4OX9M

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ox9M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ox9M02
1I94M 3A42A 3U6DA 2Q2EB 1XMOM 2UUCM 2XZUA 1Q3CA 3W0FA 2HHHM 1Q3BA 1XMQM 1N32M 4GKKM 4X65M 4AQYM 1N34M 3U6SA 4CISA 4JI0M 4JI2M 1IBKM 3A46A 4LFCM 4NRWA 2UXCM 4OX9M 2E5LM 3JR4A 2ZM6M 1N36M 4G4NA 4PCZA 4X62M 1XC8A 4LF6M 1PM5A 1EE8A 4YY3M 4G4QA 3SAWA 1HNZM 3J7AS 3JAMS 1TDHA 3GQ3A 1MU5A 3SAUA 2F5NA 3GPPA 4LF7M 3TWLA 1NNJA 4DUZM 2HKJA 1PJJA 1FJGM 1L1ZA 3SAVA 1K82A 4NXMM 4LFBM 3J80S 3DOAA 3SATA 4DR1M 3VK7A 4DR4M 4DV7M 4DR3M 1K3XA 4DV5M 3TWKA 1HR0M 2UU9M 3C58A 1Z5BA 4LFAM 4DV2M 2F4VM 4PD2A 4DV4M 4JI5M 3SBJA 1TDZA 3GQ5A 1L2CA 4JI4M 5ITUA 4JI8M 5ITXE 3U6EA 1R2ZA 1N33M 4K0KM 4JI3M 3U6PA 4DV0M 5IWAM 2F5SA 3U6LA 5ITRA 3GP1A 1IBMM 3GO8A 3U6CA 4DV3M 4DR5M 3JR5A 5IT9S 4LF9M 3T1HM 4NXNM 3GQ4A 2UXBM 5A2QS 5LMNM 3GPYA 1Q39A 1L2BA 4ITQA 4JI1M 4LF8M 4JYAM 1XNQM 3SASA 4G4OA 2VQEM 4LF4M 1XNRM 2OPFA 5ITYA 4PDGA 4GKJM 4JI6M 3OTOM 1Z5CA 4B3SM 2UXDM 1J5EM 1Z5AA 2UUAM 4JI7M 4X64M 3T1YM 1L1TA 4G4RA 4DR2M 1PJIA 5ITXA 4YHHM 3GPXA 2EA0A 4DR7M 4DUYM 1HNWM 4X66M 5BR8M 1L2DA 4KHPM 2OQ4A 2F5QA 3U6MA 3VK8A 2XZFA 5FLXS 5ITTA 1HNXM 5LMUM 4B3TM 4B3RM 4JV5M 2VQFM 3GPUA 4NRVA 3U6OA 3A45A 1IBLM 2F5PA 2UUBM 3J81S 2ZBKB 2F5OA 1K3WA 1Z59A 1R2YA 4LF5M 4PDIA 4MB7A 4DV1M 3U6QA 4B3MM 5ITQA 1MX0A 4DV6M 4DR6M 3TWMA 3SARA 1KFVA
chains in the Genus database with same CATH superfamily
3HU2A 1D0KA 1OIPA 1NY5A 1YLAA 2CV2A 3DA1A 3FRHA 1DO0A 3KOWE 1Q3CA 2KEBA 3W0FA 1Q3BA 4CJ6A 1IXRC 1NHWC 2JY6B 4X65M 4L8RC 1OQYA 2FH0A 2DZLA 3T6PA 3A46A 3KP1E 1OJLA 1PRBA 4DBGB 1MJGM 4MGYE 1A5TA 5KQDA 2HL7A 2OOAA 4QOZC 3AOGA 2MR9A 3T38A 2FNAA 4LJ4A 1QZEA 2DAGA 2KZSA 2DZNB 4B7FA 1YUBA 4YY3M 2RGHA 4G4QA 4XBOA 3SAWA 1C7YA 2QP9X 2K0BX 2L7HA 1TDHA 3L27A 1MU5A 2LVPC 3CF2A 2Y0TA 2DWZB 1Q02A 4R3DA 1NNJA 1IN7A 2EUCA 2QHOB 3K8ZA 4LZZA 1PJJA 3J27B 2K9DA 3C3DA 1L1ZA 5FTMA 2DWNA 1K82A 1QDTA 3KFUG 4LFBM 3FTFA 4A3VB 4F2LA 4ANRA 1WIVA 4DR1M 3SC3A 3M7GA 4OW0A 2LHGA 3A98B 3TWKA 3QYBA 3C58A 3AOEA 3K2LA 4Z6YA 3GLIE 3UMMA 5EQTA 2JA2A 1OTRA 3AKZA 4JI5M 3KS8A 3MK6A 3SBJA 4WURA 1HQYE 4NSOB 4JI4M 5ITUA 3K1JA 4FCWA 5ITXE 1R2ZA 1N33M 2L4EA 1V92A 2VF7A 1QAOA 3HHWA 1SXJC 1IBMM 2KDLA 1J7KA 3PVSA 3K9OA 4DV3M 2HWJA 4DR5M 3Q8GA 3KDSE 1H6UA 4LG2A 2LH0A 1VDLA 2ZTCA 3LCUA 1R4GA 3FUUA 3IECA 5A2QS 3GPYA 1L2BA 4LCBA 4GC5A 4GHLA 1BVSA 3DZDA 2ZANA 4GH9A 2QZ4A 3QYEA 4IJEA 1WR1B 1ZQ9A 2J7NA 2JZ1A 3HJQA 3W67A 1NJFA 4F1IA 4JI7M 1NVMA 5C18A 4X64M 3W68A 2XEPA 1SXJE 4D80A 1VEGA 4B7HA 1VEKA 1ZMUA 3J2PB 1IM2A 1HNWM 2O01F 2LTUA 1L8QA 1TR8A 3W0LB 4FCTA 1G59A 2Z7JA 1E9RA 2RKOA 3TE6A 2XSZD 1FNNA 3PNYA 4B7GA 3U61B 1L2DA 2F5QA 3U6MA 2H5XA 3L25A 3FUXA 3SHFA 1HNXM 3J7BA 4TUWA 3VKHA 5ITQA 4JV5M 4HLQA 2DENA 3THGA 5FTLA 1IN4A 1IN5A 3A45A 3H4MA 1IXZA 3KS4A 3E21A 2ZBKB 1EFUB 1JB0F 1R2YA 3U61A 1IXSA 1G71A 3KOYE 3E46A 2W82A 3TL4X 4EIWA 3SMPA 5BPVA 4DV1M 4B3MM 2C96A 4DV6M 2YR0A 4IJFA 3TWMA 2B3TA 3RGPA 3SMSA 1KFVA 1TTEA 1I94M 2KZUA 2Q2EB 2V1UA 1T43A 4LJ7A 4G3OA 3VDUA 1AUAA 3GRYA 2XZUA 2HHHM 2R62A 4GKKM 4AQYM 4L6V6 3U6SA 5JI2E 3V76A 2MGWA 4JI0M 1C1KA 2XF3A 4NRWA 4L16A 2QBYB 2UXCM 4AKGA 1W5TA 4OX9M 3JR4A 1T3TA 4IBFA 4RF0A 1F4IA 3QWLA 4G4NA 3FTEA 1JR3E 4QOSA 3PXGA 4PCZA 4X62M 2L09A 3HX3A 1IY2A 2YQZA 1PM5A 2N35A 2DKLA 1IN8A 3LMMA 3J7AS 3CGWA 1IY1A 2H1RA 2MH8A 3KW6A 1WGNA 2F5NA 4LF7M 1OFIA 2C9CA 2QBYA 5FTJA 4DUZM 2HKJA 4LJ9A 4Z8XA 2JXNA 2L2DA 4CGYB 3L26A 1NHGC 2J5YA 4JN6A 4I4LA 2FFJA 1AIPC 3L28A 3GLGE 3KVWA 3ZC7B 1D0LA 1PJTA 1Y8GA 2K47A 1K3XA 4RKUF 4XK8F 5EXPA 4QNMA 1GVNA 2LVAA 4ZPXA 2DXIA 1OFHA 3BXWA 3E9SA 3B7ZA 2X8AA 4LJ5A 2QQ8A 2D7HA 3I51A 1L2CA 4HEOA 4JI8M 2KRUA 3E4RA 4JXJA 2DWMA 1DGHB 4DV0M 2LXEA 4L15A 5ITRA 3GLIB 4IBEA 2DNAA 4MGIE 3U6CA 1NV9A 5DFLA 1WXQA 3JR5A 2JP7A 2R46A 1OAOC 4GEWA 3LVWA 4QHTA 5IT9S 4D82A 1TH4A 4IBKA 5C1BA 4ITQA 4JYAM 2R18A 4JI1M 2R45A 1KSFX 