4NXNM

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin resistance
rcsb
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nxnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4nxnM02
3VK8A 3OTOM 4KHPM 4JI5M 1HNWM 4X62M 3SATA 2XZUA 2F5PA 4B3SM 4B3TM 5LMNM 3GPUA 4DR4M 1KFVA 1NNJA 1HR0M 4LF6M 5ITYA 3SAVA 2XZFA 4X64M 1XNQM 4PDIA 4LF5M 4K0KM 4DV7M 4DR3M 3JAMS 1Z5CA 1PJJA 4DV4M 4JI8M 4LF8M 4X65M 3GQ4A 3T1HM 2UXCM 5ITXE 4LF4M 5ITTA 3SARA 2UUAM 4G4NA 4DR6M 5IT9S 4NXMM 3U6LA 4DV6M 3GPYA 1MX0A 3JR4A 4JI4M 4DR7M 2UXDM 1R2YA 3C58A 3A45A 3SAUA 4NRVA 1R2ZA 3U6SA 1Q3CA 3GO8A 4DR1M 3J7AS 3U6MA 3SBJA 2F5QA 5ITUA 1FJGM 1N32M 2VQEM 1Z59A 1HNXM 3SASA 4X66M 4GKJM 1K3WA 1Q3BA 4G4RA 3U6OA 4JI2M 4JI6M 1IBKM 5FLXS 3GQ3A 2EA0A 1L1ZA 1Z5AA 3J81S 3JR5A 4LFBM 1N36M 4NRWA 2ZM6M 4JV5M 2F5NA 3U6QA 2Q2EB 1TDZA 4JI3M 3W0FA 4LFAM 2UUBM 1XC8A 3J80S 1J5EM 1N34M 4JI0M 1TDHA 1XMOM 3A42A 3TWKA 4YY3M 4JI1M 3U6CA 2UXBM 4DV2M 4JYAM 3T1YM 5LMUM 1EE8A 3U6EA 2UU9M 1Z5BA 3VK7A 1L2CA 4DV5M 2F5SA 4CISA 4NXNM 1MU5A 4PD2A 3U6PA 1I94M 4LFCM 2OPFA 1L2BA 4DR5M 4B3RM 4DUYM 1XMQM 4JI7M 4LF7M 3GPPA 1K3XA 5A2QS 4DR2M 3GP1A 5BR8M 1PJIA 5IWAM 4PDGA 3GPXA 3A46A 3TWMA 4AQYM 2F5OA 2HKJA 4DV3M 5ITRA 4MB7A 1K82A 1L1TA 1HNZM 2UUCM 4OX9M 1IBMM 3TWLA 4YHHM 2OQ4A 1IBLM 4DUZM 1Q39A 2VQFM 3SAWA 1N33M 2ZBKB 3DOAA 4LF9M 4PCZA 3U6DA 2E5LM 5ITXA 2F4VM 4B3MM 3GQ5A 1L2DA 2HHHM 1XNRM 4GKKM 4G4QA 4ITQA 4DV1M 4G4OA 1PM5A 5ITQA 4DV0M
chains in the Genus database with same CATH superfamily
2A5YB 4M9XA 1A5TA 3AV0A 3VK8A 4X62M 1R4GA 2Y21A 3AJIB 4MGZE 3UMMA 2XLJA 4LY6A 3TPZA 3U61A 2CHVA 1KFVA 1NNJA 2O01F 1BVSA 4IBIA 1HR0M 4LF6M 3GRYA 3HZJA 3SAVA 4S12A 4X64M 3HHXA 4KT0F 3RGSA 3SHGB 3FYDA 3FD9A 5IZ7D 4DR3M 2XF3A 3C3EA 2JY7A 2DZNB 2DNAA 1IXRC 1N75A 4MGKE 1NSFA 4AG6A 2KNZA 3SHFA 4NXMM 2LHCA 1QZEA 3BOSA 4NSRA 3A45A 3H4MA 1DGBA 2L7HA 4GHAA 4GC5A 5EJCA 2GNOA 3UJNA 1FNNA 2MGWA 3KDSE 1R2ZA 4DR1M 2JP7A 3J7AS 2F5QA 2FOIC 2DWZB 2LWXA 2VQEM 3FE3A 3U60A 2M5ZA 3SASA 4GKJM 3MMPA 1IXSA 2O25A 5KQ8A 1K3WA 4IJEA 2FS1A 1TTEA 4LGYA 4BB9A 4KO8A 3MHVC 1I4WA 1G8PA 2DHYA 1CUKA 1N77A 4M9ZA 4M0DA 3HY5A 4LFBM 3K1JA 4JV5M 1YE9A 2X49A 2C98A 4MGHA 4FD2A 4IBJA 1TDZA 4EIWA 1OQYA 3FKEA 3W0FA 2KNAA 3QWLA 1NNUC 3TQSA 2QBYB 1GO5A 4LRTA 2RGOA 1ORYB 4LZJA 2KDLA 2KRUA 2L4FA 2XFTA 3IG8A 1C1KA 5EQTA 4DBGB 2CV1A 1OIZA 1KSFX 1PJQA 1QAQA 1TDHA 2L09A 3E9SA 3T6PA 1GABA 1VDDA 2LNHC 3H4JA 3HWSA 4AKHA 1T3TA 2KRKA 1GL6A 4LJAA 3GLFE 3E46A 1NJFA 4ZPXA 1YUBA 3HJQA 1EE8A 5FSWA 4MM3B 4KHPM 4FCWA 3UZUA 3FTEA 4GRIA 2K0BX 1R7RA 1JQJC 2KXEA 2LVQD 2OOBA 2XSZD 5FTKA 4CHTB 4PD2A 1L2CA 2MR9A 4HLQA 4OU7A 3B9PA 2CUZA 1NJGA 2LVOC 1OKSA 3FTFA 3CF6E 2HL7A 1NV9A 2LVPC 5EXSA 3HJ8A 3ZC7B 2Z7JA 1LV7A 1NHWC 4NSOB 1K3XA 4I4LA 2LVAA 3VDUA 3CTWB 2KZUA 3HU3A 3FYCA 2KW0A 3U5ZB 3TWMA 4AQYM 2DI0A 3FRIA 4REZA 2HKJA 1K82A 3GLHA 1RU3A 4IBFA 2K6BA 4FWGA 2UUCM 1TH2A 2FFJA 4YHHM 2OQ4A 3GLIE 2R4EA 2VQFM 1ZAEA 4HEOA 3B7NA 1GLNA 2KA6B 3AOEC 1W5TA 3U6DA 3LVVA 1VQ1A 2R46A 1PJSA 3M6AA 2F4VM 1SXJC 1XNRM 4ITQA 2C96A 2CRUA 4LFCM 3I4VA 4FW9A 3RE8A 5ITTA 1ZMVA 2ZANA 2DVWB 3KP1E 3OTOM 4JI5M 2J5YA 3HGIA 4LJ4A 2XZUA 3B74A 1ZQ9A 5FTMA 2EUCA 4I5SA 2X4AA 2R4JA 4AW4A 4RF0A 2DWLA 5JI3E 3SMSA 5JI2E 1DV0A 4PDIA 1V92A 4LRSA 4K0KM 1XXHE 3F92A 4FVMA 3L28A 3L29A 4Z6YA 1Z5CA 1GJSA 3J7BA 4LF8M 4X65M 2R62A 3B7QA 1VEJA 3GQ4A 5ITXE 3T1HM 2UXCM 1IQPA 1IY0A 1QVRA 4Y28F 1MN3A 1HNWM 2R0IA 4L16A 1L8QA 1SG9A 2H1RA 3W68A 2EJSA 3KS4A 1VEKA 3AKZA 4LJ7A 3JR4A 4JI4M 3T38A 1OTRA 4L78A 3VKHA 2BWBA 3C58A 2LXEA 3B7ZA 4R71A 4QOZC 1WR1B 2CFOA 5KPRA 3U6SA 3TE6A 3ILKA 3U6MA 3L26A 2XFSA 5ITUA 2RGHA 1QAOA 4IBBA 1NVMA 1SXJE 3LW5F 2QZ4A 3KOWE 1DO0A 3W67A 1IBKM 3SMPA 3FUVA 2EA0A 2BWEA 4GMQA 3JR5A 1OAIA 2R18A 2QHOB 2ZM6M 1D0LA 2F5NA 3GLIA 1NO1A 2RKOA 3U6QA 4JI3M 4W5WA 3L2AA 2JUJA 1R6BX 3KOZE 2UUBM 5GKNA 4G6ZA 5BPVA 3KW6A 3J80S 5KQDA 2W82A 3HHZA 2DZOB 2ZAOA 