4NXNM

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nxnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4nxnM02
3JAMS 1IBMM 4DR4M 3SAVA 3C58A 4JI4M 4LF6M 4X64M 1I94M 4JI6M 5ITTA 4K0KM 3U6EA 1HNWM 4NRWA 4NRVA 3U6LA 3U6CA 1PM5A 3A42A 4DV4M 1Z5CA 5BR8M 4DR7M 1XNRM 2UXDM 2OQ4A 3A45A 4JI2M 4DV0M 1J5EM 4JI0M 2UUAM 1N33M 4GKJM 4X65M 5ITUA 3SATA 1XNQM 3U6PA 1KFVA 4PDGA 2UUBM 4YY3M 1PJIA 2HHHM 4PCZA 4LF9M 2VQFM 3GPXA 1XMQM 3VK7A 2VQEM 3TWMA 5IT9S 3TWLA 4LFAM 1L2BA 1Z59A 3U6DA 4LF4M 4JI1M 3JR4A 4AQYM 2F4VM 4JI7M 1MU5A 3U6QA 3OTOM 4B3RM 3GQ4A 3U6MA 4DUZM 4LFCM 2OPFA 4LF7M 2F5SA 1L1TA 4X66M 4YHHM 4DUYM 1PJJA 5LMUM 3T1YM 1XMOM 3U6SA 3GPYA 4JI8M 2UXBM 4DV5M 1HR0M 1IBKM 1NNJA 3GPPA 5ITRA 3DOAA 3A46A 4DV1M 3J7AS 1EE8A 4DV3M 1R2YA 4DV2M 1Q39A 4DR1M 3SAWA 5A2QS 4LF8M 1HNZM 2F5QA 4G4RA 3GPUA 4DR3M 1IBLM 3W0FA 5ITXE 3GP1A 4DR5M 4G4NA 2UUCM 4JI3M 5LMNM 4X62M 3SBJA 2F5OA 2F5NA 3TWKA 3JR5A 1Q3CA 1TDHA 4G4OA 2Q2EB 1Z5BA 2HKJA 1HNXM 4CISA 4B3MM 4KHPM 3U6OA 4DR6M 5ITXA 1K82A 4JI5M 4PDIA 1R2ZA 4MB7A 2F5PA 1K3WA 2E5LM 4GKKM 3GO8A 2UU9M 1Z5AA 3J80S 4B3SM 1FJGM 1L1ZA 3SASA 4DV7M 1L2DA 2XZFA 3VK8A 4G4QA 3SAUA 2ZM6M 1XC8A 5FLXS 4LF5M 1N36M 4PD2A 2XZUA 1K3XA 5ITQA 2EA0A 4DR2M 3SARA 5IWAM 4B3TM 1Q3BA 4NXNM 5ITYA 4ITQA 1N32M 4LFBM 2ZBKB 1TDZA 1MX0A 3GQ3A 4NXMM 4DV6M 4OX9M 3J81S 4JV5M 2UXCM 4JYAM 1L2CA 1N34M 3T1HM 3GQ5A
chains in the Genus database with same CATH superfamily
1ZV1A 3MJ5A 4DR4M 4Z8XA 3DFZA 3J2PB 4M9XA 1VEKA 2KA6B 3GLIA 1WXQA 1GO5A 1I94M 4JI6M 2DAEA 3FTCA 1NHWC 3U6EA 4AKIA 2JWSA 1S3SA 2KHHA 4NRVA 4KLNA 3M7GA 4DBGB 3T6PA 4M9ZA 3SFZA 2MROB 4LGMA 3TE6A 4DR7M 3GLHE 1XNRM 3UGJA 3L29A 4NOOB 1J5EM 2B3TA 2JNHA 4GIPA 1G4AE 1D0KA 3GLFB 2C9OA 2BWEA 2UXCM 1BVSA 3FUUA 1SXJD 4YY3M 3UJNA 2HHHM 4LF9M 3HHYA 1OAIA 1XMQM 1NNUC 3Q8XA 3BBZA 2JY7A 3GLFA 1N75A 4D82A 2M60A 3GRYA 3TWLA 2I7PA 3LW5F 1VEJA 3NBIA 4F1IA 3PFIA 2EKFA 4LJ9A 3VKGA 1T43A 4JI7M 3U6QA 5KPZA 2KRUA 2D7GA 3L2AA 4MGZE 1NJGA 1DGGA 2OPFA 1EIJA 4FCWA 1OIPA 3BXWA 2JUJA 1GL6A 1C1KA 2KZUA 3L27A 3B74A 2BJVA 1Z6TA 2M5ZA 3GPYA 2LVNC 4DV5M 4ANRA 1HR0M 1QDTA 1IBKM 3GPPA 5C18A 5EXXA 3W0LB 1XWIA 7CATA 1EE8A 1R2YA 1TTEA 4RNAA 4DV2M 4IBJA 2DKLA 3H4MA 5A2QS 2WSEF 4DR3M 2L4EA 4DR5M 3C9PA 2UUCM 2CUZA 3FTFA 2QHOB 4R7GA 3HWSA 4X62M 2CHQA 2K47A 3RGPA 3ZC7B 4GH9A 1OQYA 2J7NA 1RU3A 4QHTA 1HNXM 1Q02A 2LHGA 3IG5A 4B3MM 2CE7A 2DAIA 1GL7A 2HWJA 4CJ6A 1SXJB 3FTDA 3FRHA 2QP9X 1K3WA 2XFTA 1HJPA 2DI0A 1NVMA 3KSJA 3LVWA 1TH3A 2Z8YM 3GO8A 2CV2A 3GRVA 1GLNA 2DZLA 1J7KA 3AOGA 5EP3A 1L1ZA 2K6BA 1DV0A 5FTKA 2LVQD 1OTRA 4DV7M 1WGNA 4MH0E 1DGHB 2XZFA 1L2DA 3K9PA 2ZM6M 1NHGC 3FYCA 1XC8A 3B9PA 3E4RA 1X37A 3F92A 3R9XB 4MGHA 2XF3A 4IIWA 4AG5A 4B3TM 2LH0A 2WSCF 1Q3BA 3PNYA 1DGHA 4IBIA 1HT2E 1W5SA 2Y0QA 1MX0A 2DVWB 2ZBKB 3FUTA 4P16A 3LQRA 3L25A 3J81S 1PGYA 4L6V6 3ZH9B 4R3DA 3RGSA 1XXHE 3U61B 4R71A 1D2NA 1N34M 1C7YA 4NL4H 1ORYB 2K9DA 3TL4X 3GQ5A 4LJ8A 4MGYE 2DAKA 4GC9A 4F2LA 3U61A 4X64M 2MR9A 3TQSA 2KNVA 4M0DA 3LVVA 1SXJC 2KXEA 2ZAMA 1IN7A 4QHSA 2V1CA 4XK8F 2MH8A 3QAUA 1QYRA 4D81A 4OVZA 2XH9A 3U6CA 1PM5A 5H37D 2AHMA 3K2LA 4QOSA 4AKGA 2HCBA 4IJFA 1OFHA 2CV0A 1NY6A 2FFJA 1VDDA 2VF8A 2JXNA 3U5ZB 4JI2M 1GJSA 3B89A 3EIHA 2R62A 3B7NA 4QNMA 5DYIA 4I4LA 2UUAM 4GHLA 4A3VB 2DZNB 4W5WA 5ITUA 3SATA 1XNQM 3CF0A 2C9CA 1KFVA 4PDGA 2HL7A 4UN2B 2ZTCA 4PCZA 3L26A 3GPXA 3U5ZA 1JQJC 3THGA 4L4UA 2DENA 5JI3E 1GKIA 4I81A 3FYDA 3U6DA 2K0BX 5EP1A 3FRIA 1R4GA 4AQYM 5GKNA 1GJTA 2F4VM 4IBCA 4LJ7A 1TH2A 2CFOA 4RKUF 3OTOM 3C3DA 5BPVA 4CGYB 2R4JA 2H1RA 5DNYA 1DGBA 3QYBA 1L1TA 2VDBB 4YHHM 1PJJA 5LMUM 2CEAA 1PJSA 2APLA 2V6ZM 3K8ZA 3NWLA 1R5LA 3C3EA 3QWLA 1XMOM 4JI8M 1JR3E 1TGUA 2I7NA 2LVAA 3DOAA 2L6OA 3A98B 3KS4A 4G6ZA 3KW6A 1Q39A 2BWBA 2RRUA 4DR1M 2GQFA 8CATA 3GLGE 3PVSA 4JXJA 1HNZM 2LBCA 3GPUA 3SMPA 2MJ5B 1G41A 3HZJA 1H6UA 3NBXX 3SMSA 1IY0A 1R7RA 3AFHA 1UFZA 1XHBA 3FE3A 1NSFA 4GEWA 