2Y20A 1DGGA 3SYLA 3GRUA 3SFZA 4G4OA 1YSYA 5ITYA 4PDGA 1DGHA 4JI6M 1ZMVA 2M60A 1OKSA 2Y21A 3OTOM 3GLIA 4B3SM 2UXDM 4I5SA 3AOEC 1N78A 1YE9A 2O5RA 4I81A 1UM8A 1RU3A 1N75A 2R44A 1GABA 5JI3E 4DR2M 2JUJA 3LQQA 5ITXA 4YHHM 3FD9A 2DVWB 3KSJA 4R7GA 8CATA 5BR8M 4S12A 4QHSA 3K92A 2QENA 3I4YA 1X37A 5FLXS 2DAKA 4D81A 1GLNA 3HY5A 2ZAOA 3GRRA 5DYGA 4IBBA 4NRVA 2C5RA 2FOIC 1QUTA 3VLFB 2JWSA 2CE7A 1IY0A 3J81S 1IN6A 2DHRA 3PFIA 4FVMA 3B89A 1V33A 1QANA 1J09A 2LVQD 2EO2A 2DHYA 1V34A 2EKKA 2KNAA 2R6FA 3B7NA 4GIPA 1HT2E 2FS1A 3SARA 2OO9A 1QVRA 4IBCA 4IBIA 2D7GA 1GJTA 1OIZA 1LTMA 2VIIA 4AG6A 1XMOM 2G8LA 3ILKA 1IXSB 2L7IA 1XMQM 2VDBB 1N34M 4AG5A 1XXHB 4JI2M 1IBKM 2RGOA 3HZJA 3LQRA 2BWBA 2KXEA 5H37D 1TH2A 3BBZA 4PT5A 4G6ZA 1DV0A 3BOSA 2DZOB 3GLFE 1N36M 3VFDA 2CV0A 1XC8A 3CF0A 4LJAA 2P5TA 1EE8A 1JQJC 2WSCF 2KRKA 2LVOC 1PJSA 2OOBA 4KODA 7CATA 1HNZM 3C9PA 3JAMS 4LGMA 4UN2B 1E32A 1XXHA 3GPPA 1QAQA 3KXEC 2JY5A 4MGZE 2LVNC 4FWGA 3LVVA 2CFOA 3NBXX 3SHGB 3UK6A 2Y0QA 4NXMM 1P3QQ 3DOAA 2DAMA 2CP8A 4DR4M 3TQSA 5EP2A 2QCUA 3B7QA 4M9SA 3HJSA 4BLCA 4DR3M 3AJIB 3T15A 2Z8YM 1HR0M 2CHGA 3B9PA 2CRUA 1WGLA 2UU9M 2Z4RA 1Z5BA 2F4VM 1JR3A 4DV4M 2JZ0A 3GLGB 2R0IA 3HWSA 4LRSA 3GQ5A 4NC6A 2XFSA 4LY6A 5KPZA 2M5ZA 3FUWA 4I8OA 2JY7A 5L8RF 2R4EA 3AL0C 4K0KM 2F5SA 2CEAA 3IG8A 2ZAMA 3R8FA 1TF0B 3GP1A 1HT1E 3AFHA 3GO8A 2QSFX 2CHQA 1D0MA 3FYDA 1S3SA 3F92A 3R9XB 1Z6TA 3UJNA 4GHAA 3KSXA 3T1HM 3NWLA 5FTKA 4NXNM 3GQ4A 2G3QA 2R65A 2RRUA 2V6ZM 3GLHE 3GLGA 1T6OA 1QZMA 4NSRA 3U6LA 4LF8M 1GL7A 4RNAA 3SASA 4IBDA 4LJ6A 5EXTA 1XNRM 4KO8A 3B74A 1GO5A 3FKEA 3UZUA 4GKJM 1Z5CA 2XH9A 1J5EM 2UUAM 1OAIA 2X4AA 3I04M 2C99A 5GKNA 2CUZA 3LW5F 4FWHA 5KO3A 4Q7JA 1TGUA 1VDDA 3GPXA 5EP4A 2A5YB 3HKPA 3Q8XA 3U5ZB 1D2NA 1UFZA 1XWIA 2K6BA 2BNKA 1LV7A 5E6JA 1QUSA 2VF8A 5EXSA 2OQ4A 4FWDA 4BB9A 1NNUC 3MMPA 1R5LA 2FE8A 2XZFA 1SXJD 4LRTA 5ITTA 5LMUM 4MH0E 3FYCA 3PNVA 4KLNA 3KOZE 1NO1A 1MN3A 2QPAA 2VQFM 3GPUA 3FUVA 3U6OA 4AKIA 2F5PA 2J7OA 3U5ZA 4P16A 2F5OA 2HCBA 1Z59A 1XB2B 3NBIA 4LF5M 2C9OA 1VEJA 2I7NA 4BBAA 4CIZA 1R6BX 4MGHA 2KW0A 1SG9A 2HAKA 2LNHC 1G41A 3A42A 3U6DA 2UUCM 1QQWA 2LWXA 2C98A 2L4FA 4L4UA 3MHVC 5KPTA 1N32M 1IQPA 3FE3A 2WSFF 1G8PA 4R71A 4CISA 1SXJB 3CF6E 3IG5A 3KP0E 4LFCM 1KYIA 4GRIA 4KT0F 2E5LM 2ZM6M 4W5WA 3ZH9B 2L6OA 1I4WA 2AHMA 2JY8A 4M9ZA 4HL4A 3RGSA 5DYIA 4LGYA 4LF6M 2APLA 2ZTDA 2D7EA 2YFQA 5KQ8A 3CTWB 2R4JA 2WSEF 2XFTA 2EKFA 2XGNA 3GQ3A 3SAUA 3FRIA 1ORYB 4REZA 1SXJA 3HU1A 4M9XA 3GLFB 3TWLA 3GRVA 4GMQA 3KOXE 1JR3D 2V1CA 4GITA 1GJSA 2CHVA 4RF1A 4B08A 1FJGM 1DO2A 3SAVA 3J80S 4MGKE 5IREB 3C3EA 3HHXA 1NY6A 3SATA 3VK7A 1G3IA 1WHCA 4DV7M 2MJ5B 2G5GX 2XLJA 4L78A 1R7RA 4DV5M 3D8LA 5EJCA 3FUTA 1N77A 1E9SA 2I7PA 4M0DA 3GLFA 1DGFA 4LFAM 4II7A 3I01M 4PD2A 4DV2M 1EIJA 2Z3XA 2DAEA 2EJSA 4LJ8A 2WZJA 1TDZA 1W5SA 5FTNA 3M0EA 2BWEA 3MJ5A 3M6AA 3U6EA 2ERCA 4NL4H 4WW0A 4JI3M 5IWAM 5E26A 3U6PA 1NV8A 3HGIA 1E94E 1CUKA 1TH3A 4IBGA 4MM3B 3HHYA 3VDPA 3ZQJA 1VG5A 3HHZA 1GKIA 4OU7A 1DGBA 2GQFA 1WJ7A 2LHCA 4GC9A 3RFWA 3AV0A 2CV1A 3ZCBB 3I4VA 2KA6B 3EIEA 4LF9M 1NSFA 4FW9A 5DNYA 1GL6A 4AKHA 3VKGA 3RE8A 2UXBM 5LMNM 1Q39A 2LBCA 2NQ8C 2QNJA 3QAUA 1XNQM 2KNVA 2VQEM 4LF4M 4IIWA 1ZAEA 2KHHA 2OPFA 1HJPA 1HQCA 4AW4A 2DI0A 3D8BA 3L29A 5KPRA 1NJGA 2BJVA 1Z5AA 3GLHB 3UGJA 2MROB 1XXHE 1PGYA 2GNOA 2JNHA 3T1YM 4G4RA 4M0WA 1QYRA 1L1TA 3DFZA 4OVZB 1PJIA 5IZ7D 2X49A 3K9PA 2EA0A 4DR7M 3WHLA 3FTCA 4DUYM 5EP3A 3WHKA 1ZV1A 3L2AA 2DAIA 4X66M 3TPZA 4KHPM 4XGIA 2YNMD 4FCVA 4LZJA 5FSWA 5F3WA 3LCVB 3VK8A 3HU3A 3SYKA 3U60B 4AI6A 1QDRA 1VQ1A 4B3TM 3GLHA 3EIHA 2KNZA 3IHPA 2Z4SA 4B3RM 4P17A 4AZFA 2DWLA 1XHBA 4OVZA 4Y28F 1ZMWA 1IBLM 2UUBM 1G4AE 4WP2A 2CWBA 5EP1A 1K3WA 2XSZA 2O25A 1QAMA 4FD2A 4PDIA 4MB7A 3U6QA 1MX0A 4NOOB 3FTDA 4QNRA 4CHTB 4DR6M 1IFYA 2BJWA 1PJQA 3H4JA 5EXXA 3U60A 4IBJA 3HJ8A
chains in the Genus database with same CATH topology
