4NXNM

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nxnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4nxnM02
1K3XA 1Q3CA 3GPPA 2VQEM 4JI7M 4KHPM 3J7AS 2OPFA 3GPXA 4NRVA 2UUAM 3SAVA 2XZFA 3U6PA 3SARA 4DUYM 2F5SA 3SBJA 5LMUM 4DV4M 3GPUA 2F5QA 3U6CA 1PJJA 4K0KM 4JI2M 3SASA 3SAUA 1PJIA 4LFCM 3VK7A 3T1YM 2UXBM 5ITTA 1L2BA 1I94M 5ITYA 2UU9M 1MX0A 4B3SM 2F5OA 5ITRA 3A45A 1R2YA 2HKJA 4X64M 4OX9M 3U6LA 5ITXA 3TWMA 4NRWA 3JAMS 4LF6M 3J80S 3SAWA 3OTOM 2EA0A 4JI3M 4DR2M 3SATA 4B3MM 3GQ5A 2ZBKB 1NNJA 1Z59A 3J81S 4GKJM 1HNXM 4AQYM 4LFAM 2OQ4A 4LF5M 3GP1A 1N32M 4JV5M 5BR8M 1N34M 4G4RA 4G4NA 1TDHA 1Z5BA 4LF8M 4X62M 4PDGA 1Q39A 3U6MA 2UUCM 1XNRM 4GKKM 2UXDM 1KFVA 4DR4M 4LFBM 4DR1M 1L1ZA 1L2DA 1N36M 4YY3M 2ZM6M 4JI5M 4DUZM 3U6SA 5LMNM 4JI8M 1N33M 3DOAA 1TDZA 3A42A 1K82A 1HNZM 4DR5M 5IT9S 3C58A 5ITUA 4ITQA 4JI1M 5ITQA 3GQ3A 4LF4M 4G4OA 1Q3BA 2F4VM 4MB7A 2UXCM 4DR3M 2XZUA 4JI4M 4X65M 4G4QA 1L1TA 1HR0M 4B3RM 4DV3M 4DR7M 3GQ4A 1PM5A 2UUBM 2Q2EB 4LF7M 4CISA 4JI6M 1R2ZA 4PD2A 3JR4A 5A2QS 3JR5A 1MU5A 3GO8A 1IBKM 3U6DA 3TWKA 4NXMM 1FJGM 1K3WA 1L2CA 1XNQM 4DV0M 4DV7M 3U6EA 1XMOM 3VK8A 4DV2M 5FLXS 4LF9M 4X66M 2E5LM 4DV6M 4JYAM 3TWLA 3A46A 2F5NA 2VQFM 4NXNM 3T1HM 4B3TM 1HNWM 1EE8A 1Z5AA 4PCZA 4DV5M 1Z5CA 3U6OA 1XC8A 4DR6M 5ITXE 4DV1M 2F5PA 1IBLM 3U6QA 1J5EM 4PDIA 3GPYA 3W0FA 5IWAM 4JI0M 4YHHM 2HHHM 1XMQM 1IBMM
chains in the Genus database with same CATH superfamily
1K3XA 3L27A 1Q3CA 3D8BA 1QZEA 4I5SA 1V92A 4AG5A 2DWLA 4AKGA 4WURA 3GPXA 3K92A 4IBCA 2XZFA 2QQ8A 3CF0A 4GMQA 1XXHA 3PXGA 4IBJA 2VDBB 3M7GA 4RNAA 1A5TA 4LJ9A 4DUYM 3KDSE 5E26A 3ZC7B 5L8RF 5EXSA 3TL4X 1PJJA 3J2PB 2CV0A 4B7FA 4K0KM 3SAUA 2XEPA 3VKGA 3FRIA 1YLAA 3KOWE 3EIEA 3VK7A 4RF1A 3HZJA 2MJ5B 2JZ1A 4HL4A 1QAMA 4ZPXA 2KEBA 4I8OA 1L2BA 1I94M 4ANRA 1UM8A 2VF8A 2DWNA 3SMPA 1C1KA 3C3EA 2JY7A 3W68A 2R4JA 4AI6A 5FSWA 4FVMA 3A45A 3U61B 1IY0A 5C18A 3U6LA 5ITXA 3TE6A 2C9CA 1R7RA 4LRTA 2EA0A 4MGIE 1AIPC 3L26A 2DAGA 3GQ5A 3FTEA 3HWSA 4GKJM 2OQ4A 2JZ0A 3HHXA 1N34M 2LVOC 1VEKA 4G4RA 3U5ZB 4G4NA 1N77A 3KSJA 4AKHA 1FNNA 2L7HA 2CP8A 4LZJA 3GLHA 3U6MA 2BWBA 2CFOA 2UUCM 4CHTB 1XNRM 2UXDM 1C7YA 1J09A 2CWBA 3GLHB 2M60A 1JR3A 2K0BX 2RGHA 3I01M 8CATA 1L1ZA 4YY3M 1QQWA 2C98A 2HWJA 2CUZA 2D7HA 1NJGA 3I04M 5LMNM 4JI8M 1TH2A 1WGLA 2H1RA 4XBOA 3RE8A 1TDZA 3A42A 2W82A 3SC3A 1ZMUA 2DAKA 3JR4A 2LTUA 2ZANA 4M9XA 4CJ6A 5ITQA 3GQ3A 1D0MA 4G4OA 2Z8YM 3SYKA 1DGFA 1TH4A 2LWXA 3HY5A 4L8RC 4CIZA 2HCBA 4DR3M 2XZUA 1NSFA 2JXNA 4D80A 1Z6TA 3E21A 5FTNA 4DV3M 2O25A 5DYIA 5KPTA 2FNAA 1XXHB 2UUBM 3LMMA 4CISA 4LF7M 2QCUA 5KQ8A 2JWSA 1IBKM 4XGIA 1K3WA 4M0DA 1XNQM 2L7IA 1UFZA 2LVNC 4LJ5A 1WHCA 2DKLA 5EXPA 3VK8A 1XMOM 3HHYA 4DV2M 1GABA 3DFZA 1PJQA 4GEWA 2WSFF 1JQJC 4L15A 3MJ5A 4GIPA 5FTMA 4IBIA 2VQFM 5DNYA 4MM3B 4UN2B 3T1HM 2Z7JA 1EE8A 2QP9X 3WHKA 3AV0A 3FE3A 4B08A 3GLIE 4DV5M 3ZQJA 2C9OA 2JP7A 3SYLA 2KZSA 1Z5CA 3KFUG 2EKKA 1XC8A 3VKHA 2VF7A 3K8ZA 3KSXA 3IG5A 4DV1M 3FKEA 2F5PA 2QBYB 4CGYB 4LJ4A 4GHLA 3W0FA 2DNAA 5DYGA 4NC6A 3HU3A 3IHPA 4GITA 2DZLA 2J5YA 4EIWA 1XMQM 3HHWA 4G6ZA 4HLQA 4FWDA 3HU1A 2VQEM 2LHCA 4WP2A 4JI7M 2LVPC 4IBFA 3SHGB 2EUCA 4OVZB 3KOYE 3I4VA 3SAVA 2UUAM 2WSEF 1KSFX 4AKIA 1MJGM 3SBJA 4DV4M 3GRVA 2F5QA 1HQCA 2BJVA 3PNYA 4Q7JA 3L29A 4JI2M 1V34A 2NQ8C 3FRHA 3CGWA 3HKPA 3GLFE 3FUWA 1GJTA 1PJSA 3T1YM 5ITTA 4LY6A 1OTRA 3W0LB 2LBCA 5ITYA 3FYDA 2UU9M 3B89A 5E6JA 1Y8GA 4IBDA 1GL7A 1QUSA 1T6OA 4FW9A 3RGSA 3E4RA 3VDUA 5FTJA 4F1IA 4X64M 4OX9M 4MH0E 4Y28F 4NRWA 4LF6M 4OW0A 2H5XA 1W5TA 3OTOM 2OOBA 3VLFB 4DR2M 3SAWA 1BVSA 2B3TA 3UMMA 1NNJA 2R6FA 4L6V6 1Z59A 3A98B 4B7HA 3SHFA 3TQSA 4AQYM 4LG2A 3UGJA 4LF5M 1N32M 2DAMA 4X62M 4PDGA 1G59A 3SMSA 2YR0A 2O01F 1E9SA 3QYEA 2CHGA 3K1JA 3MMPA 3LCVB 4KODA 3KW6A 2JNHA 4R3DA 1L2DA 4HEOA 2ZM6M 1N36M 1QYRA 4IBBA 1OFIA 1QDTA 3LW5F 3GRRA 4B7GA 4A3VB 2R0IA 1IQPA 3DOAA 1NVMA 2XF3A 1K82A 4DR5M 1IN5A 2R4EA 3UK6A 