4NXNM

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nxnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4nxnM02
3U6QA 2VQEM 4LFCM 5ITRA 5ITYA 2EA0A 2Q2EB 1HR0M 4JI8M 3GP1A 3JR5A 1I94M 1FJGM 1MU5A 3U6LA 2VQFM 4PD2A 4LF4M 4LF5M 3J81S 5BR8M 4K0KM 4DR2M 4YHHM 4MB7A 4AQYM 1L1ZA 1IBMM 4LF9M 4DR3M 1K3XA 3U6SA 1Z5BA 4LFBM 4DUYM 1PM5A 2UXCM 4JI4M 4B3SM 3GPXA 5ITXA 1PJIA 3JR4A 4DR5M 4B3TM 4NXNM 3GQ4A 3GO8A 4JI7M 2ZBKB 3VK7A 1N33M 4DR4M 5ITQA 4LF7M 4LF8M 5IT9S 4DV1M 3A46A 3J7AS 4JI2M 4G4QA 1XMOM 4NXMM 3W0FA 4YY3M 1L2DA 3TWMA 4PDIA 1XNRM 4DV7M 1TDZA 3U6DA 2UU9M 4JV5M 4JI6M 2UUCM 4OX9M 3U6OA 4CISA 1L1TA 4DV5M 3VK8A 4GKJM 1N32M 1R2YA 1J5EM 2OQ4A 1IBKM 2E5LM 2F4VM 4G4OA 1L2BA 3T1YM 4KHPM 2XZFA 5LMUM 3A45A 4JI0M 4DV0M 3U6CA 1Z59A 2F5QA 4GKKM 3C58A 2F5PA 2F5NA 3TWKA 1MX0A 1Q39A 4DR6M 1K3WA 3J80S 3SAVA 1TDHA 4JI1M 1XNQM 1HNXM 1Q3CA 1PJJA 2F5OA 3T1HM 3SBJA 3SARA 1Q3BA 2HKJA 5LMNM 4DR1M 5ITUA 5ITTA 3JAMS 3SAWA 3TWLA 4JI3M 1XC8A 4NRWA 2ZM6M 3GPYA 3SASA 4B3RM 3U6EA 1HNZM 3A42A 4X65M 1N34M 2F5SA 4JYAM 4X62M 4LFAM 4DV6M 4X64M 4ITQA 1EE8A 4PCZA 2OPFA 2HHHM 1NNJA 1N36M 2UXBM 5FLXS 4DV2M 3GQ3A 4B3MM 1HNWM 3GPPA 1IBLM 4JI5M 3U6PA 1Z5AA 4LF6M 5IWAM 4DR7M 4G4RA 2UUBM 1KFVA 4DUZM 2UUAM 3SAUA 4DV3M 2XZUA 5A2QS 3U6MA 3OTOM 1Z5CA 1L2CA 3DOAA 4X66M 3SATA 3GPUA 3GQ5A 4DV4M 4G4NA 1R2ZA 4PDGA 1K82A 2UXDM 5ITXE 4NRVA 1XMQM
chains in the Genus database with same CATH superfamily
4B7FA 3U6QA 2OO9A 4P17A 1N75A 2EA0A 4NOOB 1N77A 4LGYA 3EIEA 2V6ZM 1FJGM 2LTUA 5DYIA 3T38A 1QVRA 1NNUC 2CHQA 2VQFM 4QHSA 3M0EA 3T15A 1R7RA 2R45A 4LF5M 5BR8M 3RGSA 2C96A 4I8OA 1SG9A 3K1JA 1YE9A 3PNVA 4NL4H 1YLAA 3U6SA 1GJSA 1XXHA 1IFYA 1VDDA 4AKIA 1PM5A 1PJQA 3F92A 2WSEF 3TPZA 1DO2A 2QBYB 3U5ZB 3FYCA 4LJ7A 2KRUA 2I7PA 1SXJB 4XK8F 4B3SM 1T6OA 2KNAA 1NV9A 1NO1A 1TH2A 5KPTA 3M6AA 4DR5M 4L15A 2EO2A 3GO8A 4LZZA 3W0LB 3VK7A 2BNKA 3RFWA 3BXWA 4AW4A 4S12A 1N33M 3L27A 2JUJA 1HT2E 3GRYA 2JY5A 2LVQD 4JI2M 4AG6A 4L4UA 1DGGA 1G41A 4MM3B 4LJ9A 3QWLA 4YY3M 1TF0B 4R3DA 4FVMA 2KZSA 3KW6A 4DV7M 2UU9M 1GJTA 2ERCA 2LVOC 1MN3A 3HHXA 1HJPA 1IN6A 1NV8A 2R4JA 1Q02A 2XLJA 3U6OA 2YNMD 2BWEA 4MGKE 4QHTA 3SYLA 4UN2B 2R62A 1R5LA 2OQ4A 2K47A 3AOEC 2DZNB 2Y20A 3PVSA 2C5RA 1IBKM 4IBCA 1OFHA 1L2BA 3KFUG 4KHPM 1T43A 2KNZA 5KPRA 2DNAA 4GHLA 4LJ5A 1Z59A 2L7IA 2W82A 4BBAA 2R0IA 1G3IA 2DWZB 2HCBA 2XEPA 1QANA 1SXJD 1RU3A 3NBXX 4IJFA 3AKZA 4DR6M 1EIJA 2QQ8A 3GRVA 1XNQM 4JI1M 1DGHA 3H4JA 4NSOB 2JA2A 1PJJA 4LGMA 4Z6YA 3SBJA 3VKGA 1GABA 2FNAA 4DR1M 1PRBA 2O25A 2WSFF 2DVWB 5ITTA 3SAWA 4JI3M 2VIIA 2L4FA 3ZQJA 2Z3XA 3LCVB 1XC8A 5BPVA 4FD2A 5IZ7D 2LVPC 4LRSA 4B7GA 3I01M 4L78A 3FE3A 4MGZE 5E6JA 2A5YB 3I4VA 2KZUA 3L2AA 3UZUA 3SYKA 2F5SA 3MMPA 4JYAM 2D7HA 4LFAM 3DA1A 3V76A 5FTNA 3GLIE 1WGLA 4CJ6A 4PCZA 2OOAA 4M9SA 4XBOA 3K92A 2RGHA 1A5TA 1GKIA 3KDSE 1HNWM 4B3MM 5FTKA 3FYDA 3TQSA 2MROB 3FRIA 4B7HA 1IBLM 4G3OA 4IBFA 3E4RA 4JI5M 2C98A 1AUAA 1Z5AA 1NHWC 2JZ1A 2LNHC 4AKGA 4R7GA 3SMPA 2XSZA 4GHAA 1VEGA 2CV0A 1JB0F 2J7OA 4FWDA 5A2QS 2I7NA 1XXHE 3KSXA 3FTFA 3SHFA 3I4YA 2L2DA 2YR0A 3GQ5A 4CHTB 2FE8A 4FCVA 3GLIB 3L28A 4GIPA 3K9OA 3MHVC 4QNMA 3FUXA 1G8PA 3FUWA 2VQEM 5ITRA 4LFCM 1LV7A 1R4GA 2DAIA 2VF8A 2QNJA 4QNRA 3JR5A 1I94M 5IREB 4CGYB 3AJIB 3FTDA 3K2LA 1UM8A 1QAMA 4I4LA 4PD2A 2CHVA 4F2LA 4LF4M 1NVMA 4WURA 2R46A 4HL4A 3THGA 2Z4SA 4MB7A 4LG2A 1WR1B 4RF1A 4AI6A 4FCTA 3CTWB 4MGIE 2G5GX 1IBMM 4DR3M 1Z5BA 3B89A 4D82A 3L26A 1XXHB 2UXCM 1X37A 2J5YA 1NJFA 2LBCA 2QSFX 2DAMA 3QYBA 1SXJE 4B08A 2Y0QA 4FWGA 4M0DA 5EXTA 2N35A 3JR4A 1QDTA 1VQ1A 1YUBA 5EP4A 2EUCA 3TE6A 3GRUA 1ZV1A 3HZJA 3TL4X 2H5XA 1DV0A 4KO8A 5EP1A 3SMSA 4LF7M 3FTEA 1HQCA 1MJGM 4IBBA 2YFQA 4F1IA 1FNNA 2CV2A 3ILKA 3J7AS 2QHOB 4W5WA 4G4QA 1XMOM 3KP0E 1OAOC 1XHBA 1I4WA 3BOSA 4RKUF 5DNYA 2ZTDA 4II7A 4OW0A 1TDZA 3U6DA 3PXGA 2P5TA 2WSCF 2R65A 4MGYE 3LMMA 4GC9A 4CISA 4LJ8A 3VK8A 4GKJM 4FCWA 2LVAA 2X8AA 1BVSA 