3HU2A 1NY5A 2CV2A 3DA1A 1DO0A 3KOWE 1Q3CA 2KEBA 3W0FA 1Q3BA 1IXRC 1NHWC 4X65M 4L8RC 3A46A 3KP1E 1OJLA 5KQDA 4MGYE 2HL7A 4QOZC 3AOGA 3T38A 2FNAA 4LJ4A 2KZSA 2DZNB 4B7FA 1YUBA 4YY3M 2RGHA 4G4QA 4XBOA 3SAWA 2QP9X 2L7HA 1TDHA 3L27A 1MU5A 3CF2A 2Y0TA 2DWZB 1NNJA 4R3DA 1IN7A 2EUCA 3K8ZA 4LZZA 1PJJA 3J27B 2DWNA 1L1ZA 3KFUG 5FTMA 1K82A 4LFBM 3FTFA 4A3VB 4DR1M 3SC3A 3M7GA 4OW0A 3A98B 3TWKA 3C58A 3AOEA 3K2LA 4Z6YA 3UMMA 5EQTA 2JA2A 3AKZA 4JI5M 3KS8A 3MK6A 3SBJA 4WURA 1HQYE 4NSOB 4JI4M 5ITUA 3K1JA 4FCWA 5ITXE 1R2ZA 1N33M 1QAOA 3HHWA 1SXJC 1IBMM 1J7KA 3PVSA 4DV3M 4DR5M 3KDSE 1H6UA 4LG2A 2LH0A 5A2QS 3FUUA 3GPYA 1L2BA 4LCBA 4GC5A 4GHLA 3DZDA 2ZANA 4GH9A 2QZ4A 4IJEA 1ZQ9A 2J7NA 3HJQA 1NJFA 4JI7M 1NVMA 5C18A 4X64M 2XEPA 1SXJE 4D80A 4B7HA 3J2PB 1IM2A 1HNWM 3W0LB 1L8QA 4FCTA 1G59A 2Z7JA 1E9RA 2RKOA 3TE6A 2XSZD 1FNNA 3PNYA 4B7GA 3U61B 1L2DA 2F5QA 3U6MA 3L25A 3FUXA 3SHFA 1HNXM 3J7BA 4TUWA 3VKHA 4JV5M 4HLQA 3THGA 5FTLA 1IN4A 1IN5A 3A45A 3H4MA 1IXZA 3KS4A 2ZBKB 1R2YA 3U61A 3KOYE 4DV1M 2W82A 3TL4X 4EIWA 3SMPA 5BPVA 4B3MM 2C96A 4DV6M 2YR0A 4IJFA 3TWMA 3RGPA 3SMSA 1KFVA 1I94M 2KZUA 2Q2EB 2V1UA 4LJ7A 3VDUA 2XZUA 3GRYA 2HHHM 2R62A 4GKKM 4AQYM 3U6SA 5JI2E 4JI0M 1C1KA 2XF3A 4NRWA 4L16A 2QBYB 2UXCM 4AKGA 1W5TA 4OX9M 3JR4A 1T3TA 4IBFA 4RF0A 3QWLA 4G4NA 3FTEA 4PCZA 4QOSA 3PXGA 4X62M 2L09A 1IY2A 2YQZA 1PM5A 1IN8A 3LMMA 3J7AS 1IY1A 2H1RA 3KW6A 2F5NA 4LF7M 1OFIA 2C9CA 2QBYA 5FTJA 4DUZM 2HKJA 4LJ9A 4Z8XA 4CGYB 3L26A 1NHGC 4JN6A 4I4LA 2FFJA 3L28A 3KVWA 3ZC7B 2K47A 1K3XA 5EXPA 4QNMA 1GVNA 4ZPXA 2DXIA 1OFHA 3E9SA 2X8AA 4LJ5A 2D7HA 3I51A 1L2CA 4JI8M 2KRUA 3E4RA 4JXJA 2DWMA 1DGHB 4DV0M 2LXEA 4L15A 5ITRA 3GLIB 4IBEA 4MGIE 3U6CA 1WXQA 3JR5A 2R46A 5IT9S 3LVWA 4QHTA 4D82A 1TH4A 4IBKA 5C1BA 4ITQA 4JYAM 2R18A 4JI1M 2R45A 1KSFX 2Y20A 1DGGA 3SYLA 3GRUA 3SFZA 4G4OA 1YSYA 5ITYA 4PDGA 1DGHA 4JI6M 2M60A 2Y21A 1N78A 3OTOM 3GLIA 4B3SM 2UXDM 4I5SA 3AOEC 1YE9A 2O5RA 4I81A 1UM8A 1N75A 5JI3E 4DR2M 3LQQA 5ITXA 4YHHM 3FD9A 2DVWB 3KSJA 4R7GA 8CATA 5BR8M 4S12A 4QHSA 3K92A 2QENA 3I4YA 1X37A 5FLXS 4D81A 1GLNA 2ZAOA 3GRRA 5DYGA 4IBBA 4NRVA 2C5RA 2FOIC 3VLFB 2CE7A 1IY0A 3J81S 1IN6A 2DHRA 3PFIA 4FVMA 1QANA 1J09A 5ITQA 2EO2A 4GIPA 1HT2E 3SARA 1QVRA 4IBCA 4IBIA 2D7GA 4AG6A 2VIIA 1XMOM 2G8LA 3ILKA 1IXSB 2L7IA 1XMQM 1N34M 4AG5A 1XXHB 4JI2M 1IBKM 2RGOA 3LQRA 5H37D 2KXEA 1TH2A 4PT5A 4G6ZA 3BOSA 2DZOB 1N36M 3VFDA 2CV0A 1XC8A 3CF0A 4LJAA 2P5TA 1EE8A 1JQJC 7CATA 2KRKA 4KODA 1HNZM 3JAMS 4LGMA 1E32A 1XXHA 3GPPA 1QAQA 3KXEC 4MGZE 4FWGA 3LVVA 2CFOA 3SHGB 3UK6A 2Y0QA 4NXMM 3DOAA 4DR4M 3TQSA 5EP2A 2QCUA 4M9SA 3HJSA 4BLCA 4DR3M 3AJIB 3T15A 1HR0M 2CHGA 3B9PA 2UU9M 2Z4RA 1Z5BA 2F4VM 1JR3A 4DV4M 3GLGB 3HWSA 4LRSA 3GQ5A 2XFSA 4LY6A 5KPZA 2M5ZA 3FUWA 4I8OA 3AL0C 2R4EA 4K0KM 2F5SA 2CEAA 3IG8A 2ZAMA 3R8FA 3GP1A 1HT1E 3AFHA 3GO8A 2CHQA 3FYDA 1S3SA 3R9XB 1Z6TA 3UJNA 4GHAA 3KSXA 3T1HM 3NWLA 5FTKA 4NXNM 3GQ4A 2R65A 2V6ZM 3GLGA 1QZMA 4NSRA 4LF8M 1GL7A 4RNAA 3SASA 4IBDA 4LJ6A 5EXTA 1XNRM 4KO8A 3FKEA 3UZUA 4GKJM 1Z5CA 2XH9A 1J5EM 2UUAM 2X4AA 2C99A 5GKNA 2CUZA 4FWHA 5KO3A 1TGUA 1VDDA 3GPXA 5EP4A 2A5YB 3HKPA 3Q8XA 3U5ZB 1D2NA 1XWIA 2BNKA 1LV7A 5E6JA 5EXSA 2OQ4A 4FWDA 4BB9A 1NNUC 2FE8A 2XZFA 1SXJD 4LRTA 5ITTA 5LMUM 4MH0E 3FYCA 3PNVA 4KLNA 3KOZE 2QPAA 2VQFM 3GPUA 3FUVA 3U6OA 4AKIA 2F5PA 2J7OA 3U5ZA 4P16A 2F5OA 2HCBA 1Z59A 3NBIA 4LF5M 2C9OA 4BBAA 2I7NA 1R6BX 4MGHA 2KW0A 2LNHC 1G41A 3A42A 3U6DA 2UUCM 1QQWA 2LWXA 2C98A 4L4UA 5KPTA 3MHVC 1N32M 1IQPA 1G8PA 4CISA 1SXJB 3CF6E 3IG5A 3KP0E 4LFCM 1KYIA 4GRIA 2E5LM 2ZM6M 4W5WA 3ZH9B 2L6OA 1I4WA 2AHMA 4M9ZA 4HL4A 3RGSA 5DYIA 4LGYA 4LF6M 5KQ8A 2D7EA 2YFQA 3CTWB 2R4JA 2XFTA 2XGNA 3GQ3A 3SAUA 1ORYB 4REZA 1SXJA 3HU1A 4M9XA 3GLFB 3TWLA 3GRVA 4GMQA 3KOXE 1JR3D 2V1CA 4GITA 2CHVA 4RF1A 4B08A 1FJGM 1DO2A 3SAVA 3J80S 4MGKE 5IREB 3HHXA 3SATA 1NY6A 3VK7A 1G3IA 4DV7M 2G5GX 2XLJA 4L78A 1R7RA 4DV5M 3D8LA 5EJCA 3FUTA 1N77A 1E9SA 2I7PA 4M0DA 3GLFA 