DOAA 2UUCM 2EA0A 4LF8M 4JI0M 1HNXM 4DR2M 2OQ4A 4DR6M 1TDHA 3U6EA 4JI5M 4X65M 1IBMM 3GP1A 2XZFA 1K82A 1Z5CA 4LFBM 4X62M 4AQYM 4DV7M 3T1HM 3OTOM 5A2QS 1PJIA 1Q3BA 1HNWM 1NNJA 4LF9M 1PM5A 3J80S 4MB7A 3J7AS 1K3XA 1K3WA 2ZBKB 3SAUA 4LFAM 4DR4M 3A42A 4JI6M 4G4RA 4LF6M 1J5EM 1N33M 4DV1M 1FJGM 3U6MA 4DUZM 3U6CA 3JR4A 3TWMA 3A46A 1MX0A 2UUBM 1IBLM 1Q3CA 4DV2M 3GPUA 2E5LM 4JI2M 4K0KM 1PJJA 5LMNM 1HNZM 2OPFA 3U6SA 1XC8A 4DV4M 2UXDM 4JI3M 4DV3M 3U6DA 1XNQM 4PCZA 4ITQA 3TWKA 4X66M 1N36M 4JI7M 3U6QA 3C58A 2UU9M 4YY3M 5LMUM 1Z5AA 3TWLA 4NXNM 4DR5M 3SBJA 4NRVA 3T1YM 1R2YA 1Z5BA 5ITYA 4DV5M 4DR3M 1N34M 1KFVA 2UUAM 2F5SA 4JI4M 4B3TM 4YHHM 4G4NA 3SARA 3JR5A 5ITQA 4JI1M 4JI8M 1IBKM 4DV6M 3SAWA 4KHPM 5ITTA 4PD2A 5ITRA 2Q2EB 5BR8M 1I94M 1XMQM 3GQ3A 2F5PA 4G4QA 4DR7M 1Q39A 2HKJA 3SASA 2F5NA 3U6LA 5ITXA 3GQ4A 3GPYA 5IWAM 4X64M 1L2BA 3SAVA 1L1ZA 1L2DA 4NRWA 2ZM6M 2UXBM 3W0FA 1L2CA 2F5OA 4PDIA 3GO8A 4NXMM 4JV5M 2F4VM 2VQEM 4LF5M 4G4OA 4LF4M 1HR0M 1TDZA 4B3MM 5ITXE 4PDGA 5ITUA 4LFCM 2HHHM 4DV0M 4GKKM 1XNRM 5IT9S 4DUYM 4DR1M 4B3SM 1Z59A
chains in the Genus database with same CATH superfamily
1IXSA 3T6PA 5JI3E 3FUUA 3KP1E 1R5LA 2DAGA 4FCVA 1DO0A 4JXJA 1E32A 2QQ8A 4GEWA 5IZ7D 1IN8A 1T43A 3VK7A 4XBOA 2DZOB 2K9DA 3HU3A 4AZFA 1WR1B 3SATA 3R8FA 4Y28F 3B9PA 3FYDA 2MGWA 3KS8A 1Z6TA 2JY7A 2QCUA 1OIPA 3A45A 2K0BX 1TGUA 4MGHA 3ZH9B 3GLFB 4AKGA 3K1JA 2Z7JA 2UUCM 4Z8XA 1GKIA 4B08A 4DR2M 4GRIA 4LY6A 4DR6M 1CUKA 4JI5M 1H6UA 3UZUA 1OAIA 2X4AA 1WHCA 4GIPA 1IBMM 1ZQ9A 2DNAA 5DYIA 1QUTA 1Z5CA 5FTLA 4RF0A 1P3QQ 2XF3A 2CHQA 1ZAEA 4FVMA 1JR3E 3IHPA 4LJ9A 1NNJA 4WURA 4D81A 1W5SA 4MB7A 1WXQA 1QAOA 2O25A 3CGWA 3SAUA 5KPZA 3CF6E 1XHBA 2LVPC 3PXGA 4G4RA 1J5EM 2KEBA 2L7HA 1FNNA 4IBBA 2C5RA 2JZ1A 2J7NA 4IBCA 1GJTA 3U6CA 2QBYB 3B7QA 3TWMA 3V76A 1PRBA 3A46A 4AG5A 3NBIA 4JN6A 1A5TA 4FWDA 4LRSA 3M6AA 3T38A 4JI2M 1GVNA 3KS4A 1ZV1A 1PJJA 3K2LA 3UGJA 3LVVA 1YE9A 4MGIE 5KPTA 2OPFA 3LQRA 2Z8YM 3U6DA 1XWIA 2J7OA 1ORYB 1G71A 2DWLA 4PCZA 4ITQA 3FUXA 2V1UA 3M7GA 1NO1A 2WSEF 1G8PA 3QWLA 3C58A 2ZTDA 5LMUM 2LH0A 4KHPM 1NVMA 2EKKA 1UFZA 5FTMA 5ITYA 2RGOA 4DV5M 2F5SA 2XLJA 2DHYA 3FTDA 4YHHM 3SC3A 3GRUA 2EKFA 4KLNA 1WGLA 2CFOA 1VDLA 2GQFA 3D8LA 4LJAA 4JI1M 3RGPA 4R3DA 3WHKA 2C98A 4PD2A 1GLNA 3U61A 2MR9A 3J27B 3AOGA 1I94M 3KVWA 2F5PA 1Q39A 4R7GA 2HKJA 1SXJE 4D80A 1OJLA 1OFHA 4PT5A 5ITXA 3B89A 2AHMA 4LZJA 4M9ZA 3EIEA 1E94E 3GLHA 1L2DA 1AIPC 4GHLA 3BBZA 1I4WA 2ZM6M 1Y8GA 3LW5F 1L2CA 2F5OA 1DGBA 2P5TA 3FUWA 3CF0A 4PDIA 3GO8A 4NXMM 4JV5M 2HL7A 2F4VM 3KDSE 2LHCA 2VQEM 1JB0F 1G3IA 2J5YA 4MM3B 3U60B 3HX3A 1RU3A 2BJWA 2LNHC 4LGYA 1NHWC 2QZ4A 3ZQJA 2X49A 2XEPA 4FCTA 4LFCM 4DV0M 1EIJA 3AOEC 1DGHB 4FWGA 2MH8A 1XNRM 5IT9S 3VKGA 2FOIC 4DR1M 3H4JA 1GABA 1JR3D 2F5QA 2KW0A 1EE8A 4GH9A 1NV8A 5EXSA 4B7FA 1VEKA 4IJFA 1XMOM 1DGGA 2R65A 1VEGA 2Y0TA 1W5TA 3F92A 3HU1A 3IG8A 2VIIA 4LGMA 3MHVC 5EXPA 1S3SA 1N77A 1NV9A 5FTKA 3U6OA 3AJIB 3HWSA 2KNVA 2XZUA 4OW0A 1ZMWA 4P16A 4HLQA 3VFDA 3B7NA 2EJSA 5C18A 2JY5A 4B3RM 2WZJA 3SHFA 3U6PA 4AKIA 1DGHA 3GQ5A 1R2ZA 3SHGB 2VDBB 1KSFX 2JXNA 4FWHA 2L6OA 4NOOB 1GL6A 4JI0M 4LF8M 2OQ4A 1F4IA 1MN3A 1TDHA 1N78A 2KRKA 3B7ZA 4QHTA 3FE3A 4XK8F 2QHOB 3GLGB 1DV0A 2JA2A 4IBEA 3HJSA 3GP1A 2XZFA 2CHVA 2KNAA 3L25A 3K9OA 3LCVB 2KNZA 4AKHA 2QBYA 3UK6A 2K6BA 1UM8A 2RGHA 2XFSA 1SXJB 4M0WA 2HWJA 1R7RA 1IFYA 2L4FA 4KO8A 4TUWA 2LTUA 2R45A 3I01M 5FTNA 1C7YA 3J7AS 2QNJA 1NJFA 1XXHB 4KT0F 4I81A 1K3WA 5IREB 4QHSA 5FTJA 3L28A 3UMMA 3SYKA 4LF6M 4NC6A 3M0EA 2CRUA 3U6MA 2H5XA 3HHXA 1D0LA 4DUZM 3QAUA 4L4UA 4CIZA 1J09A 3JR4A 1QQWA 2CHGA 3KW6A 3VDPA 5EXTA 3WHLA 4DBGB 4F2LA 2ERCA 3FUVA 4DV2M 2Z4RA 3GPUA 2CWBA 2E5LM 2JNHA 2CV2A 2KZUA 2LVNC 2FFJA 5EP1A 2CEAA 4CHTB 2EUCA 4DV4M 4JI3M 1OQYA 4NSOB 2XGNA 4JI7M 3TWKA 1N36M 1XXHA 1VDDA 1Q02A 3L26A 3U6QA 1E9RA 3J2PB 4LJ4A 4YY3M 2UU9M 1NSFA 3AL0C 2QENA 3BOSA 4DR5M 