1EFUB 2F4VM 3VKHA 2LXEA 5EQTA 3E21A 3T1YM 4L8RC 5LMUM 3A45A 4JI0M 1G59A 2NQ8C 3WHLA 3C58A 1VEJA 5KQDA 4ZPXA 1Q39A 1OTRA 1IXSA 2L4EA 4D81A 2LWXA 4D80A 4KT0F 1Q3CA 3SFZA 1DGHB 2EJSA 1QQWA 3T1HM 3HHZA 1Q3BA 2MR9A 5KPZA 3L25A 4HLQA 3JAMS 1Z6TA 3HJSA 3J7BA 1G71A 3C3EA 3TWLA 3WHKA 1P3QQ 4NRWA 2LHGA 2CEAA 4LY6A 2D7EA 4GC5A 3GLFA 2QP9X 3PFIA 4IBKA 1PJSA 3SASA 2G8LA 4IBEA 1IQPA 1SXJC 4A3VB 2DI0A 3B7ZA 4NSRA 1EE8A 2D7GA 2UXBM 2K6BA 3KOXE 5GKNA 4DV2M 3QAUA 1WXQA 3GLHA 4M0WA 3GPPA 1V33A 3VFDA 3HU1A 2DKLA 3LQQA 4AZFA 1E9RA 4EIWA 2APLA 2CV1A 2KHHA 2KW0A 4G4RA 4DR7M 2V1UA 3QYEA 2UUAM 1OQYA 3U60A 2CE7A 2XFTA 3KS4A 3MJ5A 4DV3M 3SAUA 2QBYA 4CIZA 5EXPA 1QYRA 3AOEA 2QZ4A 1ORYB 1W5SA 4JXJA 3H4MA 2CUZA 3OTOM 2L7HA 1L2CA 4X66M 2JY8A 3GPUA 4RNAA 2DWMA 3EIHA 4IJEA 1D0KA 1UFZA 1ZQ9A 1R2ZA 3I51A 3Q8GA 2UXDM 3AL0C 1DGFA 1ZAEA 1OFIA 1WHCA 3Q8XA 1OKSA 3HKPA 1OIPA 5ITYA 1ZMUA 2Q2EB 4AG5A 2ZAOA 7CATA 4JI8M 4NC6A 4JN6A 4LZJA 2ZTCA 3CF0A 1MU5A 2K9DA 3AV0A 1VG5A 3J81S 4IBDA 4DR2M 1V34A 4M9ZA 2Z7JA 3DFZA 1K3XA 1IXZA 3FD9A 3VDUA 4LFBM 4WW0A 3T6PA 3IHPA 2QPAA 3E46A 2LH0A 4JI4M 3GPXA 1JQJC 5ITXA 4QOSA 1PJIA 1NHGC 3LW5F 2CHGA 2DHYA 3W68A 4REZA 5DFLA 3GQ4A 1NJGA 2BJWA 2X4AA 3KS8A 2DHRA 3KVWA 2XSZD 1HT1E 3HY5A 2V1CA 5F3WA 3UK6A 5ITQA 4DR4M 4LF8M 3M7GA 2O01F 3FUTA 3PNYA 3A46A 2JY6B 2EKKA 3IECA 3GLGA 5EXSA 1D2NA 5JI3E 2QENA 4NXMM 1GL7A 2DAGA 1L2DA 3ZC7B 2O5RA 3B9PA 3TWMA 1XNRM 4JV5M 5KO3A 4JI6M 2DAKA 2H1RA 2UUCM 2VF7A 4LCBA 5EJCA 1N32M 4P16A 2B3TA 2Y21A 4KLNA 1J5EM 4M9XA 2DZOB 3C9PA 2E5LM 4TUWA 4Z8XA 2XH9A 1WIVA 4KODA 1PJTA 2CP8A 3HU3A 3D8BA 3HHWA 2XZFA 3ZH9B 4DV0M 4GKKM 2F5PA 2F5NA 2C99A 3TWKA 3KOWE 1MX0A 2CRUA 1K3WA 2J7NA 1IXSB 1TDHA 3SAVA 4OVZA 4IBJA 1QZEA 3J2PB 1XWIA 3HWSA 1G4AE 4BB9A 2HKJA 3C3DA 5LMNM 4OU7A 5FTMA 5ITUA 4IBGA 1E94E 1QUTA 3HU2A 1IN4A 2MJ5B 1IY1A 4FWHA 2ZM6M 2MGWA 3VDPA 3FKEA 2LHCA 3GLFB 1HQYE 2Z8YM 3GPYA 5E26A 1S3SA 4QOZC 1JR3A 2RRUA 1N34M 1KSFX 4Q7JA 2WZJA 3HGIA 4X62M 4DV6M 5KQ8A 1J7KA 3K9PA 1N36M 2RKOA 5FLXS 1OJLA 3KXEC 3U61A 1DO0A 3B7NA 1GLNA 3FUUA 3GLHB 1IXRC 5FSWA 1QAQA 3LCUA 4Y28F 4GEWA 1JR3D 3B74A 3U6PA 3LQRA 2UUBM 1GO5A 1C1KA 3GRRA 1TR8A 3RGPA 1KFVA 2ZANA 1F4IA 4DUZM 4L6V6 2XZUA 1TTEA 2LVNC 3U60B 4FW9A 2K0BX 2R44A 3BBZA 4AKHA 1IY0A 3DOAA 3AFHA 2GQFA 1NY6A 1NSFA 2ZAMA 1ZMVA 2JXNA 2XGNA 4DV4M 4G4NA 1K82A 3NBIA 4GH9A 2JY7A 5ITXE 4IBIA 1QUSA 5DYGA 2Y0TA 3L29A 5H37D 1HR0M 3GP1A 3E9SA 3KP1E 3U6LA 4HEOA 2MH8A 5FTJA 2DENA 5EP3A 4BLCA 4K0KM 1GL6A 2R6FA 4YHHM 3GLGE 4AQYM 1AIPC 1L1ZA 4LF9M 1XB2B 4LJAA 3LVVA 4LRTA 4DUYM 3HJ8A 1QZMA 1IN8A 3U5ZA 1SXJA 1Y8GA 2DWLA 3IG5A 4ANRA 4I81A 3MK6A 2KA6B 2JNHA 5L8RF 4GITA 2HL7A 5EP2A 1GVNA 1TGUA 4B3TM 4NXNM 4JI7M 1V92A 2ZBKB 3IG8A 5C1BA 3UMMA 5FTLA 2G3QA 3HHYA 1E9SA 2FFJA 2X49A 5IT9S 2BWBA 4DV1M 3HX3A 2L6OA 3R8FA 2KEBA 3J27B 1TH3A 2KDLA 3GLGB 1N78A 4MGHA 4LJ6A 3W0FA 3ZCBB 4PDIA 2HAKA 4GRIA 2JWSA 3RE8A 2DXIA 3KOYE 4OX9M 1L1TA 4DV5M 2R4EA 1R2YA 1J09A 4MH0E 1ZMWA 2L09A 5C18A 2JP7A 4G4OA 1JR3E 2DWNA 2C9CA 4L16A 2RGOA 1PGYA 4DBGB 3U6CA 1CUKA 2F5QA 1IN5A 2FS1A 2QCUA 1WJ7A 3D8LA 3CF2A 3J80S 1IM2A 3KOZE 1YSYA 1HNXM 4R71A 4OVZB 8CATA 1OAIA 5JI2E 2AHMA 2F5OA 1IY2A 3UGJA 2DAEA 3SARA 3HJQA 3UJNA 2KXEA 3CGWA 3FUVA 3KSJA 1D0LA 1W5TA 2CFOA 2FOIC 5EXXA 2KRKA 4B3RM 2R18A 1WGNA 2EKFA 3U6EA 3VLFB 1HNZM 3SC3A 1E32A 3A42A 3I04M 4X65M 3GLFE 4PT5A 3K8ZA 1H6UA 1KYIA 2BJVA 4X64M 3AOGA 2YQZA 2M60A 4ITQA 2HHHM 2OPFA 3R9XB 1NNJA 2C9OA 3FTCA 1L8QA 3NWLA 1OIZA 1VDLA 3B7QA 3FRHA 4XGIA 2FH0A 2HWJA 3A98B 2KNVA 3GQ3A 4GMQA 1T3TA 1R6BX 3U61B 4WP2A 3CF6E 4LJ4A 1NY5A 3GLHE 3W67A 1D0MA 3SHGB 2CWBA 1TH4A 2DZLA 2XFSA 5IWAM 4LF6M 2OOBA 1IN7A 2XF3A 2Z4RA 3LVWA 4G6ZA 4IIWA 1VEKA 3U6MA 2VDBB 1LTMA 4I5SA 1Z5CA 2GNOA 1C7YA 3SATA 4RF0A 3DZDA 1QAOA 1QDRA 1DGBA 2JZ0A 4PDGA 3GLIA 2M5ZA 4NRVA 1XMQM
chains in the Genus database with same CATH topology
