4NXNM

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nxnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4nxnM02
2F5QA 1N33M 2ZM6M 4DV3M 4KHPM 4DV6M 3U6LA 4JI5M 4LF7M 4PD2A 1MX0A 3DOAA 2HKJA 2VQFM 1K82A 3GPXA 2XZFA 1IBKM 4X66M 4JI6M 4LF6M 3SAVA 4LF4M 3U6QA 5FLXS 4DR3M 4DR6M 1Q3BA 4DV5M 2UXDM 2F4VM 3U6EA 3SATA 4LFCM 1K3XA 3J80S 4X62M 3GPYA 1Z5CA 4PDIA 4DV0M 4DR5M 1TDZA 3SAUA 2OPFA 2UUBM 5LMUM 1XMQM 1R2ZA 2OQ4A 2F5SA 3J7AS 4GKKM 4YY3M 2F5PA 2Q2EB 2UUCM 3A45A 4K0KM 1NNJA 1XNQM 4NXMM 1PM5A 4G4QA 4B3TM 5ITUA 4DR7M 3GQ5A 1KFVA 5IWAM 3A46A 3GQ4A 4NRVA 5A2QS 1HR0M 4NRWA 1R2YA 2UUAM 1L1ZA 2UXCM 4CISA 1HNWM 5BR8M 1XNRM 3SASA 5ITYA 2UU9M 4DV1M 4PCZA 1Z5BA 4AQYM 3U6SA 1HNXM 4G4RA 3U6CA 3JR5A 2HHHM 1L1TA 4JI1M 3T1YM 3TWLA 5ITXA 4YHHM 2XZUA 4B3MM 4OX9M 2UXBM 3W0FA 3GP1A 4LF8M 4DUYM 5ITQA 4JI2M 3T1HM 1Z5AA 5ITTA 3GO8A 3JR4A 4DR4M 3JAMS 3C58A 3U6PA 3J81S 3U6MA 1K3WA 4ITQA 4X64M 1Q3CA 4JI8M 4JI4M 2ZBKB 4DV2M 1L2BA 4LF5M 2F5OA 4LF9M 3OTOM 4B3RM 4G4NA 4JI3M 4DV4M 4PDGA 4MB7A 2EA0A 4DV7M 3U6DA 1N32M 4DR1M 3VK8A 4DUZM 4NXNM 1EE8A 1XC8A 3GQ3A 4DR2M 1Q39A 3U6OA 3SAWA 1IBLM 3SARA 1MU5A 4JI0M 3GPPA 1L2DA 1IBMM 4JV5M 5ITXE 1PJJA 5IT9S 1J5EM 1L2CA 3VK7A 4JI7M 4JYAM 3GPUA 4LFBM 3A42A 5ITRA 1TDHA 2VQEM 2F5NA 3TWMA 4G4OA 1PJIA 3TWKA 1Z59A 3SBJA 2E5LM 5LMNM 1HNZM 1FJGM 4X65M 1N34M 4GKJM 4LFAM 4B3SM 1N36M 1XMOM 1I94M
chains in the Genus database with same CATH superfamily
5EP3A 2ZM6M 4DV3M 4LY6A 1OQYA 4DV6M 3U6LA 4JI5M 1IN8A 1V34A 2EKKA 2VQFM 3PFIA 3SHGB 3U5ZB 5F3WA 4ZPXA 2JY6B 4LF4M 2ERCA 1WHCA 3SYLA 4DR3M 1IN5A 2CV0A 2KEBA 1ZMUA 3I04M 3FUWA 4X62M 1N75A 1ZQ9A 2CP8A 2FNAA 3QYBA 4F1IA 3SAUA 2VF8A 4FWHA 3K9PA 3IECA 2QZ4A 4IBFA 5LMUM 4IJEA 1JR3E 3MHVC 4P17A 2F5SA 3B7NA 3J7AS 4L15A 1QAMA 2VDBB 2QBYB 3GRYA 2LTUA 2OOBA 3E9SA 3VDUA 4M0DA 3FRIA 3U61B 1OFHA 3LMMA 4G4QA 4B3TM 2L4EA 2R0IA 2R62A 3KOWE 3KSJA 2Z3XA 3D8LA 1KFVA 4FD2A 3A46A 1G41A 2Z4RA 4LJ9A 3RFWA 2V1CA 3FRHA 1JB0F 2DWLA 4GITA 4NRWA 1OIZA 1R2YA 2UUAM 3VKGA 2QNJA 4GEWA 1HQYE 2JP7A 4MGKE 5C18A 1UFZA 2X4AA 1H6UA 2KXEA 2QENA 3E21A 3IHPA 4CJ6A 3U6SA 1HQCA 3RE8A 1Y8GA 2BNKA 3GLFB 2CHGA 3JR5A 4G4RA 4LJ8A 1X37A 3T1YM 1L1TA 5ITXA 2DHRA 2LWXA 1AIPC 3KSXA 4Z8XA 5JI2E 4IBDA 4YHHM 3FD9A 4WURA 3W0FA 4LF8M 5BPVA 3T1HM 3SHFA 3GO8A 2CV2A 1NY5A 1TR8A 3AFHA 1VG5A 2L7HA 4R71A 3HGIA 1DO0A 2XFTA 3KXEC 4QNRA 1NY6A 2JUJA 4EIWA 2K9DA 4JI4M 3CF0A 1SXJE 1V33A 3VFDA 1QYRA 3FE3A 1LTMA 2KZSA 2WSEF 4II7A 3OTOM 3AOGA 4MGZE 1WIVA 1NV8A 1YUBA 2R46A 4JI3M 3E4RA 4MB7A 3U6DA 4IBIA 4PT5A 4I4LA 4DR1M 4L4UA 3QAUA 2KNZA 4GHLA 2DENA 4NXNM 3GLFE 3KVWA 2DAMA 1Q39A 3K92A 3PXGA 2C99A 3HZJA 3I4VA 4QOSA 2LVAA 3HU3A 2JY8A 1IQPA 2R65A 3KP0E 1PJQA 5EJCA 5KPTA 1OTRA 5FTMA 2R45A 1IBMM 3LCUA 2LXEA 2RKOA 3KP1E 5E26A 4JXJA 2I7PA 4WW0A 2R4EA 3K2LA 5L8RF 3KFUG 1TF0B 1DGHB 4IBGA 4LJAA 1J5EM 5EXXA 4JYAM 1NO1A 1TH2A 4LJ5A 3GPUA 4AKIA 1D0KA 2JY5A 2ZAOA 4L16A 3TPZA 2C5RA 4LGMA 1IXZA 2Z7JA 1QANA 1XB2B 2DAGA 2BWBA 2DWZB 4IBKA 1XXHA 1T6OA 3J27B 4KT0F 4XBOA 2DZLA 3HKPA 1FJGM 4B3SM 4Z6YA 1C1KA 1GKIA 1XMOM 2UUBM 3J2PB 1VQ1A 1TTEA 2LVOC 3KOYE 2X49A 3EIHA 3DOAA 4WP2A 2FS1A 2QP9X 3AV0A 1EIJA 3R9XB 3KDSE 3I4YA 3Q8GA 3PNYA 1IBKM 2CWBA 1G8PA 3U6QA 3K1JA 1GLNA 2M60A 2APLA 1Q3BA 3MJ5A 1PJSA 2D7GA 3FUUA 4D80A 2LH0A 3U6EA 4GHAA 5EXSA 1ZMWA 3J80S 1DGGA 3GPYA 1W5TA 1BVSA 2K6BA 1DV0A 3M7GA 1VDDA 2K47A 4AW4A 1NJFA 3U60B 2OPFA 3L27A 1NVMA 2G8LA 4NL4H 2Y20A 3EIEA 4LCBA 2ZTCA 3K8ZA 3DA1A 2RGOA 2J7NA 4GKKM 2DWNA 3C3EA 2L4FA 2V1UA 2Q2EB 1GJSA 4IBCA 1IN6A 3A45A 3FYDA 4K0KM 3AJIB 4NXMM 2MGWA 2O25A 3B74A 4NC6A 3LQQA 1QAOA 1YE9A 5KQDA 5KPRA 3IG8A 2C9OA 3HU2A 4LZZA 2CRUA 4NRVA 4FWDA 2KA6B 4AKGA 2O5RA 2Y0TA 2FFJA 4I8OA 3V76A 1S3SA 5BR8M 1HT1E 2YNMD 2MR9A 1D2NA 2EKFA 1ORYB 2JY7A 2J5YA 2DAIA 4B7GA 3ZCBB 4XK8F 4AKHA 4FW9A 2HHHM 4L8RC 4FVMA 4OX9M 1XWIA 4B08A 1CUKA 2C98A 3H4JA 3D8BA 3GLGB 2DZNB 3GLHA 4S12A 