1DGFA 4LFAM 4II7A 4DV2M 4PD2A 2Z3XA 4LJ8A 1TDZA 1W5SA 5FTNA 3M0EA 3MJ5A 3M6AA 3U6EA 2ERCA 4NL4H 4WW0A 4JI3M 5IWAM 5E26A 3U6PA 3HGIA 3HHYA 1E94E 1TH3A 4IBGA 4MM3B 3VDPA 3HHZA 3U6LA 1GKIA 4OU7A 1DGBA 4GC9A 2CV1A 3RFWA 3AV0A 3ZCBB 3I4VA 2KA6B 3EIEA 4LF9M 1NSFA 4FW9A 5DNYA 1GL6A 4AKHA 3VKGA 3RE8A 2UXBM 5LMNM 1Q39A 2NQ8C 3QAUA 1XNQM 2VQEM 4LF4M 4IIWA 1ZAEA 2OPFA 1HQCA 4AW4A 3D8BA 3L29A 5KPRA 1NJGA 2BJVA 1Z5AA 3GLHB 3UGJA 3T1YM 1L1TA 4G4RA 4M0WA 1QYRA 3DFZA 4OVZB 1PJIA 5IZ7D 2X49A 2EA0A 4DR7M 3WHLA 3FTCA 4DUYM 5EP3A 3WHKA 3L2AA 4X66M 3TPZA 4KHPM 4XGIA 2YNMD 4FCVA 4LZJA 5FSWA 5F3WA 3VK8A 3HU3A 3SYKA 3U60B 4AI6A 4B3TM 3GLHA 3EIHA 2Z4SA 4B3RM 4AZFA 2DWLA 1XHBA 4OVZA 1IBLM 2UUBM 1G4AE 5EP1A 1K3WA 2XSZA 1QAMA 4FD2A 4PDIA 4MB7A 3U6QA 1MX0A 4NOOB 3FTDA 4QNRA 4CHTB 4DR6M 2BJWA 3U60A 5EXXA 4IBJA 3HJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 M;  3A42 A;  3U6D A;  2Q2E B;  1XMO M;  2UUC M;  2XZU A;  1Q3C A;  3W0F A;  2HHH M;  1Q3B A;  1XMQ M;  1N32 M;  4GKK M;  4X65 M;  4AQY M;  1N34 M;  3U6S A;  4CIS A;  4JI0 M;  4JI2 M;  1IBK M;  3A46 A;  4LFC M;  4NRW A;  2UXC M;  4OX9 M;  2E5L M;  3JR4 A;  2ZM6 M;  1N36 M;  4G4N A;  4PCZ A;  4X62 M;  1XC8 A;  4LF6 M;  1PM5 A;  1EE8 A;  4YY3 M;  4G4Q A;  3SAW A;  1HNZ M;  3J7A S;  3JAM S;  1TDH A;  3GQ3 A;  1MU5 A;  3SAU A;  2F5N A;  3GPP A;  4LF7 M;  3TWL A;  1NNJ A;  4DUZ M;  2HKJ A;  1PJJ A;  1FJG M;  1L1Z A;  3SAV A;  1K82 A;  4NXM M;  4LFB M;  3J80 S;  3DOA A;  3SAT A;  4DR1 M;  3VK7 A;  4DR4 M;  4DV7 M;  4DR3 M;  1K3X A;  4DV5 M;  3TWK A;  1HR0 M;  2UU9 M;  3C58 A;  1Z5B A;  4LFA M;  4DV2 M;  2F4V M;  4PD2 A;  4DV4 M;  4JI5 M;  3SBJ A;  1TDZ A;  3GQ5 A;  1L2C A;  4JI4 M;  5ITU A;  4JI8 M;  5ITX E;  3U6E A;  1R2Z A;  1N33 M;  4K0K M;  4JI3 M;  3U6P A;  4DV0 M;  5IWA M;  2F5S A;  3U6L A;  5ITR A;  3GP1 A;  1IBM M;  3GO8 A;  3U6C A;  4DV3 M;  4DR5 M;  3JR5 A;  5IT9 S;  4LF9 M;  3T1H M;  4NXN M;  3GQ4 A;  2UXB M;  5A2Q S;  5LMN M;  3GPY A;  1Q39 A;  1L2B A;  4ITQ A;  4JI1 M;  4LF8 M;  4JYA M;  1XNQ M;  3SAS A;  4G4O A;  2VQE M;  4LF4 M;  1XNR M;  2OPF A;  5ITY A;  4PDG A;  4GKJ M;  4JI6 M;  3OTO M;  1Z5C A;  4B3S M;  2UXD M;  1J5E M;  1Z5A A;  2UUA M;  4JI7 M;  4X64 M;  3T1Y M;  1L1T A;  4G4R A;  4DR2 M;  1PJI A;  5ITX A;  4YHH M;  3GPX A;  2EA0 A;  4DR7 M;  4DUY M;  1HNW M;  4X66 M;  5BR8 M;  1L2D A;  4KHP M;  2OQ4 A;  2F5Q A;  3U6M A;  3VK8 A;  2XZF A;  5FLX S;  5ITT A;  1HNX M;  5LMU M;  4B3T M;  4B3R M;  4JV5 M;  2VQF M;  3GPU A;  4NRV A;  3U6O A;  3A45 A;  1IBL M;  2F5P A;  2UUB M;  3J81 S;  2ZBK B;  2F5O A;  1K3W A;  1Z59 A;  1R2Y A;  4LF5 M;  4PDI A;  4MB7 A;  4DV1 M;  3U6Q A;  4B3M M;  5ITQ A;  1MX0 A;  4DV6 M;  4DR6 M;  3TWM A;  3SAR A;  1KFV A; 
#chains in the Genus database with same CATH topology
 3HU2 A;  1D0K A;  1OIP A;  1NY5 A;  1YLA A;  2CV2 A;  3DA1 A;  3FRH A;  1DO0 A;  3KOW E;  1Q3C A;  2KEB A;  3W0F A;  1Q3B A;  4CJ6 A;  1IXR C;  1NHW C;  2JY6 B;  4X65 M;  4L8R C;  1OQY A;  2FH0 A;  2DZL A;  3T6P A;  3A46 A;  3KP1 E;  1OJL A;  1PRB A;  4DBG B;  1MJG M;  4MGY E;  1A5T A;  5KQD A;  2HL7 A;  2OOA A;  4QOZ C;  3AOG A;  2MR9 A;  3T38 A;  2FNA A;  4LJ4 A;  1QZE A;  2DAG A;  2KZS A;  2DZN B;  4B7F A;  1YUB A;  4YY3 M;  2RGH A;  4G4Q A;  4XBO A;  3SAW A;  1C7Y A;  2QP9 X;  2K0B X;  2L7H A;  1TDH A;  3L27 A;  1MU5 A;  2LVP C;  3CF2 A;  2Y0T A;  2DWZ B;  1Q02 A;  4R3D A;  1NNJ A;  1IN7 A;  2EUC A;  2QHO B;  3K8Z A;  4LZZ A;  1PJJ A;  3J27 B;  2K9D A;  3C3D A;  1L1Z A;  5FTM A;  2DWN A;  1K82 A;  1QDT A;  3KFU G;  4LFB M;  3FTF A;  4A3V B;  4F2L A;  4ANR A;  1WIV A;  4DR1 M;  3SC3 A;  3M7G A;  4OW0 A;  2LHG A;  3A98 B;  3TWK A;  3QYB A;  3C58 A;  3AOE A;  3K2L A;  4Z6Y A;  3GLI E;  3UMM A;  5EQT A;  2JA2 A;  1OTR A;  3AKZ A;  4JI5 M;  3KS8 A;  3MK6 A;  3SBJ A;  4WUR A;  1HQY E;  4NSO B;  4JI4 M;  