1QDRA

2.1 a resolution structure of escherichia coli lytic transglycosylase slt35
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Binding of calcium in the EF-hand of Escherichia coli lytic transglycosylase Slt35 is important for stability.
pubmed doi rcsb
source organism Escherichia coli
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qdrA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qdrA02
3WU9A 2Z18A 5F14A 3IJUA 1GHLA 4NEBA 5B1GA 1GF4A 1OUIA 1LJKA 1LSPA 4WMGA 1IY3A 3WVYA 4RLMA 1NDMC 5FCPA 2D91A 3FE0A 3B0OA 5LINA 3CQLA 3A93A 3GXRA 1YIKA 1REMA 1V7SA 3AB6A 5KY1A 4NGJA 1FLWA 9LYZA 1YROA 2YSSC 4HTKA 1B7LA 1GFVA 2F4GA 5D5FA 3TMWA 4ET9A 5F81A 4WM4A 4B4JA 1MELL 1YILA 4DDAA 4RW2A 7LYZA 1C10A 2Z38A 1GFUA 1LZ5A 3W6AA 4B4IA 3CT0A 6LYZA 4OWHA 4NG8A 4HTQA 1FDLY 4HPEA 4LFXA 1C43A 1GDXA 1LJIA 1VATA 2Q0MX 4OOTA 5B07A 4CHXA 1LZAA 5F9XA 4GN5C 1KXYA 2Z2FA 3WH1A 1P2CC 4XJDA 1DI3A 1GAYA 208LA 1GE3A 3WUNA 1LZ9A 2DQCY 4HPIA 3ZEKA 1LTMA 1IP4A 4WM6A 1EQ4A 2YBHA 1GDWA 2FYCA 2BQFA 1GFRA 3WVXA 5I54A 4XN6A 5I4WA 4G4HA 1AT5A 4NGOA 1A2YC 4G4BA 4QEQA 2XTHA 1DI4A 4X3BA 3HBHA 5LIOA 2BQOA 3N9CA 1KIPC 4WG1A 1D0KA 4DD3A 1YL0X 4GCCA 4L41A 3N9EA 3TXFA 2HUBA 1LJFA 4ET8A 1BB4A 4NGKA 1F10A 1JUGA 1LKSA 2I26L 3A6BY 4EOFA 4DT3A 5LVKA 4H8ZA 1GXXA 1DKJA 1LSFA 1W08A 2G4NA 2Z37A 2Z39A 3FI7A 4II8A 1C45A 2FYDA 4UWUA 3M18B 1HSXA 5L3HA 2WARA 1G7HC 1VEDA 2BQHA 4ANRA 1BB7A 4MCKA 1LCNA 1GEZA 1VDTA 1UA6Y 5KXZA 1LHJA 1GB6A 3A90A 4N1EI 1NMMA 1NDGC 1FBIX 3AJNA 1JEFA 1QSWA 2A7DA 1GFKA 1JHLA 1NWGA 2HU3A 5F16A 1C7PA 2DQGY 8LYZA 1GF8A 3HBEX 4LYZA 3G3AB 4NSIA 4YEMA 1PZYA 4BAPA 1LKRA 4WO6A 2LHMA 5K7OA 4NY5A 1BHZA 1B5XA 1BVXA 4XJGA 1ZV5L 1IC5Y 5LAFA 4LYCA 2IHLA 4N8ZA 1EL1A 1WVVA 2F30A 5HMVA 4H1PA 2HEEA 3WPLA 4ETAA 1I56A 4J1AA 1EQ5A 1IOTA 4N9RA 1OUCA 1YAPA 1A4VA 154LA 1CJ8A 1LZ8A 3AGIA 2BQAA 4NGIA 4WM5A 1OUAA 1HEMA 1KIQC 1OQMA 2EKSC 4HTNA 4PRQA 4H9EA 1REYA 4M4OA 2CDSA 2YBLA 3WPJA 1GF0A 1NHEA 4H9FA 1IC4Y 2DBTA 1HEOA 1YANA 2ZQ4A 1OUGA 1B7NA 4NHSA 5DL9A 2YBNA 4IASA 4MR1A 1IWXA 2BAAA 2W1LA 1WQMA 4QGZA 1HFZA 3CB7A 