5ITQA 4JI2M 1Z5AA 2LHGA 7CATA 4DR4M 4FWGA 4B7FA 3JAMS 3NBXX 3IG5A 4Q7JA 5EP2A 8CATA 2MJ5B 3U6MA 3M6AA 1G71A 2Y21A 1SXJB 3CF2A 2CHQA 4LF5M 1DGFA 2FE8A 4M9XA 3C9PA 3ILKA 2H5XA 1OIPA 4GRIA 4OVZA 3UZUA 1SG9A 2KNVA 3HHYA 3SMPA 3UJNA 1TH4A 4G4NA 3A98B 1T3TA 5FTNA 4PDGA 5KPZA 4DV4M 4ANRA 2ZAMA 4RKUF 2LBCA 2N35A 1IXSB 4DR2M 3K9OA 2HWJA 3HY5A 3U6OA 2L09A 3SAWA 3GLGE 3B89A 4KO8A 3T15A 4REZA 3FYCA 4LRTA 3SARA 3TE6A 2MH8A 4KLNA 1L2DA 2VF7A 4MGYE 2O01F 4QHSA 1D0LA 2FH0A 4A3VB 2CUZA 4UN2B 4M9SA 3VK7A 4NSOB 1JR3A 3Q8XA 3QWLA 4D81A 3HWSA 3GLIB 1TDHA 1JR3D 4G6ZA 3TWMA 1NHWC 3TWKA 4QOZC 4BB9A 4NSRA 4W5WA 1Q02A 2KNAA 2W82A 4X65M 4IBEA 4AG5A 3U5ZA 1IN7A 3LQRA 2DZOB 5FTJA 5FSWA 2XH9A 4L6V6 4M0WA 2QPAA 4FCWA 3W0LB 3GPXA 1QDRA 2XZFA 5EP1A 1K82A 2JZ0A 1V92A 2XSZA 4X66M 3NBIA 2EJSA 4JN6A 3RGSA 2DAEA 3UMMA 2DXIA 2XLJA 5FLXS 1IY0A 2XSZD 3SC3A 4CHTB 4D82A 3AKZA 4DR6M 1KYIA 4DV5M 2UXDM 3LVVA 4GMQA 3PVSA 1Z6TA 2LVPC 2BWEA 2KW0A 3BOSA 4LFCM 3MMPA 4PDIA 3J7BA 5C1BA 2FOIC 3GLIE 3FTFA 5KQ8A 2QBYA 4L78A 1WJ7A 1RU3A 3H4MA 4AI6A 2GQFA 1XMQM 3U61A 3LVWA 2BJVA 4G3OA 2V6ZM 2DWMA 4YY3M 4GC5A 2CHVA 4I5SA 4M9ZA 1HJPA 3ZC7B 1VDLA 2D7EA 1OAIA 2ZANA 1PM5A 3L25A 5IREB 1SXJC 3L28A 3GQ5A 2Y0QA 2Z8YM 3B9PA 4QNMA 3GQ4A 5A2QS 1HR0M 3GLFA 1GVNA 1VEGA 3WHLA 2NQ8C 2UXCM 1GABA 1WXQA 3HJ8A 4CISA 1HNWM 1NSFA 3SFZA 3KS8A 3SASA 4MGHA 4QHTA 2UU9M 4DV1M 3ZH9B 2KRKA 1Z5BA 4I81A 4AQYM 1HNXM 3U6CA 4JI1M 3HHWA 5EP4A 5JI3E 1EFUB 3CTWB 5KO3A 2LHCA 4RNAA 3QYEA 4B7HA 5H37D 3GP1A 2UXBM 2YR0A 4OW0A 4DUYM 2QCUA 3DFZA 2LVNC 3GRUA 4KODA 1PJTA 5ITTA 2DAKA 1R7RA 3U6PA 3ZQJA 1C7YA 3CGWA 3CF6E 1QUTA 2ZTDA 4GH9A 4IIWA 4LRSA 4Y28F 3J81S 1K3WA 2QHOB 4LG2A 3GLHE 4X64M 4FCTA 4JI8M 3FTEA 2ZBKB 3R8FA 4DV2M 1L2BA 1E94E 3HX3A 2F5OA 4LF9M 1AUAA 1NNUC 2JA2A 5FTLA 4B3RM 1PGYA 2DNAA 4HLQA 1FNNA 4LJ6A 1N32M 3I51A 2EA0A 4DV7M 1WGLA 2R44A 1R4GA 2QQ8A 3AOEC 1TGUA 3LCVB 3PNVA 4DUZM 1DGBA 2A5YB 3I01M 5DNYA 3HJQA 1XC8A 3GQ3A 5E6JA 5GKNA 1QZEA 1ZV1A 1E9RA 3SMSA 2WSFF 1DGHA 1OAOC 4LJ7A 4CIZA 3GPPA 1GO5A 2XEPA 2XF3A 2CFOA 1YLAA 1R6BX 5ITXE 1IFYA 3L26A 1PJJA 4F2LA 2D7HA 2XFSA 3NWLA 1UM8A 1L2CA 4JI7M 2R18A 2HAKA 4LFBM 2P5TA 2R6FA 5ITRA 1QVRA 3MK6A 2KHHA 1Z59A 2R4JA 1HNZM 1WR1B 2RGHA 2VIIA 4MH0E 4P16A 4LGYA 1N34M 2XGNA 4GKJM 2BJWA 2YFQA 3GRVA 5EXPA 3FUVA 4LFAM 4GIPA 1N36M 1I94M 4BBAA 2F5QA 1N33M 4KHPM 2LVQD 2Z4SA 3E46A 4HL4A 4LF7M 1N78A 3T38A 4PD2A 2AHMA 1J7KA 4AG6A 1MX0A 1XXHB 2HKJA 1A5TA 1IM2A 1IY2A 1KSFX 4JI6M 1L8QA 1PRBA 1IY1A 4LF6M 3SAVA 1ZMVA 3DZDA 2CEAA 3LW5F 1E9SA 1JQJC 3U60A 5EQTA 3F92A 2F4VM 2JXNA 2L2DA 2WSCF 5DYIA 3SATA 1K3XA 1VEKA 1Z5CA 4R3DA 3THGA 4DV0M 5DYGA 4DR5M 2C96A 1TDZA 2CV1A 4OU7A 4FCVA 3HHZA 2G3QA 1DO2A 4RF1A 1MN3A 1R2ZA 2RRUA 1J09A 3BXWA 3KOXE 1QUSA 3FUXA 2OQ4A 1R5LA 4IBBA 4GC9A 2I7NA 2F5PA 3KOZE 1G3IA 2L6OA 4IJFA 2UUCM 1NV9A 4RF0A 3HU1A 1NNJA 1XNQM 3AL0C 1XXHE 1TH3A 5ITUA 3W67A 2JNHA 4DR7M 2X8AA 5IWAM 3KW6A 3FTCA 3KS4A 3FTDA 4DBGB 2KRUA 2CE7A 1W5SA 4MGIE 1QQWA 1GJTA 3TL4X 1L1ZA 2KDLA 3T6PA 3VDPA 3GRRA 1XNRM 1G4AE 5ITYA 4BLCA 3GLGA 4PCZA 2JWSA 1XHBA 2HL7A 2DKLA 2EUCA 2G5GX 1OJLA 1GL7A 1N77A 3BBZA 3FKEA 3TWLA 2XZUA 4B3MM 4AZFA 3VKHA 3RGPA 2JZ1A 2M5ZA 1LV7A 2LNHC 5EXTA 1E32A 3TQSA 1IXRC 4TUWA 3JR4A 1SXJA 4IBJA 3C58A 5FTKA 4LZJA 2OOAA 1OKSA 4R7GA 1SXJD 2C9CA 3B7ZA 3GLHB 1WGNA 4ITQA 1Q3CA 5DFLA 2DI0A 1F4IA 3HHXA 4XGIA 1IXSA 3UK6A 1ZAEA 2K0BX 1GL6A 4MM3B 3L2AA 2DHYA 3VK8A 1NJGA 1QDTA 3L29A 4OVZB 4CGYB 4NOOB 2J7OA 3W68A 1EE8A 2L7IA 2B3TA 2DVWB 5IZ7D 1I4WA 2H1RA 4HEOA 2GNOA 3UGJA 1IBLM 1MU5A 1IN4A 4JI0M 3M0EA 2EO2A 2WZJA 2QSFX 1P3QQ 1YSYA 4JV5M 3GLIA 5IT9S 1D0MA 3VLFB 3FUTA 2OO9A 3HJSA 1G59A 1T43A 2KZUA 1HT2E 1MJGM 3A42A 2VQEM 2F5NA 4G4OA 1QAQA 1NHGC 2HCBA 3AOEA 3B7QA 3SBJA 1PJIA 1VEJA 5LMNM 2E5LM 1QZMA 3WHKA 3C3DA 3SYKA 4LJ4A 1OFIA 2MROB 2YQZA
chains in the Genus database with same CATH topology