4QHTA 2HCBA 1WJ7A 4AG5A 5EP3A 3THGA 1QANA 1XMOM 3TWKA 3QAUA 1PGYA 8CATA 2YNMD 4JI1M 2UXBM 2DENA 3GLFB 3RFWA 1Z6TA 3FUUA 5LMUM 1TH4A 3EIEA 4LJ8A 2KZSA 2C9CA 1GJTA 5IREB 1Z5BA 1IXSB 1E94E 2F5SA 4IBDA 4NXNM 1ZMWA 4BLCA 3U6PA 2FNAA 4NC6A 1I94M 2Y0TA 4L8RC 2QPAA 4RF1A 2OPFA 1L2BA 3ZQJA 4QOSA 4DR5M 2QSFX 4LF7M 3DZDA 1S3SA 1LTMA 2C5RA 5L8RF 1NHGC 1SXJB 2CHGA 3A98B 1E32A 3PNVA 1T43A 4XGIA 4DR2M 3AFHA 2K9DA 4XBOA 1QDTA 3GPXA 3A46A 2Y20A 4AKGA 3M7GA 4MB7A 4MGIE 1L1TA 4I81A 1IBMM 1P3QQ 3TWLA 2JY6B 4WW0A 1QZMA 2GQFA 1Q39A 3AL0C 1OAOC 4R3DA 3DOAA 3HKPA 2O5RA 2E5LM 2EKFA 2MJ5B 3C3DA 2Z3XA 3FRHA 4G3OA 2V1UA 5H37D 2JY8A 4AZFA 3GQ5A 2HHHM 2L4EA 1DGFA 2LTUA 2DWNA 1X37A 1PM5A 3I04M 3IHPA 4DV0M 3BBZA 2L2DA 2EKKA 4IBGA 2BNKA 5DYIA 3SATA 2F5PA 4B3SM 5C1BA 5LMNM 3GPUA 3NBXX 2B3TA 1PJTA 3MJ5A 4MH0E 1QAMA 3KSXA 1TR8A 1G41A 4LJ6A 2XZFA 4LG2A 2BJVA 1HQYE 2KNVA 2LHGA 2XEPA 3KSJA 4A3VB 1GVNA 4DV7M 1VEGA 2HAKA 4UN2B 4JI8M 4DV4M 4TUWA 2DKLA 1XB2B 3PXGA 4NL4H 2P5TA 4II7A 1XXHA 3PVSA 3SARA 4RKUF 2UUAM 3VFDA 2R6FA 3D8BA 3QYBA 3PFIA 5KO3A 4G4NA 1DGGA 4WURA 2CV2A 1IN8A 5IT9S 2FH0A 1WIVA 1WHCA 1IN6A 3IG5A 1XWIA 3U6LA 1V34A 4DV6M 3GPYA 2Y0QA 4GC9A 5E26A 1R2YA 4JXJA 2JY5A 3RGPA 4GH9A 2N35A 3J27B 2RRUA 2Z4SA 2ZAMA 2DAGA 1G59A 2DAKA 3LVWA 4IJFA 4L4UA 4QNRA 1ZV1A 1Q3CA 3GO8A 1N32M 5EP2A 2WZJA 4F1IA 4GITA 2X8AA 3LQQA 1Y8GA 2QCUA 5EXPA 2CEAA 3NWLA 1OJLA 4X66M 3BXWA 1YLAA 3AOEA 4GEWA 1Q3BA 3E4RA 3VKGA 3U6OA 2CHQA 3GLFA 4JI6M 3K2LA 1JR3A 3GQ3A 1L1ZA 1Z5AA 3J81S 2QNJA 2CP8A 1N36M 3KXEC 3PNYA 5DFLA 2CE7A 5FTNA 2Q2EB 3AOGA 1HT2E 1R5LA 3GLGE 2C99A 3CGWA 4L6V6 4I8OA 3NBIA 1J5EM 4KLNA 1N34M 1TH3A 4B08A 2BJWA 2OO9A 1NY5A 4FCVA 4JI0M 3FUWA 1NY6A 1VG5A 2LH0A 1E9RA 4YY3M 3U6CA 1DGHA 2XGNA 2MH8A 4DV2M 4IBCA 1HT1E 2QBYA 3T1YM 4JYAM 2DZLA 1F4IA 3CF0A 4AI6A 1D0MA 5EXXA 2L7IA 3U6EA 1H6UA 2JXNA 3UK6A 2UU9M 4FWDA 4NOOB 4CISA 4DV5M 1MU5A 2VDBB 3SYLA 5FTJA 4M9SA 3KOYE 2YQZA 1TF0B 4D80A 5DNYA 3FTDA 3R9XB 2ZTCA 1V33A 3B89A 3Q8GA 4B7GA 3FTCA 3QYEA 4DUYM 4B3RM 3KP0E 3FUXA 3KVWA 3VDPA 2M60A 2FE8A 4JN6A 5C18A 5A2QS 4LJ5A 5KPZA 2WSFF 2R65A 3LQRA 1HQCA 2VF8A 3HJSA 3K8ZA 4HL4A 2CV0A 2XSZA 4WP2A 3K9OA 3ZH9B 2YFQA 5ITRA 1IN5A 2NQ8C 4DV3M 1HNZM 4OX9M 2ZTDA 4DUZM 3SAWA 1N33M 1OFIA 1SXJD 1NV8A 4M0WA 2ZBKB 5DYGA 3DFZA 4LF9M 2KEBA 1GL7A 1OIPA 1QDRA 4IBEA 5ITXA 3LMMA 1HJPA 4GKKM 4G4QA 2G3QA 4DV1M 1IN7A 4G4OA 3I01M 2CWBA 4QHSA 4ANRA 1MJGM 3C9PA 4B7FA 2H5XA 1W5SA 2JZ0A 4R7GA 5EP4A 3HHYA 1G4AE 3V76A 3SFZA 4B3TM 3DA1A 2Z4RA 2Z8YM 2I7PA 4DR4M 1JR3E 3K9PA 2V1CA 4PT5A 5ITYA 3WHKA 3EIHA 1JR3D 1EFUB 1XNQM 1IY2A 2OOAA 2QENA 2VIIA 4LF5M 1N78A 3E21A 4P16A 4GHLA 3T15A 3LCUA 1PJJA 3HU2A 4D81A 3JAMS 5KPTA 3HU1A 2DHRA 4LF4M 1QYRA 1UFZA 2APLA 1DGHB 2JA2A 3UGJA 1Q02A 3U5ZA 3U60B 1QUTA 4DR6M 3KFUG 2HWJA 3WHLA 2WSCF 2MROB 1MX0A 3FUTA 1KYIA 3L27A 4DR7M 2UXDM 2DAEA 1E9SA 3M0EA 2LBCA 5FTLA 1UM8A 4LCBA 3KS8A 3SAUA 4NRVA 2AHMA 2KHHA 3GRUA 2C9OA 3GRVA 3SBJA 2LVNC 2ERCA 1FJGM 1G71A 2I7NA 2J7OA 3LCVB 7CATA 1Z59A 2DXIA 1HNXM 1IY1A 1T6OA 2JWSA 2WSEF 4OVZA 1IFYA 2VF7A 4LGMA 4G4RA 4AKIA 4JI2M 3IECA 4CGYB 5FLXS 2K47A 3GLHB 2EO2A 3Q8XA 2R45A 4LJ9A 3VLFB 2L6OA 1J7KA 5E6JA 3SYKA 3K92A 1WGLA 4NRWA 1IXZA 5F3WA 1IM2A 2D7EA 3U61B 1IN4A 4LFAM 1VDLA 1SXJA 4D82A 1XC8A 4P17A 3J2PB 1YSYA 3TL4X 1C7YA 1D2NA 5EP1A 3HX3A 1XHBA 3A42A 3SC3A 4CIZA 2J7NA 4IBKA 1QQWA 1EIJA 1XXHB 2JZ1A 4RNAA 4OW0A 2XH9A 3VK7A 2V6ZM 1ZMUA 1AUAA 4F2LA 3GLGB 1WGNA 4B7HA 2DAMA 3R8FA 1G3IA 2DAIA 3GLHE 4LZZA 1XMQM 3GRRA 3D8LA 3HHWA 1WXQA 4IIWA 2JNHA 4FCTA 4JI7M 4GIPA 2R44A 3GPPA 5EXTA 3MK6A 4L15A 3GP1A 3GLIB 5BR8M 1PJIA 2QQ8A 3KOXE 3CF2A 4MGYE 4PDGA 5IWAM 2G8LA 4XK8F 2F5OA 2D7HA 2D7GA 2G5GX 1AIPC 2YR0A 2DWMA 1PRBA 1TGUA 4KODA 3W0LB 1IBLM 3GLGA 3I4YA 2QP9X 1DO2A 3L25A 4Q7JA 1OFHA 4PCZA 1J09A 3ZCBB 4BBAA 1D0KA 1GKIA 4OVZB 4CJ6A 1QUSA 4B3MM 1L2DA 3I51A 4FWHA 1JB0F 4QNMA 5ITQA 4Z8XA
chains in the Genus database with same CATH topology