4B7FA 3U6QA 1N75A 2EA0A 4NOOB 1N77A 4LGYA 3EIEA 2V6ZM 1FJGM 5DYIA 3T38A 1QVRA 1NNUC 2CHQA 2VQFM 4QHSA 3M0EA 3T15A 1R7RA 2R45A 4LF5M 5BR8M 3RGSA 2C96A 4I8OA 3K1JA 1YE9A 3PNVA 4NL4H 3U6SA 1XXHA 1VDDA 4AKIA 1PM5A 3TPZA 2QBYB 1DO2A 3U5ZB 3FYCA 4LJ7A 2KRUA 2I7PA 1SXJB 4B3SM 1TH2A 5KPTA 3M6AA 4DR5M 4L15A 2EO2A 3GO8A 4LZZA 3W0LB 3VK7A 2BNKA 3RFWA 4AW4A 4S12A 1N33M 3L27A 1HT2E 3GRYA 4JI2M 4AG6A 4L4UA 1DGGA 1G41A 4MM3B 4LJ9A 3QWLA 4YY3M 4R3DA 4FVMA 2KZSA 3KW6A 4DV7M 2UU9M 2ERCA 3HHXA 2XLJA 1IN6A 2R4JA 3U6OA 3L25A 2YNMD 4MGKE 4QHTA 3SYLA 2R62A 2OQ4A 2K47A 3AOEC 2DZNB 2Y20A 3PVSA 2C5RA 1IBKM 4IBCA 1OFHA 1L2BA 3KFUG 4KHPM 5KPRA 4GHLA 4LJ5A 1Z59A 2L7IA 2W82A 4BBAA 1G3IA 2DWZB 2HCBA 2XEPA 1QANA 1SXJD 4IJFA 3AKZA 4DR6M 3GRVA 1XNQM 4JI1M 1DGHA 4NSOB 2JA2A 1PJJA 4LGMA 4Z6YA 3SBJA 3VKGA 2FNAA 4DR1M 5ITTA 2DVWB 3SAWA 4JI3M 2VIIA 2Z3XA 1XC8A 5BPVA 4FD2A 5IZ7D 4LRSA 4B7GA 4L78A 4MGZE 5E6JA 2A5YB 3I4VA 2KZUA 3L2AA 3UZUA 3SYKA 2F5SA 4JYAM 2D7HA 4LFAM 3DA1A 5FTNA 4PCZA 4M9SA 4XBOA 3K92A 2RGHA 1GKIA 3KDSE 1HNWM 4B3MM 5FTKA 3FYDA 3TQSA 4B7HA 1IBLM 4IBFA 3E4RA 4JI5M 2C98A 1Z5AA 1NHWC 2LNHC 4AKGA 4R7GA 3SMPA 2XSZA 4GHAA 2CV0A 2J7OA 4FWDA 5A2QS 2I7NA 3KSXA 3FTFA 3SHFA 3I4YA 2YR0A 3GQ5A 4CHTB 2FE8A 4FCVA 3GLIB 3L28A 4GIPA 3MHVC 4QNMA 3FUXA 1G8PA 3FUWA 2VQEM 5ITRA 4LFCM 1LV7A 4QNRA 3JR5A 1I94M 5IREB 4CGYB 3AJIB 3FTDA 3K2LA 1UM8A 1QAMA 4I4LA 4PD2A 2CHVA 4LF4M 1NVMA 4WURA 2R46A 4HL4A 3THGA 2Z4SA 4MB7A 4LG2A 4RF1A 4AI6A 4FCTA 3CTWB 4MGIE 2G5GX 1IBMM 4DR3M 1Z5BA 4D82A 3L26A 1XXHB 2UXCM 1X37A 1NJFA 4B08A 1SXJE 2Y0QA 4FWGA 4M0DA 5EXTA 3JR4A 1YUBA 5EP4A 2EUCA 3TE6A 3GRUA 3TL4X 4KO8A 5EP1A 3SMSA 4LF7M 3FTEA 1HQCA 4IBBA 2YFQA 1FNNA 2CV2A 3ILKA 3J7AS 4W5WA 4G4QA 1XMOM 3KP0E 1XHBA 5DNYA 1I4WA 3BOSA 4II7A 4OW0A 1TDZA 3U6DA 3PXGA 2P5TA 2R65A 4MGYE 3LMMA 4GC9A 4CISA 4LJ8A 3VK8A 4GKJM 4FCWA 2X8AA 2F4VM 3VKHA 2LXEA 5EQTA 3T1YM 4L8RC 5LMUM 3A45A 4JI0M 1G59A 2NQ8C 3WHLA 3C58A 5KQDA 4ZPXA 1Q39A 4D81A 2LWXA 4D80A 1Q3CA 3SFZA 1DGHB 1QQWA 3T1HM 3HHZA 1Q3BA 5KPZA 4HLQA 3JAMS 1Z6TA 3HJSA 3J7BA 3TWLA 3WHKA 4NRWA 2CEAA 4LY6A 2D7EA 4GC5A 3GLFA 2QP9X 3PFIA 4IBKA 3SASA 2G8LA 4IBEA 1IQPA 1SXJC 4A3VB 4NSRA 1EE8A 2D7GA 2UXBM 3KOXE 5GKNA 4DV2M 3QAUA 1WXQA 3GLHA 4M0WA 3GPPA 3VFDA 3HU1A 3LQQA 4AZFA 1E9RA 4EIWA 2CV1A 2KW0A 4G4RA 4DR7M 2V1UA 2UUAM 3U60A 2CE7A 2XFTA 3KS4A 3MJ5A 4DV3M 3SAUA 2QBYA 5EXPA 1QYRA 3AOEA 2QZ4A 1ORYB 1W5SA 4JXJA 3H4MA 2CUZA 3OTOM 2L7HA 1L2CA 4X66M 3GPUA 4RNAA 2DWMA 3EIHA 4IJEA 1ZQ9A 1R2ZA 3I51A 2UXDM 3AL0C 1DGFA 1ZAEA 1OFIA 3Q8XA 3HKPA 5ITYA 2Q2EB 4AG5A 2ZAOA 7CATA 4JI8M 4JN6A 4LZJA 3CF0A 1MU5A 3AV0A 3J81S 4IBDA 4DR2M 4M9ZA 2Z7JA 3DFZA 1K3XA 1IXZA 3FD9A 3VDUA 4LFBM 4WW0A 2QPAA 2LH0A 4JI4M 3GPXA 1JQJC 5ITXA 4QOSA 1PJIA 1NHGC 2CHGA 4REZA 3GQ4A 3KS8A 1NJGA 2BJWA 2X4AA 2DHRA 3KVWA 2XSZD 1HT1E 2V1CA 5F3WA 3UK6A 5ITQA 4DR4M 4LF8M 3M7GA 3FUTA 3PNYA 3A46A 3GLGA 5EXSA 1D2NA 5JI3E 2QENA 4NXMM 1GL7A 1L2DA 3ZC7B 2O5RA 3B9PA 3TWMA 1XNRM 4JV5M 5KO3A 4JI6M 2H1RA 2UUCM 4LCBA 5EJCA 1N32M 4P16A 2Y21A 4KLNA 1J5EM 4M9XA 2DZOB 2E5LM 4TUWA 4Z8XA 2XH9A 4KODA 2XZFA 3HU3A 3D8BA 3HHWA 3ZH9B 4DV0M 4GKKM 2F5PA 2F5NA 2C99A 3TWKA 3KOWE 1MX0A 1K3WA 2J7NA 1IXSB 1TDHA 3SAVA 4OVZA 4IBJA 3J2PB 1XWIA 3HWSA 1G4AE 4BB9A 2HKJA 5LMNM 4OU7A 5FTMA 5ITUA 4IBGA 1E94E 3HU2A 1IN4A 1IY1A 4FWHA 2ZM6M 3VDPA 3GLFB 3FKEA 1HQYE 3GPYA 4QOZC 5E26A 1S3SA 1JR3A 1N34M 1KSFX 3HGIA 4X62M 4DV6M 5KQ8A 1J7KA 1N36M 2RKOA 5FLXS 1OJLA 3KXEC 3U61A 1DO0A 1GLNA 3FUUA 3GLHB 1IXRC 5FSWA 1QAQA 1JR3D 3U6PA 3LQRA 2UUBM 1C1KA 3GRRA 3RGPA 1KFVA 2ZANA 4DUZM 2XZUA 3U60B 4FW9A 4AKHA 1IY0A 3DOAA 3AFHA 1NY6A 1NSFA 2ZAMA 2XGNA 4DV4M 4G4NA 1K82A 3NBIA 4GH9A 5ITXE 4IBIA 5DYGA 2Y0TA 3L29A 5H37D 1HR0M 3GP1A 3E9SA 3KP1E 3U6LA 5FTJA 5EP3A 4BLCA 4K0KM 1GL6A 4YHHM 4AQYM 1L1ZA 4LF9M 4LJAA 3LVVA 4LRTA 4DUYM 3HJ8A 1QZMA 1IN8A 3U5ZA 1SXJA 2DWLA 3IG5A 4I81A 3MK6A 2KA6B 4GITA 2HL7A 5EP2A 1GVNA 1TGUA 4B3TM 