5EP3A 2ZM6M 4DV3M 4LY6A 4DV6M 3U6LA 4JI5M 1IN8A 2VQFM 3PFIA 3SHGB 3U5ZB 5F3WA 4ZPXA 4LF4M 2ERCA 3SYLA 4DR3M 1IN5A 2CV0A 2KEBA 3FUWA 4X62M 1N75A 1ZQ9A 2FNAA 3SAUA 4FWHA 2QZ4A 4IBFA 5LMUM 4IJEA 3MHVC 2F5SA 3J7AS 4L15A 1QAMA 2QBYB 3GRYA 3E9SA 3VDUA 4M0DA 3U61B 1OFHA 3LMMA 4G4QA 4B3TM 3KOWE 2R62A 3KSJA 2Z3XA 3D8LA 1KFVA 4FD2A 3A46A 1G41A 2Z4RA 4LJ9A 3RFWA 2V1CA 2DWLA 4GITA 4NRWA 1R2YA 2UUAM 3VKGA 1HQYE 4MGKE 5C18A 2X4AA 1H6UA 2KXEA 2QENA 3U6SA 1HQCA 3RE8A 2BNKA 3GLFB 4G4RA 2CHGA 3JR5A 1L1TA 4LJ8A 1X37A 3T1YM 5ITXA 2DHRA 2LWXA 3KSXA 4Z8XA 5JI2E 4YHHM 4IBDA 3FD9A 4WURA 3W0FA 4LF8M 5BPVA 3T1HM 3SHFA 3GO8A 2CV2A 1NY5A 3AFHA 2L7HA 3HGIA 1DO0A 2XFTA 3KXEC 4QNRA 1NY6A 4EIWA 4JI4M 3CF0A 1SXJE 3VFDA 1QYRA 2KZSA 4II7A 3OTOM 3AOGA 4MGZE 1YUBA 2R46A 4JI3M 3E4RA 4MB7A 3U6DA 4IBIA 4PT5A 4I4LA 4DR1M 4L4UA 3QAUA 4GHLA 4NXNM 3KVWA 1Q39A 3K92A 3PXGA 2C99A 3I4VA 4QOSA 3HU3A 1IQPA 2R65A 3KP0E 5EJCA 5KPTA 5FTMA 2R45A 1IBMM 2LXEA 2RKOA 3KP1E 5E26A 4JXJA 2I7PA 4WW0A 2R4EA 3K2LA 3KFUG 4LJAA 1DGHB 4IBGA 1J5EM 5EXXA 4JYAM 4LJ5A 1TH2A 3GPUA 4AKIA 2ZAOA 3TPZA 4L16A 2C5RA 4LGMA 1IXZA 2Z7JA 1QANA 2DWZB 4IBKA 1XXHA 1FJGM 3J27B 4XBOA 3HKPA 4B3SM 4Z6YA 1GKIA 1C1KA 1XMOM 2UUBM 3J2PB 3KOYE 2X49A 3EIHA 3DOAA 2QP9X 3AV0A 3R9XB 3KDSE 3I4YA 3PNYA 1IBKM 1G8PA 3U6QA 3K1JA 1GLNA 2M60A 3MJ5A 1Q3BA 2D7GA 3FUUA 4D80A 2LH0A 3U6EA 4GHAA 5EXSA 3J80S 1DGGA 3GPYA 1W5TA 3M7GA 1VDDA 2K47A 4AW4A 1NJFA 3U60B 2OPFA 3L27A 1NVMA 2G8LA 4NL4H 2Y20A 3EIEA 4LCBA 3K8ZA 3DA1A 2RGOA 2J7NA 4GKKM 2DWNA 2V1UA 2Q2EB 4IBCA 1IN6A 3A45A 3FYDA 4K0KM 3AJIB 4NXMM 5KQDA 3LQQA 1QAOA 1YE9A 5KPRA 3IG8A 2C9OA 3HU2A 4LZZA 4NRVA 4FWDA 2KA6B 4AKGA 2O5RA 2Y0TA 2FFJA 4I8OA 1S3SA 5BR8M 1HT1E 2YNMD 1D2NA 4B7GA 1ORYB 3ZCBB 4AKHA 4FW9A 2HHHM 4L8RC 4FVMA 4OX9M 1XWIA 4B08A 2C98A 3D8BA 3GLGB 2DZNB 3GLHA 4S12A 5ITQA 4JI2M 1Z5AA 7CATA 4DR4M 4FWGA 4B7FA 3JAMS 3IG5A 5EP2A 8CATA 3U6MA 3M6AA 2Y21A 1SXJB 3CF2A 2CHQA 4LF5M 1DGFA 2FE8A 4M9XA 3ILKA 4OVZA 3UZUA 4GRIA 3HHYA 3SMPA 3UJNA 1TH4A 4G4NA 3A98B 1T3TA 5FTNA 4PDGA 5KPZA 4DV4M 2ZAMA 1IXSB 4DR2M 3U6OA 2L09A 3SAWA 4KO8A 3T15A 4REZA 3FYCA 4LRTA 3SARA 3TE6A 4KLNA 1L2DA 4MGYE 4QHSA 4A3VB 2CUZA 4M9SA 3VK7A 4NSOB 1JR3A 3Q8XA 3QWLA 4D81A 3HWSA 3GLIB 1TDHA 1JR3D 4G6ZA 3TWMA 1NHWC 3TWKA 4QOZC 4BB9A 4NSRA 4W5WA 4X65M 2W82A 4IBEA 4AG5A 3U5ZA 1IN7A 3LQRA 2DZOB 5FTJA 5FSWA 2XH9A 4M0WA 2QPAA 4FCWA 3W0LB 3GPXA 2XZFA 1K82A 5EP1A 2XSZA 4X66M 3NBIA 4JN6A 3RGSA 3UMMA 2DXIA 2XLJA 5FLXS 1IY0A 2XSZD 3SC3A 4CHTB 4D82A 3AKZA 4DR6M 1KYIA 4DV5M 2UXDM 3LVVA 4GMQA 3PVSA 1Z6TA 4LFCM 2KW0A 3BOSA 4PDIA 3J7BA 5C1BA 2FOIC 3FTFA 5KQ8A 2QBYA 4L78A 3H4MA 4AI6A 1XMQM 3U61A 3LVWA 2BJVA 2V6ZM 2DWMA 4YY3M 4GC5A 2CHVA 4I5SA 4M9ZA 3ZC7B 2D7EA 2ZANA 1PM5A 3L25A 5IREB 1SXJC 3L28A 3GQ5A 2Y0QA 4QNMA 3B9PA 3GQ4A 5A2QS 1HR0M 3GLFA 1GVNA 3WHLA 2UXCM 2NQ8C 1WXQA 3HJ8A 4CISA 1HNWM 1NSFA 3SFZA 3KS8A 3SASA 4MGHA 4QHTA 2UU9M 4DV1M 3ZH9B 1Z5BA 2KRKA 4I81A 4AQYM 1HNXM 3U6CA 4JI1M 3HHWA 5EP4A 5JI3E 3CTWB 5KO3A 4RNAA 2UXBM 4B7HA 5H37D 3GP1A 2YR0A 4OW0A 4DUYM 2QCUA 3DFZA 3GRUA 5ITTA 4KODA 1R7RA 3U6PA 3CF6E 4GH9A 4IIWA 4LRSA 3J81S 1K3WA 4LG2A 4X64M 4FCTA 4JI8M 3FTEA 2ZBKB 3R8FA 4DV2M 1L2BA 1E94E 2F5OA 4LF9M 1NNUC 2JA2A 5FTLA 4B3RM 4HLQA 1FNNA 4LJ6A 1N32M 3I51A 2EA0A 4DV7M 3AOEC 1TGUA 3PNVA 4DUZM 1DGBA 2A5YB 5DNYA 3HJQA 1XC8A 3GQ3A 5E6JA 5GKNA 1E9RA 3SMSA 1DGHA 4LJ7A 3GPPA 2XEPA 2XF3A 2CFOA 1R6BX 5ITXE 3L26A 1PJJA 2D7HA 2XFSA 3NWLA 1UM8A 1L2CA 4JI7M 2R18A 4LFBM 2P5TA 5ITRA 1QVRA 3MK6A 1Z59A 2R4JA 1HNZM 2VIIA 2RGHA 4MH0E 4P16A 4LGYA 1N34M 2XGNA 4GKJM 2BJWA 2YFQA 3GRVA 5EXPA 3FUVA 4LFAM 4GIPA 1N36M 1I94M 4BBAA 2F5QA 1N33M 4KHPM 2Z4SA 4HL4A 4LF7M 1N78A 3T38A 4PD2A 2AHMA 1J7KA 4AG6A 1MX0A 1XXHB 2HKJA 1IM2A 1IY2A 1KSFX 4JI6M 1L8QA 4LF6M 1IY1A 3SAVA 3DZDA 2CEAA 1E9SA 1JQJC 3U60A 5EQTA 2F4VM 5DYIA 3SATA 1K3XA 1Z5CA 4R3DA 3THGA 4DV0M 5DYGA 4DR5M 2C96A 1TDZA 2CV1A 4OU7A 4FCVA 3HHZA 1DO2A 