2A5YB 4M9XA 3AV0A 3VK8A 4X62M 2Y21A 3AJIB 4MGZE 3UMMA 2XLJA 4LY6A 3TPZA 3U61A 2CHVA 1KFVA 1NNJA 1HR0M 4IBIA 4LF6M 3GRYA 3SAVA 4S12A 4X64M 3HHXA 3RGSA 3SHGB 3FYDA 3FD9A 5IZ7D 4DR3M 2XF3A 2DZNB 1IXRC 1N75A 4MGKE 1NSFA 4AG6A 3SHFA 4NXMM 3BOSA 4NSRA 3A45A 3H4MA 1DGBA 2L7HA 4GHAA 4GC5A 5EJCA 3UJNA 1FNNA 1R2ZA 3KDSE 4DR1M 3J7AS 2F5QA 2FOIC 2DWZB 2LWXA 2VQEM 3U60A 2M5ZA 3SASA 4GKJM 5KQ8A 1K3WA 4IJEA 4BB9A 4LGYA 4KO8A 3MHVC 1I4WA 1G8PA 1N77A 4M9ZA 4M0DA 4LFBM 3K1JA 4JV5M 1YE9A 2X49A 2C98A 4MGHA 4FD2A 4IBJA 1TDZA 4EIWA 3FKEA 3W0FA 3QWLA 2QBYB 1NNUC 3TQSA 4LRTA 2RGOA 1ORYB 4LZJA 2KRUA 2XFTA 5EQTA 3IG8A 1C1KA 2CV1A 1KSFX 1QAQA 1TDHA 2L09A 3E9SA 1VDDA 2LNHC 3HWSA 4AKHA 1T3TA 2KRKA 1GL6A 4LJAA 1NJFA 4ZPXA 1YUBA 3HJQA 1EE8A 5FSWA 4MM3B 4FCWA 3UZUA 3FTEA 4GRIA 1R7RA 1JQJC 2KXEA 2XSZD 5FTKA 4CHTB 1L2CA 4PD2A 4HLQA 4OU7A 3B9PA 2CUZA 1NJGA 3FTFA 3CF6E 2HL7A 5EXSA 3HJ8A 3ZC7B 2Z7JA 1LV7A 1NHWC 4NSOB 1K3XA 4I4LA 3VDUA 3CTWB 2KZUA 3HU3A 3FYCA 2KW0A 3U5ZB 3TWMA 4AQYM 4REZA 2HKJA 1K82A 3GLHA 2UUCM 4IBFA 4FWGA 1TH2A 2FFJA 4YHHM 2OQ4A 2R4EA 2VQFM 1ZAEA 1GLNA 2KA6B 3AOEC 1W5TA 3U6DA 3LVVA 2R46A 3M6AA 2F4VM 1SXJC 1XNRM 4ITQA 2C96A 4LFCM 3I4VA 4FW9A 3RE8A 5ITTA 2ZANA 2DVWB 3KP1E 3OTOM 4JI5M 3HGIA 4LJ4A 2XZUA 1ZQ9A 5FTMA 2EUCA 4I5SA 2X4AA 2R4JA 4AW4A 4RF0A 2DWLA 5JI3E 3SMSA 5JI2E 4PDIA 4LRSA 4K0KM 4FVMA 3L28A 3L29A 4Z6YA 1Z5CA 3J7BA 4LF8M 4X65M 2R62A 3GQ4A 3T1HM 2UXCM 5ITXE 1IQPA 1IY0A 1QVRA 4L16A 1L8QA 2H1RA 3KS4A 3AKZA 4LJ7A 3JR4A 4JI4M 3T38A 4L78A 3VKHA 3C58A 2LXEA 4QOZC 2CFOA 5KPRA 3U6SA 3TE6A 3ILKA 3U6MA 3L26A 2XFSA 5ITUA 2RGHA 1QAOA 4IBBA 1NVMA 1SXJE 2QZ4A 3KOWE 1DO0A 1IBKM 3SMPA 3FUVA 2EA0A 4GMQA 3JR5A 2R18A 2ZM6M 2F5NA 3GLIA 2RKOA 3U6QA 4JI3M 4W5WA 3L2AA 1R6BX 3KOZE 2UUBM 5GKNA 4G6ZA 5BPVA 3KW6A 3J80S 5KQDA 2W82A 3HHZA 2DZOB 2ZAOA 4QHTA 2HCBA 4AG5A 5EP3A 3THGA 1QANA 1XMOM 3TWKA 3QAUA 8CATA 4JI1M 2YNMD 2UXBM 3GLFB 3RFWA 1Z6TA 3FUUA 5LMUM 1TH4A 3EIEA 4LJ8A 2KZSA 2C9CA 5IREB 1Z5BA 1IXSB 1E94E 2F5SA 4IBDA 4NXNM 4BLCA 3U6PA 2FNAA 1I94M 2Y0TA 4L8RC 2QPAA 4RF1A 2OPFA 1L2BA 4QOSA 4DR5M 4LF7M 3DZDA 1S3SA 2C5RA 1NHGC 1SXJB 2CHGA 3A98B 1E32A 3PNVA 4XGIA 4DR2M 3AFHA 4XBOA 3GPXA 3A46A 2Y20A 4AKGA 3M7GA 4MB7A 4MGIE 1L1TA 4I81A 1IBMM 3TWLA 4WW0A 1QZMA 1Q39A 3AL0C 4R3DA 3DOAA 3HKPA 2O5RA 2E5LM 2Z3XA 2V1UA 5H37D 3GQ5A 4AZFA 2HHHM 1DGFA 2DWNA 1X37A 1PM5A 4DV0M 4IBGA 2BNKA 5DYIA 3SATA 2F5PA 4B3SM 5C1BA 5LMNM 3GPUA 3MJ5A 4MH0E 1QAMA 3KSXA 1G41A 4LJ6A 2XZFA 4LG2A 2BJVA 1HQYE 2XEPA 3KSJA 4A3VB 1GVNA 4DV7M 4JI8M 4DV4M 4TUWA 3PXGA 4NL4H 2P5TA 4II7A 1XXHA 3PVSA 3SARA 2UUAM 3VFDA 3D8BA 5KO3A 4G4NA 3PFIA 2CV2A 1DGGA 4WURA 1IN8A 5IT9S 1IN6A 3IG5A 1XWIA 3U6LA 4DV6M 3GPYA 2Y0QA 4GC9A 5E26A 1R2YA 4JXJA 3RGPA 4GH9A 3J27B 2Z4SA 1G59A 2ZAMA 3LVWA 4IJFA 4L4UA 4QNRA 1Q3CA 3GO8A 1N32M 5EP2A 4GITA 2X8AA 3LQQA 2QCUA 5EXPA 2CEAA 3NWLA 1OJLA 4X66M 3AOEA 1Q3BA 3E4RA 3VKGA 3U6OA 2CHQA 3GLFA 4JI6M 3K2LA 1JR3A 3GQ3A 1L1ZA 1Z5AA 3J81S 1N36M 3KXEC 3PNYA 2CE7A 5FTNA 2Q2EB 3AOGA 1HT2E 2C99A 4I8OA 3NBIA 1J5EM 4KLNA 1N34M 1TH3A 4B08A 2BJWA 4JI0M 1NY5A 4FCVA 3FUWA 1NY6A 2LH0A 4YY3M 1E9RA 3U6CA 1DGHA 2XGNA 2QBYA 4DV2M 4IBCA 1HT1E 4JYAM 3T1YM 4AI6A 3CF0A 5EXXA 2L7IA 3U6EA 1H6UA 3UK6A 2UU9M 4FWDA 4NOOB 4CISA 4DV5M 1MU5A 3SYLA 5FTJA 4M9SA 3KOYE 2YQZA 4D80A 5DNYA 3FTDA 3R9XB 4B7GA 3FTCA 4B3RM 4DUYM 3KP0E 3FUXA 3KVWA 3VDPA 2M60A 2FE8A 4JN6A 5C18A 5A2QS 4LJ5A 5KPZA 2R65A 3LQRA 1HQCA 3HJSA 3K8ZA 4HL4A 2CV0A 2XSZA 3ZH9B 5ITRA 4DV3M 2YFQA 1HNZM 1IN5A 2NQ8C 4OX9M 4DUZM 3SAWA 1N33M 1OFIA 1SXJD 4M0WA 2ZBKB 5DYGA 3DFZA 4LF9M 2KEBA 1GL7A 4IBEA 5ITXA 3LMMA 4GKKM 4G4QA 4DV1M 1IN7A 4G4OA 4QHSA 4B7FA 4KHPM 1HNWM 1W5SA 5EP4A 4R7GA 3HHYA 1G4AE 3SFZA 4B3TM 3DA1A 2Z4RA 2I7PA 4DR4M 2V1CA 4PT5A 5ITYA 3WHKA 3EIHA 1JR3D 1XNQM 1IY2A 2QENA 2VIIA 4LF5M 1N78A 4P16A 4GHLA 3T15A 1PJJA 3HU2A 4D81A 3JAMS 5KPTA 3HU1A 2DHRA 4LF4M 1QYRA 