1OAOC 2KA6B 4W5WA 3HU2A 2Y20A 3AFHA 5EP2A 3J27B 2Z4SA 1SXJB 1ORYB 4QHSA 3RFWA 2L4FA 4R71A 1Q3BA 2F4VM 2I7PA 5FTKA 2UXCM 1DGHA 3BBZA 4WW0A 2C5RA 2CHQA 1DO0A 2EKFA 1IXZA 4NSOB 4X65M 4I81A 4B3RM 4DR7M 3AOEA 4FCVA 1NY5A 4BBAA 2DAIA 3GRYA 3U60B 2Q2EB 2DZNB 5A2QS 4IIWA 3V76A 3GRUA 2CE7A 4DV0M 2XGNA 2XSZA 2RRUA 1OIPA 3FUXA 3UZUA 3F92A 2ZTCA 2A5YB 5FLXS 1Q02A 4JN6A 4DV6M 3L28A 2I7NA 1LV7A 2CV1A 2F5NA 3FYCA 4NXNM 3FTFA 4B3TM 2KRKA 1Z5AA 2R65A 4PCZA 1MN3A 2YQZA 4IBGA 3IECA 4FCTA 2KDLA 1NV9A 3GLIA 1WR1B 1W5SA 3H4JA 3K9PA 4M9SA 2BNKA 1VDLA 2JY8A 1P3QQ 3U6QA 4PDIA 7CATA 2DHRA 3QWLA 3TPZA 1KYIA 1GKIA 4JI0M 3GPYA 5EXXA 2HHHM 3HJSA 2FS1A 1EIJA 1IBMM 4Z6YA 1OKSA 1QDRA 2M5ZA 3GPPA 1CUKA 1J7KA 1EFUB 3ZH9B 4KHPM 3T15A 4FCWA 1SXJC 4NRVA 3LCUA 1IFYA 1DGBA 1WGNA 2C99A 4AG6A 2AHMA 2FH0A 2F5SA 1GO5A 1YE9A 2K9DA 5LMUM 4L16A 4M9ZA 4RF0A 4D82A 1NV8A 3AJIB 3MHVC 2APLA 3SASA 2QENA 4GHAA 2XFSA 1HQYE 3GLGE 1HT1E 1JR3D 1SXJD 1XWIA 2G3QA 3PFIA 3NBXX 2XLJA 3I51A 2Y0TA 3M0EA 2MGWA 2BJWA 3C9PA 1XHBA 1MX0A 3AOGA 3L25A 2JUJA 3LVVA 3E9SA 3PNVA 5ITRA 3SFZA 1E9RA 4KT0F 2X4AA 3THGA 3LQQA 1PGYA 3LQRA 4L78A 3B7ZA 2DXIA 4IBKA 2JY6B 2Y21A 3GLHE 3J80S 2LHGA 4JI3M 5KPZA 3KP1E 1E94E 3J81S 3NWLA 1HNXM 4LFAM 3KS4A 3AL0C 2V1CA 3UJNA 5BR8M 1HT2E 1ZMVA 2HAKA 1TDHA 5KO3A 3HHZA 5BPVA 1Q39A 4GKKM 4MGKE 1F4IA 1S3SA 5FTLA 4IJFA 1KFVA 1QUTA 1ZV1A 2XSZD 5EQTA 1OQYA 1D0LA 4G3OA 2QHOB 4DR1M 4JI5M 2OO9A 3T6PA 1GVNA 5F3WA 2V1UA 1ZAEA 1IY1A 1PJTA 2CHVA 2KNZA 1R5LA 3DZDA 1NJFA 3AOEC 5IT9S 4GH9A 3C58A 1E32A 4FWHA 5ITUA 4ITQA 4QOZC 1WXQA 4LF4M 2V6ZM 5EP1A 4MB7A 2LVQD 2CEAA 3T38A 4JI4M 1GLNA 3H4MA 3GLGB 4G4QA 1VEJA 2Z4RA 3E46A 1V33A 4QNMA 3R9XB 1PM5A 4P17A 1G8PA 3LVWA 4LJ8A 1L8QA 3SARA 4QNRA 3B74A 1HJPA 4JI6M 3KVWA 1JR3E 1R2ZA 2RKOA 2FOIC 1IXSB 3DA1A 4PD2A 1MU5A 3GO8A 3JR5A 2J7NA 3TWKA 2BWEA 4F2LA 3U6DA 2DWZB 4BLCA 2LH0A 1L2CA 1FJGM 1OJLA 2YNMD 4LF9M 4DBGB 2QZ4A 2K6BA 1T3TA 2DZOB 1NNUC 2KW0A 5EP3A 2FFJA 2YFQA 4PT5A 4X66M 3GLGA 2EJSA 2E5LM 3KXEC 4MGYE 3A46A 4GRIA 2Z3XA 4KO8A 5IZ7D 1VQ1A 4LGYA 4NXMM 2CRUA 3HGIA 3J7BA 4RKUF 2HL7A 3VDPA 2XH9A 2R44A 4LGMA 4DR6M 2ZTDA 1D0KA 1NHGC 1IM2A 5ITXE 2D7GA 1J5EM 4LZZA 1SXJA 4P16A 5GKNA 5IWAM 2R18A 4YHHM 2L09A 4JYAM 3HX3A 3QAUA 3W67A 1AUAA 4XK8F 4R7GA 3AKZA 3L2AA 1LTMA 4LRSA 3J7AS 3GLFA 2OPFA 2C96A 3U61A 2JY5A 3U6PA 5KQDA 1VEGA 3KOXE 1JB0F 2KXEA 3FUUA 1TR8A 3GPUA 3U6CA 2QPAA 1TTEA 2P5TA 4L4UA 1PJIA 3ILKA 1QAQA 3U5ZA 4LFCM 1NO1A 1YSYA 4MGHA 3CF6E 4IBEA 4FWGA 2UXBM 3HJQA 5H37D 1SXJE 3Q8GA 1VDDA 2R62A 4LJAA 2GNOA 3U60A 4B3SM 2F5OA 1VG5A 1R2YA 1YUBA 1NHWC 2HKJA 4NOOB 3TWMA 4NSRA 3JAMS 2GQFA 4MGZE 3CF2A 1IXRC 1PRBA 2ZAOA 3FD9A 5JI2E 3CTWB 4FD2A 3SATA 1IXSA 4B3MM 1XB2B 2ZBKB 1DGGA 4GC9A 2OOAA 1X37A 4GC5A 3GP1A 2DVWB 1QANA 4JV5M 4BB9A 4LCBA 1OFHA 1D2NA 2R45A 3IG8A 1G4AE 2QNJA 4AW4A 2L4EA 1Z5BA 2X8AA 5JI3E 2KHHA 4LF8M 2Y0QA 2DAEA 1SG9A 1GL6A 2G5GX 1QAOA 3KOZE 1IN4A 2CV2A 1OAIA 4DR4M 1QZMA 3FTDA 3VFDA 4LFBM 1RU3A 1IY2A 3ZCBB 3MK6A 2MR9A 1TGUA 1N78A 1G3IA 2DWMA 3K2LA 1TF0B 4DUZM 4AZFA 3U6SA 4OVZA 2DHYA 3KP0E 2ZAMA 4S12A 4M0WA 1N33M 2LXEA 3RGPA 2QBYA 3EIHA 2L6OA 1HNZM 1N75A 3B9PA 3KS8A 3FUTA 3K9OA 3M6AA 2N35A 4D81A 1IN8A 3C3DA 3R8FA 2L2DA 4KLNA 3QYBA 3BXWA 3FUVA 5IREB 4JI1M 2J7OA 4IJEA 1QVRA 4NL4H 2LVAA 2LNHC 1WJ7A 1DO2A 1IN7A 2RGOA 1L1TA 1HR0M 2WSCF 2VIIA 2MH8A 3GQ4A 2K47A 5KPRA 1DV0A 4QHTA 3WHLA 3BOSA 3Q8XA 2O5RA 1NY6A 2KZUA 2ERCA 2WZJA 1OIZA 1T43A 4DV7M 3U6EA 2KNVA 2R46A 5DFLA 4OU7A 1R4GA 4I4LA 1ZMWA 4LJ7A 1DGHB 2DENA 3PVSA 3B7NA 1WIVA 2KNAA 1IN6A 1ZQ9A 2DI0A 3HJ8A 4II7A 5EP4A 4JXJA 3TWLA 1R6BX 3FTCA 3D8LA 1XXHE 2KRUA 1I4WA 5EJCA 3B7QA 4Z8XA 1HNWM 3GLFB 2FE8A 1H6UA 4TUWA 2X49A 4QOSA 4REZA 1G71A 2XFTA 5C1BA 1G41A 1GJSA 2JA2A 3U6OA 4LJ6A 3GLIB 2D7EA 2MROB 5EXTA 1IBLM 1TH3A 3I4YA 2G8LA 3NBIA 2QSFX 2EO2A
chains in the Genus database with same CATH topology
1K3XA 3L27A 1Q3CA 3D8BA 4I5SA 4AG5A 2DWLA 4AKGA 4WURA 3GPXA 3K92A 4IBCA 2XZFA 3CF0A 4GMQA 1XXHA 3PXGA 4IBJA 3M7GA 4RNAA 4DUYM 4LJ9A 3SARA 3KDSE 5E26A 3ZC7B 1PJJA 5EXSA 3TL4X 2CV0A 3J2PB 4K0KM 4B7FA 3SAUA 2XEPA 3VKGA 3KOWE 3EIEA 3VK7A 4RF1A 4HL4A 1QAMA 4ZPXA 2KEBA 4I8OA 1L2BA 1I94M 1UM8A 2DWNA 3SMPA 1C1KA 2R4JA 4AI6A 5FSWA 4FVMA 3A45A 3U61B 1IY0A 5C18A 3U6LA 5ITXA 3TE6A 2C9CA 1R7RA 4LRTA 2EA0A 4MGIE 3L26A 3GQ5A 3FTEA 3HWSA 4GKJM 2OQ4A 3HHXA 1N34M 4G4RA 3U5ZB 4G4NA 1N77A 3KSJA 4AKHA 1FNNA 2L7HA 4LZJA 3U6MA 3GLHA 2UUCM 2CFOA 1XNRM 2UXDM 4CHTB 1J09A 3GLHB 2M60A 1JR3A 2RGHA 8CATA 1L1ZA 4YY3M 1QQWA 2C98A 2CUZA 2D7HA 1NJGA 5LMNM 4JI8M 1TH2A 2H1RA 4XBOA 3RE8A 1TDZA 3A42A 2W82A 3SC3A 2ZANA 4M9XA 5ITQA 3GQ3A 4G4OA 3SYKA 1DGFA 1TH4A 2LWXA 4L8RC 2HCBA 4DR3M 2XZUA 1NSFA 4D80A 1Z6TA 5FTNA 4DV3M 5DYIA 5KPTA 2FNAA 1XXHB 2UUBM 3LMMA 4CISA 4LF7M 2QCUA 5KQ8A 1IBKM 4XGIA 1K3WA 4M0DA 1XNQM 2L7IA 4LJ5A 5EXPA 1XMOM 3VK8A 3HHYA 4DV2M 3DFZA 1JQJC 4L15A 3MJ5A 4GIPA 5FTMA 4IBIA 2VQFM 5DNYA 4MM3B 3T1HM 2Z7JA 1EE8A 2QP9X 3WHKA 3AV0A 4B08A 4DV5M 2C9OA 3SYLA 2KZSA 1Z5CA 3KFUG 1XC8A 3VKHA 3K8ZA 3KSXA 3IG5A 4DV1M 3FKEA 2F5PA 2QBYB 4CGYB 4LJ4A 4GHLA 3W0FA 5DYGA 3HU3A 4GITA 4EIWA 1XMQM 3HHWA 4G6ZA 4HLQA 4FWDA 3HU1A 2VQEM 4JI7M 4IBFA 3SHGB 2EUCA 4OVZB 3KOYE 3I4VA 3SAVA 2UUAM 1KSFX 4AKIA 3SBJA 4DV4M 3GRVA 2F5QA 1HQCA 2BJVA 3PNYA 3L29A 4JI2M 2NQ8C 3HKPA 3FUWA 3T1YM 5ITTA 4LY6A 3W0LB 5ITYA 3FYDA 2UU9M 5E6JA 4IBDA 1GL7A 4FW9A 3RGSA 3VDUA 4X64M 3E4RA 5FTJA 4OX9M 4MH0E 4NRWA 4LF6M 4OW0A 1W5TA 3OTOM 3SAWA 3VLFB 4DR2M 3UMMA 1NNJA 3AL0C 4LG2A 1Z59A 3A98B 4B7HA 3SHFA 3TQSA 4AQYM 1N32M 3UGJA 4LF5M 4X62M 4PDGA 1G59A 3SMSA 2YR0A 1E9SA 2CHGA 3K1JA 4KODA 3KW6A 4R3DA 1L2DA 1N36M 2ZM6M 1QYRA 4IBBA 1OFIA 3GRRA 4B7GA 4A3VB 1IQPA 3DOAA 1NVMA 2XF3A 1K82A 4DR5M 1IN5A 2R4EA 3UK6A 2KA6B 4W5WA 3HU2A 2Y20A 3AFHA 5EP2A 3J27B 2Z4SA 1SXJB 1ORYB 4QHSA 3RFWA 1Q3BA 2F4VM 2I7PA 5FTKA 2UXCM 1DGHA 4WW0A 2C5RA 2CHQA 1DO0A 4NSOB 1IXZA 4X65M 4I81A 4B3RM 4DR7M 3AOEA 4FCVA 1NY5A 4BBAA 3GRYA 3U60B 2Q2EB 2DZNB 5A2QS 4IIWA 3GRUA 2CE7A 4DV0M 2XGNA 2XSZA 3FUXA 3UZUA 2A5YB 5FLXS 4JN6A 4DV6M 3L28A 2I7NA 1LV7A 2CV1A 2F5NA 3FYCA 4NXNM 3FTFA 4B3TM 2KRKA 1Z5AA 2R65A 4PCZA 2YQZA 4IBGA 4FCTA 3GLIA 1W5SA 4M9SA 2BNKA 3U6QA 4PDIA 7CATA 2DHRA 3QWLA 3TPZA 1KYIA 1GKIA 4JI0M 3GPYA 5EXXA 2HHHM 3HJSA 1IBMM 4Z6YA 2M5ZA 3GPPA 1J7KA 3ZH9B 4KHPM 3T15A 4FCWA 1SXJC 4NRVA 1DGBA 2C99A 4AG6A 2AHMA 2F5SA 1YE9A 5LMUM 4L16A 4M9ZA 4RF0A 4D82A 3AJIB 3MHVC 3SASA 2QENA 4GHAA 2XFSA 1HQYE 1HT1E 1JR3D 1SXJD 1XWIA 3PFIA 2XLJA 3I51A 2Y0TA 3M0EA 2BJWA 1XHBA 1MX0A 3AOGA 3L25A 3LVVA 3PNVA 3E9SA 5ITRA 3SFZA 1E9RA 2X4AA 3THGA 3LQQA 3LQRA 4L78A 2DXIA 4IBKA 2Y21A 3J80S 4JI3M 5KPZA 3KP1E 1E94E 3J81S 3NWLA 1HNXM 4LFAM 3KS4A 2V1CA 3UJNA 5BR8M 1HT2E 1TDHA 5KO3A 3HHZA 5BPVA 1Q39A 4GKKM 4MGKE 1S3SA 5FTLA 4IJFA 1KFVA 2XSZD 5EQTA 4DR1M 4JI5M 1GVNA 5F3WA 2V1UA 1ZAEA 1IY1A 2CHVA 3DZDA 1NJFA 3AOEC 5IT9S 4GH9A 3C58A 1E32A 4FWHA 5ITUA 4ITQA 4QOZC 1WXQA 4LF4M 2V6ZM 5EP1A 4MB7A 2CEAA 3T38A 4JI4M 1GLNA 3H4MA 3GLGB 4G4QA 2Z4RA 4QNMA 3R9XB 1PM5A 1G8PA 3LVWA 4LJ8A 1L8QA 4QNRA 4JI6M 3KVWA 1R2ZA 2RKOA 2FOIC 1IXSB 3DA1A 4PD2A 1MU5A 3GO8A 3JR5A 2J7NA 3TWKA 3JR4A 3U6DA 1L2CA 2DWZB 4BLCA 2LH0A 1FJGM 1OJLA 2YNMD 4LF9M 2KW0A 2QZ4A 1T3TA 2DZOB 1NNUC 5EP3A 2FFJA 2YFQA 4PT5A 4X66M 3GLGA 2E5LM 3KXEC 4MGYE 3A46A 4GRIA 2Z3XA 4KO8A 5IZ7D 4LGYA 4NXMM 3HGIA 3J7BA 2HL7A 3VDPA 2XH9A 4LGMA 4DR6M 5ITXE 1NHGC 1IM2A 2D7GA 1J5EM 4LZZA 1SXJA 4P16A 5GKNA 5IWAM 2R18A 4YHHM 2L09A 3QAUA 4R7GA 3AKZA 3L2AA 4LRSA 3J7AS 3GLFA 2OPFA 2C96A 3U61A 3U6PA 5KQDA 3KOXE 2KXEA 3FUUA 3GPUA 3U6CA 2QPAA 2P5TA 4L4UA 1PJIA 3ILKA 1QAQA 3U5ZA 4LFCM 1YSYA 4MGHA 3CF6E 4IBEA 4FWGA 2UXBM 3HJQA 5H37D 1SXJE 1VDDA 2R62A 4LJAA 3U60A 4B3SM 2F5OA 1R2YA 1YUBA 1NHWC 2HKJA 4NOOB 3TWMA 4NSRA 3JAMS 4MGZE 3CF2A 1IXRC 2ZAOA 3FD9A 5JI2E 3CTWB 4FD2A 3SATA 4B3MM 2ZBKB 1DGGA 4GC9A 