2Z7JA 4D80A 1WJ7A 1YLAA 3KOWE 2ZTDA 5EJCA 4JI3M 3IHPA 4AW4A 3ZCBB 2CV1A 2Z3XA 2F5OA 3AL0C 2KZSA 4CISA 3AV0A 3KSXA 1QZMA 5ITXA 4DR6M 4OU7A 1G71A 3MK6A 3VDPA 4MB7A 3HHWA 1G3IA 4ZPXA 2E5LM 1D0MA 2QQ8A 1IN4A 2WZJA 4KODA 2XGNA 4NSOB 1NV9A 1UM8A 3FUVA 3KS8A 2WSFF 4B3SM 3HU2A 1FJGM 2L4FA 2O01F 2KW0A 4FWGA 4M9SA 3T38A 3KXEC 2CP8A 3J27B 1OKSA 2DWLA 2QNJA 2DWMA 4WP2A 1TH4A 1IN5A 5EP2A 1V34A 4PD2A 1E9SA 1K3XA 5ITQA 2EA0A 3U60B 2RGOA 2R0IA 3LCVB 4ITQA 4RF0A 4LFBM 3GQ3A 4NXMM 3MMPA 3WHLA 3GLIE 1IY1A 3EIEA 4S12A 4OX9M 1MJGM 1ZMUA 3FD9A 3PNVA 4LCBA 1L2CA 2EKKA 3U60A 3DZDA 4L16A 1HT1E 3SC3A 2DWZB 3T1HM 4IBDA 2Z4SA 4B08A 3KOZE 3JAMS 1V33A 2QBYB 4NSRA 1LTMA 3VLFB 3SAVA 4JI4M 4WURA 4LF6M 1ZMWA 1YSYA 1DO0A 4FWDA 1IM2A 1GVNA 4K0KM 2R65A 2ZANA 3I04M 2QENA 1HNWM 4FCVA 3U6LA 3HU3A 2L7HA 1L8QA 2QBYA 1VQ1A 3IECA 4HLQA 3CGWA 2OQ4A 3A45A 3GLHB 4IJEA 4B7FA 4Z6YA 3GLFE 2YNMD 4GKJM 1N33M 2R18A 2W82A 2NQ8C 2EJSA 3CTWB 3U6PA 2DHYA 2UUBM 1AIPC 1PJIA 2DHRA 3GLHA 1CUKA 4CHTB 1E9RA 3K1JA 2OO9A 2VIIA 4MGIE 5E6JA 4EIWA 4OVZB 1W5TA 4FWHA 2XEPA 3FUWA 5FTMA 3I01M 4LFAM 1L2BA 2YFQA 1EFUB 4LF4M 2Y0TA 4IBBA 1MN3A 1QVRA 2HAKA 1MU5A 4B3RM 3U6MA 2R6FA 3WHKA 2EO2A 2X8AA 4DUZM 2D7HA 2MGWA 1QAOA 4REZA 3LQQA 1HQCA 2XLJA 3HHZA 4X66M 2F5SA 4DUYM 2RGHA 3IG8A 1Y8GA 3SHGB 2FE8A 2DNAA 2UXBM 2YR0A 5ITRA 3AOEA 4QOZC 1WR1B 3ILKA 1E32A 4LJ4A 4RF1A 3A46A 2X4AA 3FKEA 4BLCA 5JI2E 4DV3M 1QANA 2G3QA 4HL4A 3KFUG 1PRBA 3SAWA 3M6AA 2O25A 1F4IA 2ZAOA 4P17A 3LCUA 1NV8A 2J7OA 2R46A 3MHVC 4LZZA 2DZOB 2Y21A 4L78A 2JY5A 3GP1A 3D8BA 2DXIA 1T6OA 3B7QA 4L15A 2R4EA 3HJ8A 4G4NA 3E9SA 5E26A 5LMNM 1AUAA 2QPAA 2QZ4A 1SG9A 3HX3A 3SBJA 4TUWA 3JR5A 1Q3CA 1TDHA 3K9OA 1Z5BA 1IN6A 5KO3A 2OOAA 2L2DA 2G5GX 4LJ5A 4LGYA 1N78A 1QUTA 4PT5A 1K82A 4CIZA 1R2ZA 4JI5M 1SXJE 2F5PA 4IBGA 4GKKM 1IXZA 4WW0A 2FNAA 3KP0E 1J09A 4MM3B 1NY5A 2G8LA 4XGIA 2UU9M 3J80S 2LVPC 4LJ6A 5IZ7D 4LY6A 1VDLA 4GITA 1V92A 4I8OA 3SASA 4LJAA 5FSWA 4G4QA 1YE9A 3R8FA 1QQWA 1N77A 2LHCA 3ZQJA 2LTUA 2KEBA 3KOYE 4LF5M 2XZUA 2KNAA 4G3OA 1A5TA 4DR2M 3SARA 2X49A 4GHAA 4II7A 3UMMA 2XSZD 4GRIA 1LV7A 2XFSA 1N32M 3RE8A 1TDZA 3LMMA 2DWNA 3K92A 3W68A 1QAQA 3E46A 1HQYE 5EP4A 2CHVA 1XXHB 1NO1A 4FVMA 2LWXA 2FS1A 3SYKA 4L8RC 1JR3D 3VK8A 4HEOA 4B7GA 3SYLA 1IBMM 2Z4RA 4IBEA 3C58A 4FCTA 3UK6A 3GRUA 1XXHA 5ITTA 3VKHA 5FTNA 5L8RF 1PJQA 4NRWA 5KPTA 4JN6A 3A42A 2BNKA 3CF6E 4FD2A 4DV4M 1Z5CA 4AG6A 1VG5A 5BR8M 2UXDM 5EXTA 1IFYA 2ERCA 4IBFA 4DV0M 1QUSA 5C1BA 4JI0M 5DYGA 1YUBA 1D0LA 4X65M 1T3TA 1KSFX 2O5RA 1IXRC 3AJIB 2L09A 1PJTA 2QCUA 3E21A 1WHCA 4GMQA 2LXEA 2VQFM 2JP7A 3KVWA 3VK7A 1TR8A 3VDUA 3HJQA 2VQEM 3TWMA 5IT9S 2LNHC 1VEGA 3Q8GA 3T15A 4BBAA 2P5TA 1Z59A 3DA1A 4JI1M 3L28A 3JR4A 4Q7JA 2RKOA 1E94E 4AI6A 3KP1E 2KDLA 4M0WA 1WGLA 2VF7A 1KYIA 3GQ4A 4LFCM 4LF7M 5KPRA 5EXSA 2C5RA 5FTJA 2JY8A 3HU1A 3KOXE 2C98A 4QNRA 3SHFA 3UZUA 2D7EA 2JZ0A 3T1YM 1I4WA 3U6SA 1QDRA 5F3WA 4I5SA 1P3QQ 3KDSE 1NNJA 1OAOC 2XSZA 1OIZA 1WIVA 2QSFX 1GABA 4LRTA 4DV1M 3J7AS 1IN8A 2FH0A 4B7HA 1ZMVA 1G59A 1DO2A 4LF8M 4Y28F 1ZAEA 2F5QA 2DAGA 1IY2A 1OJLA 1NJFA 1SXJA 3FUXA 3GLGB 3PXGA 4G4RA 1IBLM 4KO8A 3HJSA 3W0FA 5KQDA 1JR3A 2R44A 1QZEA 2JZ1A 1OFIA 3B7ZA 3QYEA 5ITXE 1ZQ9A 2Y20A 3M0EA 4NC6A 2KNZA 3W67A 5EXPA 3FTEA 4MGKE 2F5NA 3TWKA 3GLGA 2V1UA 4G4OA 2Q2EB 2HKJA 2CWBA 4KHPM 3U6OA 2YQZA 2JA2A 2R45A 1IXSB 3H4JA 4PDIA 2J5YA 2N35A 3D8LA 2C99A 3VFDA 2DAMA 4IBKA 2CHGA 3HY5A 4LG2A 1IQPA 2LVOC 1Z5AA 2BJWA 3CF2A 5EQTA 3V76A 4AZFA 5KQ8A 2OOBA 1IXSA 3RFWA 2H5XA 1FNNA 3SAUA 4AKHA 3HKPA 1QAMA 4KT0F 5FTLA 5DFLA 3J7BA 5IREB 5FLXS 1N36M 2A5YB 2GNOA 2CRUA 2JY6B 4GC5A 4LRSA 2C96A 5IWAM 3I51A 2KRKA 1JB0F 4NXNM 1XB2B 5ITYA 1G8PA 3GRRA 2FOIC 3HHXA 3AKZA 3TPZA 4DV6M 4XBOA 4JV5M 3BOSA 4JYAM 2L7IA 3GLIB 3I4YA 4BB9A 1TF0B 2EUCA 3HGIA 3AOEC 4OW0A 4LZJA 3I4VA 4FW9A 1DGFA 1R6BX
chains in the Genus database with same CATH topology