5DFLA 3UJNA 3SMPA 3T1YM 4DR3M 1KFVA 3KOXE 2YNMD 3FRHA 3FYCA 2UUAM 1TF0B 4B3TM 4IBKA 3SARA 2KZSA 5ITQA 5KQDA 1IBKM 4B7GA 2R18A 1SXJD 2JZ0A 2R0IA 1YSYA 3FUTA 5ITTA 2LHGA 3AKZA 5ITRA 2LWXA 3GLGE 2Y21A 2CV0A 4DR7M 1QUSA 2ZAOA 3SASA 1LV7A 3GLIA 2L4EA 4KODA 4L15A 3QYEA 2B3TA 2KHHA 2Z4SA 4F1IA 4GC9A 1D2NA 2D7EA 4R71A 4M0DA 4ANRA 4L8RC 2R6FA 4NSRA 4MGZE 1G41A 2QSFX 3IG5A 2YR0A 4L6V6 3A98B 1IXRC 5E6JA 3Q8XA 1HR0M 3FTEA 1X37A 5ITXE 1HT1E 3MK6A 2C9OA 2R46A 2V1CA 4GKKM 3I04M 3SYLA 4MH0E 2FNAA 3W68A 3W67A 2UXCM 5EP3A 4II7A 4BLCA 2HCBA 4LJ8A 3GLIE 2D7GA 3AFHA 3GRVA 3U60A 2CV1A 3GLFA 4CISA 3HHWA 3TPZA 1L1TA 3GPPA 3KOZE 3GPXA 2BJVA 2RKOA 4WW0A 4I5SA 1HT2E 2W82A 1HQCA 2VQFM 3GLHB 3J7BA 3FTFA 1G4AE 1QYRA 3HKPA 2JY6B 4GKJM 2JWSA 1OAOC 3KFUG 3GLIB 2EA0A 3C3DA 1HNXM 2QPAA 4BBAA 4GMQA 1IXSB 2JP7A 1XXHE 4X65M 5H37D 2Z3XA 4OVZB 2K47A 1T3TA 4AW4A 2KA6B 2DVWB 2XSZA 2A5YB 2DAEA 4LRTA 2DHRA 4FD2A 3T15A 3VLFB 4LFBM 2DWZB 3T1HM 1PJIA 3ZC7B 1Q3BA 4I4LA 3HU2A 2DXIA 4HL4A 1HNWM 2JY8A 2VF7A 2R44A 5KQ8A 1QAMA 4LG2A 2DAIA 2DAKA 1IN6A 2ZBKB 3TE6A 3BXWA 4LFAM 1QZEA 4GITA 4NL4H 4DR4M 1JR3A 4L78A 2ZANA 4JI6M 1FJGM 1L8QA 3K9PA 2LXEA 3L27A 2DWMA 2FS1A 2H1RA 4IJEA 3CF2A 3HGIA 1YUBA 5JI2E 1D0KA 3U61B 3U5ZA 3KSJA 1IBLM 1WJ7A 3DZDA 4D82A 5EP4A 2QP9X 3GRYA 1NJGA 2EO2A 3PNYA 4CJ6A 2G8LA 3FKEA 3U5ZB 3PFIA 1TTEA 2BWBA 1PJQA 2JUJA 3B74A 5EP2A 4AG6A 5LMNM 5F3WA 2DAMA 4M9XA 3E9SA 4EIWA 2GNOA 1HQYE 2UXDM 4DV3M 3DFZA 4S12A 1JQJC 5EXXA 3HHZA 2OOBA 3E21A 3H4MA 2DWNA 3TWLA 1ZMUA 3SBJA 2CUZA 1R2YA 2D7HA 1N34M 3HJ8A 1SG9A 2G5GX 4JI4M 1OTRA 2XSZD 2M5ZA 2OOAA 1IXZA 3KXEC 4RKUF 2DI0A 3ZCBB 3FTCA 5L8RF 2MJ5B 1VQ1A 1NNUC 1V33A 1J7KA 2VF8A 2ZAMA 3HZJA 4IBFA 4DV6M 3SAWA 2BNKA 2C96A 3E4RA 2Q2EB 3HY5A 1XMQM 1PJTA 3GQ3A 1QAQA 3VDUA 1V92A 1MJGM 2O01F 3MMPA 4B7HA 2F5NA 3U6LA 3GQ4A 2I7PA 5IWAM 2R62A 1QANA 1OKSA 1WGNA 2XH9A 2Y0QA 4I8OA 1IQPA 4NRWA 1N75A 3TL4X 3KSXA 2M60A 2G3QA 2UXBM 1OFIA 2KXEA 2XFTA 4CGYB 4LF5M 4P17A 4MGKE 3MJ5A 5DYGA 5C1BA 5FSWA 2CE7A 1QVRA 1IN7A 3KOWE 4B3MM 1E9SA 1TR8A 5KO3A 3L2AA 5ITUA 4MGYE 1AUAA 7CATA 3L29A 4IBJA 3PNVA 3W0LB 2WSFF 1Z59A 3KP0E 3VK8A 1GO5A 4GC5A 3DA1A 3SFZA 1IY0A 1SXJA 1G59A 3K8ZA 4LJ5A 1MU5A 4LF7M 3I51A 1PJSA 4JYAM 2R4EA 4OX9M 3J81S 1TH2A 2O5RA 3JAMS 3I4VA 3HJQA 3FRIA 5FLXS 2KDLA 1N32M 1HJPA 3DOAA 1C1KA 4L16A 3I4YA 2DZLA 2RRUA 3PVSA 4RNAA 1SXJC 4HEOA 3U6EA 2DENA 2L7IA 3AV0A 3CTWB 1TH4A 3C3EA 1K82A 3NBXX 1IN5A 1KYIA 2YFQA 4X62M 2CP8A 2DKLA 2L2DA 1OIZA 4AQYM 4WP2A 2R4JA 4DV7M 4IBGA 3RE8A 5A2QS 2LVAA 3OTOM 3Q8GA 4IBIA 4LF9M 1PM5A 8CATA 1VEJA 5E26A 3J80S 3VKHA 3LQQA 1D0MA 2LVOC 3E46A 1R6BX 4M9SA 1K3XA 2DZNB 2HAKA 1VG5A 2LVQD 2ZTCA 1LTMA 3A42A 1V34A 4DV1M 1N33M 2FH0A 3KOYE 4LJ7A 2NQ8C 3ILKA 4FCWA 1YLAA 4QNRA 1MX0A 4Z6YA 2UUBM 4GHAA 4Q7JA 4LCBA 1TH3A 1Q3CA 1DGFA 1NY6A 4IIWA 4QOSA 1XB2B 5DNYA 2FE8A 3GRRA 2X8AA 4K0KM 1QZMA 2APLA 3HHYA 5GKNA 1HNZM 3U6SA 1XC8A 1NY5A 4RF1A 5BPVA 1XNQM 1GJSA 1ZMVA 3NWLA 3SMSA 3K92A 4X66M 4FW9A 4LZZA 3R9XB 1QDRA 1Z5AA 4G3OA 4NXNM 4NRVA 2LBCA 1Z5BA 4ZPXA 2I7NA 2WSCF 2L09A 3LMMA 3QYBA 4G4NA 1IN4A 3RFWA 1GL7A 4BB9A 3D8BA 1NHGC 3JR5A 4JI8M 1QDTA 1PGYA 4LJ6A 1BVSA 1IM2A 5BR8M 1IY1A 3GLFE 3GLGA 4G4QA 2KRUA 3EIHA 2OO9A 3IECA 4QNMA 4QOZC 3FD9A 4LF4M 4REZA 1L2BA 3GPYA 4X64M 4G6ZA 3SAVA 2Y20A 3RGSA 1L1ZA 5EJCA 4W5WA 4OU7A 1DO2A 2MROB 5KPRA 3TQSA 3W0FA 2C9CA 2BWEA 4AI6A 1R4GA 3LCUA 3THGA 2N35A 4G4OA 4XGIA 3GLHE 2C99A 3C9PA 1TDZA 5EQTA 1IY2A 4PDGA 2YQZA 1WIVA 3AOEA 2HHHM 3LVWA 4UN2B 4DUYM 2V6ZM 4OVZA 1EFUB 1T6OA 4IBDA 4B3SM 4A3VB
chains in the Genus database with same CATH topology