1X37A 4GC5A 3GP1A 2DVWB 1QANA 4JV5M 4BB9A 4LCBA 1OFHA 1D2NA 2R45A 3IG8A 1G4AE 4AW4A 5JI3E 1Z5BA 2X8AA 4LF8M 2Y0QA 2G5GX 1GL6A 3KOZE 1QAOA 2CV2A 1IN4A 4DR4M 1QZMA 3FTDA 3VFDA 4LFBM 1IY2A 3ZCBB 3MK6A 1TGUA 1N78A 1G3IA 2DWMA 3K2LA 4DUZM 4AZFA 3U6SA 4OVZA 3KP0E 2ZAMA 4S12A 4M0WA 1N33M 2LXEA 3RGPA 2QBYA 3EIHA 2L6OA 1HNZM 1N75A 3B9PA 3KS8A 3FUTA 3M6AA 4D81A 1IN8A 3R8FA 4KLNA 3FUVA 5IREB 4JI1M 2J7OA 4IJEA 1QVRA 4NL4H 2LNHC 1DO2A 1IN7A 2RGOA 1L1TA 1HR0M 2VIIA 3GQ4A 2K47A 5KPRA 4QHTA 3WHLA 3BOSA 3Q8XA 2O5RA 1NY6A 2KZUA 2ERCA 4DV7M 3U6EA 2R46A 4OU7A 4I4LA 4LJ7A 1DGHB 3PVSA 1IN6A 1ZQ9A 3HJ8A 4II7A 5EP4A 3TWLA 4JXJA 4JYAM 1R6BX 3FTCA 3D8LA 2KRUA 5EJCA 1I4WA 4Z8XA 1HNWM 3GLFB 2FE8A 1H6UA 4TUWA 2X49A 4QOSA 4REZA 2XFTA 5C1BA 1G41A 2JA2A 3U6OA 4LJ6A 3GLIB 2D7EA 5EXTA 1IBLM 1TH3A 3I4YA 2G8LA 3NBIA 2EO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3X A;  1Q3C A;  3GPP A;  2VQE M;  4JI7 M;  4KHP M;  3J7A S;  2OPF A;  3GPX A;  4NRV A;  2UUA M;  3SAV A;  2XZF A;  3U6P A;  3SAR A;  4DUY M;  2F5S A;  3SBJ A;  5LMU M;  4DV4 M;  3GPU A;  2F5Q A;  3U6C A;  1PJJ A;  4K0K M;  4JI2 M;  3SAS A;  3SAU A;  1PJI A;  4LFC M;  3VK7 A;  3T1Y M;  2UXB M;  5ITT A;  1L2B A;  1I94 M;  5ITY A;  2UU9 M;  1MX0 A;  4B3S M;  2F5O A;  5ITR A;  3A45 A;  1R2Y A;  2HKJ A;  4X64 M;  4OX9 M;  3U6L A;  5ITX A;  3TWM A;  4NRW A;  3JAM S;  4LF6 M;  3J80 S;  3SAW A;  3OTO M;  2EA0 A;  4JI3 M;  4DR2 M;  3SAT A;  4B3M M;  3GQ5 A;  2ZBK B;  1NNJ A;  1Z59 A;  3J81 S;  4GKJ M;  1HNX M;  4AQY M;  4LFA M;  2OQ4 A;  4LF5 M;  3GP1 A;  1N32 M;  4JV5 M;  5BR8 M;  1N34 M;  4G4R A;  4G4N A;  1TDH A;  1Z5B A;  4LF8 M;  4X62 M;  4PDG A;  1Q39 A;  3U6M A;  2UUC M;  1XNR M;  4GKK M;  2UXD M;  1KFV A;  4DR4 M;  4LFB M;  4DR1 M;  1L1Z A;  1L2D A;  1N36 M;  4YY3 M;  2ZM6 M;  4JI5 M;  4DUZ M;  3U6S A;  5LMN M;  4JI8 M;  1N33 M;  3DOA A;  1TDZ A;  3A42 A;  1K82 A;  1HNZ M;  4DR5 M;  5IT9 S;  3C58 A;  5ITU A;  4ITQ A;  4JI1 M;  5ITQ A;  3GQ3 A;  4LF4 M;  4G4O A;  1Q3B A;  2F4V M;  4MB7 A;  2UXC M;  4DR3 M;  2XZU A;  4JI4 M;  4X65 M;  4G4Q A;  1L1T A;  1HR0 M;  4B3R M;  4DV3 M;  4DR7 M;  3GQ4 A;  1PM5 A;  2UUB M;  2Q2E B;  4LF7 M;  4CIS A;  4JI6 M;  1R2Z A;  4PD2 A;  3JR4 A;  5A2Q S;  3JR5 A;  1MU5 A;  3GO8 A;  1IBK M;  3U6D A;  3TWK A;  4NXM M;  1FJG M;  1K3W A;  1L2C A;  1XNQ M;  4DV0 M;  4DV7 M;  3U6E A;  1XMO M;  3VK8 A;  4DV2 M;  5FLX S;  4LF9 M;  4X66 M;  2E5L M;  4DV6 M;  4JYA M;  3TWL A;  3A46 A;  2F5N A;  2VQF M;  4NXN M;  3T1H M;  4B3T M;  1HNW M;  1EE8 A;  1Z5A A;  4PCZ A;  4DV5 M;  1Z5C A;  3U6O A;  1XC8 A;  4DR6 M;  5ITX E;  4DV1 M;  2F5P A;  1IBL M;  3U6Q A;  1J5E M;  4PDI A;  3GPY A;  3W0F A;  5IWA M;  4JI0 M;  4YHH M;  2HHH M;  1XMQ M;  1IBM M; 
#chains in the Genus database with same CATH topology
 1K3X A;  3L27 A;  1Q3C A;  3D8B A;  1QZE A;  4I5S A;  1V92 A;  4AG5 A;  2DWL A;  4AKG A;  4WUR A;  3GPX A;  3K92 A;  4IBC A;  2XZF A;  2QQ8 A;  3CF0 A;  4GMQ A;  1XXH A;  3PXG A;  4IBJ A;  2VDB B;  3M7G A;  4RNA A;  1A5T A;  4LJ9 A;  4DUY M;  3KDS E;  5E26 A;  3ZC7 B;  5L8R F;  5EXS A;  3TL4 X;  1PJJ A;  3J2P B;  2CV0 A;  4B7F A;  4K0K M;  3SAU A;  2XEP A;  3VKG A;  3FRI A;  1YLA A;  3KOW E;  3EIE A;  3VK7 A;  4RF1 A;  3HZJ A;  2MJ5 B;  2JZ1 A;  4HL4 A;  1QAM A;  4ZPX A;  2KEB A;  4I8O A;  1L2B A;  1I94 M;  4ANR A;  1UM8 A;  2VF8 A;  2DWN A;  3SMP A;  1C1K A;  3C3E A;  2JY7 A;  3W68 A;  2R4J A;  4AI6 A;  5FSW A;  4FVM A;  3A45 A;  3U61 B;  1IY0 A;  5C18 A;  3U6L A;  5ITX A;  3TE6 A;  2C9C A;  1R7R A;  4LRT A;  2EA0 A;  4MGI E;  1AIP C;  3L26 A;  2DAG A;  3GQ5 A;  3FTE A;  3HWS A;  4GKJ M;  2OQ4 A;  2JZ0 A;  3HHX A;  1N34 M;  2LVO C;  1VEK A;  4G4R A;  3U5Z B;  4G4N A;  1N77 A;  3KSJ A;  4AKH A;  1FNN A;  2L7H A;  2CP8 A;  4LZJ A;  3GLH A;  3U6M A;  2BWB A;  2CFO A;  2UUC M;  4CHT B;  1XNR M;  2UXD M;  