5ITU A;  3K1J A;  4FCW A;  5ITX E;  1R2Z A;  1N33 M;  2L4E A;  1V92 A;  2VF7 A;  1QAO A;  3HHW A;  1SXJ C;  1IBM M;  2KDL A;  1J7K A;  3PVS A;  3K9O A;  4DV3 M;  2HWJ A;  4DR5 M;  3Q8G A;  3KDS E;  1H6U A;  4LG2 A;  2LH0 A;  1VDL A;  2ZTC A;  3LCU A;  1R4G A;  3FUU A;  3IEC A;  5A2Q S;  3GPY A;  1L2B A;  4LCB A;  4GC5 A;  4GHL A;  1BVS A;  3DZD A;  2ZAN A;  4GH9 A;  2QZ4 A;  3QYE A;  4IJE A;  1WR1 B;  1ZQ9 A;  2J7N A;  2JZ1 A;  3HJQ A;  3W67 A;  1NJF A;  4F1I A;  4JI7 M;  1NVM A;  5C18 A;  4X64 M;  3W68 A;  2XEP A;  1SXJ E;  4D80 A;  1VEG A;  4B7H A;  1VEK A;  1ZMU A;  3J2P B;  1IM2 A;  1HNW M;  2O01 F;  2LTU A;  1L8Q A;  1TR8 A;  3W0L B;  4FCT A;  1G59 A;  2Z7J A;  1E9R A;  2RKO A;  3TE6 A;  2XSZ D;  1FNN A;  3PNY A;  4B7G A;  3U61 B;  1L2D A;  2F5Q A;  3U6M A;  2H5X A;  3L25 A;  3FUX A;  3SHF A;  1HNX M;  3J7B A;  4TUW A;  3VKH A;  5ITQ A;  4JV5 M;  4HLQ A;  2DEN A;  3THG A;  5FTL A;  1IN4 A;  1IN5 A;  3A45 A;  3H4M A;  1IXZ A;  3KS4 A;  3E21 A;  2ZBK B;  1EFU B;  1JB0 F;  1R2Y A;  3U61 A;  1IXS A;  1G71 A;  3KOY E;  3E46 A;  2W82 A;  3TL4 X;  4EIW A;  3SMP A;  5BPV A;  4DV1 M;  4B3M M;  2C96 A;  4DV6 M;  2YR0 A;  4IJF A;  3TWM A;  2B3T A;  3RGP A;  3SMS A;  1KFV A;  1TTE A;  1I94 M;  2KZU A;  2Q2E B;  2V1U A;  1T43 A;  4LJ7 A;  4G3O A;  3VDU A;  1AUA A;  3GRY A;  2XZU A;  2HHH M;  2R62 A;  4GKK M;  4AQY M;  4L6V 6;  3U6S A;  5JI2 E;  3V76 A;  2MGW A;  4JI0 M;  1C1K A;  2XF3 A;  4NRW A;  4L16 A;  2QBY B;  2UXC M;  4AKG A;  1W5T A;  4OX9 M;  3JR4 A;  1T3T A;  4IBF A;  4RF0 A;  1F4I A;  3QWL A;  4G4N A;  3FTE A;  1JR3 E;  4QOS A;  3PXG A;  4PCZ A;  4X62 M;  2L09 A;  3HX3 A;  1IY2 A;  2YQZ A;  1PM5 A;  2N35 A;  2DKL A;  1IN8 A;  3LMM A;  3J7A S;  3CGW A;  1IY1 A;  2H1R A;  2MH8 A;  3KW6 A;  1WGN A;  2F5N A;  4LF7 M;  1OFI A;  2C9C A;  2QBY A;  5FTJ A;  4DUZ M;  2HKJ A;  4LJ9 A;  4Z8X A;  2JXN A;  2L2D A;  4CGY B;  3L26 A;  1NHG C;  2J5Y A;  4JN6 A;  4I4L A;  2FFJ A;  1AIP C;  3L28 A;  3GLG E;  3KVW A;  3ZC7 B;  1D0L A;  1PJT A;  1Y8G A;  2K47 A;  1K3X A;  4RKU F;  4XK8 F;  5EXP A;  4QNM A;  1GVN A;  2LVA A;  4ZPX A;  2DXI A;  1OFH A;  3BXW A;  3E9S A;  3B7Z A;  2X8A A;  4LJ5 A;  2QQ8 A;  2D7H A;  3I51 A;  1L2C A;  4HEO A;  4JI8 M;  2KRU A;  3E4R A;  4JXJ A;  2DWM A;  1DGH B;  4DV0 M;  2LXE A;  4L15 A;  5ITR A;  3GLI B;  4IBE A;  2DNA A;  4MGI E;  3U6C A;  1NV9 A;  5DFL A;  1WXQ A;  3JR5 A;  2JP7 A;  2R46 A;  1OAO C;  4GEW A;  3LVW A;  4QHT A;  5IT9 S;  4D82 A;  1TH4 A;  4IBK A;  5C1B A;  4ITQ A;  4JYA M;  2R18 A;  4JI1 M;  2R45 A;  1KSF X;  2Y20 A;  1DGG A;  3SYL A;  3GRU A;  3SFZ A;  4G4O A;  1YSY A;  5ITY A;  4PDG A;  1DGH A;  4JI6 M;  1ZMV A;  2M60 A;  1OKS A;  2Y21 A;  3OTO M;  3GLI A;  4B3S M;  2UXD M;  4I5S A;  3AOE C;  1N78 A;  1YE9 A;  2O5R A;  4I81 A;  1UM8 A;  1RU3 A;  1N75 A;  2R44 A;  1GAB A;  5JI3 E;  4DR2 M;  2JUJ A;  3LQQ A;  5ITX A;  4YHH M;  3FD9 A;  2DVW B;  3KSJ A;  4R7G A;  8CAT A;  5BR8 M;  4S12 A;  4QHS A;  3K92 A;  2QEN A;  3I4Y A;  1X37 A;  5FLX S;  2DAK A;  4D81 A;  1GLN A;  3HY5 A;  2ZAO A;  3GRR A;  5DYG A;  4IBB A;  4NRV A;  2C5R A;  2FOI C;  1QUT A;  3VLF B;  2JWS A;  2CE7 A;  1IY0 A;  3J81 S;  1IN6 A;  2DHR A;  3PFI A;  4FVM A;  3B89 A;  1V33 A;  1QAN A;  1J09 A;  2LVQ D;  2EO2 A;  2DHY A;  1V34 A;  2EKK A;  2KNA A;  2R6F A;  3B7N A;  4GIP A;  1HT2 E;  2FS1 A;  3SAR A;  2OO9 A;  1QVR A;  4IBC A;  4IBI A;  2D7G A;  1GJT A;  1OIZ A;  1LTM A;  2VII A;  4AG6 A;  1XMO M;  2G8L A;  3ILK A;  1IXS B;  2L7I A;  1XMQ M;  2VDB B;  1N34 M;  4AG5 A;  1XXH B;  4JI2 M;  1IBK M;  2RGO A;  3HZJ A;  3LQR A;  2BWB A;  2KXE A;  5H37 D;  1TH2 A;  3BBZ A;  4PT5 A;  4G6Z A;  1DV0 A;  3BOS A;  2DZO B;  3GLF E;  1N36 M;  3VFD A;  2CV0 A;  1XC8 A;  3CF0 A;  4LJA A;  2P5T A;  1EE8 A;  1JQJ C;  2WSC F;  2KRK A;  2LVO C;  1PJS A;  2OOB A;  