5JI3E 3FUUA 3KP1E 4FCVA 1DO0A 4JXJA 1E32A 5IZ7D 1IN8A 3VK7A 4XBOA 2DZOB 3HU3A 4AZFA 3SATA 3R8FA 3B9PA 3FYDA 3KS8A 1Z6TA 2QCUA 3A45A 1TGUA 4MGHA 3ZH9B 3GLFB 4AKGA 3K1JA 2Z7JA 2UUCM 4Z8XA 1GKIA 4B08A 4DR2M 4GRIA 4LY6A 4DR6M 4JI5M 1H6UA 3UZUA 2X4AA 4GIPA 1IBMM 1ZQ9A 5DYIA 1Z5CA 5FTLA 4RF0A 2XF3A 2CHQA 1ZAEA 4FVMA 4LJ9A 1NNJA 4WURA 4D81A 1W5SA 4MB7A 1WXQA 1QAOA 3SAUA 5KPZA 3CF6E 1XHBA 3PXGA 4G4RA 1J5EM 2KEBA 2L7HA 1FNNA 4IBBA 2C5RA 2J7NA 4IBCA 3U6CA 2QBYB 3TWMA 3A46A 4AG5A 3NBIA 4JN6A 4FWDA 4LRSA 3M6AA 3T38A 4JI2M 1GVNA 3KS4A 1PJJA 3K2LA 3UGJA 3LVVA 1YE9A 4MGIE 5KPTA 2OPFA 3LQRA 3U6DA 1XWIA 2J7OA 1ORYB 2DWLA 4PCZA 4ITQA 3FUXA 2V1UA 3M7GA 3QWLA 1G8PA 3C58A 5LMUM 2LH0A 4KHPM 1NVMA 5FTMA 4DV5M 5ITYA 2RGOA 2F5SA 2XLJA 3FTDA 4YHHM 3SC3A 3GRUA 4KLNA 4JI1M 2CFOA 4LJAA 3D8LA 3RGPA 4R3DA 3WHKA 2C98A 4PD2A 1GLNA 3U61A 3J27B 3AOGA 1I94M 3KVWA 2F5PA 1Q39A 4R7GA 2HKJA 1SXJE 4D80A 1OJLA 1OFHA 4PT5A 5ITXA 2AHMA 4LZJA 4M9ZA 3EIEA 1E94E 3GLHA 1L2DA 4GHLA 2ZM6M 1I4WA 1L2CA 2F5OA 1DGBA 2P5TA 3FUWA 3CF0A 4PDIA 3GO8A 4NXMM 4JV5M 2HL7A 2F4VM 3KDSE 2VQEM 1G3IA 4MM3B 3U60B 2LNHC 2BJWA 4LGYA 1NHWC 2QZ4A 2X49A 2XEPA 4FCTA 4LFCM 4DV0M 3AOEC 1DGHB 4FWGA 1XNRM 5IT9S 3VKGA 2FOIC 4DR1M 1JR3D 2F5QA 2KW0A 1EE8A 4GH9A 5EXSA 4B7FA 4IJFA 1XMOM 1DGGA 2R65A 3IG8A 2Y0TA 1W5TA 3HU1A 2VIIA 4LGMA 3MHVC 5EXPA 1S3SA 1N77A 5FTKA 3U6OA 3AJIB 3HWSA 2XZUA 4OW0A 4P16A 4HLQA 3VFDA 4B3RM 5C18A 3SHFA 3U6PA 4AKIA 1DGHA 3GQ5A 1R2ZA 3SHGB 1KSFX 4LF8M 4FWHA 2L6OA 4NOOB 1GL6A 4JI0M 2OQ4A 1TDHA 1N78A 2KRKA 4QHTA 3GLGB 2JA2A 4IBEA 3HJSA 3GP1A 2XZFA 2CHVA 3L25A 4AKHA 2QBYA 3UK6A 1UM8A 2RGHA 2XFSA 1SXJB 4M0WA 1R7RA 4KO8A 4TUWA 2R45A 5FTNA 3J7AS 1NJFA 1XXHB 4I81A 1K3WA 5IREB 4QHSA 5FTJA 3L28A 3UMMA 3SYKA 4LF6M 3M0EA 3U6MA 3HHXA 4DUZM 3QAUA 4L4UA 1J09A 3JR4A 1QQWA 2CHGA 3KW6A 3VDPA 5EXTA 3WHLA 2ERCA 3FUVA 4DV2M 2Z4RA 3GPUA 2E5LM 2CV2A 2KZUA 5EP1A 2FFJA 2CEAA 4CHTB 2EUCA 4DV4M 4JI3M 4NSOB 2XGNA 4JI7M 3TWKA 1N36M 1XXHA 1VDDA 3L26A 3U6QA 1E9RA 3J2PB 4LJ4A 4YY3M 2UU9M 1NSFA 3AL0C 2QENA 3BOSA 4DR5M 3UJNA 3SMPA 3T1YM 4DR3M 1KFVA 3KOXE 2YNMD 3FYCA 2UUAM 4B3TM 4IBKA 3SARA 2KZSA 5ITQA 5KQDA 1IBKM 4B7GA 1SXJD 2R18A 1YSYA 3FUTA 5ITTA 3AKZA 5ITRA 2LWXA 2Y21A 2CV0A 4DR7M 2ZAOA 3SASA 1LV7A 3GLIA 4KODA 4L15A 2Z4SA 4GC9A 1D2NA 2D7EA 4L8RC 4M0DA 4NSRA 4MGZE 1G41A 3IG5A 2YR0A 3A98B 1IXRC 5E6JA 3Q8XA 1HR0M 3FTEA 1X37A 5ITXE 1HT1E 3MK6A 2C9OA 2R46A 2V1CA 4GKKM 3SYLA 4MH0E 2FNAA 2UXCM 5EP3A 4II7A 4BLCA 2HCBA 4LJ8A 2D7GA 3AFHA 3GRVA 3U60A 2CV1A 3GLFA 4CISA 3HHWA 3TPZA 1L1TA 3GPPA 3KOZE 3GPXA 2BJVA 2RKOA 4WW0A 4I5SA 1HT2E 2W82A 1HQCA 2VQFM 3GLHB 3J7BA 3FTFA 1G4AE 1QYRA 3HKPA 4GKJM 3KFUG 3GLIB 2EA0A 1HNXM 2QPAA 4BBAA 4GMQA 1IXSB 4X65M 5H37D 2Z3XA 4OVZB 2K47A 1T3TA 4AW4A 2KA6B 2DVWB 2XSZA 2A5YB 4LRTA 3T15A 2DHRA 4FD2A 3VLFB 4LFBM 2DWZB 3T1HM 1PJIA 3ZC7B 1Q3BA 4I4LA 3HU2A 2DXIA 4HL4A 1HNWM 5KQ8A 1QAMA 4LG2A 1IN6A 2ZBKB 3TE6A 4LFAM 4GITA 4NL4H 4DR4M 1JR3A 4L78A 2ZANA 4JI6M 1FJGM 1L8QA 2LXEA 3L27A 2DWMA 2H1RA 4IJEA 3CF2A 3HGIA 1YUBA 5JI2E 3U61B 3U5ZA 3KSJA 1IBLM 3DZDA 4D82A 5EP4A 2QP9X 3GRYA 1NJGA 2EO2A 3PNYA 3U5ZB 2G8LA 3FKEA 3PFIA 5EP2A 4AG6A 5LMNM 5F3WA 4M9XA 3E9SA 4EIWA 1HQYE 2UXDM 4DV3M 3DFZA 4S12A 1JQJC 5EXXA 3HHZA 3H4MA 2DWNA 3TWLA 3SBJA 1R2YA 2CUZA 1N34M 2D7HA 3HJ8A 2G5GX 4JI4M 2XSZD 2M5ZA 1IXZA 3KXEC 3ZCBB 3JR5A 3FTCA 2ZAMA 1NNUC 1J7KA 4DV6M 4IBFA 3SAWA 2BNKA 2C96A 3E4RA 2Q2EB 1XMQM 3GQ3A 1QAQA 3VDUA 2F5NA 4B7HA 3U6LA 3GQ4A 2I7PA 5IWAM 2R62A 1QANA 2XH9A 4I8OA 2Y0QA 1IQPA 4NRWA 1N75A 3TL4X 3KSXA 2M60A 2UXBM 1OFIA 2KXEA 2XFTA 4CGYB 4LF5M 4MGKE 3MJ5A 5DYGA 5C1BA 5FSWA 2CE7A 1QVRA 1IN7A 3KOWE 4B3MM 1E9SA 5KO3A 4LF4M 3L2AA 5ITUA 4MGYE 7CATA 3L29A 4IBJA 3PNVA 3W0LB 1Z59A 3KP0E 3VK8A 4GC5A 3DA1A 3SFZA 1IY0A 1SXJA 1G59A 3K8ZA 4LJ5A 1MU5A 4LF7M 3I51A 4JYAM 2R4EA 4OX9M 3J81S 1TH2A 2O5RA 3JAMS 3I4VA 3HJQA 5FLXS 1N32M 3DOAA 1C1KA 4L16A 3I4YA 3PVSA 4RNAA 1SXJC 3U6EA 2L7IA 3AV0A 3CTWB 1TH4A 1K82A 1IN5A 1KYIA 2YFQA 4X62M 4AQYM 2R4JA 4DV7M 4IBGA 3RE8A 5A2QS 3OTOM 4IBIA 4LF9M 1PM5A 8CATA 5E26A 3J80S 3VKHA 3LQQA 1K3XA 1R6BX 4M9SA 2DZNB 3A42A 1N33M 4DV1M 