2JA2A 1DGHB 3UGJA 3U5ZA 3U60B 4DR6M 3KFUG 3WHLA 1MX0A 3FUTA 1KYIA 3L27A 4DR7M 2UXDM 1E9SA 3M0EA 5FTLA 1UM8A 4LCBA 3KS8A 3SAUA 4NRVA 2AHMA 3GRUA 2C9OA 3GRVA 3SBJA 1FJGM 2ERCA 2I7NA 2J7OA 7CATA 1Z59A 2DXIA 1HNXM 1IY1A 4OVZA 4LGMA 4G4RA 4AKIA 4JI2M 4CGYB 5FLXS 2K47A 3GLHB 2EO2A 3Q8XA 2R45A 4LJ9A 3VLFB 2L6OA 1J7KA 5E6JA 3SYKA 3K92A 4NRWA 1IXZA 5F3WA 1IM2A 2D7EA 3U61B 1IN4A 4LFAM 1SXJA 4D82A 1XC8A 3J2PB 1YSYA 3TL4X 1D2NA 5EP1A 1XHBA 3A42A 3SC3A 2J7NA 4IBKA 1QQWA 1XXHB 4RNAA 4OW0A 2XH9A 3VK7A 2V6ZM 3GLGB 4B7HA 3R8FA 1G3IA 4LZZA 1XMQM 3GRRA 3D8LA 3HHWA 1WXQA 4IIWA 4FCTA 4JI7M 4GIPA 3GPPA 5EXTA 3MK6A 4L15A 3GP1A 3GLIB 5BR8M 1PJIA 5IWAM 3KOXE 3CF2A 4MGYE 4PDGA 2G8LA 2F5OA 2D7HA 2D7GA 2G5GX 2YR0A 2DWMA 1TGUA 4KODA 3W0LB 1IBLM 3GLGA 3I4YA 2QP9X 1DO2A 3L25A 1OFHA 4PCZA 1J09A 3ZCBB 4BBAA 1GKIA 4OVZB 4B3MM 1L2DA 3I51A 4FWHA 4QNMA 5ITQA 4Z8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VK8 A;  3OTO M;  4KHP M;  4JI5 M;  1HNW M;  4X62 M;  3SAT A;  2XZU A;  2F5P A;  4B3S M;  4B3T M;  5LMN M;  3GPU A;  4DR4 M;  1KFV A;  1NNJ A;  1HR0 M;  4LF6 M;  5ITY A;  3SAV A;  2XZF A;  4X64 M;  1XNQ M;  4PDI A;  4LF5 M;  4K0K M;  4DV7 M;  4DR3 M;  3JAM S;  1Z5C A;  1PJJ A;  4DV4 M;  4JI8 M;  4LF8 M;  4X65 M;  3GQ4 A;  3T1H M;  2UXC M;  5ITX E;  4LF4 M;  5ITT A;  3SAR A;  2UUA M;  4G4N A;  4DR6 M;  5IT9 S;  4NXM M;  3U6L A;  4DV6 M;  3GPY A;  1MX0 A;  3JR4 A;  4JI4 M;  4DR7 M;  2UXD M;  1R2Y A;  3C58 A;  3A45 A;  3SAU A;  4NRV A;  1R2Z A;  3U6S A;  1Q3C A;  3GO8 A;  4DR1 M;  3J7A S;  3U6M A;  3SBJ A;  2F5Q A;  5ITU A;  1FJG M;  1N32 M;  2VQE M;  1Z59 A;  1HNX M;  3SAS A;  4X66 M;  4GKJ M;  1K3W A;  1Q3B A;  4G4R A;  3U6O A;  4JI2 M;  4JI6 M;  1IBK M;  5FLX S;  3GQ3 A;  2EA0 A;  1L1Z A;  1Z5A A;  3J81 S;  3JR5 A;  4LFB M;  1N36 M;  4NRW A;  2ZM6 M;  4JV5 M;  2F5N A;  3U6Q A;  2Q2E B;  1TDZ A;  4JI3 M;  3W0F A;  4LFA M;  2UUB M;  1XC8 A;  3J80 S;  1J5E M;  1N34 M;  4JI0 M;  1TDH A;  1XMO M;  3A42 A;  3TWK A;  4YY3 M;  4JI1 M;  3U6C A;  2UXB M;  4DV2 M;  4JYA M;  3T1Y M;  5LMU M;  1EE8 A;  3U6E A;  2UU9 M;  1Z5B A;  3VK7 A;  1L2C A;  4DV5 M;  2F5S A;  4CIS A;  4NXN M;  1MU5 A;  4PD2 A;  3U6P A;  1I94 M;  4LFC M;  2OPF A;  1L2B A;  4DR5 M;  4B3R M;  4DUY M;  1XMQ M;  4JI7 M;  4LF7 M;  3GPP A;  1K3X A;  5A2Q S;  4DR2 M;  3GP1 A;  5BR8 M;  1PJI A;  5IWA M;  4PDG A;  3GPX A;  3A46 A;  3TWM A;  4AQY M;  2F5O A;  2HKJ A;  4DV3 M;  5ITR A;  4MB7 A;  1K82 A;  1L1T A;  1HNZ M;  2UUC M;  4OX9 M;  1IBM M;  3TWL A;  4YHH M;  2OQ4 A;  1IBL M;  4DUZ M;  1Q39 A;  2VQF M;  3SAW A;  1N33 M;  2ZBK B;  3DOA A;  4LF9 M;  4PCZ A;  3U6D A;  2E5L M;  5ITX A;  2F4V M;  4B3M M;  3GQ5 A;  1L2D A;  2HHH M;  1XNR M;  4GKK M;  4G4Q A;  4ITQ A;  4DV1 M;  4G4O A;  1PM5 A;  5ITQ A;  4DV0 M; 
#chains in the Genus database with same CATH topology
 2A5Y B;  4M9X A;  1A5T A;  3AV0 A;  3VK8 A;  4X62 M;  1R4G A;  2Y21 A;  3AJI B;  4MGZ E;  3UMM A;  2XLJ A;  4LY6 A;  3TPZ A;  3U61 A;  2CHV A;  1KFV A;  1NNJ A;  2O01 F;  1BVS A;  4IBI A;  1HR0 M;  4LF6 M;  3GRY A;  3HZJ A;  3SAV A;  4S12 A;  4X64 M;  3HHX A;  4KT0 F;  3RGS A;  3SHG B;  3FYD A;  3FD9 A;  5IZ7 D;  4DR3 M;  2XF3 A;  3C3E A;  2JY7 A;  2DZN B;  2DNA A;  1IXR C;  1N75 A;  4MGK E;  1NSF A;  4AG6 A;  2KNZ A;  3SHF A;  4NXM M;  2LHC A;  1QZE A;  3BOS A;  4NSR A;  3A45 A;  3H4M A;  1DGB A;  2L7H A;  4GHA A;  4GC5 A;  5EJC A;  2GNO A;  3UJN A;  1FNN A;  2MGW A;  3KDS E;  1R2Z A;  4DR1 M;  2JP7 A;  3J7A S;  2F5Q A;  2FOI C;  2DWZ B;  2LWX A;  2VQE M;  3FE3 A;  3U60 A;  2M5Z A;  3SAS A;  4GKJ M;  3MMP A;  1IXS A;  2O25 A;  5KQ8 A;  1K3W A;  4IJE A;  2FS1 A;  1TTE A;  4LGY A;  4BB9 A;  4KO8 A;  3MHV C;  1I4W A;  1G8P A;  2DHY A;  1CUK A;  1N77 A;  4M9Z A;  4M0D A;  3HY5 A;  4LFB M;  3K1J A;  4JV5 M;  1YE9 A;  2X49 A;  2C98 A;  4MGH A;  4FD2 A;  4IBJ A;  1TDZ A;  4EIW A;  1OQY A;  3FKE A;  3W0F A;  2KNA A;  3QWL A;  1NNU C;  3TQS A;  2QBY B;  1GO5 A;  4LRT A;  2RGO A;  1ORY B;  4LZJ A;  2KDL A;  2KRU A;  2L4F A;  2XFT A;  3IG8 A;  1C1K A;  5EQT A;  4DBG B;  2CV1 A;  1OIZ A;  1KSF X;  1PJQ A;  1QAQ A;  1TDH A;  2L09 A;  3E9S A;  3T6P A;  1GAB A;  1VDD A;  2LNH C;  3H4J A;  3HWS A;  4AKH A;  1T3T A;  2KRK A;  1GL6 A;  4LJA A;  3GLF E;  3E46 A;  1NJF A;  4ZPX A;  1YUB A;  3HJQ A;  1EE8 A;  5FSW A;  4MM3 B;  4KHP M;  4FCW A;  3UZU A;  3FTE A;  4GRI A;  2K0B X;  1R7R A;  1JQJ C;  2KXE A;  2LVQ D;  2OOB A;  2XSZ D;  5FTK A;  4CHT B;  4PD2 A;  1L2C A;  2MR9 A;  4HLQ A;  4OU7 A;  3B9P A;  2CUZ A;  1NJG A;  2LVO C;  1OKS A;  3FTF A;  3CF6 E;  2HL7 A;  1NV9 A;  2LVP C;  5EXS A;  3HJ8 A;  3ZC7 B;  2Z7J A;  1LV7 A;  1NHW C;  4NSO B;  1K3X A;  4I4L A;  2LVA A;  3VDU A;  3CTW B;  2KZU A;  3HU3 A;  3FYC A;  2KW0 A;  3U5Z B;  3TWM A;  4AQY M;  2DI0 A;  3FRI A;  4REZ A;  2HKJ A;  1K82 A;  3GLH A;  1RU3 A;  4IBF A;  2K6B A;  4FWG A;  2UUC M;  1TH2 A;  2FFJ A;  4YHH M;  2OQ4 A;  3GLI E;  2R4E A;  2VQF M;  1ZAE A;  4HEO A;  3B7N A;  1GLN A;  2KA6 B;  3AOE C;  1W5T A;  3U6D A;  3LVV A;  1VQ1 A;  2R46 A;  1PJS A;  3M6A A;  2F4V M;  1SXJ C;  1XNR M;  4ITQ A;  2C96 A;  2CRU A;  4LFC M;  3I4V A;  4FW9 A;  3RE8 A;  5ITT A;  1ZMV A;  2ZAN A;  2DVW B;  3KP1 E;  3OTO M;  4JI5 M;  2J5Y A;  3HGI A;  4LJ4 A;  2XZU A;  3B74 A;  1ZQ9 A;  5FTM A;  2EUC A;  4I5S A;  2X4A A;  2R4J A;  4AW4 A;  4RF0 A;  2DWL A;  5JI3 E;  3SMS A;  5JI2 E;  1DV0 A;  4PDI A;  1V92 A;  4LRS A;  4K0K M;  1XXH E;  3F92 A;  4FVM A;  3L28 A;  3L29 A;  4Z6Y A;  1Z5C A;  1GJS A;  3J7B A;  4LF8 M;  4X65 M;  2R62 A;  3B7Q A;  1VEJ A;  3GQ4 A;  5ITX E;  3T1H M;  2UXC M;  1IQP A;  1IY0 A;  1QVR A;  4Y28 F;  1MN3 A;  1HNW M;  2R0I A;  4L16 A;  1L8Q A;  1SG9 A;  2H1R A;  3W68 A;  2EJS A;  3KS4 A;  1VEK A;  3AKZ A;  4LJ7 A;  3JR4 A;  4JI4 M;  3T38 A;  1OTR A;  4L78 A;  3VKH A;  2BWB A;  3C58 A;  2LXE A;  3B7Z A;  4R71 A;  4QOZ C;  1WR1 B;  2CFO A;  5KPR A;  3U6S A;  3TE6 A;  3ILK A;  3U6M A;  3L26 A;  2XFS A;  5ITU A;  2RGH A;  1QAO A;  4IBB A;  1NVM A;  1SXJ E;  3LW5 F;  2QZ4 A;  3KOW E;  1DO0 A;  3W67 A;  1IBK M;  3SMP A;  3FUV A;  2EA0 A;  2BWE A;  4GMQ A;  3JR5 A;  1OAI A;  2R18 A;  2QHO B;  2ZM6 M;  1D0L A;  2F5N A;  3GLI A;  1NO1 A;  2RKO A;  3U6Q A;  4JI3 M;  4W5W A;  3L2A A;  2JUJ A;  1R6B X;  3KOZ E;  2UUB M;  5GKN A;  4G6Z A;  5BPV A;  3KW6 A;  3J80 S;  5KQD A;  2W82 A;  3HHZ A;  2DZO B;  2ZAO A;  4QHT A;  2HCB A;  1WJ7 A;  4AG5 A;  5EP3 A;  3THG A;  1QAN A;  1XMO M;  3TWK A;  3QAU A;  1PGY A;  8CAT A;  2YNM D;  4JI1 M;  2UXB M;  2DEN A;  3GLF B;  3RFW A;  1Z6T A;  3FUU A;  5LMU M;  1TH4 A;  3EIE A;  4LJ8 A;  2KZS A;  2C9C A;  1GJT A;  5IRE B;  1Z5B A;  1IXS B;  1E94 E;  2F5S A;  4IBD A;  4NXN M;  1ZMW A;  4BLC A;  3U6P A;  2FNA A;  4NC6 A;  1I94 M;  2Y0T A;  4L8R C;  2QPA A;  4RF1 A;  2OPF A;  1L2B A;  3ZQJ A;  4QOS A;  4DR5 M;  2QSF X;  4LF7 M;  3DZD A;  1S3S A;  1LTM A;  2C5R A;  5L8R F;  1NHG C;  1SXJ B;  2CHG A;  3A98 B;  1E32 A;  3PNV A;  1T43 A;  4XGI A;  4DR2 M;  3AFH A;  2K9D A;  4XBO A;  1QDT A;  3GPX A;  3A46 A;  2Y20 A;  4AKG A;  3M7G A;  4MB7 A;  4MGI E;  1L1T A;  4I81 A;  1IBM M;  1P3Q Q;  3TWL A;  2JY6 B;  4WW0 A;  1QZM A;  2GQF A;  1Q39 A;  3AL0 C;  1OAO C;  4R3D A;  3DOA A;  3HKP A;  2O5R A;  2E5L M;  2EKF A;  2MJ5 B;  3C3D A;  2Z3X A;  3FRH A;  4G3O A;  2V1U A;  5H37 D;  2JY8 A;  4AZF A;  3GQ5 A;  2HHH M;  2L4E A;  1DGF A;  2LTU A;  2DWN A;  1X37 A;  1PM5 A;  3I04 M;  3IHP A;  4DV0 M;  3BBZ A;  2L2D A;  2EKK A;  4IBG A;  2BNK A;  5DYI A;  3SAT A;  2F5P A;  4B3S M;  5C1B A;  5LMN M;  3GPU A;  3NBX X;  2B3T A;  1PJT A;  3MJ5 A;  4MH0 E;  1QAM A;  3KSX A;  1TR8 A;  1G41 A;  4LJ6 A;  2XZF A;  4LG2 A;  2BJV A;  1HQY E;  2KNV A;  2LHG A;  2XEP A;  3KSJ A;  4A3V B;  1GVN A;  4DV7 M;  1VEG A;  2HAK A;  4UN2 B;  4JI8 M;  4DV4 M;  4TUW A;  2DKL A;  1XB2 B;  3PXG A;  4NL4 H;  2P5T A;  4II7 A;  1XXH A;  3PVS A;  3SAR A;  4RKU F;  2UUA M;  3VFD A;  2R6F A;  3D8B A;  3QYB A;  3PFI A;  5KO3 A;  4G4N A;  1DGG A;  4WUR A;  2CV2 A;  1IN8 A;  5IT9 S;  2FH0 A;  1WIV A;  1WHC A;  1IN6 A;  3IG5 A;  1XWI A;  3U6L A;  1V34 A;  4DV6 M;  3GPY A;  2Y0Q A;  4GC9 A;  5E26 A;  1R2Y A;  4JXJ A;  2JY5 A;  3RGP A;  4GH9 A;  2N35 A;  3J27 B;  2RRU A;  2Z4S A;  2ZAM A;  2DAG A;  1G59 A;  2DAK A;  3LVW A;  4IJF A;  4L4U A;  4QNR A;  1ZV1 A;  1Q3C A;  3GO8 A;  1N32 M;  5EP2 A;  2WZJ A;  4F1I A;  4GIT A;  2X8A A;  3LQQ A;  1Y8G A;  2QCU A;  5EXP A;  2CEA A;  3NWL A;  1OJL A;  4X66 M;  3BXW A;  1YLA A;  3AOE A;  4GEW A;  1Q3B A;  3E4R A;  3VKG A;  3U6O A;  2CHQ A;  3GLF A;  4JI6 M;  3K2L A;  1JR3 A;  3GQ3 A;  1L1Z A;  1Z5A A;  3J81 S;  2QNJ A;  2CP8 A;  1N36 M;  3KXE C;  3PNY A;  5DFL A;  2CE7 A;  5FTN A;  2Q2E B;  3AOG A;  1HT2 E;  1R5L A;  3GLG E;  2C99 A;  3CGW A;  4L6V 6;  4I8O A;  3NBI A;  1J5E M;  4KLN A;  1N34 M;  1TH3 A;  4B08 A;  2BJW A;  2OO9 A;  1NY5 A;  4FCV A;  4JI0 M;  3FUW A;  1NY6 A;  1VG5 A;  2LH0 A;  1E9R A;  4YY3 M;  3U6C A;  1DGH A;  2XGN A;  2MH8 A;  4DV2 M;  4IBC A;  1HT1 E;  2QBY A;  3T1Y M;  4JYA M;  2DZL A;  1F4I A;  3CF0 A;  4AI6 A;  1D0M A;  5EXX A;  2L7I A;  3U6E A;  1H6U A;  2JXN A;  3UK6 A;  2UU9 M;  4FWD A;  4NOO B;  4CIS A;  4DV5 M;  1MU5 A;  2VDB B;  3SYL A;  5FTJ A;  4M9S A;  3KOY E;  2YQZ A;  1TF0 B;  4D80 A;  5DNY A;  3FTD A;  3R9X B;  2ZTC A;  1V33 A;  3B89 A;  3Q8G A;  4B7G A;  3FTC A;  3QYE A;  4DUY M;  4B3R M;  3KP0 E;  3FUX A;  3KVW A;  3VDP A;  2M60 A;  2FE8 A;  4JN6 A;  5C18 A;  5A2Q S;  4LJ5 A;  5KPZ A;  2WSF F;  2R65 A;  3LQR A;  1HQC A;  2VF8 A;  3HJS A;  3K8Z A;  4HL4 A;  2CV0 A;  2XSZ A;  4WP2 A;  3K9O A;  3ZH9 B;  2YFQ A;  5ITR A;  1IN5 A;  2NQ8 C;  4DV3 M;  1HNZ M;  4OX9 M;  2ZTD A;  4DUZ M;  3SAW A;  1N33 M;  1OFI A;  1SXJ D;  1NV8 A;  4M0W A;  2ZBK B;  5DYG A;  3DFZ A;  4LF9 M;  2KEB A;  1GL7 A;  1OIP A;  1QDR A;  4IBE A;  5ITX A;  3LMM A;  1HJP A;  4GKK M;  4G4Q A;  2G3Q A;  4DV1 M;  1IN7 A;  4G4O A;  3I01 M;  2CWB A;  4QHS A;  4ANR A;  1MJG M;  3C9P A;  4B7F A;  2H5X A;  1W5S A;  2JZ0 A;  4R7G A;  5EP4 A;  3HHY A;  1G4A E;  3V76 A;  3SFZ A;  4B3T M;  3DA1 A;  2Z4R A;  2Z8Y M;  2I7P A;  4DR4 M;  1JR3 E;  3K9P A;  2V1C A;  4PT5 A;  5ITY A;  3WHK A;  3EIH A;  1JR3 D;  1EFU B;  1XNQ M;  1IY2 A;  2OOA A;  2QEN A;  2VII A;  4LF5 M;  1N78 A;  3E21 A;  4P16 A;  4GHL A;  3T15 A;  3LCU A;  1PJJ A;  3HU2 A;  4D81 A;  3JAM S;  5KPT A;  3HU1 A;  2DHR A;  4LF4 M;  1QYR A;  1UFZ A;  2APL A;  1DGH B;  2JA2 A;  3UGJ A;  1Q02 A;  3U5Z A;  3U60 B;  1QUT A;  4DR6 M;  3KFU G;  2HWJ A;  3WHL A;  2WSC F;  2MRO B;  1MX0 A;  3FUT A;  1KYI A;  3L27 A;  4DR7 M;  2UXD M;  2DAE A;  1E9S A;  3M0E A;  2LBC A;  5FTL A;  1UM8 A;  4LCB A;  3KS8 A;  3SAU A;  4NRV A;  2AHM A;  2KHH A;  3GRU A;  2C9O A;  3GRV A;  3SBJ A;  2LVN C;  2ERC A;  1FJG M;  1G71 A;  2I7N A;  2J7O A;  3LCV B;  7CAT A;  1Z59 A;  2DXI A;  1HNX M;  1IY1 A;  1T6O A;  2JWS A;  2WSE F;  4OVZ A;  1IFY A;  2VF7 A;  4LGM A;  4G4R A;  4AKI A;  4JI2 M;  3IEC A;  4CGY B;  5FLX S;  2K47 A;  3GLH B;  2EO2 A;  3Q8X A;  2R45 A;  4LJ9 A;  3VLF B;  2L6O A;  1J7K A;  5E6J A;  3SYK A;  3K92 A;  1WGL A;  4NRW A;  1IXZ A;  5F3W A;  1IM2 A;  2D7E A;  3U61 B;  1IN4 A;  4LFA M;  1VDL A;  1SXJ A;  4D82 A;  1XC8 A;  4P17 A;  3J2P B;  1YSY A;  3TL4 X;  1C7Y A;  1D2N A;  5EP1 A;  3HX3 A;  1XHB A;  3A42 A;  3SC3 A;  4CIZ A;  2J7N A;  4IBK A;  1QQW A;  1EIJ A;  1XXH B;  2JZ1 A;  4RNA A;  4OW0 A;  2XH9 A;  3VK7 A;  2V6Z M;  1ZMU A;  1AUA A;  4F2L A;  3GLG B;  1WGN A;  4B7H A;  2DAM A;  3R8F A;  1G3I A;  2DAI A;  3GLH E;  4LZZ A;  1XMQ M;  3GRR A;  3D8L A;  3HHW A;  1WXQ A;  4IIW A;  2JNH A;  4FCT A;  4JI7 M;  4GIP A;  2R44 A;  3GPP A;  5EXT A;  3MK6 A;  4L15 A;  3GP1 A;  3GLI B;  5BR8 M;  1PJI A;  2QQ8 A;  3KOX E;  3CF2 A;  4MGY E;  4PDG A;  5IWA M;  2G8L A;  4XK8 F;  2F5O A;  2D7H A;  2D7G A;  2G5G X;  1AIP C;  2YR0 A;  2DWM A;  1PRB A;  1TGU A;  4KOD A;  3W0L B;  1IBL M;  3GLG A;  3I4Y A;  2QP9 X;  1DO2 A;  3L25 A;  4Q7J A;  1OFH A;  4PCZ A;  1J09 A;  3ZCB B;  4BBA A;  1D0K A;  1GKI A;  4OVZ B;  4CJ6 A;  1QUS A;  4B3M M;  1L2D A;  3I51 A;  4FWH A;  1JB0 F;  4QNM A;  5ITQ A;  4Z8X A; 