4RF1A 1R2ZA 1J09A 3KOXE 3FUXA 2OQ4A 4IBBA 4GC9A 2I7NA 2F5PA 3KOZE 1G3IA 2L6OA 4IJFA 2UUCM 4RF0A 3HU1A 1NNJA 1XNQM 3AL0C 1TH3A 5ITUA 4DR7M 2X8AA 5IWAM 3KW6A 3FTCA 3KS4A 3FTDA 2KRUA 2CE7A 1W5SA 4MGIE 1QQWA 3TL4X 1L1ZA 3VDPA 3GRRA 1XNRM 1G4AE 5ITYA 4BLCA 3GLGA 4PCZA 1XHBA 2HL7A 2G5GX 2EUCA 1OJLA 1GL7A 1N77A 3FKEA 3TWLA 2XZUA 4B3MM 4AZFA 3VKHA 3RGPA 2M5ZA 1LV7A 2LNHC 5EXTA 1E32A 3TQSA 1IXRC 4TUWA 3JR4A 1SXJA 4IBJA 3C58A 5FTKA 4LZJA 4R7GA 1SXJD 2C9CA 3GLHB 4ITQA 1Q3CA 3HHXA 4XGIA 3UK6A 1ZAEA 1GL6A 4MM3B 3L2AA 3VK8A 1NJGA 3L29A 4OVZB 4CGYB 4NOOB 2J7OA 1EE8A 2L7IA 2DVWB 5IZ7D 1I4WA 2H1RA 3UGJA 1IBLM 1MU5A 1IN4A 4JI0M 3M0EA 2EO2A 1YSYA 4JV5M 3GLIA 5IT9S 3VLFB 3FUTA 3HJSA 1G59A 2KZUA 1HT2E 3A42A 2VQEM 2F5NA 4G4OA 1QAQA 1NHGC 2HCBA 3AOEA 3SBJA 1PJIA 2E5LM 5LMNM 1QZMA 3WHKA 3SYKA 4LJ4A 1OFIA 2YQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5Q A;  1N33 M;  2ZM6 M;  4DV3 M;  4KHP M;  4DV6 M;  3U6L A;  4JI5 M;  4LF7 M;  4PD2 A;  1MX0 A;  3DOA A;  2HKJ A;  2VQF M;  1K82 A;  3GPX A;  2XZF A;  1IBK M;  4X66 M;  4JI6 M;  4LF6 M;  3SAV A;  4LF4 M;  3U6Q A;  5FLX S;  4DR3 M;  4DR6 M;  1Q3B A;  4DV5 M;  2UXD M;  2F4V M;  3U6E A;  3SAT A;  4LFC M;  1K3X A;  3J80 S;  4X62 M;  3GPY A;  1Z5C A;  4PDI A;  4DV0 M;  4DR5 M;  1TDZ A;  3SAU A;  2OPF A;  2UUB M;  5LMU M;  1XMQ M;  1R2Z A;  2OQ4 A;  2F5S A;  3J7A S;  4GKK M;  4YY3 M;  2F5P A;  2Q2E B;  2UUC M;  3A45 A;  4K0K M;  1NNJ A;  1XNQ M;  4NXM M;  1PM5 A;  4G4Q A;  4B3T M;  5ITU A;  4DR7 M;  3GQ5 A;  1KFV A;  5IWA M;  3A46 A;  3GQ4 A;  4NRV A;  5A2Q S;  1HR0 M;  4NRW A;  1R2Y A;  2UUA M;  1L1Z A;  2UXC M;  4CIS A;  1HNW M;  5BR8 M;  1XNR M;  3SAS A;  5ITY A;  2UU9 M;  4DV1 M;  4PCZ A;  1Z5B A;  4AQY M;  3U6S A;  1HNX M;  4G4R A;  3U6C A;  3JR5 A;  2HHH M;  1L1T A;  4JI1 M;  3T1Y M;  3TWL A;  5ITX A;  4YHH M;  2XZU A;  4B3M M;  4OX9 M;  2UXB M;  3W0F A;  3GP1 A;  4LF8 M;  4DUY M;  5ITQ A;  4JI2 M;  3T1H M;  1Z5A A;  5ITT A;  3GO8 A;  3JR4 A;  4DR4 M;  3JAM S;  3C58 A;  3U6P A;  3J81 S;  3U6M A;  1K3W A;  4ITQ A;  4X64 M;  1Q3C A;  4JI8 M;  4JI4 M;  2ZBK B;  4DV2 M;  1L2B A;  4LF5 M;  2F5O A;  4LF9 M;  3OTO M;  4B3R M;  4G4N A;  4JI3 M;  4DV4 M;  4PDG A;  4MB7 A;  2EA0 A;  4DV7 M;  3U6D A;  1N32 M;  4DR1 M;  3VK8 A;  4DUZ M;  4NXN M;  1EE8 A;  1XC8 A;  3GQ3 A;  4DR2 M;  1Q39 A;  3U6O A;  3SAW A;  1IBL M;  3SAR A;  1MU5 A;  4JI0 M;  3GPP A;  1L2D A;  1IBM M;  4JV5 M;  5ITX E;  1PJJ A;  5IT9 S;  1J5E M;  1L2C A;  3VK7 A;  4JI7 M;  4JYA M;  3GPU A;  4LFB M;  3A42 A;  5ITR A;  1TDH A;  2VQE M;  2F5N A;  3TWM A;  4G4O A;  1PJI A;  3TWK A;  1Z59 A;  3SBJ A;  2E5L M;  5LMN M;  1HNZ M;  1FJG M;  4X65 M;  1N34 M;  4GKJ M;  4LFA M;  4B3S M;  1N36 M;  1XMO M;  1I94 M; 
#chains in the Genus database with same CATH topology
 5EP3 A;  2ZM6 M;  4DV3 M;  4LY6 A;  1OQY A;  4DV6 M;  3U6L A;  4JI5 M;  1IN8 A;  1V34 A;  2EKK A;  2VQF M;  3PFI A;  3SHG B;  3U5Z B;  5F3W A;  4ZPX A;  2JY6 B;  4LF4 M;  2ERC A;  1WHC A;  3SYL A;  4DR3 M;  1IN5 A;  2CV0 A;  2KEB A;  1ZMU A;  3I04 M;  3FUW A;  4X62 M;  1N75 A;  1ZQ9 A;  2CP8 A;  2FNA A;  3QYB A;  4F1I A;  3SAU A;  2VF8 A;  4FWH A;  3K9P A;  3IEC A;  2QZ4 A;  4IBF A;  5LMU M;  4IJE A;  1JR3 E;  3MHV C;  4P17 A;  2F5S A;  3B7N A;  3J7A S;  4L15 A;  1QAM A;  2VDB B;  2QBY B;  3GRY A;  2LTU A;  2OOB A;  3E9S A;  3VDU A;  4M0D A;  3FRI A;  3U61 B;  1OFH A;  3LMM A;  4G4Q A;  4B3T M;  2L4E A;  2R0I A;  2R62 A;  3KOW E;  3KSJ A;  2Z3X A;  3D8L A;  1KFV A;  4FD2 A;  3A46 A;  1G41 A;  2Z4R A;  4LJ9 A;  3RFW A;  2V1C A;  3FRH A;  1JB0 F;  2DWL A;  4GIT A;  4NRW A;  1OIZ A;  1R2Y A;  2UUA M;  3VKG A;  2QNJ A;  4GEW A;  1HQY E;  2JP7 A;  4MGK E;  5C18 A;  1UFZ A;  2X4A A;  1H6U A;  2KXE A;  2QEN A;  3E21 A;  3IHP A;  4CJ6 A;  3U6S A;  1HQC A;  3RE8 A;  1Y8G A;  2BNK A;  3GLF B;  2CHG A;  3JR5 A;  