1C7Y A;  1J09 A;  2CWB A;  3GLH B;  2M60 A;  1JR3 A;  2K0B X;  2RGH A;  3I01 M;  8CAT A;  1L1Z A;  4YY3 M;  1QQW A;  2C98 A;  2HWJ A;  2CUZ A;  2D7H A;  1NJG A;  3I04 M;  5LMN M;  4JI8 M;  1TH2 A;  1WGL A;  2H1R A;  4XBO A;  3RE8 A;  1TDZ A;  3A42 A;  2W82 A;  3SC3 A;  1ZMU A;  2DAK A;  3JR4 A;  2LTU A;  2ZAN A;  4M9X A;  4CJ6 A;  5ITQ A;  3GQ3 A;  1D0M A;  4G4O A;  2Z8Y M;  3SYK A;  1DGF A;  1TH4 A;  2LWX A;  3HY5 A;  4L8R C;  4CIZ A;  2HCB A;  4DR3 M;  2XZU A;  1NSF A;  2JXN A;  4D80 A;  1Z6T A;  3E21 A;  5FTN A;  4DV3 M;  2O25 A;  5DYI A;  5KPT A;  2FNA A;  1XXH B;  2UUB M;  3LMM A;  4CIS A;  4LF7 M;  2QCU A;  5KQ8 A;  2JWS A;  1IBK M;  4XGI A;  1K3W A;  4M0D A;  1XNQ M;  2L7I A;  1UFZ A;  2LVN C;  4LJ5 A;  1WHC A;  2DKL A;  5EXP A;  3VK8 A;  1XMO M;  3HHY A;  4DV2 M;  1GAB A;  3DFZ A;  1PJQ A;  4GEW A;  2WSF F;  1JQJ C;  4L15 A;  3MJ5 A;  4GIP A;  5FTM A;  4IBI A;  2VQF M;  5DNY A;  4MM3 B;  4UN2 B;  3T1H M;  2Z7J A;  1EE8 A;  2QP9 X;  3WHK A;  3AV0 A;  3FE3 A;  4B08 A;  3GLI E;  4DV5 M;  3ZQJ A;  2C9O A;  2JP7 A;  3SYL A;  2KZS A;  1Z5C A;  3KFU G;  2EKK A;  1XC8 A;  3VKH A;  2VF7 A;  3K8Z A;  3KSX A;  3IG5 A;  4DV1 M;  3FKE A;  2F5P A;  2QBY B;  4CGY B;  4LJ4 A;  4GHL A;  3W0F A;  2DNA A;  5DYG A;  4NC6 A;  3HU3 A;  3IHP A;  4GIT A;  2DZL A;  2J5Y A;  4EIW A;  1XMQ M;  3HHW A;  4G6Z A;  4HLQ A;  4FWD A;  3HU1 A;  2VQE M;  2LHC A;  4WP2 A;  4JI7 M;  2LVP C;  4IBF A;  3SHG B;  2EUC A;  4OVZ B;  3KOY E;  3I4V A;  3SAV A;  2UUA M;  2WSE F;  1KSF X;  4AKI A;  1MJG M;  3SBJ A;  4DV4 M;  3GRV A;  2F5Q A;  1HQC A;  2BJV A;  3PNY A;  4Q7J A;  3L29 A;  4JI2 M;  1V34 A;  2NQ8 C;  3FRH A;  3CGW A;  3HKP A;  3GLF E;  3FUW A;  1GJT A;  1PJS A;  3T1Y M;  5ITT A;  4LY6 A;  1OTR A;  3W0L B;  2LBC A;  5ITY A;  3FYD A;  2UU9 M;  3B89 A;  5E6J A;  1Y8G A;  4IBD A;  1GL7 A;  1QUS A;  1T6O A;  4FW9 A;  3RGS A;  3E4R A;  3VDU A;  5FTJ A;  4F1I A;  4X64 M;  4OX9 M;  4MH0 E;  4Y28 F;  4NRW A;  4LF6 M;  4OW0 A;  2H5X A;  1W5T A;  3OTO M;  2OOB A;  3VLF B;  4DR2 M;  3SAW A;  1BVS A;  2B3T A;  3UMM A;  1NNJ A;  2R6F A;  4L6V 6;  1Z59 A;  3A98 B;  4B7H A;  3SHF A;  3TQS A;  4AQY M;  4LG2 A;  3UGJ A;  4LF5 M;  1N32 M;  2DAM A;  4X62 M;  4PDG A;  1G59 A;  3SMS A;  2YR0 A;  2O01 F;  1E9S A;  3QYE A;  2CHG A;  3K1J A;  3MMP A;  3LCV B;  4KOD A;  3KW6 A;  2JNH A;  4R3D A;  1L2D A;  4HEO A;  2ZM6 M;  1N36 M;  1QYR A;  4IBB A;  1OFI A;  1QDT A;  3LW5 F;  3GRR A;  4B7G A;  4A3V B;  2R0I A;  1IQP A;  3DOA A;  1NVM A;  2XF3 A;  1K82 A;  4DR5 M;  1IN5 A;  2R4E A;  3UK6 A;  1OAO C;  2KA6 B;  4W5W A;  3HU2 A;  2Y20 A;  3AFH A;  5EP2 A;  3J27 B;  2Z4S A;  1SXJ B;  1ORY B;  4QHS A;  3RFW A;  2L4F A;  4R71 A;  1Q3B A;  2F4V M;  2I7P A;  5FTK A;  2UXC M;  1DGH A;  3BBZ A;  4WW0 A;  2C5R A;  2CHQ A;  1DO0 A;  2EKF A;  1IXZ A;  4NSO B;  4X65 M;  4I81 A;  4B3R M;  4DR7 M;  3AOE A;  4FCV A;  1NY5 A;  4BBA A;  2DAI A;  3GRY A;  3U60 B;  2Q2E B;  2DZN B;  5A2Q S;  4IIW A;  3V76 A;  3GRU A;  2CE7 A;  4DV0 M;  2XGN A;  2XSZ A;  2RRU A;  1OIP A;  3FUX A;  3UZU A;  3F92 A;  2ZTC A;  2A5Y B;  5FLX S;  1Q02 A;  4JN6 A;  4DV6 M;  3L28 A;  2I7N A;  1LV7 A;  2CV1 A;  2F5N A;  3FYC A;  4NXN M;  3FTF A;  4B3T M;  2KRK A;  1Z5A A;  2R65 A;  4PCZ A;  1MN3 A;  2YQZ A;  4IBG A;  3IEC A;  4FCT A;  2KDL A;  1NV9 A;  3GLI A;  1WR1 B;  1W5S A;  3H4J A;  3K9P A;  4M9S A;  2BNK A;  1VDL A;  2JY8 A;  1P3Q Q;  3U6Q A;  4PDI A;  7CAT A;  2DHR A;  3QWL A;  3TPZ A;  1KYI A;  1GKI A;  4JI0 M;  3GPY A;  5EXX A;  2HHH M;  3HJS A;  2FS1 A;  1EIJ A;  1IBM M;  4Z6Y A;  1OKS A;  1QDR A;  2M5Z A;  3GPP A;  1CUK A;  1J7K A;  1EFU B;  3ZH9 B;  4KHP M;  3T15 A;  4FCW A;  1SXJ C;  4NRV A;  3LCU A;  1IFY A;  1DGB A;  1WGN A;  2C99 A;  4AG6 A;  2AHM A;  2FH0 A;  2F5S A;  1GO5 A;  1YE9 A;  2K9D A;  5LMU M;  4L16 A;  4M9Z A;  