4NXNM 4JI7M 2ZBKB 3UMMA 3IG8A 5C1BA 5FTLA 3HHYA 1E9SA 2FFJA 2X49A 5IT9S 4DV1M 2L6OA 3R8FA 2KEBA 3J27B 1TH3A 3GLGB 1N78A 4MGHA 4LJ6A 3W0FA 3ZCBB 4PDIA 4GRIA 2DXIA 3RE8A 3KOYE 4OX9M 1L1TA 4DV5M 2R4EA 1R2YA 1J09A 4MH0E 2L09A 5C18A 4G4OA 2DWNA 2C9CA 4L16A 2RGOA 3U6CA 2F5QA 1IN5A 2QCUA 3D8LA 3CF2A 3J80S 1IM2A 3KOZE 1YSYA 1HNXM 4OVZB 8CATA 5JI2E 2AHMA 2F5OA 1IY2A 3UGJA 3SARA 3HJQA 3UJNA 2KXEA 3FUVA 3KSJA 1W5TA 2CFOA 2FOIC 5EXXA 2KRKA 4B3RM 2R18A 3U6EA 1HNZM 3VLFB 3SC3A 1E32A 3A42A 4X65M 4PT5A 3K8ZA 1H6UA 1KYIA 2BJVA 4X64M 3AOGA 2YQZA 2M60A 4ITQA 2HHHM 2OPFA 3R9XB 1NNJA 2C9OA 3FTCA 1L8QA 3NWLA 4XGIA 3A98B 3GQ3A 4GMQA 1T3TA 1R6BX 3U61B 3CF6E 4LJ4A 1NY5A 3SHGB 2XFSA 1TH4A 5IWAM 4LF6M 1IN7A 2XF3A 2Z4RA 3LVWA 4G6ZA 4IIWA 3U6MA 4I5SA 1Z5CA 3SATA 4RF0A 3DZDA 1QAOA 1DGBA 4PDGA 3GLIA 2M5ZA 4NRVA 1XMQM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6Q A;  2VQE M;  4LFC M;  5ITR A;  5ITY A;  2EA0 A;  2Q2E B;  1HR0 M;  4JI8 M;  3GP1 A;  3JR5 A;  1I94 M;  1FJG M;  1MU5 A;  3U6L A;  2VQF M;  4PD2 A;  4LF4 M;  4LF5 M;  3J81 S;  5BR8 M;  4K0K M;  4DR2 M;  4YHH M;  4MB7 A;  4AQY M;  1L1Z A;  1IBM M;  4LF9 M;  4DR3 M;  1K3X A;  3U6S A;  1Z5B A;  4LFB M;  4DUY M;  1PM5 A;  2UXC M;  4JI4 M;  4B3S M;  3GPX A;  5ITX A;  1PJI A;  3JR4 A;  4DR5 M;  4B3T M;  4NXN M;  3GQ4 A;  3GO8 A;  4JI7 M;  2ZBK B;  3VK7 A;  1N33 M;  4DR4 M;  5ITQ A;  4LF7 M;  4LF8 M;  5IT9 S;  4DV1 M;  3A46 A;  3J7A S;  4JI2 M;  4G4Q A;  1XMO M;  4NXM M;  3W0F A;  4YY3 M;  1L2D A;  3TWM A;  4PDI A;  1XNR M;  4DV7 M;  1TDZ A;  3U6D A;  2UU9 M;  4JV5 M;  4JI6 M;  2UUC M;  4OX9 M;  3U6O A;  4CIS A;  1L1T A;  4DV5 M;  3VK8 A;  4GKJ M;  1N32 M;  1R2Y A;  1J5E M;  2OQ4 A;  1IBK M;  2E5L M;  2F4V M;  4G4O A;  1L2B A;  3T1Y M;  4KHP M;  2XZF A;  5LMU M;  3A45 A;  4JI0 M;  4DV0 M;  3U6C A;  1Z59 A;  2F5Q A;  4GKK M;  3C58 A;  2F5P A;  2F5N A;  3TWK A;  1MX0 A;  1Q39 A;  4DR6 M;  1K3W A;  3J80 S;  3SAV A;  1TDH A;  4JI1 M;  1XNQ M;  1HNX M;  1Q3C A;  1PJJ A;  2F5O A;  3T1H M;  3SBJ A;  3SAR A;  1Q3B A;  2HKJ A;  5LMN M;  4DR1 M;  5ITU A;  5ITT A;  3JAM S;  3SAW A;  3TWL A;  4JI3 M;  1XC8 A;  4NRW A;  2ZM6 M;  3GPY A;  3SAS A;  4B3R M;  3U6E A;  1HNZ M;  3A42 A;  4X65 M;  1N34 M;  2F5S A;  4JYA M;  4X62 M;  4LFA M;  4DV6 M;  4X64 M;  4ITQ A;  1EE8 A;  4PCZ A;  2OPF A;  2HHH M;  1NNJ A;  1N36 M;  2UXB M;  5FLX S;  4DV2 M;  3GQ3 A;  4B3M M;  1HNW M;  3GPP A;  1IBL M;  4JI5 M;  3U6P A;  1Z5A A;  4LF6 M;  5IWA M;  4DR7 M;  4G4R A;  2UUB M;  1KFV A;  4DUZ M;  2UUA M;  3SAU A;  4DV3 M;  2XZU A;  5A2Q S;  3U6M A;  3OTO M;  1Z5C A;  1L2C A;  3DOA A;  4X66 M;  3SAT A;  3GPU A;  3GQ5 A;  4DV4 M;  4G4N A;  1R2Z A;  4PDG A;  1K82 A;  2UXD M;  5ITX E;  4NRV A;  1XMQ M; 
#chains in the Genus database with same CATH topology
 4B7F A;  3U6Q A;  2OO9 A;  4P17 A;  1N75 A;  2EA0 A;  4NOO B;  1N77 A;  4LGY A;  3EIE A;  2V6Z M;  1FJG M;  2LTU A;  5DYI A;  3T38 A;  1QVR A;  1NNU C;  2CHQ A;  2VQF M;  4QHS A;  3M0E A;  3T15 A;  1R7R A;  2R45 A;  4LF5 M;  5BR8 M;  3RGS A;  2C96 A;  4I8O A;  1SG9 A;  3K1J A;  1YE9 A;  3PNV A;  4NL4 H;  1YLA A;  3U6S A;  1GJS A;  1XXH A;  1IFY A;  1VDD A;  4AKI A;  1PM5 A;  1PJQ A;  3F92 A;  2WSE F;  3TPZ A;  1DO2 A;  2QBY B;  3U5Z B;  3FYC A;  4LJ7 A;  2KRU A;  2I7P A;  1SXJ B;  4XK8 F;  4B3S M;  1T6O A;  2KNA A;  1NV9 A;  1NO1 A;  1TH2 A;  5KPT A;  3M6A A;  4DR5 M;  4L15 A;  2EO2 A;  3GO8 A;  4LZZ A;  3W0L B;  3VK7 A;  2BNK A;  3RFW A;  3BXW A;  4AW4 A;  4S12 A;  1N33 M;  3L27 A;  2JUJ A;  1HT2 E;  3GRY A;  2JY5 A;  2LVQ D;  4JI2 M;  4AG6 A;  4L4U A;  1DGG A;  1G41 A;  4MM3 B;  4LJ9 A;  3QWL A;  4YY3 M;  1TF0 B;  4R3D A;  4FVM A;  2KZS A;  3KW6 A;  4DV7 M;  2UU9 M;  1GJT A;  2ERC A;  2LVO C;  1MN3 A;  3HHX A;  1HJP A;  1IN6 A;  1NV8 A;  2R4J A;  1Q02 A;  2XLJ A;  3U6O A;  2YNM D;  2BWE A;  4MGK