4G4R A;  4LJ8 A;  1X37 A;  3T1Y M;  1L1T A;  5ITX A;  2DHR A;  2LWX A;  1AIP C;  3KSX A;  4Z8X A;  5JI2 E;  4IBD A;  4YHH M;  3FD9 A;  4WUR A;  3W0F A;  4LF8 M;  5BPV A;  3T1H M;  3SHF A;  3GO8 A;  2CV2 A;  1NY5 A;  1TR8 A;  3AFH A;  1VG5 A;  2L7H A;  4R71 A;  3HGI A;  1DO0 A;  2XFT A;  3KXE C;  4QNR A;  1NY6 A;  2JUJ A;  4EIW A;  2K9D A;  4JI4 M;  3CF0 A;  1SXJ E;  1V33 A;  3VFD A;  1QYR A;  3FE3 A;  1LTM A;  2KZS A;  2WSE F;  4II7 A;  3OTO M;  3AOG A;  4MGZ E;  1WIV A;  1NV8 A;  1YUB A;  2R46 A;  4JI3 M;  3E4R A;  4MB7 A;  3U6D A;  4IBI A;  4PT5 A;  4I4L A;  4DR1 M;  4L4U A;  3QAU A;  2KNZ A;  4GHL A;  2DEN A;  4NXN M;  3GLF E;  3KVW A;  2DAM A;  1Q39 A;  3K92 A;  3PXG A;  2C99 A;  3HZJ A;  3I4V A;  4QOS A;  2LVA A;  3HU3 A;  2JY8 A;  1IQP A;  2R65 A;  3KP0 E;  1PJQ A;  5EJC A;  5KPT A;  1OTR A;  5FTM A;  2R45 A;  1IBM M;  3LCU A;  2LXE A;  2RKO A;  3KP1 E;  5E26 A;  4JXJ A;  2I7P A;  4WW0 A;  2R4E A;  3K2L A;  5L8R F;  3KFU G;  1TF0 B;  1DGH B;  4IBG A;  4LJA A;  1J5E M;  5EXX A;  4JYA M;  1NO1 A;  1TH2 A;  4LJ5 A;  3GPU A;  4AKI A;  1D0K A;  2JY5 A;  2ZAO A;  4L16 A;  3TPZ A;  2C5R A;  4LGM A;  1IXZ A;  2Z7J A;  1QAN A;  1XB2 B;  2DAG A;  2BWB A;  2DWZ B;  4IBK A;  1XXH A;  1T6O A;  3J27 B;  4KT0 F;  4XBO A;  2DZL A;  3HKP A;  1FJG M;  4B3S M;  4Z6Y A;  1C1K A;  1GKI A;  1XMO M;  2UUB M;  3J2P B;  1VQ1 A;  1TTE A;  2LVO C;  3KOY E;  2X49 A;  3EIH A;  3DOA A;  4WP2 A;  2FS1 A;  2QP9 X;  3AV0 A;  1EIJ A;  3R9X B;  3KDS E;  3I4Y A;  3Q8G A;  3PNY A;  1IBK M;  2CWB A;  1G8P A;  3U6Q A;  3K1J A;  1GLN A;  2M60 A;  2APL A;  1Q3B A;  3MJ5 A;  1PJS A;  2D7G A;  3FUU A;  4D80 A;  2LH0 A;  3U6E A;  4GHA A;  5EXS A;  1ZMW A;  3J80 S;  1DGG A;  3GPY A;  1W5T A;  1BVS A;  2K6B A;  1DV0 A;  3M7G A;  1VDD A;  2K47 A;  4AW4 A;  1NJF A;  3U60 B;  2OPF A;  3L27 A;  1NVM A;  2G8L A;  4NL4 H;  2Y20 A;  3EIE A;  4LCB A;  2ZTC A;  3K8Z A;  3DA1 A;  2RGO A;  2J7N A;  4GKK M;  2DWN A;  3C3E A;  2L4F A;  2V1U A;  2Q2E B;  1GJS A;  4IBC A;  1IN6 A;  3A45 A;  3FYD A;  4K0K M;  3AJI B;  4NXM M;  2MGW A;  2O25 A;  3B74 A;  4NC6 A;  3LQQ A;  1QAO A;  1YE9 A;  5KQD A;  5KPR A;  3IG8 A;  2C9O A;  3HU2 A;  4LZZ A;  2CRU A;  4NRV A;  4FWD A;  2KA6 B;  4AKG A;  2O5R A;  2Y0T A;  2FFJ A;  4I8O A;  3V76 A;  1S3S A;  5BR8 M;  1HT1 E;  2YNM D;  2MR9 A;  1D2N A;  2EKF A;  1ORY B;  2JY7 A;  2J5Y A;  2DAI A;  4B7G A;  3ZCB B;  4XK8 F;  4AKH A;  4FW9 A;  2HHH M;  4L8R C;  4FVM A;  4OX9 M;  1XWI A;  4B08 A;  1CUK A;  2C98 A;  3H4J A;  3D8B A;  3GLG B;  2DZN B;  3GLH A;  4S12 A;  5ITQ A;  4JI2 M;  1Z5A A;  2LHG A;  7CAT A;  4DR4 M;  4FWG A;  4B7F A;  3JAM S;  3NBX X;  3IG5 A;  4Q7J A;  5EP2 A;  8CAT A;  2MJ5 B;  3U6M A;  3M6A A;  1G71 A;  2Y21 A;  1SXJ B;  3CF2 A;  2CHQ A;  4LF5 M;  1DGF A;  2FE8 A;  4M9X A;  3C9P A;  3ILK A;  2H5X A;  1OIP A;  4GRI A;  4OVZ A;  3UZU A;  1SG9 A;  2KNV A;  3HHY A;  3SMP A;  3UJN A;  1TH4 A;  4G4N A;  3A98 B;  1T3T A;  5FTN A;  4PDG A;  5KPZ A;  4DV4 M;  4ANR A;  2ZAM A;  4RKU F;  2LBC A;  2N35 A;  1IXS B;  4DR2 M;  3K9O A;  2HWJ A;  3HY5 A;  3U6O A;  2L09 A;  3SAW A;  3GLG E;  3B89 A;  4KO8 A;  3T15 A;  4REZ A;  3FYC A;  4LRT A;  3SAR A;  3TE6 A;  2MH8 A;  4KLN A;  1L2D A;  2VF7 A;  4MGY E;  2O01 F;  4QHS A;  1D0L A;  2FH0 A;  4A3V B;  2CUZ A;  4UN2 B;  4M9S A;  3VK7 A;  4NSO B;  1JR3 A;  3Q8X A;  3QWL A;  4D81 A;  3HWS A;  3GLI B;  1TDH A;  1JR3 D;  4G6Z A;  3TWM A;  1NHW C;  3TWK A;  4QOZ C;  4BB9 A;  4NSR A;  4W5W A;  1Q02 A;  2KNA A;  2W82 A;  4X65 M;  4IBE A;  4AG5 A;  3U5Z A;  1IN7 A;  3LQR A;  2DZO B;  5FTJ A;  5FSW A;  2XH9 A;  4L6V 6;  4M0W A;  2QPA A;  4FCW A;  3W0L B;  3GPX A;  1QDR A;  2XZF A;  5EP1 A;  1K82 A;  2JZ0 A;  1V92 A;  2XSZ A;  4X66 M;  3NBI A;  2EJS A;  4JN6 A;  3RGS A;  2DAE A;  3UMM A;  2DXI A;  2XLJ A;  5FLX S;  1IY0 A;  