3MJ5A 4DR4M 4Z8XA 3DFZA 3J2PB 4M9XA 3GLIA 2KA6B 1WXQA 1I94M 4JI6M 3FTCA 1NHWC 3U6EA 4AKIA 1S3SA 4NRVA 4KLNA 3M7GA 4M9ZA 3SFZA 4LGMA 3TE6A 4DR7M 1XNRM 3UGJA 3L29A 4NOOB 1J5EM 4GIPA 1G4AE 3GLFB 2C9OA 3FUUA 1SXJD 4YY3M 3UJNA 2HHHM 4LF9M 3HHYA 1XMQM 1NNUC 3Q8XA 3GLFA 1N75A 4D82A 2M60A 3GRYA 3TWLA 2I7PA 3NBIA 3PFIA 4LJ9A 3VKGA 4JI7M 3U6QA 5KPZA 2KRUA 2D7GA 3L2AA 4MGZE 1NJGA 1DGGA 2OPFA 4FCWA 1GL6A 1C1KA 2KZUA 3L27A 2BJVA 1Z6TA 2M5ZA 3GPYA 4DV5M 1HR0M 1IBKM 3GPPA 5C18A 5EXXA 3W0LB 1XWIA 7CATA 1EE8A 1R2YA 4RNAA 4DV2M 4IBJA 3H4MA 5A2QS 4DR3M 4DR5M 2UUCM 2CUZA 3FTFA 4R7GA 3HWSA 4X62M 2CHQA 2K47A 3RGPA 3ZC7B 4GH9A 2J7NA 4QHTA 1HNXM 4B3MM 3IG5A 2CE7A 1GL7A 1SXJB 3FTDA 2QP9X 1K3WA 2XFTA 1NVMA 3KSJA 3LVWA 1TH3A 3GO8A 2CV2A 3GRVA 1GLNA 3AOGA 1J7KA 5EP3A 1L1ZA 5FTKA 4DV7M 4MH0E 2XZFA 1DGHB 1L2DA 2ZM6M 1NHGC 3FYCA 1XC8A 3B9PA 3E4RA 1X37A 3R9XB 4MGHA 2XF3A 4IIWA 4AG5A 4B3TM 2LH0A 1Q3BA 3PNYA 1DGHA 4IBIA 1HT2E 1W5SA 2Y0QA 1MX0A 2DVWB 2ZBKB 3FUTA 4P16A 3LQRA 3L25A 3J81S 3ZH9B 3U61B 4R3DA 3RGSA 1D2NA 1N34M 4NL4H 1ORYB 3TL4X 3GQ5A 4LJ8A 4MGYE 4GC9A 3U61A 4X64M 3TQSA 4M0DA 3LVVA 1SXJC 2KXEA 2ZAMA 1IN7A 4QHSA 2V1CA 3QAUA 1QYRA 4D81A 4OVZA 2XH9A 3U6CA 1PM5A 5H37D 2AHMA 3K2LA 4QOSA 4AKGA 2HCBA 4IJFA 1OFHA 2CV0A 1NY6A 2FFJA 1VDDA 4JI2M 3U5ZB 3EIHA 2R62A 5DYIA 4QNMA 2UUAM 4I4LA 4GHLA 4A3VB 2DZNB 4W5WA 5ITUA 3SATA 1XNQM 3CF0A 2C9CA 1KFVA 4PDGA 2HL7A 4PCZA 3L26A 3GPXA 3U5ZA 1JQJC 3THGA 4L4UA 5JI3E 1GKIA 4I81A 3FYDA 3U6DA 5EP1A 4AQYM 5GKNA 2F4VM 4IBCA 4LJ7A 1TH2A 2CFOA 3OTOM 5BPVA 4CGYB 2R4JA 2H1RA 5DNYA 1DGBA 1L1TA 4YHHM 1PJJA 5LMUM 2CEAA 3K8ZA 2V6ZM 3NWLA 3QWLA 1XMOM 4JI8M 1TGUA 2I7NA 3DOAA 2L6OA 3A98B 3KS4A 4G6ZA 3KW6A 1Q39A 4DR1M 8CATA 3PVSA 4JXJA 1HNZM 3GPUA 3SMPA 1G41A 1H6UA 3SMSA 1IY0A 1R7RA 3AFHA 1XHBA 1NSFA 2Z7JA 4D80A 3KOWE 4JI3M 5EJCA 4AW4A 3ZCBB 2CV1A 2Z3XA 2F5OA 3AL0C 2KZSA 4CISA 3AV0A 3KSXA 1QZMA 5ITXA 4DR6M 4OU7A 3MK6A 3VDPA 4MB7A 3HHWA 1G3IA 4ZPXA 2E5LM 1IN4A 4KODA 2XGNA 4NSOB 1UM8A 3FUVA 3KS8A 4B3SM 3HU2A 1FJGM 2KW0A 4FWGA 4M9SA 3T38A 3KXEC 3J27B 2DWLA 2DWMA 1TH4A 1IN5A 5EP2A 4PD2A 1E9SA 1K3XA 5ITQA 2EA0A 3U60B 2RGOA 4ITQA 4RF0A 4LFBM 3GQ3A 4NXMM 3WHLA 4OX9M 2UXCM 1IY1A 3EIEA 4S12A 3FD9A 3PNVA 4LCBA 1L2CA 3U60A 3DZDA 4L16A 1HT1E 3SC3A 2DWZB 3T1HM 4IBDA 2Z4SA 4B08A 3KOZE 3JAMS 2QBYB 4NSRA 3VLFB 3SAVA 4JI4M 4LF6M 4WURA 1YSYA 1DO0A 4FWDA 1IM2A 1GVNA 4K0KM 2R65A 2ZANA 2QENA 1HNWM 4FCVA 3U6LA 3HU3A 2L7HA 1L8QA 2QBYA 4HLQA 2OQ4A 3A45A 3GLHB 4IJEA 4B7FA 4Z6YA 2YNMD 4GKJM 1N33M 2R18A 2W82A 2NQ8C 3CTWB 3U6PA 2UUBM 1PJIA 2DHRA 3GLHA 4CHTB 1E9RA 3K1JA 2VIIA 4MGIE 5E6JA 4EIWA 4OVZB 1W5TA 4FWHA 2XEPA 3FUWA 5FTMA 4LFAM 1L2BA 2YFQA 4LF4M 2Y0TA 4IBBA 1QVRA 1MU5A 4B3RM 3U6MA 3WHKA 2EO2A 2X8AA 4DUZM 2D7HA 1QAOA 4REZA 3LQQA 1HQCA 2XLJA 3HHZA 4X66M 2F5SA 4DUYM 2RGHA 3IG8A 3SHGB 2FE8A 2UXBM 2YR0A 5ITRA 3AOEA 4QOZC 3ILKA 4LJ4A 1E32A 3A46A 4RF1A 2X4AA 3FKEA 4BLCA 5JI2E 4DV3M 1QANA 3KFUG 4HL4A 3SAWA 3M6AA 2ZAOA 2J7OA 2R46A 3MHVC 4LZZA 2DZOB 2Y21A 4L78A 3GP1A 3D8BA 2DXIA 4L15A 2R4EA 3HJ8A 4G4NA 3E9SA 5E26A 5LMNM 2QPAA 2QZ4A 3SBJA 4TUWA 3JR5A 1Q3CA 1TDHA 1Z5BA 1IN6A 5KO3A 4LJ5A 2G5GX 4LGYA 1N78A 4PT5A 1K82A 4JI5M 1R2ZA 1SXJE 2F5PA 4IBGA 4GKKM 1IXZA 4WW0A 2FNAA 3KP0E 1J09A 4MM3B 1NY5A 2G8LA 4XGIA 2UU9M 3J80S 4LJ6A 5IZ7D 4LY6A 4GITA 3SASA 4I8OA 4LJAA 5FSWA 4G4QA 1YE9A 3R8FA 1QQWA 1N77A 2KEBA 3KOYE 4LF5M 2XZUA 4DR2M 3SARA 2X49A 4GHAA 4II7A 3UMMA 2XSZD 4GRIA 1LV7A 2XFSA 1N32M 3RE8A 1TDZA 3LMMA 2DWNA 3K92A 1QAQA 1HQYE 5EP4A 2CHVA 1XXHB 4FVMA 2LWXA 4L8RC 3SYKA 1JR3D 3VK8A 4B7GA 3SYLA 1IBMM 2Z4RA 4IBEA 3C58A 4FCTA 3UK6A 3GRUA 1XXHA 5ITTA 3VKHA 5FTNA 4NRWA 5KPTA 4JN6A 3A42A 2BNKA 3CF6E 4FD2A 4DV4M 1Z5CA 4AG6A 5BR8M 2UXDM 5EXTA 2ERCA 4IBFA 4DV0M 5C1BA 4JI0M 5DYGA 1YUBA 4X65M 1T3TA 1KSFX 2O5RA 1IXRC 3AJIB 2L09A 2QCUA 4GMQA 2LXEA 2VQFM 3KVWA 3VK7A 3VDUA 3HJQA 2VQEM 3TWMA 5IT9S 2LNHC 3T15A 4BBAA 2P5TA 1Z59A 3DA1A 4JI1M 3L28A 3JR4A 2RKOA 1E94E 4AI6A 3KP1E 4M0WA 1KYIA 3GQ4A 4LFCM 4LF7M 5KPRA 5EXSA 2C5RA 5FTJA 3HU1A 3KOXE 2C98A 4QNRA 3SHFA 3UZUA 2D7EA 3T1YM 1I4WA 3U6SA 5F3WA 4I5SA 3KDSE 1NNJA 2XSZA 4LRTA 4DV1M 3J7AS 1IN8A 4B7HA 1G59A 1DO2A 4LF8M 2F5QA 1ZAEA 4G4RA 1IY2A 1OJLA 1NJFA 1SXJA 3FUXA 3GLGB 3PXGA 1IBLM 4KO8A 3HJSA 3W0FA 5KQDA 1JR3A 5ITXE 1OFIA 1ZQ9A 2Y20A 3M0EA 5EXPA 3FTEA 4MGKE 2F5NA 3TWKA 3GLGA 2V1UA 4G4OA 2Q2EB 2HKJA 4KHPM 3U6OA 2YQZA 2JA2A 2R45A 1IXSB 4PDIA 3D8LA 2C99A 3VFDA 4IBKA 2CHGA 4LG2A 1IQPA 5EQTA 1Z5AA 2BJWA 3CF2A 4AZFA 5KQ8A 3RFWA 1FNNA 3SAUA 4AKHA 3HKPA 1QAMA 5FLXS 5FTLA 5IREB 3J7BA 1N36M 2A5YB 4GC5A 4LRSA 2C96A 5IWAM 3I51A 2KRKA 4NXNM 5ITYA 1G8PA 3GRRA 2FOIC 3HHXA 3AKZA 3TPZA 4DV6M 4XBOA 4JV5M 3BOSA 4JYAM 2L7IA 3GLIB 3I4YA 4BB9A 2EUCA 3HGIA 3AOEC 4OW0A 4LZJA 3I4VA 4FW9A 1DGFA 1R6BX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM S;  1IBM M;  4DR4 M;  3SAV A;  3C58 A;  4JI4 M;  4LF6 M;  4X64 M;  1I94 M;  4JI6 M;  5ITT A;  4K0K M;  3U6E A;  1HNW M;  4NRW A;  4NRV A;  3U6L A;  3U6C A;  1PM5 A;  3A42 A;  4DV4 M;  1Z5C A;  5BR8 M;  4DR7 M;  1XNR M;  2UXD M;  2OQ4 A;  3A45 A;  4JI2 M;  4DV0 M;  1J5E M;  4JI0 M;  2UUA M;  1N33 M;  4GKJ M;  4X65 M;  5ITU A;  3SAT A;  1XNQ M;  3U6P A;  1KFV A;  4PDG A;  2UUB M;  4YY3 M;  1PJI A;  2HHH M;  4PCZ A;  4LF9 M;  2VQF M;  3GPX A;  1XMQ M;  3VK7 A;  2VQE M;  3TWM A;  5IT9 S;  3TWL A;  4LFA M;  1L2B A;  1Z59 A;  3U6D A;  4LF4 M;  4JI1 M;  3JR4 A;  4AQY M;  2F4V M;  4JI7 M;  1MU5 A;  3U6Q A;  3OTO M;  4B3R M;  3GQ4 A;  3U6M A;  4DUZ M;  4LFC M;  2OPF A;  4LF7 M;  2F5S A;  1L1T A;  4X66 M;  4YHH M;  4DUY M;  1PJJ A;  5LMU M;  3T1Y M;  1XMO M;  3U6S A;  3GPY A;  4JI8 M;  2UXB M;  4DV5 M;  1HR0 M;  1IBK M;  1NNJ A;  3GPP A;  5ITR A;  3DOA A;  3A46 A;  4DV1 M;  3J7A S;  1EE8 A;  4DV3 M;  1R2Y A;  4DV2 M;  1Q39 A;  4DR1 M;  3SAW A;  5A2Q S;  4LF8 M;  1HNZ M;  2F5Q A;  4G4R A;  3GPU A;  4DR3 M;  1IBL M;  3W0F A;  5ITX E;  3GP1 A;  4DR5 M;  4G4N A;  2UUC M;  4JI3 M;  5LMN M;  4X62 M;  3SBJ A;  2F5O A;  2F5N A;  3TWK A;  3JR5 A;  1Q3C A;  1TDH A;  4G4O A;  2Q2E B;  1Z5B A;  2HKJ A;  1HNX M;  4CIS A;  4B3M M;  4KHP M;  3U6O A;  4DR6 M;  5ITX A;  1K82 A;  4JI5 M;  4PDI A;  1R2Z A;  4MB7 A;  2F5P A;  1K3W A;  2E5L M;  4GKK M;  3GO8 A;  2UU9 M;  1Z5A A;  3J80 S;  4B3S M;  1FJG M;  1L1Z A;  3SAS A;  4DV7 M;  1L2D A;  2XZF A;  3VK8 A;  4G4Q A;  3SAU A;  2ZM6 M;  1XC8 A;  5FLX S;  4LF5 M;  1N36 M;  4PD2 A;  2XZU A;  1K3X A;  5ITQ A;  2EA0 A;  4DR2 M;  3SAR A;  5IWA M;  4B3T M;  1Q3B A;  4NXN M;  5ITY A;  4ITQ A;  1N32 M;  4LFB M;  2ZBK B;  1TDZ A;  1MX0 A;  3GQ3 A;  4NXM M;  4DV6 M;  4OX9 M;  3J81 S;  4JV5 M;  2UXC M;  4JYA M;  1L2C A;  1N34 M;  3T1H M;  3GQ5 A; 
#chains in the Genus database with same CATH topology
 1ZV1 A;  3MJ5 A;  4DR4 M;  4Z8X A;  3DFZ A;  3J2P B;  4M9X A;  1VEK A;  2KA6 B;  3GLI A;  1WXQ A;  1GO5 A;  1I94 M;  4JI6 M;  2DAE A;  3FTC A;  1NHW C;  3U6E A;  4AKI A;  2JWS A;  1S3S A;  2KHH A;  4NRV A;  4KLN A;  3M7G A;  4DBG B;  3T6P A;  4M9Z A;  3SFZ A;  2MRO B;  4LGM A;  3TE6 A;  4DR7 M;  3GLH E;  1XNR M;  3UGJ A;  3L29 A;  4NOO B;  1J5E M;  2B3T A;  2JNH A;  4GIP A;  1G4A E;  1D0K A;  3GLF B;  2C9O A;  2BWE A;  2UXC M;  1BVS A;  3FUU A;  1SXJ D;  4YY3 M;  3UJN A;  2HHH M;  4LF9 M;  3HHY A;  1OAI A;  1XMQ M;  1NNU C;  3Q8X A;  3BBZ A;  2JY7 A;  3GLF A;  1N75 A;  4D82 A;  2M60 A;  3GRY A;  3TWL A;  2I7P A;  3LW5 F;  1VEJ A;  3NBI A;  4F1I A;  3PFI A;  2EKF A;  4LJ9 A;  3VKG A;  1T43 A;  4JI7 M;  3U6Q A;  5KPZ A;  2KRU A;  2D7G A;  3L2A A;  4MGZ E;  1NJG A;  1DGG A;  2OPF A;  1EIJ A;  4FCW A;  1OIP A;  3BXW A;  2JUJ A;  1GL6 A;  1C1K A;  2KZU A;  3L27 A;  3B74 A;  2BJV A;  1Z6T A;  2M5Z A;  3GPY A;  2LVN C;  4DV5 M;  4ANR A;  1HR0 M;  1QDT A;  1IBK M;  3GPP A;  5C18 A;  5EXX A;  3W0L B;  1XWI A;  