4KOD A;  7CAT A;  1HNZ M;  3C9P A;  3JAM S;  4LGM A;  4UN2 B;  1E32 A;  1XXH A;  3GPP A;  1QAQ A;  3KXE C;  2JY5 A;  4MGZ E;  2LVN C;  4FWG A;  3LVV A;  2CFO A;  3NBX X;  3SHG B;  3UK6 A;  2Y0Q A;  4NXM M;  1P3Q Q;  3DOA A;  2DAM A;  2CP8 A;  4DR4 M;  3TQS A;  5EP2 A;  2QCU A;  3B7Q A;  4M9S A;  3HJS A;  4BLC A;  4DR3 M;  3AJI B;  3T15 A;  2Z8Y M;  1HR0 M;  2CHG A;  3B9P A;  2CRU A;  1WGL A;  2UU9 M;  2Z4R A;  1Z5B A;  2F4V M;  1JR3 A;  4DV4 M;  2JZ0 A;  3GLG B;  2R0I A;  3HWS A;  4LRS A;  3GQ5 A;  4NC6 A;  2XFS A;  4LY6 A;  5KPZ A;  2M5Z A;  3FUW A;  4I8O A;  2JY7 A;  5L8R F;  2R4E A;  3AL0 C;  4K0K M;  2F5S A;  2CEA A;  3IG8 A;  2ZAM A;  3R8F A;  1TF0 B;  3GP1 A;  1HT1 E;  3AFH A;  3GO8 A;  2QSF X;  2CHQ A;  1D0M A;  3FYD A;  1S3S A;  3F92 A;  3R9X B;  1Z6T A;  3UJN A;  4GHA A;  3KSX A;  3T1H M;  3NWL A;  5FTK A;  4NXN M;  3GQ4 A;  2G3Q A;  2R65 A;  2RRU A;  2V6Z M;  3GLH E;  3GLG A;  1T6O A;  1QZM A;  4NSR A;  3U6L A;  4LF8 M;  1GL7 A;  4RNA A;  3SAS A;  4IBD A;  4LJ6 A;  5EXT A;  1XNR M;  4KO8 A;  3B74 A;  1GO5 A;  3FKE A;  3UZU A;  4GKJ M;  1Z5C A;  2XH9 A;  1J5E M;  2UUA M;  1OAI A;  2X4A A;  3I04 M;  2C99 A;  5GKN A;  2CUZ A;  3LW5 F;  4FWH A;  5KO3 A;  4Q7J A;  1TGU A;  1VDD A;  3GPX A;  5EP4 A;  2A5Y B;  3HKP A;  3Q8X A;  3U5Z B;  1D2N A;  1UFZ A;  1XWI A;  2K6B A;  2BNK A;  1LV7 A;  5E6J A;  1QUS A;  2VF8 A;  5EXS A;  2OQ4 A;  4FWD A;  4BB9 A;  1NNU C;  3MMP A;  1R5L A;  2FE8 A;  2XZF A;  1SXJ D;  4LRT A;  5ITT A;  5LMU M;  4MH0 E;  3FYC A;  3PNV A;  4KLN A;  3KOZ E;  1NO1 A;  1MN3 A;  2QPA A;  2VQF M;  3GPU A;  3FUV A;  3U6O A;  4AKI A;  2F5P A;  2J7O A;  3U5Z A;  4P16 A;  2F5O A;  2HCB A;  1Z59 A;  1XB2 B;  3NBI A;  4LF5 M;  2C9O A;  1VEJ A;  2I7N A;  4BBA A;  4CIZ A;  1R6B X;  4MGH A;  2KW0 A;  1SG9 A;  2HAK A;  2LNH C;  1G41 A;  3A42 A;  3U6D A;  2UUC M;  1QQW A;  2LWX A;  2C98 A;  2L4F A;  4L4U A;  3MHV C;  5KPT A;  1N32 M;  1IQP A;  3FE3 A;  2WSF F;  1G8P A;  4R71 A;  4CIS A;  1SXJ B;  3CF6 E;  3IG5 A;  3KP0 E;  4LFC M;  1KYI A;  4GRI A;  4KT0 F;  2E5L M;  2ZM6 M;  4W5W A;  3ZH9 B;  2L6O A;  1I4W A;  2AHM A;  2JY8 A;  4M9Z A;  4HL4 A;  3RGS A;  5DYI A;  4LGY A;  4LF6 M;  2APL A;  2ZTD A;  2D7E A;  2YFQ A;  5KQ8 A;  3CTW B;  2R4J A;  2WSE F;  2XFT A;  2EKF A;  2XGN A;  3GQ3 A;  3SAU A;  3FRI A;  1ORY B;  4REZ A;  1SXJ A;  3HU1 A;  4M9X A;  3GLF B;  3TWL A;  3GRV A;  4GMQ A;  3KOX E;  1JR3 D;  2V1C A;  4GIT A;  1GJS A;  2CHV A;  4RF1 A;  4B08 A;  1FJG M;  1DO2 A;  3SAV A;  3J80 S;  4MGK E;  5IRE B;  3C3E A;  3HHX A;  1NY6 A;  3SAT A;  3VK7 A;  1G3I A;  1WHC A;  4DV7 M;  2MJ5 B;  2G5G X;  2XLJ A;  4L78 A;  1R7R A;  4DV5 M;  3D8L A;  5EJC A;  3FUT A;  1N77 A;  1E9S A;  2I7P A;  4M0D A;  3GLF A;  1DGF A;  4LFA M;  4II7 A;  3I01 M;  4PD2 A;  4DV2 M;  1EIJ A;  2Z3X A;  2DAE A;  2EJS A;  4LJ8 A;  2WZJ A;  1TDZ A;  1W5S A;  5FTN A;  3M0E A;  2BWE A;  3MJ5 A;  3M6A A;  3U6E A;  2ERC A;  4NL4 H;  4WW0 A;  4JI3 M;  5IWA M;  5E26 A;  3U6P A;  1NV8 A;  3HGI A;  1E94 E;  1CUK A;  1TH3 A;  4IBG A;  4MM3 B;  3HHY A;  3VDP A;  3ZQJ A;  1VG5 A;  3HHZ A;  1GKI A;  4OU7 A;  1DGB A;  2GQF A;  1WJ7 A;  2LHC A;  4GC9 A;  3RFW A;  3AV0 A;  2CV1 A;  3ZCB B;  3I4V A;  2KA6 B;  3EIE A;  4LF9 M;  1NSF A;  4FW9 A;  5DNY A;  1GL6 A;  4AKH A;  3VKG A;  3RE8 A;  2UXB M;  5LMN M;  1Q39 A;  2LBC A;  2NQ8 C;  2QNJ A;  3QAU A;  1XNQ M;  2KNV A;  2VQE M;  4LF4 M;  4IIW A;  1ZAE A;  2KHH A;  2OPF A;  1HJP A;  1HQC A;  4AW4 A;  2DI0 A;  3D8B A;  3L29 A;  5KPR A;  1NJG A;  2BJV A;  1Z5A A;  3GLH B;  3UGJ A;  2MRO B;  1XXH E;  1PGY A;  2GNO A;  2JNH A;  3T1Y M;  4G4R A;  4M0W A;  1QYR A;  1L1T A;  3DFZ A;  4OVZ B;  1PJI A;  5IZ7 D;  2X49 A;  3K9P A;  2EA0 A;  4DR7 M;  3WHL A;  3FTC A;  4DUY M;  5EP3 A;  3WHK A;  1ZV1 A;  3L2A A;  2DAI A;  4X66 M;  3TPZ A;  4KHP M;  4XGI A;  2YNM D;  4FCV A;  4LZJ A;  5FSW A;  5F3W A;  3LCV B;  3VK8 A;  3HU3 A;  3SYK A;  3U60 B;  4AI6 A;  1QDR A;  1VQ1 A;  4B3T M;  3GLH A;  3EIH A;  2KNZ A;  3IHP A;  2Z4S A;  4B3R M;  4P17 A;  4AZF A;  2DWL A;  1XHB A;  4OVZ A;  4Y28 F;  1ZMW A;  1IBL M;  2UUB M;  1G4A E;  4WP2 A;  2CWB A;  5EP1 A;  1K3W A;  2XSZ A;  2O25 A;  1QAM A;  4FD2 A;  4PDI A;  4MB7 A;  3U6Q A;  1MX0 A;  4NOO B;  3FTD A;  4QNR A;  4CHT B;  4DR6 M;  1IFY A;  2BJW A;  1PJQ A;  3H4J A;  5EXX A;  3U60 A;  4IBJ A;  3HJ8 A; 