4RF0 A;  4D82 A;  1NV8 A;  3AJI B;  3MHV C;  2APL A;  3SAS A;  2QEN A;  4GHA A;  2XFS A;  1HQY E;  3GLG E;  1HT1 E;  1JR3 D;  1SXJ D;  1XWI A;  2G3Q A;  3PFI A;  3NBX X;  2XLJ A;  3I51 A;  2Y0T A;  3M0E A;  2MGW A;  2BJW A;  3C9P A;  1XHB A;  1MX0 A;  3AOG A;  3L25 A;  2JUJ A;  3LVV A;  3E9S A;  3PNV A;  5ITR A;  3SFZ A;  1E9R A;  4KT0 F;  2X4A A;  3THG A;  3LQQ A;  1PGY A;  3LQR A;  4L78 A;  3B7Z A;  2DXI A;  4IBK A;  2JY6 B;  2Y21 A;  3GLH E;  3J80 S;  2LHG A;  4JI3 M;  5KPZ A;  3KP1 E;  1E94 E;  3J81 S;  3NWL A;  1HNX M;  4LFA M;  3KS4 A;  3AL0 C;  2V1C A;  3UJN A;  5BR8 M;  1HT2 E;  1ZMV A;  2HAK A;  1TDH A;  5KO3 A;  3HHZ A;  5BPV A;  1Q39 A;  4GKK M;  4MGK E;  1F4I A;  1S3S A;  5FTL A;  4IJF A;  1KFV A;  1QUT A;  1ZV1 A;  2XSZ D;  5EQT A;  1OQY A;  1D0L A;  4G3O A;  2QHO B;  4DR1 M;  4JI5 M;  2OO9 A;  3T6P A;  1GVN A;  5F3W A;  2V1U A;  1ZAE A;  1IY1 A;  1PJT A;  2CHV A;  2KNZ A;  1R5L A;  3DZD A;  1NJF A;  3AOE C;  5IT9 S;  4GH9 A;  3C58 A;  1E32 A;  4FWH A;  5ITU A;  4ITQ A;  4QOZ C;  1WXQ A;  4LF4 M;  2V6Z M;  5EP1 A;  4MB7 A;  2LVQ D;  2CEA A;  3T38 A;  4JI4 M;  1GLN A;  3H4M A;  3GLG B;  4G4Q A;  1VEJ A;  2Z4R A;  3E46 A;  1V33 A;  4QNM A;  3R9X B;  1PM5 A;  4P17 A;  1G8P A;  3LVW A;  4LJ8 A;  1L8Q A;  3SAR A;  4QNR A;  3B74 A;  1HJP A;  4JI6 M;  3KVW A;  1JR3 E;  1R2Z A;  2RKO A;  2FOI C;  1IXS B;  3DA1 A;  4PD2 A;  1MU5 A;  3GO8 A;  3JR5 A;  2J7N A;  3TWK A;  2BWE A;  4F2L A;  3U6D A;  2DWZ B;  4BLC A;  2LH0 A;  1L2C A;  1FJG M;  1OJL A;  2YNM D;  4LF9 M;  4DBG B;  2QZ4 A;  2K6B A;  1T3T A;  2DZO B;  1NNU C;  2KW0 A;  5EP3 A;  2FFJ A;  2YFQ A;  4PT5 A;  4X66 M;  3GLG A;  2EJS A;  2E5L M;  3KXE C;  4MGY E;  3A46 A;  4GRI A;  2Z3X A;  4KO8 A;  5IZ7 D;  1VQ1 A;  4LGY A;  4NXM M;  2CRU A;  3HGI A;  3J7B A;  4RKU F;  2HL7 A;  3VDP A;  2XH9 A;  2R44 A;  4LGM A;  4DR6 M;  2ZTD A;  1D0K A;  1NHG C;  1IM2 A;  5ITX E;  2D7G A;  1J5E M;  4LZZ A;  1SXJ A;  4P16 A;  5GKN A;  5IWA M;  2R18 A;  4YHH M;  2L09 A;  4JYA M;  3HX3 A;  3QAU A;  3W67 A;  1AUA A;  4XK8 F;  4R7G A;  3AKZ A;  3L2A A;  1LTM A;  4LRS A;  3J7A S;  3GLF A;  2OPF A;  2C96 A;  3U61 A;  2JY5 A;  3U6P A;  5KQD A;  1VEG A;  3KOX E;  1JB0 F;  2KXE A;  3FUU A;  1TR8 A;  3GPU A;  3U6C A;  2QPA A;  1TTE A;  2P5T A;  4L4U A;  1PJI A;  3ILK A;  1QAQ A;  3U5Z A;  4LFC M;  1NO1 A;  1YSY A;  4MGH A;  3CF6 E;  4IBE A;  4FWG A;  2UXB M;  3HJQ A;  5H37 D;  1SXJ E;  3Q8G A;  1VDD A;  2R62 A;  4LJA A;  2GNO A;  3U60 A;  4B3S M;  2F5O A;  1VG5 A;  1R2Y A;  1YUB A;  1NHW C;  2HKJ A;  4NOO B;  3TWM A;  4NSR A;  3JAM S;  2GQF A;  4MGZ E;  3CF2 A;  1IXR C;  1PRB A;  2ZAO A;  3FD9 A;  5JI2 E;  3CTW B;  4FD2 A;  3SAT A;  1IXS A;  4B3M M;  1XB2 B;  2ZBK B;  1DGG A;  4GC9 A;  2OOA A;  1X37 A;  4GC5 A;  3GP1 A;  2DVW B;  1QAN A;  4JV5 M;  4BB9 A;  4LCB A;  1OFH A;  1D2N A;  2R45 A;  3IG8 A;  1G4A E;  2QNJ A;  4AW4 A;  2L4E A;  1Z5B A;  2X8A A;  5JI3 E;  2KHH A;  4LF8 M;  2Y0Q A;  2DAE A;  1SG9 A;  1GL6 A;  2G5G X;  1QAO A;  3KOZ E;  1IN4 A;  2CV2 A;  1OAI A;  4DR4 M;  1QZM A;  3FTD A;  3VFD A;  4LFB M;  1RU3 A;  1IY2 A;  3ZCB B;  3MK6 A;  2MR9 A;  1TGU A;  1N78 A;  1G3I A;  2DWM A;  3K2L A;  1TF0 B;  4DUZ M;  4AZF A;  3U6S A;  4OVZ A;  2DHY A;  3KP0 E;  2ZAM A;  4S12 A;  4M0W A;  1N33 M;  2LXE A;  3RGP A;  2QBY A;  3EIH A;  2L6O A;  1HNZ M;  1N75 A;  3B9P A;  3KS8 A;  3FUT A;  3K9O A;  3M6A A;  2N35 A;  4D81 A;  1IN8 A;  3C3D A;  3R8F A;  2L2D A;  4KLN A;  3QYB A;  3BXW A;  3FUV A;  5IRE B;  4JI1 M;  2J7O A;  4IJE A;  1QVR A;  4NL4 H;  2LVA A;  2LNH C;  1WJ7 A;  1DO2 A;  1IN7 A;  2RGO A;  1L1T A;  1HR0 M;  2WSC F;  2VII A;  2MH8 A;  3GQ4 A;  2K47 A;  5KPR A;  1DV0 A;  4QHT A;  3WHL A;  3BOS A;  3Q8X A;  2O5R A;  1NY6 A;  2KZU A;  2ERC A;  2WZJ A;  1OIZ A;  1T43 A;  4DV7 M;  3U6E A;  2KNV A;  2R46 A;  5DFL A;  4OU7 A;  1R4G A;  4I4L A;  1ZMW A;  4LJ7 A;  1DGH B;  2DEN A;  3PVS A;  3B7N A;  1WIV A;  2KNA A;  1IN6 A;  1ZQ9 A;  2DI0 A;  3HJ8 A;  4II7 A;  5EP4 A;  4JXJ A;  3TWL A;  1R6B X;  3FTC A;  3D8L A;  1XXH E;  2KRU A;  1I4W A;  5EJC A;  3B7Q A;  4Z8X A;  1HNW M;  3GLF B;  2FE8 A;  1H6U A;  4TUW A;  2X49 A;  4QOS A;  4REZ A;  1G71 A;  2XFT A;  5C1B A;  1G41 A;  1GJS A;  2JA2 A;  3U6O A;  4LJ6 A;  3GLI B;  2D7E A;  2MRO B;  5EXT A;  1IBL M;  1TH3 A;  3I4Y A;  2G8L A;  3NBI A;  2QSF X;  2EO2 A; 