E;  4QHT A;  3SYL A;  4UN2 B;  2R62 A;  1R5L A;  2OQ4 A;  2K47 A;  3AOE C;  2DZN B;  2Y20 A;  3PVS A;  2C5R A;  1IBK M;  4IBC A;  1OFH A;  1L2B A;  3KFU G;  4KHP M;  1T43 A;  2KNZ A;  5KPR A;  2DNA A;  4GHL A;  4LJ5 A;  1Z59 A;  2L7I A;  2W82 A;  4BBA A;  2R0I A;  1G3I A;  2DWZ B;  2HCB A;  2XEP A;  1QAN A;  1SXJ D;  1RU3 A;  3NBX X;  4IJF A;  3AKZ A;  4DR6 M;  1EIJ A;  2QQ8 A;  3GRV A;  1XNQ M;  4JI1 M;  1DGH A;  3H4J A;  4NSO B;  2JA2 A;  1PJJ A;  4LGM A;  4Z6Y A;  3SBJ A;  3VKG A;  1GAB A;  2FNA A;  4DR1 M;  1PRB A;  2O25 A;  2WSF F;  2DVW B;  5ITT A;  3SAW A;  4JI3 M;  2VII A;  2L4F A;  3ZQJ A;  2Z3X A;  3LCV B;  1XC8 A;  5BPV A;  4FD2 A;  5IZ7 D;  2LVP C;  4LRS A;  4B7G A;  3I01 M;  4L78 A;  3FE3 A;  4MGZ E;  5E6J A;  2A5Y B;  3I4V A;  2KZU A;  3L2A A;  3UZU A;  3SYK A;  2F5S A;  3MMP A;  4JYA M;  2D7H A;  4LFA M;  3DA1 A;  3V76 A;  5FTN A;  3GLI E;  1WGL A;  4CJ6 A;  4PCZ A;  2OOA A;  4M9S A;  4XBO A;  3K92 A;  2RGH A;  1A5T A;  1GKI A;  3KDS E;  1HNW M;  4B3M M;  5FTK A;  3FYD A;  3TQS A;  2MRO B;  3FRI A;  4B7H A;  1IBL M;  4G3O A;  4IBF A;  3E4R A;  4JI5 M;  2C98 A;  1AUA A;  1Z5A A;  1NHW C;  2JZ1 A;  2LNH C;  4AKG A;  4R7G A;  3SMP A;  2XSZ A;  4GHA A;  1VEG A;  2CV0 A;  1JB0 F;  2J7O A;  4FWD A;  5A2Q S;  2I7N A;  1XXH E;  3KSX A;  3FTF A;  3SHF A;  3I4Y A;  2L2D A;  2YR0 A;  3GQ5 A;  4CHT B;  2FE8 A;  4FCV A;  3GLI B;  3L28 A;  4GIP A;  3K9O A;  3MHV C;  4QNM A;  3FUX A;  1G8P A;  3FUW A;  2VQE M;  5ITR A;  4LFC M;  1LV7 A;  1R4G A;  2DAI A;  2VF8 A;  2QNJ A;  4QNR A;  3JR5 A;  1I94 M;  5IRE B;  4CGY B;  3AJI B;  3FTD A;  3K2L A;  1UM8 A;  1QAM A;  4I4L A;  4PD2 A;  2CHV A;  4F2L A;  4LF4 M;  1NVM A;  4WUR A;  2R46 A;  4HL4 A;  3THG A;  2Z4S A;  4MB7 A;  4LG2 A;  1WR1 B;  4RF1 A;  4AI6 A;  4FCT A;  3CTW B;  4MGI E;  2G5G X;  1IBM M;  4DR3 M;  1Z5B A;  3B89 A;  4D82 A;  3L26 A;  1XXH B;  2UXC M;  1X37 A;  2J5Y A;  1NJF A;  2LBC A;  2QSF X;  2DAM A;  3QYB A;  1SXJ E;  4B08 A;  2Y0Q A;  4FWG A;  4M0D A;  5EXT A;  2N35 A;  3JR4 A;  1QDT A;  1VQ1 A;  1YUB A;  5EP4 A;  2EUC A;  3TE6 A;  3GRU A;  1ZV1 A;  3HZJ A;  3TL4 X;  2H5X A;  1DV0 A;  4KO8 A;  5EP1 A;  3SMS A;  4LF7 M;  3FTE A;  1HQC A;  1MJG M;  4IBB A;  2YFQ A;  4F1I A;  1FNN A;  2CV2 A;  3ILK A;  3J7A S;  2QHO B;  4W5W A;  4G4Q A;  1XMO M;  3KP0 E;  1OAO C;  1XHB A;  1I4W A;  3BOS A;  4RKU F;  5DNY A;  2ZTD A;  4II7 A;  4OW0 A;  1TDZ A;  3U6D A;  3PXG A;  2P5T A;  2WSC F;  2R65 A;  4MGY E;  3LMM A;  4GC9 A;  4CIS A;  4LJ8 A;  3VK8 A;  4GKJ M;  4FCW A;  2LVA A;  2X8A A;  1BVS A;  1EFU B;  2F4V M;  3VKH A;  2LXE A;  5EQT A;  3E21 A;  3T1Y M;  4L8R C;  5LMU M;  3A45 A;  4JI0 M;  1G59 A;  2NQ8 C;  3WHL A;  3C58 A;  1VEJ A;  5KQD A;  4ZPX A;  1Q39 A;  1OTR A;  1IXS A;  2L4E A;  4D81 A;  2LWX A;  4D80 A;  4KT0 F;  1Q3C A;  3SFZ A;  1DGH B;  2EJS A;  1QQW A;  3T1H M;  3HHZ A;  1Q3B A;  2MR9 A;  5KPZ A;  3L25 A;  4HLQ A;  3JAM S;  1Z6T A;  3HJS A;  3J7B A;  1G71 A;  3C3E A;  3TWL A;  3WHK A;  1P3Q Q;  4NRW A;  2LHG A;  2CEA A;  4LY6 A;  2D7E A;  4GC5 A;  3GLF A;  2QP9 X;  3PFI A;  4IBK A;  1PJS A;  3SAS A;  2G8L A;  4IBE A;  1IQP A;  1SXJ C;  4A3V B;  2DI0 A;  3B7Z A;  4NSR A;  1EE8 A;  2D7G A;  2UXB M;  2K6B A;  3KOX E;  5GKN A;  4DV2 M;  3QAU A;  1WXQ A;  3GLH A;  4M0W A;  3GPP A;  1V33 A;  3VFD A;  3HU1 A;  2DKL A;  3LQQ A;  4AZF A;  1E9R A;  4EIW A;  2APL A;  2CV1 A;  2KHH A;  2KW0 A;  4G4R A;  4DR7 M;  2V1U A;  3QYE A;  2UUA M;  1OQY A;  3U60 A;  2CE7 A;  2XFT A;  3KS4 A;  3MJ5 A;  4DV3 M;  3SAU A;  2QBY A;  4CIZ A;  5EXP A;  1QYR A;  3AOE A;  2QZ4 A;  1ORY B;  1W5S A;  4JXJ A;  3H4M A;  2CUZ A;  3OTO M;  2L7H A;  1L2C A;  4X66 M;  2JY8 A;  3GPU A;  4RNA A;  2DWM A;  3EIH A;  4IJE A;  1D0K A;  1UFZ A;  1ZQ9 A;  1R2Z A;  3I51 A;  3Q8G A;  2UXD M;  3AL0 C;  1DGF A;  1ZAE A;  1OFI