#chains in the Genus database with same CATH homology
 2A5Y B;  4M9X A;  3AV0 A;  3VK8 A;  4X62 M;  2Y21 A;  3AJI B;  4MGZ E;  3UMM A;  2XLJ A;  4LY6 A;  3TPZ A;  3U61 A;  2CHV A;  1KFV A;  1NNJ A;  1HR0 M;  4IBI A;  4LF6 M;  3GRY A;  3SAV A;  4S12 A;  4X64 M;  3HHX A;  3RGS A;  3SHG B;  3FYD A;  3FD9 A;  5IZ7 D;  4DR3 M;  2XF3 A;  2DZN B;  1IXR C;  1N75 A;  4MGK E;  1NSF A;  4AG6 A;  3SHF A;  4NXM M;  3BOS A;  4NSR A;  3A45 A;  3H4M A;  1DGB A;  2L7H A;  4GHA A;  4GC5 A;  5EJC A;  3UJN A;  1FNN A;  1R2Z A;  3KDS E;  4DR1 M;  3J7A S;  2F5Q A;  2FOI C;  2DWZ B;  2LWX A;  2VQE M;  3U60 A;  2M5Z A;  3SAS A;  4GKJ M;  5KQ8 A;  1K3W A;  4IJE A;  4BB9 A;  4LGY A;  4KO8 A;  3MHV C;  1I4W A;  1G8P A;  1N77 A;  4M9Z A;  4M0D A;  4LFB M;  3K1J A;  4JV5 M;  1YE9 A;  2X49 A;  2C98 A;  4MGH A;  4FD2 A;  4IBJ A;  1TDZ A;  4EIW A;  3FKE A;  3W0F A;  3QWL A;  2QBY B;  1NNU C;  3TQS A;  4LRT A;  2RGO A;  1ORY B;  4LZJ A;  2KRU A;  2XFT A;  5EQT A;  3IG8 A;  1C1K A;  2CV1 A;  1KSF X;  1QAQ A;  1TDH A;  2L09 A;  3E9S A;  1VDD A;  2LNH C;  3HWS A;  4AKH A;  1T3T A;  2KRK A;  1GL6 A;  4LJA A;  1NJF A;  4ZPX A;  1YUB A;  3HJQ A;  1EE8 A;  5FSW A;  4MM3 B;  4FCW A;  3UZU A;  3FTE A;  4GRI A;  1R7R A;  1JQJ C;  2KXE A;  2XSZ D;  5FTK A;  4CHT B;  1L2C A;  4PD2 A;  4HLQ A;  4OU7 A;  3B9P A;  2CUZ A;  1NJG A;  3FTF A;  3CF6 E;  2HL7 A;  5EXS A;  3HJ8 A;  3ZC7 B;  2Z7J A;  1LV7 A;  1NHW C;  4NSO B;  1K3X A;  4I4L A;  3VDU A;  3CTW B;  2KZU A;  3HU3 A;  3FYC A;  2KW0 A;  3U5Z B;  3TWM A;  4AQY M;  4REZ A;  2HKJ A;  1K82 A;  3GLH A;  2UUC M;  4IBF A;  4FWG A;  1TH2 A;  2FFJ A;  4YHH M;  2OQ4 A;  2R4E A;  2VQF M;  1ZAE A;  1GLN A;  2KA6 B;  3AOE C;  1W5T A;  3U6D A;  3LVV A;  2R46 A;  3M6A A;  2F4V M;  1SXJ C;  1XNR M;  4ITQ A;  2C96 A;  4LFC M;  3I4V A;  4FW9 A;  3RE8 A;  5ITT A;  2ZAN A;  2DVW B;  3KP1 E;  3OTO M;  4JI5 M;  3HGI A;  4LJ4 A;  2XZU A;  1ZQ9 A;  5FTM A;  2EUC A;  4I5S A;  2X4A A;  2R4J A;  4AW4 A;  4RF0 A;  2DWL A;  5JI3 E;  3SMS A;  5JI2 E;  4PDI A;  4LRS A;  4K0K M;  4FVM A;  3L28 A;  3L29 A;  4Z6Y A;  1Z5C A;  3J7B A;  4LF8 M;  4X65 M;  2R62 A;  3GQ4 A;  3T1H M;  2UXC M;  5ITX E;  1IQP A;  1IY0 A;  1QVR A;  4L16 A;  1L8Q A;  2H1R A;  3KS4 A;  3AKZ A;  4LJ7 A;  3JR4 A;  4JI4 M;  3T38 A;  4L78 A;  3VKH A;  3C58 A;  2LXE A;  4QOZ C;  2CFO A;  5KPR A;  3U6S A;  3TE6 A;  3ILK A;  3U6M A;  3L26 A;  2XFS A;  5ITU A;  2RGH A;  1QAO A;  4IBB A;  1NVM A;  1SXJ E;  2QZ4 A;  3KOW E;  1DO0 A;  1IBK M;  3SMP A;  3FUV A;  2EA0 A;  4GMQ A;  3JR5 A;  2R18 A;  2ZM6 M;  2F5N A;  3GLI A;  2RKO A;  3U6Q A;  4JI3 M;  4W5W A;  3L2A A;  1R6B X;  3KOZ E;  2UUB M;  5GKN A;  4G6Z A;  5BPV A;  3KW6 A;  3J80 S;  5KQD A;  2W82 A;  3HHZ A;  2DZO B;  2ZAO A;  4QHT A;  2HCB A;  4AG5 A;  5EP3 A;  3THG A;  1QAN A;  1XMO M;  3TWK A;  3QAU A;  8CAT A;  4JI1 M;  2YNM D;  2UXB M;  3GLF B;  3RFW A;  1Z6T A;  3FUU A;  5LMU M;  1TH4 A;  3EIE A;  4LJ8 A;  2KZS A;  2C9C A;  5IRE B;  1Z5B A;  1IXS B;  1E94 E;  2F5S A;  4IBD A;  4NXN M;  4BLC A;  3U6P A;  2FNA A;  1I94 M;  2Y0T A;  4L8R C;  2QPA A;  4RF1 A;  2OPF A;  1L2B A;  4QOS A;  4DR5 M;  4LF7 M;  3DZD A;  1S3S A;  2C5R A;  1NHG C;  1SXJ B;  2CHG A;  3A98 B;  1E32 A;  3PNV A;  4XGI A;  4DR2 M;  3AFH A;  4XBO A;  3GPX A;  3A46 A;  2Y20 