7CAT A;  1EE8 A;  1R2Y A;  1TTE A;  4RNA A;  4DV2 M;  4IBJ A;  2DKL A;  3H4M A;  5A2Q S;  2WSE F;  4DR3 M;  2L4E A;  4DR5 M;  3C9P A;  2UUC M;  2CUZ A;  3FTF A;  2QHO B;  4R7G A;  3HWS A;  4X62 M;  2CHQ A;  2K47 A;  3RGP A;  3ZC7 B;  4GH9 A;  1OQY A;  2J7N A;  1RU3 A;  4QHT A;  1HNX M;  1Q02 A;  2LHG A;  3IG5 A;  4B3M M;  2CE7 A;  2DAI A;  1GL7 A;  2HWJ A;  4CJ6 A;  1SXJ B;  3FTD A;  3FRH A;  2QP9 X;  1K3W A;  2XFT A;  1HJP A;  2DI0 A;  1NVM A;  3KSJ A;  3LVW A;  1TH3 A;  2Z8Y M;  3GO8 A;  2CV2 A;  3GRV A;  1GLN A;  2DZL A;  1J7K A;  3AOG A;  5EP3 A;  1L1Z A;  2K6B A;  1DV0 A;  5FTK A;  2LVQ D;  1OTR A;  4DV7 M;  1WGN A;  4MH0 E;  1DGH B;  2XZF A;  1L2D A;  3K9P A;  2ZM6 M;  1NHG C;  3FYC A;  1XC8 A;  3B9P A;  3E4R A;  1X37 A;  3F92 A;  3R9X B;  4MGH A;  2XF3 A;  4IIW A;  4AG5 A;  4B3T M;  2LH0 A;  2WSC F;  1Q3B A;  3PNY A;  1DGH A;  4IBI A;  1HT2 E;  1W5S A;  2Y0Q A;  1MX0 A;  2DVW B;  2ZBK B;  3FUT A;  4P16 A;  3LQR A;  3L25 A;  3J81 S;  1PGY A;  4L6V 6;  3ZH9 B;  4R3D A;  3RGS A;  1XXH E;  3U61 B;  4R71 A;  1D2N A;  1N34 M;  1C7Y A;  4NL4 H;  1ORY B;  2K9D A;  3TL4 X;  3GQ5 A;  4LJ8 A;  4MGY E;  2DAK A;  4GC9 A;  4F2L A;  3U61 A;  4X64 M;  2MR9 A;  3TQS A;  2KNV A;  4M0D A;  3LVV A;  1SXJ C;  2KXE A;  2ZAM A;  1IN7 A;  4QHS A;  2V1C A;  4XK8 F;  2MH8 A;  3QAU A;  1QYR A;  4D81 A;  4OVZ A;  2XH9 A;  3U6C A;  1PM5 A;  5H37 D;  2AHM A;  3K2L A;  4QOS A;  4AKG A;  2HCB A;  4IJF A;  1OFH A;  2CV0 A;  1NY6 A;  2FFJ A;  1VDD A;  2VF8 A;  2JXN A;  3U5Z B;  4JI2 M;  1GJS A;  3B89 A;  3EIH A;  2R62 A;  3B7N A;  4QNM A;  5DYI A;  4I4L A;  2UUA M;  4GHL A;  4A3V B;  2DZN B;  4W5W A;  5ITU A;  3SAT A;  1XNQ M;  3CF0 A;  2C9C A;  1KFV A;  4PDG A;  2HL7 A;  4UN2 B;  2ZTC A;  4PCZ A;  3L26 A;  3GPX A;  3U5Z A;  1JQJ C;  3THG A;  4L4U A;  2DEN A;  5JI3 E;  1GKI A;  4I81 A;  3FYD A;  3U6D A;  2K0B X;  5EP1 A;  3FRI A;  1R4G A;  4AQY M;  5GKN A;  1GJT A;  2F4V M;  4IBC A;  4LJ7 A;  1TH2 A;  2CFO A;  4RKU F;  3OTO M;  3C3D A;  5BPV A;  4CGY B;  2R4J A;  2H1R A;  5DNY A;  1DGB A;  3QYB A;  1L1T A;  2VDB B;  4YHH M;  1PJJ A;  5LMU M;  2CEA A;  1PJS A;  2APL A;  2V6Z M;  3K8Z A;  3NWL A;  1R5L A;  3C3E A;  3QWL A;  1XMO M;  4JI8 M;  1JR3 E;  1TGU A;  2I7N A;  2LVA A;  3DOA A;  2L6O A;  3A98 B;  3KS4 A;  4G6Z A;  3KW6 A;  1Q39 A;  2BWB A;  2RRU A;  4DR1 M;  2GQF A;  8CAT A;  3GLG E;  3PVS A;  4JXJ A;  1HNZ M;  2LBC A;  3GPU A;  3SMP A;  2MJ5 B;  1G41 A;  3HZJ A;  1H6U A;  3NBX X;  3SMS A;  1IY0 A;  1R7R A;  3AFH A;  1UFZ A;  1XHB A;  3FE3 A;  1NSF A;  4GEW A;  2Z7J A;  4D80 A;  1WJ7 A;  1YLA A;  3KOW E;  2ZTD A;  5EJC A;  4JI3 M;  3IHP A;  4AW4 A;  3ZCB B;  2CV1 A;  2Z3X A;  2F5O A;  3AL0 C;  2KZS A;  4CIS A;  3AV0 A;  3KSX A;  1QZM A;  5ITX A;  4DR6 M;  4OU7 A;  1G71 A;  3MK6 A;  3VDP A;  4MB7 A;  3HHW A;  1G3I A;  4ZPX A;  2E5L M;  1D0M A;  2QQ8 A;  1IN4 A;  2WZJ A;  4KOD A;  2XGN A;  4NSO B;  1NV9 A;  1UM8 A;  3FUV A;  3KS8 A;  2WSF F;  4B3S M;  3HU2 A;  1FJG M;  2L4F A;  2O01 F;  2KW0 A;  4FWG A;  4M9S A;  3T38 A;  3KXE C;  2CP8 A;  3J27 B;  1OKS A;  2DWL A;  2QNJ A;  2DWM A;  4WP2 A;  1TH4 A;  1IN5 A;  5EP2 A;  1V34 A;  4PD2 A;  1E9S A;  1K3X A;  5ITQ A;  2EA0 A;  3U60 B;  2RGO A;  2R0I A;  3LCV B;  4ITQ A;  4RF0 A;  4LFB M;  3GQ3 A;  4NXM M;  3MMP A;  3WHL A;  3GLI E;  1IY1 A;  3EIE A;  4S12 A;  4OX9 M;  1MJG M;  1ZMU A;  3FD9 A;  3PNV A;  4LCB A;  1L2C A;  2EKK A;  3U60 A;  3DZD A;  4L16 A;  1HT1 E;  3SC3 A;  2DWZ B;  3T1H M;  4IBD A;  2Z4S A;  4B08 A;  3KOZ E;  3JAM S;  1V33 A;  2QBY B;  4NSR A;  1LTM A;  3VLF B;  3SAV A;  4JI4 M;  4WUR A;  4LF6 M;  1ZMW A;  1YSY A;  1DO0 A;  4FWD A;  1IM2 A;  1GVN A;  4K0K M;  2R65 A;  2ZAN A;  3I04 M;  2QEN A;  1HNW M;  4FCV A;  3U6L A;  3HU3 A;  2L7H A;  1L8Q A;  2QBY A;  1VQ1 A;  3IEC A;  4HLQ A;  3CGW A;  2OQ4 A;  