A;  1WHC A;  3Q8X A;  1OKS A;  3HKP A;  1OIP A;  5ITY A;  1ZMU A;  2Q2E B;  4AG5 A;  2ZAO A;  7CAT A;  4JI8 M;  4NC6 A;  4JN6 A;  4LZJ A;  2ZTC A;  3CF0 A;  1MU5 A;  2K9D A;  3AV0 A;  1VG5 A;  3J81 S;  4IBD A;  4DR2 M;  1V34 A;  4M9Z A;  2Z7J A;  3DFZ A;  1K3X A;  1IXZ A;  3FD9 A;  3VDU A;  4LFB M;  4WW0 A;  3T6P A;  3IHP A;  2QPA A;  3E46 A;  2LH0 A;  4JI4 M;  3GPX A;  1JQJ C;  5ITX A;  4QOS A;  1PJI A;  1NHG C;  3LW5 F;  2CHG A;  2DHY A;  3W68 A;  4REZ A;  5DFL A;  3GQ4 A;  1NJG A;  2BJW A;  2X4A A;  3KS8 A;  2DHR A;  3KVW A;  2XSZ D;  1HT1 E;  3HY5 A;  2V1C A;  5F3W A;  3UK6 A;  5ITQ A;  4DR4 M;  4LF8 M;  3M7G A;  2O01 F;  3FUT A;  3PNY A;  3A46 A;  2JY6 B;  2EKK A;  3IEC A;  3GLG A;  5EXS A;  1D2N A;  5JI3 E;  2QEN A;  4NXM M;  1GL7 A;  2DAG A;  1L2D A;  3ZC7 B;  2O5R A;  3B9P A;  3TWM A;  1XNR M;  4JV5 M;  5KO3 A;  4JI6 M;  2DAK A;  2H1R A;  2UUC M;  2VF7 A;  4LCB A;  5EJC A;  1N32 M;  4P16 A;  2B3T A;  2Y21 A;  4KLN A;  1J5E M;  4M9X A;  2DZO B;  3C9P A;  2E5L M;  4TUW A;  4Z8X A;  2XH9 A;  1WIV A;  4KOD A;  1PJT A;  2CP8 A;  3HU3 A;  3D8B A;  3HHW A;  2XZF A;  3ZH9 B;  4DV0 M;  4GKK M;  2F5P A;  2F5N A;  2C99 A;  3TWK A;  3KOW E;  1MX0 A;  2CRU A;  1K3W A;  2J7N A;  1IXS B;  1TDH A;  3SAV A;  4OVZ A;  4IBJ A;  1QZE A;  3J2P B;  1XWI A;  3HWS A;  1G4A E;  4BB9 A;  2HKJ A;  3C3D A;  5LMN M;  4OU7 A;  5FTM A;  5ITU A;  4IBG A;  1E94 E;  1QUT A;  3HU2 A;  1IN4 A;  2MJ5 B;  1IY1 A;  4FWH A;  2ZM6 M;  2MGW A;  3VDP A;  3FKE A;  2LHC A;  3GLF B;  1HQY E;  2Z8Y M;  3GPY A;  5E26 A;  1S3S A;  4QOZ C;  1JR3 A;  2RRU A;  1N34 M;  1KSF X;  4Q7J A;  2WZJ A;  3HGI A;  4X62 M;  4DV6 M;  5KQ8 A;  1J7K A;  3K9P A;  1N36 M;  2RKO A;  5FLX S;  1OJL A;  3KXE C;  3U61 A;  1DO0 A;  3B7N A;  1GLN A;  3FUU A;  3GLH B;  1IXR C;  5FSW A;  1QAQ A;  3LCU A;  4Y28 F;  4GEW A;  1JR3 D;  3B74 A;  3U6P A;  3LQR A;  2UUB M;  1GO5 A;  1C1K A;  3GRR A;  1TR8 A;  3RGP A;  1KFV A;  2ZAN A;  1F4I A;  4DUZ M;  4L6V 6;  2XZU A;  1TTE A;  2LVN C;  3U60 B;  4FW9 A;  2K0B X;  2R44 A;  3BBZ A;  4AKH A;  1IY0 A;  3DOA A;  3AFH A;  2GQF A;  1NY6 A;  1NSF A;  2ZAM A;  1ZMV A;  2JXN A;  2XGN A;  4DV4 M;  4G4N A;  1K82 A;  3NBI A;  4GH9 A;  2JY7 A;  5ITX E;  4IBI A;  1QUS A;  5DYG A;  2Y0T A;  3L29 A;  5H37 D;  1HR0 M;  3GP1 A;  3E9S A;  3KP1 E;  3U6L A;  4HEO A;  2MH8 A;  5FTJ A;  2DEN A;  5EP3 A;  4BLC A;  4K0K M;  1GL6 A;  2R6F A;  4YHH M;  3GLG E;  4AQY M;  1AIP C;  1L1Z A;  4LF9 M;  1XB2 B;  4LJA A;  3LVV A;  4LRT A;  4DUY M;  3HJ8 A;  1QZM A;  1IN8 A;  3U5Z A;  1SXJ A;  1Y8G A;  2DWL A;  3IG5 A;  4ANR A;  4I81 A;  3MK6 A;  2KA6 B;  2JNH A;  5L8R F;  4GIT A;  2HL7 A;  5EP2 A;  1GVN A;  1TGU A;  4B3T M;  4NXN M;  4JI7 M;  1V92 A;  2ZBK B;  3IG8 A;  5C1B A;  3UMM A;  5FTL A;  2G3Q A;  3HHY A;  1E9S A;  2FFJ A;  2X49 A;  5IT9 S;  2BWB A;  4DV1 M;  3HX3 A;  2L6O A;  3R8F A;  2KEB A;  3J27 B;  1TH3 A;  2KDL A;  3GLG B;  1N78 A;  4MGH A;  4LJ6 A;  3W0F A;  3ZCB B;  4PDI A;  2HAK A;  4GRI A;  2JWS A;  3RE8 A;  2DXI A;  3KOY E;  4OX9 M;  1L1T A;  4DV5 M;  2R4E A;  1R2Y A;  1J09 A;  4MH0 E;  1ZMW A;  2L09 A;  5C18 A;  2JP7 A;  4G4O A;  1JR3 E;  2DWN A;  2C9C A;  4L16 A;  2RGO A;  1PGY A;  4DBG B;  3U6C A;  1CUK A;  2F5Q A;  1IN5 A;  2FS1 A;  2QCU A;  1WJ7 A;  3D8L A;  3CF2 A;  3J80 S;  1IM2 A;  3KOZ E;  1YSY A;  1HNX M;  4R71 A;  4OVZ B;  8CAT A;  1OAI A;  5JI2 E;  2AHM A;  2F5O A;  1IY2 A;  3UGJ A;  2DAE A;  3SAR A;  3HJQ A;  3UJN A;  2KXE A;  3CGW A;  3FUV A;  3KSJ A;  1D0L A;  1W5T A;  2CFO A;  2FOI C;  5EXX A;  2KRK A;  4B3R M;  2R18 A;  1WGN A;  2EKF A;  3U6E A;  3VLF B;  1HNZ M;  3SC3 A;  1E32 A;  3A42 A;  3I04 M;  4X65 M;  3GLF E;  4PT5 A;  3K8Z A;  1H6U A;  1KYI A;  2BJV A;  4X64 M;  3AOG A;  2YQZ A;  2M60 A;  4ITQ A;  2HHH M;  2OPF A;  3R9X B;  1NNJ A;  2C9O A;  3FTC A;  1L8Q A;  3NWL A;  1OIZ A;  1VDL A;  3B7Q A;  3FRH A;  4XGI A;  2FH0 A;  2HWJ A;  3A98 B;  2KNV A;  3GQ3 A;  4GMQ A;  1T3T A;  1R6B X;  3U61 B;  4WP2 A;  3CF6 E;  4LJ4 A;  1NY5 A;  3GLH E;  3W67 A;  1D0M A;  3SHG B;  2CWB A;  1TH4 A;  2DZL A;  2XFS A;  5IWA M;  4LF6 M;  2OOB A;  1IN7 A;  2XF3 A;  2Z4R A;  3LVW A;  4G6Z A;  4IIW A;  1VEK A;  3U6M A;  2VDB B;  1LTM A;  4I5S A;  1Z5C A;  2GNO A;  1C7Y A;  3SAT A;  4RF0 A;  3DZD A;  1QAO A;  1QDR A;  1DGB A;  2JZ0 A;  4PDG A;  3GLI A;  2M5Z A;  4NRV A;  1XMQ M; 