#chains in the Genus database with same CATH homology
 1K3X A;  3L27 A;  1Q3C A;  3D8B A;  4I5S A;  4AG5 A;  2DWL A;  4AKG A;  4WUR A;  3GPX A;  3K92 A;  4IBC A;  2XZF A;  3CF0 A;  4GMQ A;  1XXH A;  3PXG A;  4IBJ A;  3M7G A;  4RNA A;  4DUY M;  4LJ9 A;  3SAR A;  3KDS E;  5E26 A;  3ZC7 B;  1PJJ A;  5EXS A;  3TL4 X;  2CV0 A;  3J2P B;  4K0K M;  4B7F A;  3SAU A;  2XEP A;  3VKG A;  3KOW E;  3EIE A;  3VK7 A;  4RF1 A;  4HL4 A;  1QAM A;  4ZPX A;  2KEB A;  4I8O A;  1L2B A;  1I94 M;  1UM8 A;  2DWN A;  3SMP A;  1C1K A;  2R4J A;  4AI6 A;  5FSW A;  4FVM A;  3A45 A;  3U61 B;  1IY0 A;  5C18 A;  3U6L A;  5ITX A;  3TE6 A;  2C9C A;  1R7R A;  4LRT A;  2EA0 A;  4MGI E;  3L26 A;  3GQ5 A;  3FTE A;  3HWS A;  4GKJ M;  2OQ4 A;  3HHX A;  1N34 M;  4G4R A;  3U5Z B;  4G4N A;  1N77 A;  3KSJ A;  4AKH A;  1FNN A;  2L7H A;  4LZJ A;  3U6M A;  3GLH A;  2UUC M;  2CFO A;  1XNR M;  2UXD M;  4CHT B;  1J09 A;  3GLH B;  2M60 A;  1JR3 A;  2RGH A;  8CAT A;  1L1Z A;  4YY3 M;  1QQW A;  2C98 A;  2CUZ A;  2D7H A;  1NJG A;  5LMN M;  4JI8 M;  1TH2 A;  2H1R A;  4XBO A;  3RE8 A;  1TDZ A;  3A42 A;  2W82 A;  3SC3 A;  2ZAN A;  4M9X A;  5ITQ A;  3GQ3 A;  4G4O A;  3SYK A;  1DGF A;  1TH4 A;  2LWX A;  4L8R C;  2HCB A;  4DR3 M;  2XZU A;  1NSF A;  4D80 A;  1Z6T A;  5FTN A;  4DV3 M;  5DYI A;  5KPT A;  2FNA A;  1XXH B;  2UUB M;  3LMM A;  4CIS A;  4LF7 M;  2QCU A;  5KQ8 A;  1IBK M;  4XGI A;  1K3W A;  4M0D A;  1XNQ M;  2L7I A;  4LJ5 A;  5EXP A;  1XMO M;  3VK8 A;  3HHY A;  4DV2 M;  3DFZ A;  1JQJ C;  4L15 A;  3MJ5 A;  4GIP A;  5FTM A;  4IBI A;  2VQF M;  5DNY A;  4MM3 B;  3T1H M;  2Z7J A;  1EE8 A;  2QP9 X;  3WHK A;  3AV0 A;  4B08 A;  4DV5 M;  2C9O A;  3SYL A;  2KZS A;  1Z5C A;  3KFU G;  1XC8 A;  3VKH A;  3K8Z A;  3KSX A;  3IG5 A;  4DV1 M;  3FKE A;  2F5P A;  2QBY B;  4CGY B;  4LJ4 A;  4GHL A;  3W0F A;  5DYG A;  3HU3 A;  4GIT A;  4EIW A;  1XMQ M;  3HHW A;  4G6Z A;  4HLQ A;  4FWD A;  3HU1 A;  2VQE M;  4JI7 M;  4IBF A;  3SHG B;  2EUC A;  4OVZ B;  3KOY E;  3I4V A;  3SAV A;  2UUA M;  1KSF X;  4AKI A;  3SBJ A;  4DV4 M;  3GRV A;  2F5Q A;  1HQC A;  2BJV A;  3PNY A;  3L29 A;  4JI2 M;  2NQ8 C;  3HKP A;  3FUW A;  3T1Y M;  5ITT A;  4LY6 A;  3W0L B;  5ITY A;  3FYD A;  2UU9 M;  5E6J A;  4IBD A;  1GL7 A;  4FW9 A;  3RGS A;  3VDU A;  4X64 M;  3E4R A;  5FTJ A;  4OX9 M;  4MH0 E;  4NRW A;  4LF6 M;  4OW0 A;  1W5T A;  3OTO M;  3SAW A;  3VLF B;  4DR2 M;  3UMM A;  1NNJ A;  3AL0 C;  4LG2 A;  1Z59 A;  3A98 B;  4B7H A;  3SHF A;  3TQS A;  4AQY M;  1N32 M;  3UGJ A;  4LF5 M;  4X62 M;  4PDG A;  1G59 A;  3SMS A;  2YR0 A;  1E9S A;  2CHG A;  3K1J A;  4KOD A;  3KW6 A;  4R3D A;  1L2D A;  1N36 M;  2ZM6 M;  1QYR A;  4IBB A;  1OFI A;  3GRR A;  4B7G A;  4A3V B;  1IQP A;  3DOA A;  1NVM A;  2XF3 A;  1K82 A;  4DR5 M;  1IN5 A;  2R4E A;  3UK6 A;  2KA6 B;  4W5W A;  3HU2 A;  2Y20 A;  3AFH A;  5EP2 A;  3J27 B;  2Z4S A;  1SXJ B;  1ORY B;  4QHS A;  3RFW A;  1Q3B A;  2F4V M;  2I7P A;  5FTK A;  2UXC M;  1DGH A;  4WW0 A;  2C5R A;  2CHQ A;  1DO0 A;  4NSO B;  1IXZ A;  4X65 M;  4I81 A;  4B3R M;  4DR7 M;  3AOE A;  4FCV A;  1NY5 A;  4BBA A;  3GRY A;  3U60 B;  2Q2E B;  2DZN B;  5A2Q S;  4IIW A;  3GRU A;  2CE7 A;  4DV0 M;  2XGN A;  2XSZ A;  3FUX A;  3UZU A;  2A5Y B;  5FLX S;  4JN6 A;  4DV6 M;  3L28 A;  2I7N A;  1LV7 A;  2CV1 A;  2F5N A;  3FYC A;  4NXN M;  3FTF A;  4B3T