3KOYE 4LJ7A 2NQ8C 3ILKA 4FCWA 4QNRA 1MX0A 4Z6YA 2UUBM 4GHAA 4LCBA 1TH3A 1Q3CA 1DGFA 1NY6A 4IIWA 4QOSA 5DNYA 2FE8A 3GRRA 2X8AA 4K0KM 1QZMA 3HHYA 5GKNA 1HNZM 3U6SA 1XC8A 1NY5A 4RF1A 5BPVA 1XNQM 3NWLA 3SMSA 3K92A 4X66M 4FW9A 4LZZA 3R9XB 1Z5AA 4NXNM 4NRVA 1Z5BA 4ZPXA 2I7NA 2L09A 3LMMA 4G4NA 1IN4A 3RFWA 1GL7A 4BB9A 3D8BA 1NHGC 4JI8M 4LJ6A 1IM2A 5BR8M 1IY1A 3GLGA 4G4QA 2KRUA 3EIHA 4QNMA 4QOZC 3FD9A 4REZA 1L2BA 3GPYA 4X64M 4G6ZA 3SAVA 2Y20A 3RGSA 1L1ZA 5EJCA 4W5WA 4OU7A 1DO2A 5KPRA 3TQSA 3W0FA 2C9CA 4AI6A 3THGA 4G4OA 4XGIA 2C99A 1TDZA 5EQTA 1IY2A 4PDGA 2YQZA 2HHHM 3AOEA 3LVWA 4DUYM 2V6ZM 4OVZA 4IBDA 4B3SM 4A3VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5Q A;  1EE8 A;  3VK8 A;  2UXC M;  1XMO M;  1MU5 A;  3VK7 A;  4LF7 M;  4CIS A;  1L1T A;  3U6O A;  3SAT A;  3GPP A;  4JYA M;  3GPX A;  4OX9 M;  2XZU A;  3J81 S;  4B3R M;  3JAM S;  2VQF M;  3A45 A;  3U6P A;  5FLX S;  3GQ5 A;  4GKJ M;  1R2Z A;  1N32 M;  3DOA A;  2UUC M;  2EA0 A;  4LF8 M;  4JI0 M;  1HNX M;  4DR2 M;  2OQ4 A;  4DR6 M;  1TDH A;  3U6E A;  4JI5 M;  4X65 M;  1IBM M;  3GP1 A;  2XZF A;  1K82 A;  1Z5C A;  4LFB M;  4X62 M;  4AQY M;  4DV7 M;  3T1H M;  3OTO M;  5A2Q S;  1PJI A;  1Q3B A;  1HNW M;  1NNJ A;  4LF9 M;  1PM5 A;  3J80 S;  4MB7 A;  3J7A S;  1K3X A;  1K3W A;  2ZBK B;  3SAU A;  4LFA M;  4DR4 M;  3A42 A;  4JI6 M;  4G4R A;  4LF6 M;  1J5E M;  1N33 M;  4DV1 M;  1FJG M;  3U6M A;  4DUZ M;  3U6C A;  3JR4 A;  3TWM A;  3A46 A;  1MX0 A;  2UUB M;  1IBL M;  1Q3C A;  4DV2 M;  3GPU A;  2E5L M;  4JI2 M;  4K0K M;  1PJJ A;  5LMN M;  1HNZ M;  2OPF A;  3U6S A;  1XC8 A;  4DV4 M;  2UXD M;  4JI3 M;  4DV3 M;  3U6D A;  1XNQ M;  4PCZ A;  4ITQ A;  3TWK A;  4X66 M;  1N36 M;  4JI7 M;  3U6Q A;  3C58 A;  2UU9 M;  4YY3 M;  5LMU M;  1Z5A A;  3TWL A;  4NXN M;  4DR5 M;  3SBJ A;  4NRV A;  3T1Y M;  1R2Y A;  1Z5B A;  5ITY A;  4DV5 M;  4DR3 M;  1N34 M;  1KFV A;  2UUA M;  2F5S A;  4JI4 M;  4B3T M;  4YHH M;  4G4N A;  3SAR A;  3JR5 A;  5ITQ A;  4JI1 M;  4JI8 M;  1IBK M;  4DV6 M;  3SAW A;  4KHP M;  5ITT A;  4PD2 A;  5ITR A;  2Q2E B;  5BR8 M;  1I94 M;  1XMQ M;  3GQ3 A;  2F5P A;  4G4Q A;  4DR7 M;  1Q39 A;  2HKJ A;  3SAS A;  2F5N A;  3U6L A;  5ITX A;  3GQ4 A;  3GPY A;  5IWA M;  4X64 M;  1L2B A;  3SAV A;  1L1Z A;  1L2D A;  4NRW A;  2ZM6 M;  2UXB M;  3W0F A;  1L2C A;  2F5O A;  4PDI A;  3GO8 A;  4NXM M;  4JV5 M;  2F4V M;  2VQE M;  4LF5 M;  4G4O A;  4LF4 M;  1HR0 M;  1TDZ A;  4B3M M;  5ITX E;  4PDG A;  5ITU A;  4LFC M;  2HHH M;  4DV0 M;  4GKK M;  1XNR M;  5IT9 S;  4DUY M;  4DR1 M;  4B3S M;  1Z59 A; 
#chains in the Genus database with same CATH topology
 1IXS A;  3T6P A;  5JI3 E;  3FUU A;  3KP1 E;  1R5L A;  2DAG A;  4FCV A;  1DO0 A;  4JXJ A;  1E32 A;  2QQ8 A;  4GEW A;  5IZ7 D;  1IN8 A;  1T43 A;  3VK7 A;  4XBO A;  2DZO B;  2K9D A;  3HU3 A;  4AZF A;  1WR1 B;  3SAT A;  3R8F A;  4Y28 F;  3B9P A;  3FYD A;  2MGW A;  3KS8 A;  1Z6T A;  2JY7 A;  2QCU A;  1OIP A;  3A45 A;  2K0B X;  1TGU A;  4MGH A;  3ZH9 B;  3GLF B;  4AKG A;  3K1J A;  2Z7J A;  2UUC M;  4Z8X A;  1GKI A;  4B08 A;  4DR2 M;  4GRI A;  4LY6 A;  4DR6 M;  1CUK A;  4JI5 M;  1H6U A;  3UZU A;  1OAI A;  2X4A A;  1WHC A;  4GIP A;  1IBM M;  1ZQ9 A;  2DNA A;  5DYI A;  1QUT A;  1Z5C A;  5FTL A;  4RF0 A;  1P3Q Q;  2XF3 A;  2CHQ A;  1ZAE A;  4FVM A;  1JR3 E;  3IHP A;  4LJ9 A;  1NNJ A;  4WUR A;  4D81 A;  1W5S A;  4MB7 A;  1WXQ A;  1QAO A;  2O25 A;  3CGW A;  3SAU A;  5KPZ A;  3CF6 E;  1XHB A;  2LVP C;  3PXG A;  4G4R A;  1J5E M;  2KEB A;  2L7H A;  1FNN A;  4IBB A;  2C5R A;  2JZ1 A;  2J7N A;  4IBC A;  1GJT A;  3U6C A;  2QBY B;  3B7Q A;  3TWM A;  3V76 A;  1PRB A;  3A46 A;  4AG5 A;  3NBI A;  4JN6 A;  1A5T A;  4FWD A;  4LRS A;  3M6A A;  3T38 A;  4JI2 M;  1GVN A;  3KS4 A;  1ZV1 A;  1PJJ A;  3K2L A;  3UGJ A;  3LVV A;  1YE9 A;  4MGI E;  5KPT A;  2OPF A;  3LQR A;  