2XSZ D;  3SC3 A;  4CHT B;  4D82 A;  3AKZ A;  4DR6 M;  1KYI A;  4DV5 M;  2UXD M;  3LVV A;  4GMQ A;  3PVS A;  1Z6T A;  2LVP C;  2BWE A;  2KW0 A;  3BOS A;  4LFC M;  3MMP A;  4PDI A;  3J7B A;  5C1B A;  2FOI C;  3GLI E;  3FTF A;  5KQ8 A;  2QBY A;  4L78 A;  1WJ7 A;  1RU3 A;  3H4M A;  4AI6 A;  2GQF A;  1XMQ M;  3U61 A;  3LVW A;  2BJV A;  4G3O A;  2V6Z M;  2DWM A;  4YY3 M;  4GC5 A;  2CHV A;  4I5S A;  4M9Z A;  1HJP A;  3ZC7 B;  1VDL A;  2D7E A;  1OAI A;  2ZAN A;  1PM5 A;  3L25 A;  5IRE B;  1SXJ C;  3L28 A;  3GQ5 A;  2Y0Q A;  2Z8Y M;  3B9P A;  4QNM A;  3GQ4 A;  5A2Q S;  1HR0 M;  3GLF A;  1GVN A;  1VEG A;  3WHL A;  2NQ8 C;  2UXC M;  1GAB A;  1WXQ A;  3HJ8 A;  4CIS A;  1HNW M;  1NSF A;  3SFZ A;  3KS8 A;  3SAS A;  4MGH A;  4QHT A;  2UU9 M;  4DV1 M;  3ZH9 B;  2KRK A;  1Z5B A;  4I81 A;  4AQY M;  1HNX M;  3U6C A;  4JI1 M;  3HHW A;  5EP4 A;  5JI3 E;  1EFU B;  3CTW B;  5KO3 A;  2LHC A;  4RNA A;  3QYE A;  4B7H A;  5H37 D;  3GP1 A;  2UXB M;  2YR0 A;  4OW0 A;  4DUY M;  2QCU A;  3DFZ A;  2LVN C;  3GRU A;  4KOD A;  1PJT A;  5ITT A;  2DAK A;  1R7R A;  3U6P A;  3ZQJ A;  1C7Y A;  3CGW A;  3CF6 E;  1QUT A;  2ZTD A;  4GH9 A;  4IIW A;  4LRS A;  4Y28 F;  3J81 S;  1K3W A;  2QHO B;  4LG2 A;  3GLH E;  4X64 M;  4FCT A;  4JI8 M;  3FTE A;  2ZBK B;  3R8F A;  4DV2 M;  1L2B A;  1E94 E;  3HX3 A;  2F5O A;  4LF9 M;  1AUA A;  1NNU C;  2JA2 A;  5FTL A;  4B3R M;  1PGY A;  2DNA A;  4HLQ A;  1FNN A;  4LJ6 A;  1N32 M;  3I51 A;  2EA0 A;  4DV7 M;  1WGL A;  2R44 A;  1R4G A;  2QQ8 A;  3AOE C;  1TGU A;  3LCV B;  3PNV A;  4DUZ M;  1DGB A;  2A5Y B;  3I01 M;  5DNY A;  3HJQ A;  1XC8 A;  3GQ3 A;  5E6J A;  5GKN A;  1QZE A;  1ZV1 A;  1E9R A;  3SMS A;  2WSF F;  1DGH A;  1OAO C;  4LJ7 A;  4CIZ A;  3GPP A;  1GO5 A;  2XEP A;  2XF3 A;  2CFO A;  1YLA A;  1R6B X;  5ITX E;  1IFY A;  3L26 A;  1PJJ A;  4F2L A;  2D7H A;  2XFS A;  3NWL A;  1UM8 A;  1L2C A;  4JI7 M;  2R18 A;  2HAK A;  4LFB M;  2P5T A;  2R6F A;  5ITR A;  1QVR A;  3MK6 A;  2KHH A;  1Z59 A;  2R4J A;  1HNZ M;  1WR1 B;  2RGH A;  2VII A;  4MH0 E;  4P16 A;  4LGY A;  1N34 M;  2XGN A;  4GKJ M;  2BJW A;  2YFQ A;  3GRV A;  5EXP A;  3FUV A;  4LFA M;  4GIP A;  1N36 M;  1I94 M;  4BBA A;  2F5Q A;  1N33 M;  4KHP M;  2LVQ D;  2Z4S A;  3E46 A;  4HL4 A;  4LF7 M;  1N78 A;  3T38 A;  4PD2 A;  2AHM A;  1J7K A;  4AG6 A;  1MX0 A;  1XXH B;  2HKJ A;  1A5T A;  1IM2 A;  1IY2 A;  1KSF X;  4JI6 M;  1L8Q A;  1PRB A;  1IY1 A;  4LF6 M;  3SAV A;  1ZMV A;  3DZD A;  2CEA A;  3LW5 F;  1E9S A;  1JQJ C;  3U60 A;  5EQT A;  3F92 A;  2F4V M;  2JXN A;  2L2D A;  2WSC F;  5DYI A;  3SAT A;  1K3X A;  1VEK A;  1Z5C A;  4R3D A;  3THG A;  4DV0 M;  5DYG A;  4DR5 M;  2C96 A;  1TDZ A;  2CV1 A;  4OU7 A;  4FCV A;  3HHZ A;  2G3Q A;  1DO2 A;  4RF1 A;  1MN3 A;  1R2Z A;  2RRU A;  1J09 A;  3BXW A;  3KOX E;  1QUS A;  3FUX A;  2OQ4 A;  1R5L A;  4IBB A;  4GC9 A;  2I7N A;  2F5P A;  3KOZ E;  1G3I A;  2L6O A;  4IJF A;  2UUC M;  1NV9 A;  4RF0 A;  3HU1 A;  1NNJ A;  1XNQ M;  3AL0 C;  1XXH E;  1TH3 A;  5ITU A;  3W67 A;  2JNH A;  4DR7 M;  2X8A A;  5IWA M;  3KW6 A;  3FTC A;  3KS4 A;  3FTD A;  4DBG B;  2KRU A;  2CE7 A;  1W5S A;  4MGI E;  1QQW A;  1GJT A;  3TL4 X;  1L1Z A;  2KDL A;  3T6P A;  3VDP A;  3GRR A;  1XNR M;  1G4A E;  5ITY A;  4BLC A;  3GLG A;  4PCZ A;  2JWS A;  1XHB A;  2HL7 A;  2DKL A;  2EUC A;  2G5G X;  1OJL A;  1GL7 A;  1N77 A;  3BBZ A;  3FKE A;  3TWL A;  2XZU A;  4B3M M;  4AZF A;  3VKH A;  3RGP A;  2JZ1 A;  2M5Z A;  1LV7 A;  2LNH C;  5EXT A;  1E32 A;  3TQS A;  1IXR C;  4TUW A;  3JR4 A;  1SXJ A;  4IBJ A;  3C58 A;  5FTK A;  4LZJ A;  2OOA A;  1OKS A;  4R7G A;  1SXJ D;  2C9C A;  3B7Z A;  3GLH B;  1WGN A;  4ITQ A;  1Q3C A;  5DFL A;  2DI0 A;  1F4I A;  3HHX A;  4XGI A;  1IXS A;  3UK6 A;  1ZAE A;  2K0B X;  1GL6 A;  4MM3 B;  3L2A A;  2DHY A;  3VK8 A;  1NJG A;  1QDT A;  3L29 A;  4OVZ B;  4CGY B;  4NOO B;  2J7O A;  3W68 A;  1EE8 A;  2L7I A;  2B3T A;  2DVW B;  5IZ7 D;  1I4W A;  2H1R A;  4HEO A;  2GNO A;  3UGJ A;  1IBL M;  1MU5 A;  1IN4 A;  4JI0 M;  3M0E A;  2EO2 A;  2WZJ A;  2QSF X;  1P3Q Q;  1YSY A;  4JV5 M;  3GLI A;  5IT9 S;  1D0M A;  3VLF B;  3FUT A;  2OO9 A;  3HJS A;  1G59 A;  1T43 A;  2KZU A;  1HT2 E;  1MJG M;  3A42 A;  2VQE M;  2F5N A;  4G4O A;  1QAQ A;  1NHG C;  2HCB A;  3AOE A;  3B7Q A;  3SBJ A;  1PJI A;  1VEJ A;  5LMN M;  2E5L M;  1QZM A;  3WHK A;  3C3D A;  3SYK A;  4LJ4 A;  1OFI A;  2MRO B;  2YQZ A; 