#chains in the Genus database with same CATH homology
 4B7F A;  3U6Q A;  1N75 A;  2EA0 A;  4NOO B;  1N77 A;  4LGY A;  3EIE A;  2V6Z M;  1FJG M;  5DYI A;  3T38 A;  1QVR A;  1NNU C;  2CHQ A;  2VQF M;  4QHS A;  3M0E A;  3T15 A;  1R7R A;  2R45 A;  4LF5 M;  5BR8 M;  3RGS A;  2C96 A;  4I8O A;  3K1J A;  1YE9 A;  3PNV A;  4NL4 H;  3U6S A;  1XXH A;  1VDD A;  4AKI A;  1PM5 A;  3TPZ A;  2QBY B;  1DO2 A;  3U5Z B;  3FYC A;  4LJ7 A;  2KRU A;  2I7P A;  1SXJ B;  4B3S M;  1TH2 A;  5KPT A;  3M6A A;  4DR5 M;  4L15 A;  2EO2 A;  3GO8 A;  4LZZ A;  3W0L B;  3VK7 A;  2BNK A;  3RFW A;  4AW4 A;  4S12 A;  1N33 M;  3L27 A;  1HT2 E;  3GRY A;  4JI2 M;  4AG6 A;  4L4U A;  1DGG A;  1G41 A;  4MM3 B;  4LJ9 A;  3QWL A;  4YY3 M;  4R3D A;  4FVM A;  2KZS A;  3KW6 A;  4DV7 M;  2UU9 M;  2ERC A;  3HHX A;  2XLJ A;  1IN6 A;  2R4J A;  3U6O A;  3L25 A;  2YNM D;  4MGK E;  4QHT A;  3SYL A;  2R62 A;  2OQ4 A;  2K47 A;  3AOE C;  2DZN B;  2Y20 A;  3PVS A;  2C5R A;  1IBK M;  4IBC A;  1OFH A;  1L2B A;  3KFU G;  4KHP M;  5KPR A;  4GHL A;  4LJ5 A;  1Z59 A;  2L7I A;  2W82 A;  4BBA A;  1G3I A;  2DWZ B;  2HCB A;  2XEP A;  1QAN A;  1SXJ D;  4IJF A;  3AKZ A;  4DR6 M;  3GRV A;  1XNQ M;  4JI1 M;  1DGH A;  4NSO B;  2JA2 A;  1PJJ A;  4LGM A;  4Z6Y A;  3SBJ A;  3VKG A;  2FNA A;  4DR1 M;  5ITT A;  2DVW B;  3SAW A;  4JI3 M;  2VII A;  2Z3X A;  1XC8 A;  5BPV A;  4FD2 A;  5IZ7 D;  4LRS A;  4B7G A;  4L78 A;  4MGZ E;  5E6J A;  2A5Y B;  3I4V A;  2KZU A;  3L2A A;  3UZU A;  3SYK A;  2F5S A;  4JYA M;  2D7H A;  4LFA M;  3DA1 A;  5FTN A;  4PCZ A;  4M9S A;  4XBO A;  3K92 A;  2RGH A;  1GKI A;  3KDS E;  1HNW M;  4B3M M;  5FTK A;  3FYD A;  3TQS A;  4B7H A;  1IBL M;  4IBF A;  3E4R A;  4JI5 M;  2C98 A;  1Z5A A;  1NHW C;  2LNH C;  4AKG A;  4R7G A;  3SMP A;  2XSZ A;  4GHA A;  2CV0 A;  2J7O A;  4FWD A;  5A2Q S;  2I7N A;  3KSX A;  3FTF A;  3SHF A;  3I4Y A;  2YR0 A;  3GQ5 A;  4CHT B;  2FE8 A;  4FCV A;  3GLI B;  3L28 A;  4GIP A;  3MHV C;  4QNM A;  3FUX A;  1G8P A;  3FUW A;  2VQE M;  5ITR A;  4LFC M;  1LV7 A;  4QNR A;  3JR5 A;  1I94 M;  5IRE B;  4CGY B;  3AJI B;  3FTD A;  3K2L A;  1UM8 A;  1QAM A;  4I4L A;  4PD2 A;  2CHV A;  4LF4 M;  1NVM A;  4WUR A;  2R46 A;  4HL4 A;  3THG A;  2Z4S A;  4MB7 A;  4LG2 A;  4RF1 A;  4AI6 A;  4FCT A;  3CTW B;  4MGI E;  2G5G X;  1IBM M;  4DR3 M;  1Z5B A;  4D82 A;  3L26 A;  1XXH B;  2UXC M;  1X37 A;  1NJF A;  4B08 A;  1SXJ E;  2Y0Q A;  4FWG A;  4M0D A;  5EXT A;  3JR4 A;  1YUB A;  5EP4 A;  2EUC A;  3TE6 A;  3GRU A;  3TL4 X;  4KO8 A;  5EP1 A;  3SMS A;  4LF7 M;  3FTE A;  1HQC A;  4IBB A;  2YFQ A;  1FNN A;  2CV2 A;  3ILK A;  3J7A S;  4W5W A;  4G4Q A;  1XMO M;  3KP0 E;  1XHB A;  5DNY A;  1I4W A;  3BOS A;  4II7 A;  4OW0 A;  1TDZ A;  3U6D A;  3PXG A;  2P5T A;  2R65 A;  4MGY E;  3LMM A;  4GC9 A;  4CIS A;  4LJ8 A;  3VK8 A;  4GKJ M;  4FCW A;  2X8A A;  2F4V M;  3VKH A;  2LXE A;  5EQT A;  3T1Y M;  4L8R C;  5LMU M;  3A45 A;  4JI0 M;  1G59 A;  2NQ8 C;  3WHL A;  3C58 A;  5KQD A;  4ZPX A;  1Q39 A;  4D81 A;  2LWX A;  4D80 A;  1Q3C A;  3SFZ A;  1DGH B;  1QQW A;  3T1H M;  3HHZ A;  1Q3B A;  5KPZ A;  4HLQ A;  3JAM S;  1Z6T A;  3HJS A;  3J7B A;  3TWL A;  3WHK A;  4NRW A;  2CEA A;  4LY6 A;  2D7E A;  4GC5 A;  3GLF A;  2QP9 X;  3PFI A;  4IBK A;  3SAS A;  2G8L A;  4IBE A;  1IQP A;  1SXJ C;  4A3V B;  4NSR A;  1EE8 A;  2D7G A;  2UXB