2Z8Y M;  3U6D A;  1XWI A;  2J7O A;  1ORY B;  1G71 A;  2DWL A;  4PCZ A;  4ITQ A;  3FUX A;  2V1U A;  3M7G A;  1NO1 A;  2WSE F;  1G8P A;  3QWL A;  3C58 A;  2ZTD A;  5LMU M;  2LH0 A;  4KHP M;  1NVM A;  2EKK A;  1UFZ A;  5FTM A;  5ITY A;  2RGO A;  4DV5 M;  2F5S A;  2XLJ A;  2DHY A;  3FTD A;  4YHH M;  3SC3 A;  3GRU A;  2EKF A;  4KLN A;  1WGL A;  2CFO A;  1VDL A;  2GQF A;  3D8L A;  4LJA A;  4JI1 M;  3RGP A;  4R3D A;  3WHK A;  2C98 A;  4PD2 A;  1GLN A;  3U61 A;  2MR9 A;  3J27 B;  3AOG A;  1I94 M;  3KVW A;  2F5P A;  1Q39 A;  4R7G A;  2HKJ A;  1SXJ E;  4D80 A;  1OJL A;  1OFH A;  4PT5 A;  5ITX A;  3B89 A;  2AHM A;  4LZJ A;  4M9Z A;  3EIE A;  1E94 E;  3GLH A;  1L2D A;  1AIP C;  4GHL A;  3BBZ A;  1I4W A;  2ZM6 M;  1Y8G A;  3LW5 F;  1L2C A;  2F5O A;  1DGB A;  2P5T A;  3FUW A;  3CF0 A;  4PDI A;  3GO8 A;  4NXM M;  4JV5 M;  2HL7 A;  2F4V M;  3KDS E;  2LHC A;  2VQE M;  1JB0 F;  1G3I A;  2J5Y A;  4MM3 B;  3U60 B;  3HX3 A;  1RU3 A;  2BJW A;  2LNH C;  4LGY A;  1NHW C;  2QZ4 A;  3ZQJ A;  2X49 A;  2XEP A;  4FCT A;  4LFC M;  4DV0 M;  1EIJ A;  3AOE C;  1DGH B;  4FWG A;  2MH8 A;  1XNR M;  5IT9 S;  3VKG A;  2FOI C;  4DR1 M;  3H4J A;  1GAB A;  1JR3 D;  2F5Q A;  2KW0 A;  1EE8 A;  4GH9 A;  1NV8 A;  5EXS A;  4B7F A;  1VEK A;  4IJF A;  1XMO M;  1DGG A;  2R65 A;  1VEG A;  2Y0T A;  1W5T A;  3F92 A;  3HU1 A;  3IG8 A;  2VII A;  4LGM A;  3MHV C;  5EXP A;  1S3S A;  1N77 A;  1NV9 A;  5FTK A;  3U6O A;  3AJI B;  3HWS A;  2KNV A;  2XZU A;  4OW0 A;  1ZMW A;  4P16 A;  4HLQ A;  3VFD A;  3B7N A;  2EJS A;  5C18 A;  2JY5 A;  4B3R M;  2WZJ A;  3SHF A;  3U6P A;  4AKI A;  1DGH A;  3GQ5 A;  1R2Z A;  3SHG B;  2VDB B;  1KSF X;  2JXN A;  4FWH A;  2L6O A;  4NOO B;  1GL6 A;  4JI0 M;  4LF8 M;  2OQ4 A;  1F4I A;  1MN3 A;  1TDH A;  1N78 A;  2KRK A;  3B7Z A;  4QHT A;  3FE3 A;  4XK8 F;  2QHO B;  3GLG B;  1DV0 A;  2JA2 A;  4IBE A;  3HJS A;  3GP1 A;  2XZF A;  2CHV A;  2KNA A;  3L25 A;  3K9O A;  3LCV B;  2KNZ A;  4AKH A;  2QBY A;  3UK6 A;  2K6B A;  1UM8 A;  2RGH A;  2XFS A;  1SXJ B;  4M0W A;  2HWJ A;  1R7R A;  1IFY A;  2L4F A;  4KO8 A;  4TUW A;  2LTU A;  2R45 A;  3I01 M;  5FTN A;  1C7Y A;  3J7A S;  2QNJ A;  1NJF A;  1XXH B;  4KT0 F;  4I81 A;  1K3W A;  5IRE B;  4QHS A;  5FTJ A;  3L28 A;  3UMM A;  3SYK A;  4LF6 M;  4NC6 A;  3M0E A;  2CRU A;  3U6M A;  2H5X A;  3HHX A;  1D0L A;  4DUZ M;  3QAU A;  4L4U A;  4CIZ A;  1J09 A;  3JR4 A;  1QQW A;  2CHG A;  3KW6 A;  3VDP A;  5EXT A;  3WHL A;  4DBG B;  4F2L A;  2ERC A;  3FUV A;  4DV2 M;  2Z4R A;  3GPU A;  2CWB A;  2E5L M;  2JNH A;  2CV2 A;  2KZU A;  2LVN C;  2FFJ A;  5EP1 A;  2CEA A;  4CHT B;  2EUC A;  4DV4 M;  4JI3 M;  1OQY A;  4NSO B;  2XGN A;  4JI7 M;  3TWK A;  1N36 M;  1XXH A;  1VDD A;  1Q02 A;  3L26 A;  3U6Q A;  1E9R A;  3J2P B;  4LJ4 A;  4YY3 M;  2UU9 M;  1NSF A;  3AL0 C;  2QEN A;  3BOS A;  4DR5 M;  5DFL A;  3UJN A;  3SMP A;  3T1Y M;  4DR3 M;  1KFV A;  3KOX E;  2YNM D;  3FRH A;  3FYC A;  2UUA M;  1TF0 B;  4B3T M;  4IBK A;  3SAR A;  2KZS A;  5ITQ A;  5KQD A;  1IBK M;  4B7G A;  2R18 A;  1SXJ D;  2JZ0 A;  2R0I A;  1YSY A;  3FUT A;  5ITT A;  2LHG A;  3AKZ A;  5ITR A;  2LWX A;  3GLG E;  2Y21 A;  2CV0 A;  4DR7 M;  1QUS A;  2ZAO A;  3SAS A;  1LV7 A;  3GLI A;  2L4E A;  4KOD A;  4L15 A;  3QYE A;  2B3T A;  2KHH A;  2Z4S A;  4F1I A;  4GC9 A;  1D2N A;  2D7E A;  4R71 A;  4M0D A;  4ANR A;  4L8R C;  2R6F A;  4NSR A;  4MGZ E;  1G41 A;  2QSF X;  3IG5 A;  2YR0 A;  4L6V 6;  3A98 B;  1IXR C;  5E6J A;  3Q8X A;  1HR0 M;  3FTE A;  1X37 A;  5ITX E;  1HT1 E;  3MK6 A;  2C9O A;  2R46 A;  2V1C A;  4GKK M;  3I04 M;  3SYL A;  4MH0 E;  2FNA A;  3W68 A;  3W67 A;  2UXC M;  5EP3 A;  4II7 A;  4BLC A;  2HCB A;  4LJ8 A;  3GLI E;  2D7G A;  3AFH A;  3GRV A;  3U60 A;  2CV1 A;  3GLF A;  4CIS A;  3HHW A;  3TPZ A;  1L1T A;  3GPP A;  3KOZ E;  3GPX A;  2BJV A;  2RKO A;  