3A45 A;  3GLH B;  4IJE A;  4B7F A;  4Z6Y A;  3GLF E;  2YNM D;  4GKJ M;  1N33 M;  2R18 A;  2W82 A;  2NQ8 C;  2EJS A;  3CTW B;  3U6P A;  2DHY A;  2UUB M;  1AIP C;  1PJI A;  2DHR A;  3GLH A;  1CUK A;  4CHT B;  1E9R A;  3K1J A;  2OO9 A;  2VII A;  4MGI E;  5E6J A;  4EIW A;  4OVZ B;  1W5T A;  4FWH A;  2XEP A;  3FUW A;  5FTM A;  3I01 M;  4LFA M;  1L2B A;  2YFQ A;  1EFU B;  4LF4 M;  2Y0T A;  4IBB A;  1MN3 A;  1QVR A;  2HAK A;  1MU5 A;  4B3R M;  3U6M A;  2R6F A;  3WHK A;  2EO2 A;  2X8A A;  4DUZ M;  2D7H A;  2MGW A;  1QAO A;  4REZ A;  3LQQ A;  1HQC A;  2XLJ A;  3HHZ A;  4X66 M;  2F5S A;  4DUY M;  2RGH A;  3IG8 A;  1Y8G A;  3SHG B;  2FE8 A;  2DNA A;  2UXB M;  2YR0 A;  5ITR A;  3AOE A;  4QOZ C;  1WR1 B;  3ILK A;  1E32 A;  4LJ4 A;  4RF1 A;  3A46 A;  2X4A A;  3FKE A;  4BLC A;  5JI2 E;  4DV3 M;  1QAN A;  2G3Q A;  4HL4 A;  3KFU G;  1PRB A;  3SAW A;  3M6A A;  2O25 A;  1F4I A;  2ZAO A;  4P17 A;  3LCU A;  1NV8 A;  2J7O A;  2R46 A;  3MHV C;  4LZZ A;  2DZO B;  2Y21 A;  4L78 A;  2JY5 A;  3GP1 A;  3D8B A;  2DXI A;  1T6O A;  3B7Q A;  4L15 A;  2R4E A;  3HJ8 A;  4G4N A;  3E9S A;  5E26 A;  5LMN M;  1AUA A;  2QPA A;  2QZ4 A;  1SG9 A;  3HX3 A;  3SBJ A;  4TUW A;  3JR5 A;  1Q3C A;  1TDH A;  3K9O A;  1Z5B A;  1IN6 A;  5KO3 A;  2OOA A;  2L2D A;  2G5G X;  4LJ5 A;  4LGY A;  1N78 A;  1QUT A;  4PT5 A;  1K82 A;  4CIZ A;  1R2Z A;  4JI5 M;  1SXJ E;  2F5P A;  4IBG A;  4GKK M;  1IXZ A;  4WW0 A;  2FNA A;  3KP0 E;  1J09 A;  4MM3 B;  1NY5 A;  2G8L A;  4XGI A;  2UU9 M;  3J80 S;  2LVP C;  4LJ6 A;  5IZ7 D;  4LY6 A;  1VDL A;  4GIT A;  1V92 A;  4I8O A;  3SAS A;  4LJA A;  5FSW A;  4G4Q A;  1YE9 A;  3R8F A;  1QQW A;  1N77 A;  2LHC A;  3ZQJ A;  2LTU A;  2KEB A;  3KOY E;  4LF5 M;  2XZU A;  2KNA A;  4G3O A;  1A5T A;  4DR2 M;  3SAR A;  2X49 A;  4GHA A;  4II7 A;  3UMM A;  2XSZ D;  4GRI A;  1LV7 A;  2XFS A;  1N32 M;  3RE8 A;  1TDZ A;  3LMM A;  2DWN A;  3K92 A;  3W68 A;  1QAQ A;  3E46 A;  1HQY E;  5EP4 A;  2CHV A;  1XXH B;  1NO1 A;  4FVM A;  2LWX A;  2FS1 A;  3SYK A;  4L8R C;  1JR3 D;  3VK8 A;  4HEO A;  4B7G A;  3SYL A;  1IBM M;  2Z4R A;  4IBE A;  3C58 A;  4FCT A;  3UK6 A;  3GRU A;  1XXH A;  5ITT A;  3VKH A;  5FTN A;  5L8R F;  1PJQ A;  4NRW A;  5KPT A;  4JN6 A;  3A42 A;  2BNK A;  3CF6 E;  4FD2 A;  4DV4 M;  1Z5C A;  4AG6 A;  1VG5 A;  5BR8 M;  2UXD M;  5EXT A;  1IFY A;  2ERC A;  4IBF A;  4DV0 M;  1QUS A;  5C1B A;  4JI0 M;  5DYG A;  1YUB A;  1D0L A;  4X65 M;  1T3T A;  1KSF X;  2O5R A;  1IXR C;  3AJI B;  2L09 A;  1PJT A;  2QCU A;  3E21 A;  1WHC A;  4GMQ A;  2LXE A;  2VQF M;  2JP7 A;  3KVW A;  3VK7 A;  1TR8 A;  3VDU A;  3HJQ A;  2VQE M;  3TWM A;  5IT9 S;  2LNH C;  1VEG A;  3Q8G A;  3T15 A;  4BBA A;  2P5T A;  1Z59 A;  3DA1 A;  4JI1 M;  3L28 A;  3JR4 A;  4Q7J A;  2RKO A;  1E94 E;  4AI6 A;  3KP1 E;  2KDL A;  4M0W A;  1WGL A;  2VF7 A;  1KYI A;  3GQ4 A;  4LFC M;  4LF7 M;  5KPR A;  5EXS A;  2C5R A;  5FTJ A;  2JY8 A;  3HU1 A;  3KOX E;  2C98 A;  4QNR A;  3SHF A;  3UZU A;  2D7E A;  2JZ0 A;  3T1Y M;  1I4W A;  3U6S A;  1QDR A;  5F3W A;  4I5S A;  1P3Q Q;  3KDS E;  1NNJ A;  1OAO C;  2XSZ A;  1OIZ A;  1WIV A;  2QSF X;  1GAB A;  4LRT A;  4DV1 M;  3J7A S;  1IN8 A;  2FH0 A;  4B7H A;  1ZMV A;  1G59 A;  1DO2 A;  4LF8 M;  4Y28 F;  1ZAE A;  2F5Q A;  2DAG A;  1IY2 A;  1OJL A;  1NJF A;  1SXJ A;  3FUX A;  3GLG B;  3PXG A;  4G4R A;  1IBL M;  4KO8 A;  3HJS A;  3W0F A;  5KQD A;  1JR3 A;  2R44 A;  1QZE A;  2JZ1 A;  1OFI A;  3B7Z A;  3QYE A;  5ITX E;  1ZQ9 A;  2Y20 A;  3M0E A;  4NC6 A;  2KNZ A;  3W67 A;  5EXP A;  3FTE A;  4MGK E;  2F5N A;  3TWK A;  3GLG A;  2V1U A;  4G4O A;  2Q2E B;  2HKJ A;  2CWB A;  4KHP M;  3U6O A;  2YQZ A;  2JA2 A;  2R45 A;  1IXS B;  3H4J A;  4PDI A;  2J5Y A;  2N35 A;  3D8L A;  2C99 A;  3VFD A;  2DAM A;  4IBK A;  2CHG A;  3HY5 A;  4LG2 A;  1IQP A;  2LVO C;  1Z5A A;  2BJW A;  3CF2 A;  5EQT A;  3V76 A;  4AZF A;  5KQ8 A;  2OOB A;  1IXS A;  3RFW A;  2H5X A;  1FNN A;  3SAU A;  4AKH A;  3HKP A;  1QAM A;  4KT0 F;  5FTL A;  5DFL A;  3J7B A;  5IRE B;  5FLX S;  1N36 M;  2A5Y B;  2GNO A;  2CRU A;  2JY6 B;  4GC5 A;  4LRS A;  2C96 A;  5IWA M;  3I51 A;  2KRK A;  1JB0 F;  4NXN M;  1XB2 B;  5ITY A;  1G8P A;  3GRR A;  2FOI C;  3HHX A;  3AKZ A;  3TPZ A;  4DV6 M;  4XBO A;  4JV5 M;  3BOS A;  4JYA M;  2L7I A;  3GLI B;  3I4Y A;  4BB9 A;  1TF0 B;  2EUC A;  3HGI A;  3AOE C;  4OW0 A;  4LZJ A;  3I4V A;  4FW9 A;  1DGF A;  1R6B X; 