#chains in the Genus database with same CATH homology
 3HU2 A;  1NY5 A;  2CV2 A;  3DA1 A;  1DO0 A;  3KOW E;  1Q3C A;  2KEB A;  3W0F A;  1Q3B A;  1IXR C;  1NHW C;  4X65 M;  4L8R C;  3A46 A;  3KP1 E;  1OJL A;  5KQD A;  4MGY E;  2HL7 A;  4QOZ C;  3AOG A;  3T38 A;  2FNA A;  4LJ4 A;  2KZS A;  2DZN B;  4B7F A;  1YUB A;  4YY3 M;  2RGH A;  4G4Q A;  4XBO A;  3SAW A;  2QP9 X;  2L7H A;  1TDH A;  3L27 A;  1MU5 A;  3CF2 A;  2Y0T A;  2DWZ B;  1NNJ A;  4R3D A;  1IN7 A;  2EUC A;  3K8Z A;  4LZZ A;  1PJJ A;  3J27 B;  2DWN A;  1L1Z A;  3KFU G;  5FTM A;  1K82 A;  4LFB M;  3FTF A;  4A3V B;  4DR1 M;  3SC3 A;  3M7G A;  4OW0 A;  3A98 B;  3TWK A;  3C58 A;  3AOE A;  3K2L A;  4Z6Y A;  3UMM A;  5EQT A;  2JA2 A;  3AKZ A;  4JI5 M;  3KS8 A;  3MK6 A;  3SBJ A;  4WUR A;  1HQY E;  4NSO B;  4JI4 M;  5ITU A;  3K1J A;  4FCW A;  5ITX E;  1R2Z A;  1N33 M;  1QAO A;  3HHW A;  1SXJ C;  1IBM M;  1J7K A;  3PVS A;  4DV3 M;  4DR5 M;  3KDS E;  1H6U A;  4LG2 A;  2LH0 A;  5A2Q S;  3FUU A;  3GPY A;  1L2B A;  4LCB A;  4GC5 A;  4GHL A;  3DZD A;  2ZAN A;  4GH9 A;  2QZ4 A;  4IJE A;  1ZQ9 A;  2J7N A;  3HJQ A;  1NJF A;  4JI7 M;  1NVM A;  5C18 A;  4X64 M;  2XEP A;  1SXJ E;  4D80 A;  4B7H A;  3J2P B;  1IM2 A;  1HNW M;  3W0L B;  1L8Q A;  4FCT A;  1G59 A;  2Z7J A;  1E9R A;  2RKO A;  3TE6 A;  2XSZ D;  1FNN A;  3PNY A;  4B7G A;  3U61 B;  1L2D A;  2F5Q A;  3U6M A;  3L25 A;  3FUX A;  3SHF A;  1HNX M;  3J7B A;  4TUW A;  3VKH A;  4JV5 M;  4HLQ A;  3THG A;  5FTL A;  1IN4 A;  1IN5 A;  3A45 A;  3H4M A;  1IXZ A;  3KS4 A;  2ZBK B;  1R2Y A;  3U61 A;  3KOY E;  4DV1 M;  2W82 A;  3TL4 X;  4EIW A;  3SMP A;  5BPV A;  4B3M M;  2C96 A;  4DV6 M;  2YR0 A;  4IJF A;  3TWM A;  3RGP A;  3SMS A;  1KFV A;  1I94 M;  2KZU A;  2Q2E B;  2V1U A;  4LJ7 A;  3VDU A;  2XZU A;  3GRY A;  2HHH M;  2R62 A;  4GKK M;  4AQY M;  3U6S A;  5JI2 E;  4JI0 M;  1C1K A;  2XF3 A;  4NRW A;  4L16 A;  2QBY B;  2UXC M;  4AKG A;  1W5T A;  4OX9 M;  3JR4 A;  1T3T A;  4IBF A;  4RF0 A;  3QWL A;  4G4N A;  3FTE A;  4PCZ A;  4QOS A;  3PXG A;  4X62 M;  2L09 A;  1IY2 A;  2YQZ A;  1PM5 A;  1IN8 A;  3LMM A;  3J7A S;  1IY1 A;  2H1R A;  3KW6 A;  2F5N A;  4LF7 M;  1OFI A;  2C9C A;  2QBY A;  5FTJ A;  4DUZ M;  2HKJ A;  4LJ9 A;  4Z8X A;  4CGY B;  3L26 A;  1NHG C;  4JN6 A;  4I4L A;  2FFJ A;  3L28 A;  3KVW A;  3ZC7 B;  2K47 A;  1K3X A;  5EXP A;  4QNM A;  1GVN A;  4ZPX A;  2DXI A;  1OFH A;  3E9S A;  2X8A A;  4LJ5 A;  2D7H A;  3I51 A;  1L2C A;  4JI8 M;  2KRU A;  3E4R A;  4JXJ A;  2DWM A;  1DGH B;  4DV0 M;  2LXE A;  4L15 A;  5ITR A;  3GLI B;  4IBE A;  4MGI E;  3U6C A;  1WXQ A;  3JR5 A;  2R46 A;  5IT9 S;  3LVW A;  4QHT A;  4D82 A;  1TH4 A;  4IBK A;  5C1B A;  4ITQ A;  4JYA M;  2R18 A;  4JI1 M;  2R45 A;  1KSF X;  2Y20 A;  1DGG A;  3SYL A;  3GRU A;  3SFZ A;  4G4O A;  1YSY A;  5ITY A;  4PDG A;  1DGH A;  4JI6 M;  2M60 A;  2Y21 A;  1N78 A;  3OTO M;  3GLI A;  4B3S M;  2UXD M;  4I5S A;  3AOE C;  1YE9 A;  2O5R A;  4I81 A;  1UM8 A;  1N75 A;  5JI3 E;  4DR2 M;  3LQQ A;  5ITX A;  4YHH M;  3FD9 A;  2DVW B;  3KSJ A;  4R7G A;  8CAT A;  5BR8 M;  4S12 A;  4QHS A;  3K92 A;  2QEN A;  3I4Y A;  1X37 A;  5FLX S;  4D81 A;  1GLN A;  2ZAO A;  3GRR A;  5DYG A;  4IBB A;  4NRV A;  2C5R A;  2FOI C;  3VLF B;  2CE7 A;  1IY0 A;  3J81 S;  1IN6 A;  2DHR A;  3PFI A;  4FVM A;  1QAN A;  1J09 A;  5ITQ A;  2EO2 A;  4GIP