5B06A 1G7LC 1HEQA 5HMJA 4B1AA 1HENA 5KXXA 4NGVA 4QY9A 1LPIA 5LA5A 4TSCA 3EMSA 1GF6A 4NHIA 4XADA 2HECA 4LGKA 1UIHA 1YKXX 3K3TA 2LYOA 4XYYA 1OUDA 3T36A 4DDCA 4YF2A 3J6KA 1CKFA 1GBWA 5APDA 4IJ4A 3B0KA 1LSAA 5FHWA 1LJNA 1XSFA 3CSQA 1UIEA 4I0CA 3WULA 2BQMA 4NSHA 1LSGA 4H93A 3J4GA 1CNSA 1GFJA 1LZCA 2BQEA 1ZVYB 1GPQC 2CWIA 1LSBA 4DD9A 1HF4A 1DKKA 1QIOA 1UACY 1UBZA 1V7TA 2DQIY 1GEVA 1LJHA 3TXIA 1I1ZA 1IX0A 5B05A 3QNGA 3BKHA 2MEBA 1NF5A 1XGRC 4B0DA 1IO5A 3TXEA 4XJIA 1UUZC 1VAUA 5LVHA 2ZYPA 4DD1A 1LZNA 1TAYA 3WU8A 2BQDA 1LJEA 3VWOA 1UICA 1CKGA 3A8ZA 2X0AA 1JTTL 2EPEA 4YOPA 3CSRA 1B5WA 4H9BA 1B7QA 4B4EA 1IORA 5HNCA 5KXMA 1B7OA 2ZNWY 4QDNA 3TXHA 1C46A 4N0JA 1CKCA 5FEKA 5KXPA 1J1PY 1XEKA 2EIZC 132LA 2PC2A 1LHKA 5E9RA 2Y8PA 4IATA 2AUBA 1WVUA 1IR9A 3A6CY 3BKVA 1TEWA 2YVBA 1UIFA 1WQPA 1Z55A 5APEA 1B2KA 1HEPA 2G4QA 2I25L 1B5UA 1LZRA 1OUJA 2C8OA 1NBYC 4D9ZA 4HJVA 3ATOA 1GE2A 1BWHA 2MECA 1LMPA 5B1FA 1LSYA 1WQOA 2DQJY 1IOQA 1JJ0A 1QSAA 4WLDA 4ETBA 4NHTA 3LYTA 4NHPA 3LN2A 3MGWA 1DI5A 1GF5A 5A3ZA 2XBRA 3CT5A 5IDDA 1IR8A 4P2EA 3A67Y 4OOOA 4PJ2C 4Z3MA 4DYGA 5KKIA 3A95A 5FSTA 4R6CA 4C3WA 1KIRC 4WL6A 1VFBC 3WL2A 4YM8A 2F4AA 3W6BA 2CJLA 1YKZX 2LYMA 1LYSA 1YAOA 3P4ZA 1GE1A 2A7FA 3A34A 4NSGA 5F9UA 6LYTA 5KXKA 4WG7A 3P68A 1W6ZA 3QY4A 2H9KA 4OWEA 5KXWA 1ZMYL 1QTEA 1IY4A 1LZBA 3WMKA 1XEIA 2MEEA 3LZTA 1XGQC 4NG1A 1CJ6A 1HMLA 1OUEA 3T6UA 4NWHA 1GF7A 4PGJB 4WM2A 4ZEEA 5ILFA 1XEJA 4BS7A 134LA 1GBOA 2BLXA 5JENB 1QQYA 4YENA 4NHQA 1JPOA 4UWNA 1HEWA 1QTKA 3WPKA 3EXDA 1LZ6A 1HFXA 1B5YA 1BB6A 1JKAA 1AZFA 3EO5A 3WUMA 1BVKC 1B7PA 3AW6A 1IR7A 1GBXA 1JJ3A 5KXLA 4FDYA 1GB7A 4XJFA 1T6VL 2MEAA 1IC7Y 5E4PA 2ZQ3A 1NKHA 1UIDA 5DN4A 2MEFA 1UCOA 5HQ1A 2ZILA 1DPWA 2I6ZA 1GWDA 1LMOA 4WL7A 4BAFA 1HC0A 1JSFA 4WO9A 4W96A 5LYZA 3A94A 4LT0A 1IOSA 4GLAA 1LMQA 3LHMA 4LFPA 4PPOA 1FN5A 1HELA 1C08C 1BB5A 4LZTA 2XBSA 4XJBA 5KXNA 1WTNA 153LA 2BQCA 4H94A 4TWSA 5KXSA 3TMUA 1LSDA 3IJVA 2HEAA 3GXKA 4NFVA 3TXJA 4GN4A 4W94A 3TXBA 2BQBA 5C6JA 2BQKA 5APCA 4RW1A 1XGTC 5LA8A 1SQ2L 1FLUA 1D6PA 2BQIA 3A92A 3RT5X 4DWXA 1OP9B 3G3BB 4FJRA 1IP1A 