4WW0 A;  4I5S A;  1HT2 E;  2W82 A;  1HQC A;  2VQF M;  3GLH B;  3J7B A;  3FTF A;  1G4A E;  1QYR A;  3HKP A;  2JY6 B;  4GKJ M;  2JWS A;  1OAO C;  3KFU G;  3GLI B;  2EA0 A;  3C3D A;  1HNX M;  2QPA A;  4BBA A;  4GMQ A;  1IXS B;  2JP7 A;  1XXH E;  4X65 M;  5H37 D;  2Z3X A;  4OVZ B;  2K47 A;  1T3T A;  4AW4 A;  2KA6 B;  2DVW B;  2XSZ A;  2A5Y B;  2DAE A;  4LRT A;  2DHR A;  4FD2 A;  3T15 A;  3VLF B;  4LFB M;  2DWZ B;  3T1H M;  1PJI A;  3ZC7 B;  1Q3B A;  4I4L A;  3HU2 A;  2DXI A;  4HL4 A;  1HNW M;  2JY8 A;  2VF7 A;  2R44 A;  5KQ8 A;  1QAM A;  4LG2 A;  2DAI A;  2DAK A;  1IN6 A;  2ZBK B;  3TE6 A;  3BXW A;  4LFA M;  1QZE A;  4GIT A;  4NL4 H;  4DR4 M;  1JR3 A;  4L78 A;  2ZAN A;  4JI6 M;  1FJG M;  1L8Q A;  3K9P A;  2LXE A;  3L27 A;  2DWM A;  2FS1 A;  2H1R A;  4IJE A;  3CF2 A;  3HGI A;  1YUB A;  5JI2 E;  1D0K A;  3U61 B;  3U5Z A;  3KSJ A;  1IBL M;  1WJ7 A;  3DZD A;  4D82 A;  5EP4 A;  2QP9 X;  3GRY A;  1NJG A;  2EO2 A;  3PNY A;  4CJ6 A;  2G8L A;  3FKE A;  3U5Z B;  3PFI A;  1TTE A;  2BWB A;  1PJQ A;  2JUJ A;  3B74 A;  5EP2 A;  4AG6 A;  5LMN M;  5F3W A;  2DAM A;  4M9X A;  3E9S A;  4EIW A;  2GNO A;  1HQY E;  2UXD M;  4DV3 M;  3DFZ A;  4S12 A;  1JQJ C;  5EXX A;  3HHZ A;  2OOB A;  3E21 A;  3H4M A;  2DWN A;  3TWL A;  1ZMU A;  3SBJ A;  2CUZ A;  1R2Y A;  2D7H A;  1N34 M;  3HJ8 A;  1SG9 A;  2G5G X;  4JI4 M;  1OTR A;  2XSZ D;  2M5Z A;  2OOA A;  1IXZ A;  3KXE C;  4RKU F;  2DI0 A;  3ZCB B;  3FTC A;  5L8R F;  2MJ5 B;  1VQ1 A;  1NNU C;  1V33 A;  1J7K A;  2VF8 A;  2ZAM A;  3HZJ A;  4IBF A;  4DV6 M;  3SAW A;  2BNK A;  2C96 A;  3E4R A;  2Q2E B;  3HY5 A;  1XMQ M;  1PJT A;  3GQ3 A;  1QAQ A;  3VDU A;  1V92 A;  1MJG M;  2O01 F;  3MMP A;  4B7H A;  2F5N A;  3U6L A;  3GQ4 A;  2I7P A;  5IWA M;  2R62 A;  1QAN A;  1OKS A;  1WGN A;  2XH9 A;  2Y0Q A;  4I8O A;  1IQP A;  4NRW A;  1N75 A;  3TL4 X;  3KSX A;  2M60 A;  2G3Q A;  2UXB M;  1OFI A;  2KXE A;  2XFT A;  4CGY B;  4LF5 M;  4P17 A;  4MGK E;  3MJ5 A;  5DYG A;  5C1B A;  5FSW A;  2CE7 A;  1QVR A;  1IN7 A;  3KOW E;  4B3M M;  1E9S A;  1TR8 A;  5KO3 A;  3L2A A;  5ITU A;  4MGY E;  1AUA A;  7CAT A;  3L29 A;  4IBJ A;  3PNV A;  3W0L B;  2WSF F;  1Z59 A;  3KP0 E;  3VK8 A;  1GO5 A;  4GC5 A;  3DA1 A;  3SFZ A;  1IY0 A;  1SXJ A;  1G59 A;  3K8Z A;  4LJ5 A;  1MU5 A;  4LF7 M;  3I51 A;  1PJS A;  4JYA M;  2R4E A;  4OX9 M;  3J81 S;  1TH2 A;  2O5R A;  3JAM S;  3I4V A;  3HJQ A;  3FRI A;  5FLX S;  2KDL A;  1N32 M;  1HJP A;  3DOA A;  1C1K A;  4L16 A;  3I4Y A;  2DZL A;  2RRU A;  3PVS A;  4RNA A;  1SXJ C;  4HEO A;  3U6E A;  2DEN A;  2L7I A;  3AV0 A;  3CTW B;  1TH4 A;  3C3E A;  1K82 A;  3NBX X;  1IN5 A;  1KYI A;  2YFQ A;  4X62 M;  2CP8 A;  2DKL A;  2L2D A;  1OIZ A;  4AQY M;  4WP2 A;  2R4J A;  4DV7 M;  4IBG A;  3RE8 A;  5A2Q S;  2LVA A;  3OTO M;  3Q8G A;  4IBI A;  4LF9 M;  1PM5 A;  8CAT A;  1VEJ A;  5E26 A;  3J80 S;  3VKH A;  3LQQ A;  1D0M A;  2LVO C;  3E46 A;  1R6B X;  4M9S A;  1K3X A;  2DZN B;  2HAK A;  1VG5 A;  2LVQ D;  2ZTC A;  1LTM A;  3A42 A;  1V34 A;  4DV1 M;  1N33 M;  2FH0 A;  3KOY E;  4LJ7 A;  2NQ8 C;  3ILK A;  4FCW A;  1YLA A;  4QNR A;  1MX0 A;  4Z6Y A;  2UUB M;  4GHA A;  4Q7J A;  4LCB A;  1TH3 A;  1Q3C A;  1DGF A;  1NY6 A;  4IIW A;  4QOS A;  1XB2 B;  5DNY A;  2FE8 A;  3GRR A;  2X8A A;  4K0K M;  1QZM A;  2APL A;  3HHY A;  5GKN A;  1HNZ M;  3U6S A;  1XC8 A;  1NY5 A;  4RF1 A;  5BPV A;  1XNQ M;  1GJS A;  1ZMV A;  3NWL A;  3SMS A;  3K92 A;  4X66 M;  4FW9 A;  4LZZ A;  3R9X B;  1QDR A;  1Z5A A;  4G3O A;  4NXN M;  4NRV A;  2LBC A;  1Z5B A;  4ZPX A;  2I7N A;  2WSC F;  2L09 A;  3LMM A;  3QYB A;  4G4N A;  1IN4 A;  3RFW A;  1GL7 A;  4BB9 A;  3D8B A;  1NHG C;  3JR5 A;  4JI8 M;  1QDT A;  1PGY A;  4LJ6 A;  1BVS A;  1IM2 A;  5BR8 M;  1IY1 A;  3GLF E;  3GLG A;  4G4Q A;  2KRU A;  3EIH A;  2OO9 A;  3IEC A;  4QNM A;  4QOZ C;  3FD9 A;  4LF4 M;  4REZ A;  1L2B A;  3GPY A;  4X64 M;  4G6Z A;  3SAV A;  2Y20 A;  3RGS A;  1L1Z A;  5EJC A;  4W5W A;  4OU7 A;  1DO2 A;  2MRO B;  5KPR A;  3TQS A;  3W0F A;  2C9C A;  2BWE A;  4AI6 A;  1R4G A;  3LCU A;  3THG A;  2N35 A;  4G4O A;  4XGI A;  3GLH E;  2C99 A;  3C9P A;  1TDZ A;  5EQT A;  1IY2 A;  4PDG A;  2YQZ A;  1WIV A;  3AOE A;  2HHH M;  3LVW A;  4UN2 B;  4DUY M;  2V6Z M;  4OVZ A;  1EFU B;  1T6O A;  4IBD A;  4B3S M;  4A3V B; 