A;  4AKG A;  3M7G A;  4MB7 A;  4MGI E;  1L1T A;  4I81 A;  1IBM M;  3TWL A;  4WW0 A;  1QZM A;  1Q39 A;  3AL0 C;  4R3D A;  3DOA A;  3HKP A;  2O5R A;  2E5L M;  2Z3X A;  2V1U A;  5H37 D;  3GQ5 A;  4AZF A;  2HHH M;  1DGF A;  2DWN A;  1X37 A;  1PM5 A;  4DV0 M;  4IBG A;  2BNK A;  5DYI A;  3SAT A;  2F5P A;  4B3S M;  5C1B A;  5LMN M;  3GPU A;  3MJ5 A;  4MH0 E;  1QAM A;  3KSX A;  1G41 A;  4LJ6 A;  2XZF A;  4LG2 A;  2BJV A;  1HQY E;  2XEP A;  3KSJ A;  4A3V B;  1GVN A;  4DV7 M;  4JI8 M;  4DV4 M;  4TUW A;  3PXG A;  4NL4 H;  2P5T A;  4II7 A;  1XXH A;  3PVS A;  3SAR A;  2UUA M;  3VFD A;  3D8B A;  5KO3 A;  4G4N A;  3PFI A;  2CV2 A;  1DGG A;  4WUR A;  1IN8 A;  5IT9 S;  1IN6 A;  3IG5 A;  1XWI A;  3U6L A;  4DV6 M;  3GPY A;  2Y0Q A;  4GC9 A;  5E26 A;  1R2Y A;  4JXJ A;  3RGP A;  4GH9 A;  3J27 B;  2Z4S A;  1G59 A;  2ZAM A;  3LVW A;  4IJF A;  4L4U A;  4QNR A;  1Q3C A;  3GO8 A;  1N32 M;  5EP2 A;  4GIT A;  2X8A A;  3LQQ A;  2QCU A;  5EXP A;  2CEA A;  3NWL A;  1OJL A;  4X66 M;  3AOE A;  1Q3B A;  3E4R A;  3VKG A;  3U6O A;  2CHQ A;  3GLF A;  4JI6 M;  3K2L A;  1JR3 A;  3GQ3 A;  1L1Z A;  1Z5A A;  3J81 S;  1N36 M;  3KXE C;  3PNY A;  2CE7 A;  5FTN A;  2Q2E B;  3AOG A;  1HT2 E;  2C99 A;  4I8O A;  3NBI A;  1J5E M;  4KLN A;  1N34 M;  1TH3 A;  4B08 A;  2BJW A;  4JI0 M;  1NY5 A;  4FCV A;  3FUW A;  1NY6 A;  2LH0 A;  4YY3 M;  1E9R A;  3U6C A;  1DGH A;  2XGN A;  2QBY A;  4DV2 M;  4IBC A;  1HT1 E;  4JYA M;  3T1Y M;  4AI6 A;  3CF0 A;  5EXX A;  2L7I A;  3U6E A;  1H6U A;  3UK6 A;  2UU9 M;  4FWD A;  4NOO B;  4CIS A;  4DV5 M;  1MU5 A;  3SYL A;  5FTJ A;  4M9S A;  3KOY E;  2YQZ A;  4D80 A;  5DNY A;  3FTD A;  3R9X B;  4B7G A;  3FTC A;  4B3R M;  4DUY M;  3KP0 E;  3FUX A;  3KVW A;  3VDP A;  2M60 A;  2FE8 A;  4JN6 A;  5C18 A;  5A2Q S;  4LJ5 A;  5KPZ A;  2R65 A;  3LQR A;  1HQC A;  3HJS A;  3K8Z A;  4HL4 A;  2CV0 A;  2XSZ A;  3ZH9 B;  5ITR A;  4DV3 M;  2YFQ A;  1HNZ M;  1IN5 A;  2NQ8 C;  4OX9 M;  4DUZ M;  3SAW A;  1N33 M;  1OFI A;  1SXJ D;  4M0W A;  2ZBK B;  5DYG A;  3DFZ A;  4LF9 M;  2KEB A;  1GL7 A;  4IBE A;  5ITX A;  3LMM A;  4GKK M;  4G4Q A;  4DV1 M;  1IN7 A;  4G4O A;  4QHS A;  4B7F A;  4KHP M;  1HNW M;  1W5S A;  5EP4 A;  4R7G A;  3HHY A;  1G4A E;  3SFZ A;  4B3T M;  3DA1 A;  2Z4R A;  2I7P A;  4DR4 M;  2V1C A;  4PT5 A;  5ITY A;  3WHK A;  3EIH A;  1JR3 D;  1XNQ M;  1IY2 A;  2QEN A;  2VII A;  4LF5 M;  1N78 A;  4P16 A;  4GHL A;  3T15 A;  1PJJ A;  3HU2 A;  4D81 A;  3JAM S;  5KPT A;  3HU1 A;  2DHR A;  4LF4 M;  1QYR A;  2JA2 A;  1DGH B;  3UGJ A;  3U5Z A;  3U60 B;  4DR6 M;  3KFU G;  3WHL A;  1MX0 A;  3FUT A;  1KYI A;  3L27 A;  4DR7 M;  2UXD M;  1E9S A;  3M0E A;  5FTL A;  1UM8 A;  4LCB A;  3KS8 A;  3SAU A;  4NRV A;  2AHM A;  3GRU A;  2C9O A;  3GRV A;  3SBJ A;  1FJG M;  2ERC A;  2I7N A;  2J7O A;  7CAT A;  1Z59 A;  2DXI A;  1HNX M;  1IY1 A;  4OVZ A;  4LGM A;  4G4R A;  4AKI A;  4JI2 M;  4CGY B;  5FLX S;  2K47 A;  3GLH B;  2EO2 A;  3Q8X A;  2R45 A;  4LJ9 A;  3VLF B;  2L6O A;  1J7K A;  5E6J A;  3SYK A;  3K92 A;  4NRW A;  1IXZ A;  5F3W A;  1IM2 A;  2D7E A;  3U61 B;  1IN4 A;  4LFA M;  1SXJ A;  4D82 A;  1XC8 A;  3J2P B;  1YSY A;  3TL4 X;  1D2N A;  5EP1 A;  1XHB A;  3A42 A;  3SC3 A;  2J7N A;  4IBK A;  1QQW A;  1XXH B;  4RNA A;  4OW0 A;  2XH9 A;  3VK7 A;  2V6Z M;  3GLG B;  4B7H A;  3R8F A;  1G3I A;  4LZZ A;  1XMQ M;  3GRR A;  3D8L A;  3HHW A;  1WXQ A;  4IIW A;  4FCT A;  4JI7 M;  4GIP A;  3GPP A;  5EXT A;  3MK6 A;  4L15 A;  3GP1 A;  3GLI B;  5BR8 M;  1PJI A;  5IWA M;  3KOX E;  3CF2 A;  4MGY E;  4PDG A;  2G8L A;  2F5O A;  2D7H A;  2D7G A;  2G5G X;  2YR0 A;  2DWM A;  1TGU A;  4KOD A;  3W0L B;  1IBL M;  3GLG A;  3I4Y A;  2QP9 X;  1DO2 A;  3L25 A;  1OFH A;  4PCZ A;  1J09 A;  3ZCB B;  4BBA A;  1GKI A;  4OVZ B;  4B3M M;  1L2D A;  3I51 A;  4FWH A;  4QNM A;  5ITQ A;  4Z8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...