#chains in the Genus database with same CATH homology
 3MJ5 A;  4DR4 M;  4Z8X A;  3DFZ A;  3J2P B;  4M9X A;  3GLI A;  2KA6 B;  1WXQ A;  1I94 M;  4JI6 M;  3FTC A;  1NHW C;  3U6E A;  4AKI A;  1S3S A;  4NRV A;  4KLN A;  3M7G A;  4M9Z A;  3SFZ A;  4LGM A;  3TE6 A;  4DR7 M;  1XNR M;  3UGJ A;  3L29 A;  4NOO B;  1J5E M;  4GIP A;  1G4A E;  3GLF B;  2C9O A;  3FUU A;  1SXJ D;  4YY3 M;  3UJN A;  2HHH M;  4LF9 M;  3HHY A;  1XMQ M;  1NNU C;  3Q8X A;  3GLF A;  1N75 A;  4D82 A;  2M60 A;  3GRY A;  3TWL A;  2I7P A;  3NBI A;  3PFI A;  4LJ9 A;  3VKG A;  4JI7 M;  3U6Q A;  5KPZ A;  2KRU A;  2D7G A;  3L2A A;  4MGZ E;  1NJG A;  1DGG A;  2OPF A;  4FCW A;  1GL6 A;  1C1K A;  2KZU A;  3L27 A;  2BJV A;  1Z6T A;  2M5Z A;  3GPY A;  4DV5 M;  1HR0 M;  1IBK M;  3GPP A;  5C18 A;  5EXX A;  3W0L B;  1XWI A;  7CAT A;  1EE8 A;  1R2Y A;  4RNA A;  4DV2 M;  4IBJ A;  3H4M A;  5A2Q S;  4DR3 M;  4DR5 M;  2UUC M;  2CUZ A;  3FTF A;  4R7G A;  3HWS A;  4X62 M;  2CHQ A;  2K47 A;  3RGP A;  3ZC7 B;  4GH9 A;  2J7N A;  4QHT A;  1HNX M;  4B3M M;  3IG5 A;  2CE7 A;  1GL7 A;  1SXJ B;  3FTD A;  2QP9 X;  1K3W A;  2XFT A;  1NVM A;  3KSJ A;  3LVW A;  1TH3 A;  3GO8 A;  2CV2 A;  3GRV A;  1GLN A;  3AOG A;  1J7K A;  5EP3 A;  1L1Z A;  5FTK A;  4DV7 M;  4MH0 E;  2XZF A;  1DGH B;  1L2D A;  2ZM6 M;  1NHG C;  3FYC A;  1XC8 A;  3B9P A;  3E4R A;  1X37 A;  3R9X B;  4MGH A;  2XF3 A;  4IIW A;  4AG5 A;  4B3T M;  2LH0 A;  1Q3B A;  3PNY A;  1DGH A;  4IBI A;  1HT2 E;  1W5S A;  2Y0Q A;  1MX0 A;  2DVW B;  2ZBK B;  3FUT A;  4P16 A;  3LQR A;  3L25 A;  3J81 S;  3ZH9 B;  3U61 B;  4R3D A;  3RGS A;  1D2N A;  1N34 M;  4NL4 H;  1ORY B;  3TL4 X;  3GQ5 A;  4LJ8 A;  4MGY E;  4GC9 A;  3U61 A;  4X64 M;  3TQS A;  4M0D A;  3LVV A;  1SXJ C;  2KXE A;  2ZAM A;  1IN7 A;  4QHS A;  2V1C A;  3QAU A;  1QYR A;  4D81 A;  4OVZ A;  2XH9 A;  3U6C A;  1PM5 A;  5H37 D;  2AHM A;  3K2L A;  4QOS A;  4AKG A;  2HCB A;  4IJF A;  1OFH A;  2CV0 A;  1NY6 A;  2FFJ A;  1VDD A;  4JI2 M;  3U5Z B;  3EIH A;  2R62 A;  5DYI A;  4QNM A;  2UUA M;  4I4L A;  4GHL A;  4A3V B;  2DZN B;  4W5W A;  5ITU A;  3SAT A;  1XNQ M;  3CF0 A;  2C9C A;  1KFV A;  4PDG A;  2HL7 A;  4PCZ A;  3L26 A;  3GPX A;  3U5Z A;  1JQJ C;  3THG A;  4L4U A;  5JI3 E;  1GKI A;  4I81 A;  3FYD A;  3U6D A;  5EP1 A;  4AQY M;  5GKN A;  2F4V M;  4IBC A;  4LJ7 A;  1TH2 A;  2CFO A;  3OTO M;  5BPV A;  4CGY B;  2R4J A;  2H1R A;  5DNY A;  1DGB A;  1L1T A;  4YHH M;  1PJJ A;  5LMU M;  2CEA A;  3K8Z A;  2V6Z M;  3NWL A;  3QWL A;  1XMO M;  4JI8 M;  1TGU A;  2I7N A;  3DOA A;  2L6O A;  3A98 B;  3KS4 A;  4G6Z A;  3KW6 A;  1Q39 A;  4DR1 M;  8CAT A;  3PVS A;  4JXJ A;  1HNZ M;  3GPU A;  3SMP A;  1G41 A;  1H6U A;  3SMS A;  1IY0 A;  1R7R A;  3AFH A;  1XHB A;  1NSF A;  2Z7J A;  4D80 A;  3KOW E;  4JI3 M;  5EJC A;  4AW4 A;  3ZCB B;  2CV1 A;  2Z3X A;  2F5O A;  3AL0 C;  2KZS A;  4CIS A;  3AV0 A;  3KSX A;  1QZM A;  5ITX A;  4DR6 M;  4OU7 A;  3MK6 A;  3VDP A;  4MB7 A;  3HHW A;  1G3I A;  4ZPX A;  2E5L M;  1IN4 A;  4KOD A;  2XGN A;  4NSO B;  1UM8 A;  3FUV A;  3KS8 A;  4B3S M;  3HU2 A;  1FJG M;  2KW0 A;  4FWG A;  4M9S A;  3T38 A;  3KXE C;  3J27 B;  2DWL A;  2DWM A;  1TH4 A;  1IN5 A;  5EP2 A;  4PD2 A;  1E9S A;  1K3X A;  5ITQ A;  2EA0 A;  3U60 B;  2RGO A;  4ITQ A;  4RF0 A;  4LFB M;  3GQ3 A;  4NXM M;  3WHL A;  4OX9 M;  2UXC M;  1IY1 A;  3EIE A;  