#chains in the Genus database with same CATH homology
 5JI3 E;  3FUU A;  3KP1 E;  4FCV A;  1DO0 A;  4JXJ A;  1E32 A;  5IZ7 D;  1IN8 A;  3VK7 A;  4XBO A;  2DZO B;  3HU3 A;  4AZF A;  3SAT A;  3R8F A;  3B9P A;  3FYD A;  3KS8 A;  1Z6T A;  2QCU A;  3A45 A;  1TGU A;  4MGH A;  3ZH9 B;  3GLF B;  4AKG A;  3K1J A;  2Z7J A;  2UUC M;  4Z8X A;  1GKI A;  4B08 A;  4DR2 M;  4GRI A;  4LY6 A;  4DR6 M;  4JI5 M;  1H6U A;  3UZU A;  2X4A A;  4GIP A;  1IBM M;  1ZQ9 A;  5DYI A;  1Z5C A;  5FTL A;  4RF0 A;  2XF3 A;  2CHQ A;  1ZAE A;  4FVM A;  4LJ9 A;  1NNJ A;  4WUR A;  4D81 A;  1W5S A;  4MB7 A;  1WXQ A;  1QAO A;  3SAU A;  5KPZ A;  3CF6 E;  1XHB A;  3PXG A;  4G4R A;  1J5E M;  2KEB A;  2L7H A;  1FNN A;  4IBB A;  2C5R A;  2J7N A;  4IBC A;  3U6C A;  2QBY B;  3TWM A;  3A46 A;  4AG5 A;  3NBI A;  4JN6 A;  4FWD A;  4LRS A;  3M6A A;  3T38 A;  4JI2 M;  1GVN A;  3KS4 A;  1PJJ A;  3K2L A;  3UGJ A;  3LVV A;  1YE9 A;  4MGI E;  5KPT A;  2OPF A;  3LQR A;  3U6D A;  1XWI A;  2J7O A;  1ORY B;  2DWL A;  4PCZ A;  4ITQ A;  3FUX A;  2V1U A;  3M7G A;  3QWL A;  1G8P A;  3C58 A;  5LMU M;  2LH0 A;  4KHP M;  1NVM A;  5FTM A;  4DV5 M;  5ITY A;  2RGO A;  2F5S A;  2XLJ A;  3FTD A;  4YHH M;  3SC3 A;  3GRU A;  4KLN A;  4JI1 M;  2CFO A;  4LJA A;  3D8L A;  3RGP A;  4R3D A;  3WHK A;  2C98 A;  4PD2 A;  1GLN A;  3U61 A;  3J27 B;  3AOG A;  1I94 M;  3KVW A;  2F5P A;  1Q39 A;  4R7G A;  2HKJ A;  1SXJ E;  4D80 A;  1OJL A;  1OFH A;  4PT5 A;  5ITX A;  2AHM A;  4LZJ A;  4M9Z A;  3EIE A;  1E94 E;  3GLH A;  1L2D A;  4GHL A;  2ZM6 M;  1I4W A;  1L2C A;  2F5O A;  1DGB A;  2P5T A;  3FUW A;  3CF0 A;  4PDI A;  3GO8 A;  4NXM M;  4JV5 M;  2HL7 A;  2F4V M;  3KDS E;  2VQE M;  1G3I A;  4MM3 B;  3U60 B;  2LNH C;  2BJW A;  4LGY A;  1NHW C;  2QZ4 A;  2X49 A;  2XEP A;  4FCT A;  4LFC M;  4DV0 M;  3AOE C;  1DGH B;  4FWG A;  1XNR M;  5IT9 S;  3VKG A;  2FOI C;  4DR1 M;  1JR3 D;  2F5Q A;  2KW0 A;  1EE8 A;  4GH9 A;  5EXS A;  4B7F A;  4IJF A;  1XMO M;  1DGG A;  2R65 A;  3IG8 A;  2Y0T A;  1W5T A;  3HU1 A;  2VII A;  4LGM A;  3MHV C;  5EXP A;  1S3S A;  1N77 A;  5FTK A;  3U6O A;  3AJI B;  3HWS A;  2XZU A;  4OW0 A;  4P16 A;  4HLQ A;  3VFD A;  4B3R M;  5C18 A;  3SHF A;  3U6P A;  4AKI A;  1DGH A;  3GQ5 A;  1R2Z A;  3SHG B;  1KSF X;  4LF8 M;  4FWH A;  2L6O A;  4NOO B;  1GL6 A;  4JI0 M;  2OQ4 A;  1TDH A;  1N78 A;  2KRK A;  4QHT A;  3GLG B;  2JA2 A;  4IBE A;  3HJS A;  3GP1 A;  2XZF A;  2CHV A;  3L25 A;  4AKH A;  2QBY A;  3UK6 A;  1UM8 A;  2RGH A;  2XFS A;  1SXJ B;  4M0W A;  1R7R A;  4KO8 A;  4TUW A;  2R45 A;  5FTN A;  3J7A S;  1NJF A;  1XXH B;  4I81 A;  1K3W A;  5IRE B;  4QHS A;  5FTJ A;  3L28 A;  3UMM A;  3SYK A;  4LF6 M;  3M0E A;  3U6M A;  3HHX A;  4DUZ M;  3QAU A;  4L4U A;  1J09 A;  3JR4 A;  1QQW A;  2CHG A;  3KW6 A;  3VDP A;  5EXT A;  3WHL A;  2ERC A;  3FUV A;  4DV2 M;  2Z4R A;  3GPU A;  2E5L M;  2CV2 A;  2KZU A;  5EP1 A;  2FFJ A;  2CEA A;  4CHT B;  2EUC A;  4DV4 M;  4JI3 M;  4NSO B;  2XGN A;  4JI7 M;  3TWK A;  1N36 M;  1XXH A;  1VDD A;  3L26 A;  3U6Q A;  1E9R A;  3J2P B;  4LJ4 A;  4YY3 M;  2UU9 M;  1NSF A;  3AL0 C;  2QEN A;  3BOS A;  4DR5 M;  3UJN A;  3SMP A;  3T1Y M;  4DR3 M;  1KFV A;  3KOX E;  2YNM D;  3FYC A;  2UUA M;  4B3T M;  4IBK A;  3SAR A;  2KZS A;  5ITQ A;  5KQD A;  1IBK M;  4B7G A;  1SXJ D;  2R18 A;  1YSY A;  3FUT A;  5ITT A;  3AKZ A;  5ITR A;  2LWX A;  2Y21 A;  2CV0 