#chains in the Genus database with same CATH homology
 5EP3 A;  2ZM6 M;  4DV3 M;  4LY6 A;  4DV6 M;  3U6L A;  4JI5 M;  1IN8 A;  2VQF M;  3PFI A;  3SHG B;  3U5Z B;  5F3W A;  4ZPX A;  4LF4 M;  2ERC A;  3SYL A;  4DR3 M;  1IN5 A;  2CV0 A;  2KEB A;  3FUW A;  4X62 M;  1N75 A;  1ZQ9 A;  2FNA A;  3SAU A;  4FWH A;  2QZ4 A;  4IBF A;  5LMU M;  4IJE A;  3MHV C;  2F5S A;  3J7A S;  4L15 A;  1QAM A;  2QBY B;  3GRY A;  3E9S A;  3VDU A;  4M0D A;  3U61 B;  1OFH A;  3LMM A;  4G4Q A;  4B3T M;  3KOW E;  2R62 A;  3KSJ A;  2Z3X A;  3D8L A;  1KFV A;  4FD2 A;  3A46 A;  1G41 A;  2Z4R A;  4LJ9 A;  3RFW A;  2V1C A;  2DWL A;  4GIT A;  4NRW A;  1R2Y A;  2UUA M;  3VKG A;  1HQY E;  4MGK E;  5C18 A;  2X4A A;  1H6U A;  2KXE A;  2QEN A;  3U6S A;  1HQC A;  3RE8 A;  2BNK A;  3GLF B;  4G4R A;  2CHG A;  3JR5 A;  1L1T A;  4LJ8 A;  1X37 A;  3T1Y M;  5ITX A;  2DHR A;  2LWX A;  3KSX A;  4Z8X A;  5JI2 E;  4YHH M;  4IBD A;  3FD9 A;  4WUR A;  3W0F A;  4LF8 M;  5BPV A;  3T1H M;  3SHF A;  3GO8 A;  2CV2 A;  1NY5 A;  3AFH A;  2L7H A;  3HGI A;  1DO0 A;  2XFT A;  3KXE C;  4QNR A;  1NY6 A;  4EIW A;  4JI4 M;  3CF0 A;  1SXJ E;  3VFD A;  1QYR A;  2KZS A;  4II7 A;  3OTO M;  3AOG A;  4MGZ E;  1YUB A;  2R46 A;  4JI3 M;  3E4R A;  4MB7 A;  3U6D A;  4IBI A;  4PT5 A;  4I4L A;  4DR1 M;  4L4U A;  3QAU A;  4GHL A;  4NXN M;  3KVW A;  1Q39 A;  3K92 A;  3PXG A;  2C99 A;  3I4V A;  4QOS A;  3HU3 A;  1IQP A;  2R65 A;  3KP0 E;  5EJC A;  5KPT A;  5FTM A;  2R45 A;  1IBM M;  2LXE A;  2RKO A;  3KP1 E;  5E26 A;  4JXJ A;  2I7P A;  4WW0 A;  2R4E A;  3K2L A;  3KFU G;  4LJA A;  1DGH B;  4IBG A;  1J5E M;  5EXX A;  4JYA M;  4LJ5 A;  1TH2 A;  3GPU A;  4AKI A;  2ZAO A;  3TPZ A;  4L16 A;  2C5R A;  4LGM A;  1IXZ A;  2Z7J A;  1QAN A;  2DWZ B;  4IBK A;  1XXH A;  1FJG M;  3J27 B;  4XBO A;  3HKP A;  4B3S M;  4Z6Y A;  1GKI A;  1C1K A;  1XMO M;  2UUB M;  3J2P B;  3KOY E;  2X49 A;  3EIH A;  3DOA A;  2QP9 X;  3AV0 A;  3R9X B;  3KDS E;  3I4Y A;  3PNY A;  1IBK M;  1G8P A;  3U6Q A;  3K1J A;  1GLN A;  2M60 A;  3MJ5 A;  1Q3B A;  2D7G A;  3FUU A;  4D80 A;  2LH0 A;  3U6E A;  4GHA A;  5EXS A;  3J80 S;  1DGG A;  3GPY A;  1W5T A;  3M7G A;  1VDD A;  2K47 A;  4AW4 A;  1NJF A;  3U60 B;  2OPF A;  3L27 A;  1NVM A;  2G8L A;  4NL4 H;  2Y20 A;  3EIE A;  4LCB A;  3K8Z A;  3DA1 A;  2RGO A;  2J7N A;  4GKK M;  2DWN A;  2V1U A;  2Q2E B;  4IBC A;  1IN6 A;  3A45 A;  3FYD A;  4K0K M;  3AJI B;  4NXM M;  5KQD A;  3LQQ A;  1QAO A;  1YE9 A;  5KPR A;  3IG8 A;  2C9O A;  3HU2 A;  4LZZ A;  4NRV A;  4FWD A;  2KA6 B;  4AKG A;  2O5R A;  2Y0T A;  2FFJ A;  4I8O A;  1S3S A;  5BR8 M;  1HT1 E;  2YNM D;  1D2N A;  4B7G A;  1ORY B;  3ZCB B;  4AKH A;  4FW9 A;  2HHH M;  4L8R C;  4FVM A;  4OX9 M;  1XWI A;  4B08 A;  2C98 A;  3D8B A;  3GLG B;  2DZN B;  3GLH A;  4S12 A;  5ITQ A;  4JI2 M;  1Z5A A;  7CAT A;  4DR4 M;  4FWG A;  4B7F A;  3JAM S;  3IG5 A;  5EP2 A;  8CAT A;  3U6M A;  3M6A A;  2Y21 A;  1SXJ B;  3CF2 A;  2CHQ A;  4LF5 M;  1DGF A;  2FE8 A;  4M9X A;  3ILK A;  4OVZ A;  3UZU A;  4GRI A;  3HHY A;  3SMP A;  3UJN A;  1TH4 A;  4G4N A;  3A98 B;  1T3T A;  5FTN A;  4PDG A;  5KPZ A;  4DV4 M;  2ZAM A;  1IXS B;  4DR2 M;  3U6O A;  2L09 A;  3SAW A;  4KO8 A;  3T15 A;  4REZ A;  3FYC A;  4LRT A;  3SAR A;  3TE6 A;  4KLN A;  1L2D A;  4MGY E;  4QHS A;  4A3V B;  2CUZ A;  4M9S A;  3VK7 A;  4NSO B;  1JR3 