M;  2KRK A;  1Z5A A;  2R65 A;  4PCZ A;  2YQZ A;  4IBG A;  4FCT A;  3GLI A;  1W5S A;  4M9S A;  2BNK A;  3U6Q A;  4PDI A;  7CAT A;  2DHR A;  3QWL A;  3TPZ A;  1KYI A;  1GKI A;  4JI0 M;  3GPY A;  5EXX A;  2HHH M;  3HJS A;  1IBM M;  4Z6Y A;  2M5Z A;  3GPP A;  1J7K A;  3ZH9 B;  4KHP M;  3T15 A;  4FCW A;  1SXJ C;  4NRV A;  1DGB A;  2C99 A;  4AG6 A;  2AHM A;  2F5S A;  1YE9 A;  5LMU M;  4L16 A;  4M9Z A;  4RF0 A;  4D82 A;  3AJI B;  3MHV C;  3SAS A;  2QEN A;  4GHA A;  2XFS A;  1HQY E;  1HT1 E;  1JR3 D;  1SXJ D;  1XWI A;  3PFI A;  2XLJ A;  3I51 A;  2Y0T A;  3M0E A;  2BJW A;  1XHB A;  1MX0 A;  3AOG A;  3L25 A;  3LVV A;  3PNV A;  3E9S A;  5ITR A;  3SFZ A;  1E9R A;  2X4A A;  3THG A;  3LQQ A;  3LQR A;  4L78 A;  2DXI A;  4IBK A;  2Y21 A;  3J80 S;  4JI3 M;  5KPZ A;  3KP1 E;  1E94 E;  3J81 S;  3NWL A;  1HNX M;  4LFA M;  3KS4 A;  2V1C A;  3UJN A;  5BR8 M;  1HT2 E;  1TDH A;  5KO3 A;  3HHZ A;  5BPV A;  1Q39 A;  4GKK M;  4MGK E;  1S3S A;  5FTL A;  4IJF A;  1KFV A;  2XSZ D;  5EQT A;  4DR1 M;  4JI5 M;  1GVN A;  5F3W A;  2V1U A;  1ZAE A;  1IY1 A;  2CHV A;  3DZD A;  1NJF A;  3AOE C;  5IT9 S;  4GH9 A;  3C58 A;  1E32 A;  4FWH A;  5ITU A;  4ITQ A;  4QOZ C;  1WXQ A;  4LF4 M;  2V6Z M;  5EP1 A;  4MB7 A;  2CEA A;  3T38 A;  4JI4 M;  1GLN A;  3H4M A;  3GLG B;  4G4Q A;  2Z4R A;  4QNM A;  3R9X B;  1PM5 A;  1G8P A;  3LVW A;  4LJ8 A;  1L8Q A;  4QNR A;  4JI6 M;  3KVW A;  1R2Z A;  2RKO A;  2FOI C;  1IXS B;  3DA1 A;  4PD2 A;  1MU5 A;  3GO8 A;  3JR5 A;  2J7N A;  3TWK A;  3JR4 A;  3U6D A;  1L2C A;  2DWZ B;  4BLC A;  2LH0 A;  1FJG M;  1OJL A;  2YNM D;  4LF9 M;  2KW0 A;  2QZ4 A;  1T3T A;  2DZO B;  1NNU C;  5EP3 A;  2FFJ A;  2YFQ A;  4PT5 A;  4X66 M;  3GLG A;  2E5L M;  3KXE C;  4MGY E;  3A46 A;  4GRI A;  2Z3X A;  4KO8 A;  5IZ7 D;  4LGY A;  4NXM M;  3HGI A;  3J7B A;  2HL7 A;  3VDP A;  2XH9 A;  4LGM A;  4DR6 M;  5ITX E;  1NHG C;  1IM2 A;  2D7G A;  1J5E M;  4LZZ A;  1SXJ A;  4P16 A;  5GKN A;  5IWA M;  2R18 A;  4YHH M;  2L09 A;  3QAU A;  4R7G A;  3AKZ A;  3L2A A;  4LRS A;  3J7A S;  3GLF A;  2OPF A;  2C96 A;  3U61 A;  3U6P A;  5KQD A;  3KOX E;  2KXE A;  3FUU A;  3GPU A;  3U6C A;  2QPA A;  2P5T A;  4L4U A;  1PJI A;  3ILK A;  1QAQ A;  3U5Z A;  4LFC M;  1YSY A;  4MGH A;  3CF6 E;  4IBE A;  4FWG A;  2UXB M;  3HJQ A;  5H37 D;  1SXJ E;  1VDD A;  2R62 A;  4LJA A;  3U60 A;  4B3S M;  2F5O A;  1R2Y A;  1YUB A;  1NHW C;  2HKJ A;  4NOO B;  3TWM A;  4NSR A;  3JAM S;  4MGZ E;  3CF2 A;  1IXR C;  2ZAO A;  3FD9 A;  5JI2 E;  3CTW B;  4FD2 A;  3SAT A;  4B3M M;  2ZBK B;  1DGG A;  4GC9 A;  1X37 A;  4GC5 A;  3GP1 A;  2DVW B;  1QAN A;  4JV5 M;  4BB9 A;  4LCB A;  1OFH A;  1D2N A;  2R45 A;  3IG8 A;  1G4A E;  4AW4 A;  5JI3 E;  1Z5B A;  2X8A A;  4LF8 M;  2Y0Q A;  2G5G X;  1GL6 A;  3KOZ E;  1QAO A;  2CV2 A;  1IN4 A;  4DR4 M;  1QZM A;  3FTD A;  3VFD A;  4LFB M;  1IY2 A;  3ZCB B;  3MK6 A;  1TGU A;  1N78 A;  1G3I A;  2DWM A;  3K2L A;  4DUZ M;  4AZF A;  3U6S A;  4OVZ A;  3KP0 E;  2ZAM A;  4S12 A;  4M0W A;  1N33 M;  2LXE A;  3RGP A;  2QBY A;  3EIH A;  2L6O A;  1HNZ M;  1N75 A;  3B9P A;  3KS8 A;  3FUT A;  3M6A A;  4D81 A;  1IN8 A;  3R8F A;  4KLN A;  3FUV A;  5IRE B;  4JI1 M;  2J7O A;  4IJE A;  1QVR A;  4NL4 H;  2LNH C;  1DO2 A;  1IN7 A;  2RGO A;  1L1T A;  1HR0 M;  2VII A;  3GQ4 A;  2K47 A;  5KPR A;  4QHT A;  3WHL A;  3BOS A;  3Q8X A;  2O5R A;  1NY6 A;  2KZU A;  2ERC A;  4DV7 M;  3U6E A;  2R46 A;  4OU7 A;  4I4L A;  4LJ7 A;  1DGH B;  3PVS A;  1IN6 A;  1ZQ9 A;  3HJ8 A;  4II7 A;  5EP4 A;  3TWL A;  4JXJ A;  4JYA M;  1R6B X;  3FTC A;  3D8L A;  2KRU A;  5EJC A;  1I4W A;  4Z8X A;  1HNW M;  3GLF B;  2FE8 A;  1H6U A;  4TUW A;  2X49 A;  4QOS A;  4REZ A;  2XFT A;  5C1B A;  1G41 A;  2JA2 A;  3U6O A;  4LJ6 A;  3GLI B;  2D7E A;  5EXT A;  1IBL M;  1TH3 A;  3I4Y A;  2G8L A;  3NBI A;  2EO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...