A;  4DR7 M;  2ZAO A;  3SAS A;  1LV7 A;  3GLI A;  4KOD A;  4L15 A;  2Z4S A;  4GC9 A;  1D2N A;  2D7E A;  4L8R C;  4M0D A;  4NSR A;  4MGZ E;  1G41 A;  3IG5 A;  2YR0 A;  3A98 B;  1IXR C;  5E6J A;  3Q8X A;  1HR0 M;  3FTE A;  1X37 A;  5ITX E;  1HT1 E;  3MK6 A;  2C9O A;  2R46 A;  2V1C A;  4GKK M;  3SYL A;  4MH0 E;  2FNA A;  2UXC M;  5EP3 A;  4II7 A;  4BLC A;  2HCB A;  4LJ8 A;  2D7G A;  3AFH A;  3GRV A;  3U60 A;  2CV1 A;  3GLF A;  4CIS A;  3HHW A;  3TPZ A;  1L1T A;  3GPP A;  3KOZ E;  3GPX A;  2BJV A;  2RKO A;  4WW0 A;  4I5S A;  1HT2 E;  2W82 A;  1HQC A;  2VQF M;  3GLH B;  3J7B A;  3FTF A;  1G4A E;  1QYR A;  3HKP A;  4GKJ M;  3KFU G;  3GLI B;  2EA0 A;  1HNX M;  2QPA A;  4BBA A;  4GMQ A;  1IXS B;  4X65 M;  5H37 D;  2Z3X A;  4OVZ B;  2K47 A;  1T3T A;  4AW4 A;  2KA6 B;  2DVW B;  2XSZ A;  2A5Y B;  4LRT A;  3T15 A;  2DHR A;  4FD2 A;  3VLF B;  4LFB M;  2DWZ B;  3T1H M;  1PJI A;  3ZC7 B;  1Q3B A;  4I4L A;  3HU2 A;  2DXI A;  4HL4 A;  1HNW M;  5KQ8 A;  1QAM A;  4LG2 A;  1IN6 A;  2ZBK B;  3TE6 A;  4LFA M;  4GIT A;  4NL4 H;  4DR4 M;  1JR3 A;  4L78 A;  2ZAN A;  4JI6 M;  1FJG M;  1L8Q A;  2LXE A;  3L27 A;  2DWM A;  2H1R A;  4IJE A;  3CF2 A;  3HGI A;  1YUB A;  5JI2 E;  3U61 B;  3U5Z A;  3KSJ A;  1IBL M;  3DZD A;  4D82 A;  5EP4 A;  2QP9 X;  3GRY A;  1NJG A;  2EO2 A;  3PNY A;  3U5Z B;  2G8L A;  3FKE A;  3PFI A;  5EP2 A;  4AG6 A;  5LMN M;  5F3W A;  4M9X A;  3E9S A;  4EIW A;  1HQY E;  2UXD M;  4DV3 M;  3DFZ A;  4S12 A;  1JQJ C;  5EXX A;  3HHZ A;  3H4M A;  2DWN A;  3TWL A;  3SBJ A;  1R2Y A;  2CUZ A;  1N34 M;  2D7H A;  3HJ8 A;  2G5G X;  4JI4 M;  2XSZ D;  2M5Z A;  1IXZ A;  3KXE C;  3ZCB B;  3JR5 A;  3FTC A;  2ZAM A;  1NNU C;  1J7K A;  4DV6 M;  4IBF A;  3SAW A;  2BNK A;  2C96 A;  3E4R A;  2Q2E B;  1XMQ M;  3GQ3 A;  1QAQ A;  3VDU A;  2F5N A;  4B7H A;  3U6L A;  3GQ4 A;  2I7P A;  5IWA M;  2R62 A;  1QAN A;  2XH9 A;  4I8O A;  2Y0Q A;  1IQP A;  4NRW A;  1N75 A;  3TL4 X;  3KSX A;  2M60 A;  2UXB M;  1OFI A;  2KXE A;  2XFT A;  4CGY B;  4LF5 M;  4MGK E;  3MJ5 A;  5DYG A;  5C1B A;  5FSW A;  2CE7 A;  1QVR A;  1IN7 A;  3KOW E;  4B3M M;  1E9S A;  5KO3 A;  4LF4 M;  3L2A A;  5ITU A;  4MGY E;  7CAT A;  3L29 A;  4IBJ A;  3PNV A;  3W0L B;  1Z59 A;  3KP0 E;  3VK8 A;  4GC5 A;  3DA1 A;  3SFZ A;  1IY0 A;  1SXJ A;  1G59 A;  3K8Z A;  4LJ5 A;  1MU5 A;  4LF7 M;  3I51 A;  4JYA M;  2R4E A;  4OX9 M;  3J81 S;  1TH2 A;  2O5R A;  3JAM S;  3I4V A;  3HJQ A;  5FLX S;  1N32 M;  3DOA A;  1C1K A;  4L16 A;  3I4Y A;  3PVS A;  4RNA A;  1SXJ C;  3U6E A;  2L7I A;  3AV0 A;  3CTW B;  1TH4 A;  1K82 A;  1IN5 A;  1KYI A;  2YFQ A;  4X62 M;  4AQY M;  2R4J A;  4DV7 M;  4IBG A;  3RE8 A;  5A2Q S;  3OTO M;  4IBI A;  4LF9 M;  1PM5 A;  8CAT A;  5E26 A;  3J80 S;  3VKH A;  3LQQ A;  1K3X A;  1R6B X;  4M9S A;  2DZN B;  3A42 A;  1N33 M;  4DV1 M;  3KOY E;  4LJ7 A;  2NQ8 C;  3ILK A;  4FCW A;  4QNR A;  1MX0 A;  4Z6Y A;  2UUB M;  4GHA A;  4LCB A;  1TH3 A;  1Q3C A;  1DGF A;  1NY6 A;  4IIW A;  4QOS A;  5DNY A;  2FE8 A;  3GRR A;  2X8A A;  4K0K M;  1QZM A;  3HHY A;  5GKN A;  1HNZ M;  3U6S A;  1XC8 A;  1NY5 A;  4RF1 A;  5BPV A;  1XNQ M;  3NWL A;  3SMS A;  3K92 A;  4X66 M;  4FW9 A;  4LZZ A;  3R9X B;  1Z5A A;  4NXN M;  4NRV A;  1Z5B A;  4ZPX A;  2I7N A;  2L09 A;  3LMM A;  4G4N A;  1IN4 A;  3RFW A;  1GL7 A;  4BB9 A;  3D8B A;  1NHG C;  4JI8 M;  4LJ6 A;  1IM2 A;  5BR8 M;  1IY1 A;  3GLG A;  4G4Q A;  2KRU A;  3EIH A;  4QNM A;  4QOZ C;  3FD9 A;  4REZ A;  1L2B A;  3GPY A;  4X64 M;  4G6Z A;  3SAV A;  2Y20 A;  3RGS A;  1L1Z A;  5EJC A;  4W5W A;  4OU7 A;  1DO2 A;  5KPR A;  3TQS A;  3W0F A;  2C9C A;  4AI6 A;  3THG A;  4G4O A;  4XGI A;  2C99 A;  1TDZ A;  5EQT A;  1IY2 A;  4PDG A;  2YQZ A;  2HHH M;  3AOE A;  3LVW A;  4DUY M;  2V6Z M;  4OVZ A;  4IBD A;  4B3S M;  4A3V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...