M;  3KOX E;  5GKN A;  4DV2 M;  3QAU A;  1WXQ A;  3GLH A;  4M0W A;  3GPP A;  3VFD A;  3HU1 A;  3LQQ A;  4AZF A;  1E9R A;  4EIW A;  2CV1 A;  2KW0 A;  4G4R A;  4DR7 M;  2V1U A;  2UUA M;  3U60 A;  2CE7 A;  2XFT A;  3KS4 A;  3MJ5 A;  4DV3 M;  3SAU A;  2QBY A;  5EXP A;  1QYR A;  3AOE A;  2QZ4 A;  1ORY B;  1W5S A;  4JXJ A;  3H4M A;  2CUZ A;  3OTO M;  2L7H A;  1L2C A;  4X66 M;  3GPU A;  4RNA A;  2DWM A;  3EIH A;  4IJE A;  1ZQ9 A;  1R2Z A;  3I51 A;  2UXD M;  3AL0 C;  1DGF A;  1ZAE A;  1OFI A;  3Q8X A;  3HKP A;  5ITY A;  2Q2E B;  4AG5 A;  2ZAO A;  7CAT A;  4JI8 M;  4JN6 A;  4LZJ A;  3CF0 A;  1MU5 A;  3AV0 A;  3J81 S;  4IBD A;  4DR2 M;  4M9Z A;  2Z7J A;  3DFZ A;  1K3X A;  1IXZ A;  3FD9 A;  3VDU A;  4LFB M;  4WW0 A;  2QPA A;  2LH0 A;  4JI4 M;  3GPX A;  1JQJ C;  5ITX A;  4QOS A;  1PJI A;  1NHG C;  2CHG A;  4REZ A;  3GQ4 A;  3KS8 A;  1NJG A;  2BJW A;  2X4A A;  2DHR A;  3KVW A;  2XSZ D;  1HT1 E;  2V1C A;  5F3W A;  3UK6 A;  5ITQ A;  4DR4 M;  4LF8 M;  3M7G A;  3FUT A;  3PNY A;  3A46 A;  3GLG A;  5EXS A;  1D2N A;  5JI3 E;  2QEN A;  4NXM M;  1GL7 A;  1L2D A;  3ZC7 B;  2O5R A;  3B9P A;  3TWM A;  1XNR M;  4JV5 M;  5KO3 A;  4JI6 M;  2H1R A;  2UUC M;  4LCB A;  5EJC A;  1N32 M;  4P16 A;  2Y21 A;  4KLN A;  1J5E M;  4M9X A;  2DZO B;  2E5L M;  4TUW A;  4Z8X A;  2XH9 A;  4KOD A;  2XZF A;  3HU3 A;  3D8B A;  3HHW A;  3ZH9 B;  4DV0 M;  4GKK M;  2F5P A;  2F5N A;  2C99 A;  3TWK A;  3KOW E;  1MX0 A;  1K3W A;  2J7N A;  1IXS B;  1TDH A;  3SAV A;  4OVZ A;  4IBJ A;  3J2P B;  1XWI A;  3HWS A;  1G4A E;  4BB9 A;  2HKJ A;  5LMN M;  4OU7 A;  5FTM A;  5ITU A;  4IBG A;  1E94 E;  3HU2 A;  1IN4 A;  1IY1 A;  4FWH A;  2ZM6 M;  3VDP A;  3GLF B;  3FKE A;  1HQY E;  3GPY A;  4QOZ C;  5E26 A;  1S3S A;  1JR3 A;  1N34 M;  1KSF X;  3HGI A;  4X62 M;  4DV6 M;  5KQ8 A;  1J7K A;  1N36 M;  2RKO A;  5FLX S;  1OJL A;  3KXE C;  3U61 A;  1DO0 A;  1GLN A;  3FUU A;  3GLH B;  1IXR C;  5FSW A;  1QAQ A;  1JR3 D;  3U6P A;  3LQR A;  2UUB M;  1C1K A;  3GRR A;  3RGP A;  1KFV A;  2ZAN A;  4DUZ M;  2XZU A;  3U60 B;  4FW9 A;  4AKH A;  1IY0 A;  3DOA A;  3AFH A;  1NY6 A;  1NSF A;  2ZAM A;  2XGN A;  4DV4 M;  4G4N A;  1K82 A;  3NBI A;  4GH9 A;  5ITX E;  4IBI A;  5DYG A;  2Y0T A;  3L29 A;  5H37 D;  1HR0 M;  3GP1 A;  3E9S A;  3KP1 E;  3U6L A;  5FTJ A;  5EP3 A;  4BLC A;  4K0K M;  1GL6 A;  4YHH M;  4AQY M;  1L1Z A;  4LF9 M;  4LJA A;  3LVV A;  4LRT A;  4DUY M;  3HJ8 A;  1QZM A;  1IN8 A;  3U5Z A;  1SXJ A;  2DWL A;  3IG5 A;  4I81 A;  3MK6 A;  2KA6 B;  4GIT A;  2HL7 A;  5EP2 A;  1GVN A;  1TGU A;  4B3T M;  4NXN M;  4JI7 M;  2ZBK B;  3UMM A;  3IG8 A;  5C1B A;  5FTL A;  3HHY A;  1E9S A;  2FFJ A;  2X49 A;  5IT9 S;  4DV1 M;  2L6O A;  3R8F A;  2KEB A;  3J27 B;  1TH3 A;  3GLG B;  1N78 A;  4MGH A;  4LJ6 A;  3W0F A;  3ZCB B;  4PDI A;  4GRI A;  2DXI A;  3RE8 A;  3KOY E;  4OX9 M;  1L1T A;  4DV5 M;  2R4E A;  1R2Y A;  1J09 A;  4MH0 E;  2L09 A;  5C18 A;  4G4O A;  2DWN A;  2C9C A;  4L16 A;  2RGO A;  3U6C A;  2F5Q A;  1IN5 A;  2QCU A;  3D8L A;  3CF2 A;  3J80 S;  1IM2 A;  3KOZ E;  1YSY A;  1HNX M;  4OVZ B;  8CAT A;  5JI2 E;  2AHM A;  2F5O A;  1IY2 A;  3UGJ A;  3SAR A;  3HJQ A;  3UJN A;  2KXE A;  3FUV A;  3KSJ A;  1W5T A;  2CFO A;  2FOI C;  5EXX A;  2KRK A;  4B3R M;  2R18 A;  3U6E A;  1HNZ M;  3VLF B;  3SC3 A;  1E32 A;  3A42 A;  4X65 M;  4PT5 A;  3K8Z A;  1H6U A;  1KYI A;  2BJV A;  4X64 M;  3AOG A;  2YQZ A;  2M60 A;  4ITQ A;  2HHH M;  2OPF A;  3R9X B;  1NNJ A;  2C9O A;  3FTC A;  1L8Q A;  3NWL A;  4XGI A;  3A98 B;  3GQ3 A;  4GMQ A;  1T3T A;  1R6B X;  3U61 B;  3CF6 E;  4LJ4 A;  1NY5 A;  3SHG B;  2XFS A;  1TH4 A;  5IWA M;  4LF6 M;  1IN7 A;  2XF3 A;  2Z4R A;  3LVW A;  4G6Z A;  4IIW A;  3U6M A;  4I5S A;  1Z5C A;  3SAT A;  4RF0 A;  3DZD A;  1QAO A;  1DGB A;  4PDG A;  3GLI A;  2M5Z A;  4NRV A;  1XMQ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...