A;  3Q8X A;  3QWL A;  4D81 A;  3HWS A;  3GLI B;  1TDH A;  1JR3 D;  4G6Z A;  3TWM A;  1NHW C;  3TWK A;  4QOZ C;  4BB9 A;  4NSR A;  4W5W A;  4X65 M;  2W82 A;  4IBE A;  4AG5 A;  3U5Z A;  1IN7 A;  3LQR A;  2DZO B;  5FTJ A;  5FSW A;  2XH9 A;  4M0W A;  2QPA A;  4FCW A;  3W0L B;  3GPX A;  2XZF A;  1K82 A;  5EP1 A;  2XSZ A;  4X66 M;  3NBI A;  4JN6 A;  3RGS A;  3UMM A;  2DXI A;  2XLJ A;  5FLX S;  1IY0 A;  2XSZ D;  3SC3 A;  4CHT B;  4D82 A;  3AKZ A;  4DR6 M;  1KYI A;  4DV5 M;  2UXD M;  3LVV A;  4GMQ A;  3PVS A;  1Z6T A;  4LFC M;  2KW0 A;  3BOS A;  4PDI A;  3J7B A;  5C1B A;  2FOI C;  3FTF A;  5KQ8 A;  2QBY A;  4L78 A;  3H4M A;  4AI6 A;  1XMQ M;  3U61 A;  3LVW A;  2BJV A;  2V6Z M;  2DWM A;  4YY3 M;  4GC5 A;  2CHV A;  4I5S A;  4M9Z A;  3ZC7 B;  2D7E A;  2ZAN A;  1PM5 A;  3L25 A;  5IRE B;  1SXJ C;  3L28 A;  3GQ5 A;  2Y0Q A;  4QNM A;  3B9P A;  3GQ4 A;  5A2Q S;  1HR0 M;  3GLF A;  1GVN A;  3WHL A;  2UXC M;  2NQ8 C;  1WXQ A;  3HJ8 A;  4CIS A;  1HNW M;  1NSF A;  3SFZ A;  3KS8 A;  3SAS A;  4MGH A;  4QHT A;  2UU9 M;  4DV1 M;  3ZH9 B;  1Z5B A;  2KRK A;  4I81 A;  4AQY M;  1HNX M;  3U6C A;  4JI1 M;  3HHW A;  5EP4 A;  5JI3 E;  3CTW B;  5KO3 A;  4RNA A;  2UXB M;  4B7H A;  5H37 D;  3GP1 A;  2YR0 A;  4OW0 A;  4DUY M;  2QCU A;  3DFZ A;  3GRU A;  5ITT A;  4KOD A;  1R7R A;  3U6P A;  3CF6 E;  4GH9 A;  4IIW A;  4LRS A;  3J81 S;  1K3W A;  4LG2 A;  4X64 M;  4FCT A;  4JI8 M;  3FTE A;  2ZBK B;  3R8F A;  4DV2 M;  1L2B A;  1E94 E;  2F5O A;  4LF9 M;  1NNU C;  2JA2 A;  5FTL A;  4B3R M;  4HLQ A;  1FNN A;  4LJ6 A;  1N32 M;  3I51 A;  2EA0 A;  4DV7 M;  3AOE C;  1TGU A;  3PNV A;  4DUZ M;  1DGB A;  2A5Y B;  5DNY A;  3HJQ A;  1XC8 A;  3GQ3 A;  5E6J A;  5GKN A;  1E9R A;  3SMS A;  1DGH A;  4LJ7 A;  3GPP A;  2XEP A;  2XF3 A;  2CFO A;  1R6B X;  5ITX E;  3L26 A;  1PJJ A;  2D7H A;  2XFS A;  3NWL A;  1UM8 A;  1L2C A;  4JI7 M;  2R18 A;  4LFB M;  2P5T A;  5ITR A;  1QVR A;  3MK6 A;  1Z59 A;  2R4J A;  1HNZ M;  2VII A;  2RGH A;  4MH0 E;  4P16 A;  4LGY A;  1N34 M;  2XGN A;  4GKJ M;  2BJW A;  2YFQ A;  3GRV A;  5EXP A;  3FUV A;  4LFA M;  4GIP A;  1N36 M;  1I94 M;  4BBA A;  2F5Q A;  1N33 M;  4KHP M;  2Z4S A;  4HL4 A;  4LF7 M;  1N78 A;  3T38 A;  4PD2 A;  2AHM A;  1J7K A;  4AG6 A;  1MX0 A;  1XXH B;  2HKJ A;  1IM2 A;  1IY2 A;  1KSF X;  4JI6 M;  1L8Q A;  4LF6 M;  1IY1 A;  3SAV A;  3DZD A;  2CEA A;  1E9S A;  1JQJ C;  3U60 A;  5EQT A;  2F4V M;  5DYI A;  3SAT A;  1K3X A;  1Z5C A;  4R3D A;  3THG A;  4DV0 M;  5DYG A;  4DR5 M;  2C96 A;  1TDZ A;  2CV1 A;  4OU7 A;  4FCV A;  3HHZ A;  1DO2 A;  4RF1 A;  1R2Z A;  1J09 A;  3KOX E;  3FUX A;  2OQ4 A;  4IBB A;  4GC9 A;  2I7N A;  2F5P A;  3KOZ E;  1G3I A;  2L6O A;  4IJF A;  2UUC M;  4RF0 A;  3HU1 A;  1NNJ A;  1XNQ M;  3AL0 C;  1TH3 A;  5ITU A;  4DR7 M;  2X8A A;  5IWA M;  3KW6 A;  3FTC A;  3KS4 A;  3FTD A;  2KRU A;  2CE7 A;  1W5S A;  4MGI E;  1QQW A;  3TL4 X;  1L1Z A;  3VDP A;  3GRR A;  1XNR M;  1G4A E;  5ITY A;  4BLC A;  3GLG A;  4PCZ A;  1XHB A;  2HL7 A;  2G5G X;  2EUC A;  1OJL A;  1GL7 A;  1N77 A;  3FKE A;  3TWL A;  2XZU A;  4B3M M;  4AZF A;  3VKH A;  3RGP A;  2M5Z A;  1LV7 A;  2LNH C;  5EXT A;  1E32 A;  3TQS A;  1IXR C;  4TUW A;  3JR4 A;  1SXJ A;  4IBJ A;  3C58 A;  5FTK A;  4LZJ A;  4R7G A;  1SXJ D;  2C9C A;  3GLH B;  4ITQ A;  1Q3C A;  3HHX A;  4XGI A;  3UK6 A;  1ZAE A;  1GL6 A;  4MM3 B;  3L2A A;  3VK8 A;  1NJG A;  3L29 A;  4OVZ B;  4CGY B;  4NOO B;  2J7O A;  1EE8 A;  2L7I A;  2DVW B;  5IZ7 D;  1I4W A;  2H1R A;  3UGJ A;  1IBL M;  1MU5 A;  1IN4 A;  4JI0 M;  3M0E A;  2EO2 A;  1YSY A;  4JV5 M;  3GLI A;  5IT9 S;  3VLF B;  3FUT A;  3HJS A;  1G59 A;  2KZU A;  1HT2 E;  3A42 A;  2VQE M;  2F5N A;  4G4O A;  1QAQ A;  1NHG C;  2HCB A;  3AOE A;  3SBJ A;  1PJI A;  2E5L M;  5LMN M;  1QZM A;  3WHK A;  3SYK A;  4LJ4 A;  1OFI A;  2YQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...