4S12 A;  3FD9 A;  3PNV A;  4LCB A;  1L2C A;  3U60 A;  3DZD A;  4L16 A;  1HT1 E;  3SC3 A;  2DWZ B;  3T1H M;  4IBD A;  2Z4S A;  4B08 A;  3KOZ E;  3JAM S;  2QBY B;  4NSR A;  3VLF B;  3SAV A;  4JI4 M;  4LF6 M;  4WUR A;  1YSY A;  1DO0 A;  4FWD A;  1IM2 A;  1GVN A;  4K0K M;  2R65 A;  2ZAN A;  2QEN A;  1HNW M;  4FCV A;  3U6L A;  3HU3 A;  2L7H A;  1L8Q A;  2QBY A;  4HLQ A;  2OQ4 A;  3A45 A;  3GLH B;  4IJE A;  4B7F A;  4Z6Y A;  2YNM D;  4GKJ M;  1N33 M;  2R18 A;  2W82 A;  2NQ8 C;  3CTW B;  3U6P A;  2UUB M;  1PJI A;  2DHR A;  3GLH A;  4CHT B;  1E9R A;  3K1J A;  2VII A;  4MGI E;  5E6J A;  4EIW A;  4OVZ B;  1W5T A;  4FWH A;  2XEP A;  3FUW A;  5FTM A;  4LFA M;  1L2B A;  2YFQ A;  4LF4 M;  2Y0T A;  4IBB A;  1QVR A;  1MU5 A;  4B3R M;  3U6M A;  3WHK A;  2EO2 A;  2X8A A;  4DUZ M;  2D7H A;  1QAO A;  4REZ A;  3LQQ A;  1HQC A;  2XLJ A;  3HHZ A;  4X66 M;  2F5S A;  4DUY M;  2RGH A;  3IG8 A;  3SHG B;  2FE8 A;  2UXB M;  2YR0 A;  5ITR A;  3AOE A;  4QOZ C;  3ILK A;  4LJ4 A;  1E32 A;  3A46 A;  4RF1 A;  2X4A A;  3FKE A;  4BLC A;  5JI2 E;  4DV3 M;  1QAN A;  3KFU G;  4HL4 A;  3SAW A;  3M6A A;  2ZAO A;  2J7O A;  2R46 A;  3MHV C;  4LZZ A;  2DZO B;  2Y21 A;  4L78 A;  3GP1 A;  3D8B A;  2DXI A;  4L15 A;  2R4E A;  3HJ8 A;  4G4N A;  3E9S A;  5E26 A;  5LMN M;  2QPA A;  2QZ4 A;  3SBJ A;  4TUW A;  3JR5 A;  1Q3C A;  1TDH A;  1Z5B A;  1IN6 A;  5KO3 A;  4LJ5 A;  2G5G X;  4LGY A;  1N78 A;  4PT5 A;  1K82 A;  4JI5 M;  1R2Z A;  1SXJ E;  2F5P A;  4IBG A;  4GKK M;  1IXZ A;  4WW0 A;  2FNA A;  3KP0 E;  1J09 A;  4MM3 B;  1NY5 A;  2G8L A;  4XGI A;  2UU9 M;  3J80 S;  4LJ6 A;  5IZ7 D;  4LY6 A;  4GIT A;  3SAS A;  4I8O A;  4LJA A;  5FSW A;  4G4Q A;  1YE9 A;  3R8F A;  1QQW A;  1N77 A;  2KEB A;  3KOY E;  4LF5 M;  2XZU A;  4DR2 M;  3SAR A;  2X49 A;  4GHA A;  4II7 A;  3UMM A;  2XSZ D;  4GRI A;  1LV7 A;  2XFS A;  1N32 M;  3RE8 A;  1TDZ A;  3LMM A;  2DWN A;  3K92 A;  1QAQ A;  1HQY E;  5EP4 A;  2CHV A;  1XXH B;  4FVM A;  2LWX A;  4L8R C;  3SYK A;  1JR3 D;  3VK8 A;  4B7G A;  3SYL A;  1IBM M;  2Z4R A;  4IBE A;  3C58 A;  4FCT A;  3UK6 A;  3GRU A;  1XXH A;  5ITT A;  3VKH A;  5FTN A;  4NRW A;  5KPT A;  4JN6 A;  3A42 A;  2BNK A;  3CF6 E;  4FD2 A;  4DV4 M;  1Z5C A;  4AG6 A;  5BR8 M;  2UXD M;  5EXT A;  2ERC A;  4IBF A;  4DV0 M;  5C1B A;  4JI0 M;  5DYG A;  1YUB A;  4X65 M;  1T3T A;  1KSF X;  2O5R A;  1IXR C;  3AJI B;  2L09 A;  2QCU A;  4GMQ A;  2LXE A;  2VQF M;  3KVW A;  3VK7 A;  3VDU A;  3HJQ A;  2VQE M;  3TWM A;  5IT9 S;  2LNH C;  3T15 A;  4BBA A;  2P5T A;  1Z59 A;  3DA1 A;  4JI1 M;  3L28 A;  3JR4 A;  2RKO A;  1E94 E;  4AI6 A;  3KP1 E;  4M0W A;  1KYI A;  3GQ4 A;  4LFC M;  4LF7 M;  5KPR A;  5EXS A;  2C5R A;  5FTJ A;  3HU1 A;  3KOX E;  2C98 A;  4QNR A;  3SHF A;  3UZU A;  2D7E A;  3T1Y M;  1I4W A;  3U6S A;  5F3W A;  4I5S A;  3KDS E;  1NNJ A;  2XSZ A;  4LRT A;  4DV1 M;  3J7A S;  1IN8 A;  4B7H A;  1G59 A;  1DO2 A;  4LF8 M;  2F5Q A;  1ZAE A;  4G4R A;  1IY2 A;  1OJL A;  1NJF A;  1SXJ A;  3FUX A;  3GLG B;  3PXG A;  1IBL M;  4KO8 A;  3HJS A;  3W0F A;  5KQD A;  1JR3 A;  5ITX E;  1OFI A;  1ZQ9 A;  2Y20 A;  3M0E A;  5EXP A;  3FTE A;  4MGK E;  2F5N A;  3TWK A;  3GLG A;  2V1U A;  4G4O A;  2Q2E B;  2HKJ A;  4KHP M;  3U6O A;  2YQZ A;  2JA2 A;  2R45 A;  1IXS B;  4PDI A;  3D8L A;  2C99 A;  3VFD A;  4IBK A;  2CHG A;  4LG2 A;  1IQP A;  5EQT A;  1Z5A A;  2BJW A;  3CF2 A;  4AZF A;  5KQ8 A;  3RFW A;  1FNN A;  3SAU A;  4AKH A;  3HKP A;  1QAM A;  5FLX S;  5FTL A;  5IRE B;  3J7B A;  1N36 M;  2A5Y B;  4GC5 A;  4LRS A;  2C96 A;  5IWA M;  3I51 A;  2KRK A;  4NXN M;  5ITY A;  1G8P A;  3GRR A;  2FOI C;  3HHX A;  3AKZ A;  3TPZ A;  4DV6 M;  4XBO A;  4JV5 M;  3BOS A;  4JYA M;  2L7I A;  3GLI B;  3I4Y A;  4BB9 A;  2EUC A;  3HGI A;  3AOE C;  4OW0 A;  4LZJ A;  3I4V A;  4FW9 A;  1DGF A;  1R6B X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...