A;  1HT2 E;  3SAR A;  1QVR A;  4IBC A;  4IBI A;  2D7G A;  4AG6 A;  2VII A;  1XMO M;  2G8L A;  3ILK A;  1IXS B;  2L7I A;  1XMQ M;  1N34 M;  4AG5 A;  1XXH B;  4JI2 M;  1IBK M;  2RGO A;  3LQR A;  5H37 D;  2KXE A;  1TH2 A;  4PT5 A;  4G6Z A;  3BOS A;  2DZO B;  1N36 M;  3VFD A;  2CV0 A;  1XC8 A;  3CF0 A;  4LJA A;  2P5T A;  1EE8 A;  1JQJ C;  7CAT A;  2KRK A;  4KOD A;  1HNZ M;  3JAM S;  4LGM A;  1E32 A;  1XXH A;  3GPP A;  1QAQ A;  3KXE C;  4MGZ E;  4FWG A;  3LVV A;  2CFO A;  3SHG B;  3UK6 A;  2Y0Q A;  4NXM M;  3DOA A;  4DR4 M;  3TQS A;  5EP2 A;  2QCU A;  4M9S A;  3HJS A;  4BLC A;  4DR3 M;  3AJI B;  3T15 A;  1HR0 M;  2CHG A;  3B9P A;  2UU9 M;  2Z4R A;  1Z5B A;  2F4V M;  1JR3 A;  4DV4 M;  3GLG B;  3HWS A;  4LRS A;  3GQ5 A;  2XFS A;  4LY6 A;  5KPZ A;  2M5Z A;  3FUW A;  4I8O A;  3AL0 C;  2R4E A;  4K0K M;  2F5S A;  2CEA A;  3IG8 A;  2ZAM A;  3R8F A;  3GP1 A;  1HT1 E;  3AFH A;  3GO8 A;  2CHQ A;  3FYD A;  1S3S A;  3R9X B;  1Z6T A;  3UJN A;  4GHA A;  3KSX A;  3T1H M;  3NWL A;  5FTK A;  4NXN M;  3GQ4 A;  2R65 A;  2V6Z M;  3GLG A;  1QZM A;  4NSR A;  4LF8 M;  1GL7 A;  4RNA A;  3SAS A;  4IBD A;  4LJ6 A;  5EXT A;  1XNR M;  4KO8 A;  3FKE A;  3UZU A;  4GKJ M;  1Z5C A;  2XH9 A;  1J5E M;  2UUA M;  2X4A A;  2C99 A;  5GKN A;  2CUZ A;  4FWH A;  5KO3 A;  1TGU A;  1VDD A;  3GPX A;  5EP4 A;  2A5Y B;  3HKP A;  3Q8X A;  3U5Z B;  1D2N A;  1XWI A;  2BNK A;  1LV7 A;  5E6J A;  5EXS A;  2OQ4 A;  4FWD A;  4BB9 A;  1NNU C;  2FE8 A;  2XZF A;  1SXJ D;  4LRT A;  5ITT A;  5LMU M;  4MH0 E;  3FYC A;  3PNV A;  4KLN A;  3KOZ E;  2QPA A;  2VQF M;  3GPU A;  3FUV A;  3U6O A;  4AKI A;  2F5P A;  2J7O A;  3U5Z A;  4P16 A;  2F5O A;  2HCB A;  1Z59 A;  3NBI A;  4LF5 M;  2C9O A;  4BBA A;  2I7N A;  1R6B X;  4MGH A;  2KW0 A;  2LNH C;  1G41 A;  3A42 A;  3U6D A;  2UUC M;  1QQW A;  2LWX A;  2C98 A;  4L4U A;  5KPT A;  3MHV C;  1N32 M;  1IQP A;  1G8P A;  4CIS A;  1SXJ B;  3CF6 E;  3IG5 A;  3KP0 E;  4LFC M;  1KYI A;  4GRI A;  2E5L M;  2ZM6 M;  4W5W A;  3ZH9 B;  2L6O A;  1I4W A;  2AHM A;  4M9Z A;  4HL4 A;  3RGS A;  5DYI A;  4LGY A;  4LF6 M;  5KQ8 A;  2D7E A;  2YFQ A;  3CTW B;  2R4J A;  2XFT A;  2XGN A;  3GQ3 A;  3SAU A;  1ORY B;  4REZ A;  1SXJ A;  3HU1 A;  4M9X A;  3GLF B;  3TWL A;  3GRV A;  4GMQ A;  3KOX E;  1JR3 D;  2V1C A;  4GIT A;  2CHV A;  4RF1 A;  4B08 A;  1FJG M;  1DO2 A;  3SAV A;  3J80 S;  4MGK E;  5IRE B;  3HHX A;  3SAT A;  1NY6 A;  3VK7 A;  1G3I A;  4DV7 M;  2G5G X;  2XLJ A;  4L78 A;  1R7R A;  4DV5 M;  3D8L A;  5EJC A;  3FUT A;  1N77 A;  1E9S A;  2I7P A;  4M0D A;  3GLF A;  1DGF A;  4LFA M;  4II7 A;  4DV2 M;  4PD2 A;  2Z3X A;  4LJ8 A;  1TDZ A;  1W5S A;  5FTN A;  3M0E A;  3MJ5 A;  3M6A A;  3U6E A;  2ERC A;  4NL4 H;  4WW0 A;  4JI3 M;  5IWA M;  5E26 A;  3U6P A;  3HGI A;  3HHY A;  1E94 E;  1TH3 A;  4IBG A;  4MM3 B;  3VDP A;  3HHZ A;  3U6L A;  1GKI A;  4OU7 A;  1DGB A;  4GC9 A;  2CV1 A;  3RFW A;  3AV0 A;  3ZCB B;  3I4V A;  2KA6 B;  3EIE A;  4LF9 M;  1NSF A;  4FW9 A;  5DNY A;  1GL6 A;  4AKH A;  3VKG A;  3RE8 A;  2UXB M;  5LMN M;  1Q39 A;  2NQ8 C;  3QAU A;  1XNQ M;  2VQE M;  4LF4 M;  4IIW A;  1ZAE A;  2OPF A;  1HQC A;  4AW4 A;  3D8B A;  3L29 A;  5KPR A;  1NJG A;  2BJV A;  1Z5A A;  3GLH B;  3UGJ A;  3T1Y M;  1L1T A;  4G4R A;  4M0W A;  1QYR A;  3DFZ A;  4OVZ B;  1PJI A;  5IZ7 D;  2X49 A;  2EA0 A;  4DR7 M;  3WHL A;  3FTC A;  4DUY M;  5EP3 A;  3WHK A;  3L2A A;  4X66 M;  3TPZ A;  4KHP M;  4XGI A;  2YNM D;  4FCV A;  4LZJ A;  5FSW A;  5F3W A;  3VK8 A;  3HU3 A;  3SYK A;  3U60 B;  4AI6 A;  4B3T M;  3GLH A;  3EIH A;  2Z4S A;  4B3R M;  4AZF A;  2DWL A;  1XHB A;  4OVZ A;  1IBL M;  2UUB M;  1G4A E;  5EP1 A;  1K3W A;  2XSZ A;  1QAM A;  4FD2 A;  4PDI A;  4MB7 A;  3U6Q A;  1MX0 A;  4NOO B;  3FTD A;  4QNR A;  4CHT B;  4DR6 M;  2BJW A;  3U60 A;  5EXX A;  4IBJ A;  3HJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...