4G9SA 3RW8A 3WU7A 2W1MA 1E8LA 4LT3A 4CGEA 1IWZA 3AYQA 1FKQA 1LYOA 4CFOA 1G7MC 4OWBA 4XJHA 1GBYA 2YBMA 2DQDY 3F6ZA 1QUTA 3D9AC 3A3QA 1B5VA 4LYBA 1IVMA 4TTDA 5LAGA 1LZ4A 4GLVA 1GD6A 4C5FA 1YQVY 4WOAA 3ZVQA 1LMCA 3RZ4A 5IHGA 5J7CA 1WTMA 4TUNA 2HTXA 3W6EA 1LZSA 1INUA 1BB3A 2BLYA 2BQJA 1IP5A 1GB9A 3E3DA 4J7VA 4NGYA 4NSJA 3W6DA 4KT3A 1GFHA 3AZ4A 1JKCA 1T3PA 2B5ZA 2NWDX 2MEIA 3CSZA 5D5CA 1KXXA 2DQHY 4ML7A 1IP7A 2IFFY 5A3EA 3HBDA 1LHLA 3A96A 3WW6A 1JWRA 5I53A 3AZ7A 1J1OY 3AZ5A 4ETDA 4J1BA 2D6BA 3ATNA 3W6CA 4H90A 3WYHA 1YL1X 5I4YA 3TXGA 1UIGA 4PRUA 4ETCA 1JTOL 1MLCE 3W6FA 2BQNA 3W3EA 2BPUA 5AMYA 5T3FA 4BADA 4UWVA 4NGZA 3HFMY 1JITA 1GBSA 1JTPL 4OW1A 1LZ1A 2ZIJA 1LAAA 133LA 1AKIA 2D4JA 4HSFA 1LJGA 5L3IA 1IWTA 1LZDA 1D6QA 1WQQA 1OUHA 3RNXA 5DM9A 1OUFA 1BWJA 1CKHA 3WW5A 1GB5A 2RSCA 4E3UA 4H8XA 4RDSA 3AGHA 1IWWA 1TDYA 4H91A 4LYTA 2Z2EA 4AXTA 1I20A 3M3UA 1DQJC 5FELA 1LMAA 2W1XA 1WQRA 5KXRA 1PS5A 2ZIKA 5II3A 3P65A 1ALCA 3WXUA 1H87A 1IEEA 1ZVHL 4HP0A 5IELA 5EBHA 1F6RA 1GB8A 4LT1A 1GF3A 4KL7A 1AM7A 1D0LA 4B49A 2EQLA 5FDJA 4GCBA 1LHHA 1IOCA 5LYMA 4LT2A 4Z41A 2VB1A 2D4IA 1LYZA 4WLXA 3D3DA 5APFA 1B0DA 1FKVA 1RI8B 1GB2A 1HNLA 3B72A 1LSCA 1QDTA 4LYMA 4DD2A 193LA 1UIAA 1YKYX 1YAMA 1LHIA 2YDGA 1FLYA 1DPXA 4GCEA 4H8YA 4WLYA 1LSMA 1OUBA 5KJ9A 1XFPL 1AT6A 3A3RX 5KXYA 5I4XA 1HMKA 3AW7A 4WM1A 3ULRA 1F6SA 1LJJA 3OJPA 4PHIA 1GFGA 4XENA 1JSEA 2BQLA 1IWUA 1IP6A 3SP3A 1IP3A 1LOZA 3N9AA 2LZ2A 4G49A 1B7RA 4EMNA 5HNLA 1HFYA 1VDQA 2MEGA 4R0FA 1GXV2 2ZNXY 2FBDA 4DC4A 4CFPA 4OWAA 1B5ZA 1RE2A 5DN5A 4HV2A 4ZFPA 1YAQA 1GFEA 1HERA 1UIBA 1QUSA 3LYZA 1TBYA 3WXTA 1LSEA 1GFTA 1IIZA 1KXWA 1LJ4A 2G4PA 1B7MA 4GN3A 135LA 2LZTA 1LZTA 1D0MA 4GCDA 1BWIA 1H6MA 2HEDA 3WUAA 4DD7A 5M1YA 1G7JC 1GB3A 1GF9A 4LYOA 1LHMA 4NWEA 4MSTA 4YEOA 2HEFA 2DKVA 3LZ2A 2ZYCA 4NGLA 207LA 1F0WA 1RFPA 3LYOA 1QDRA 5C6IA 3TMVA 4HJYA 5C6LA 5ILCA 1JKDA 1LJ3A 4Z98A 3P64A 1BGIA 2H9JA 3TXDA 4OWCA 2Z12A 4HJZA 3TMXA 1WQNA 3TXKA 2LYZA 1TCYA 1B9OA 2N5ZA 1LSZA 4O34A 1EQEA 2F2NA 3B6LA 1VDSA 1UC0A 4AGAA 3P66A 4WLTA 5LYTA 1JIYA 1CKDA 4H9AA 2HEBA 4J0LA 2DQFC 5LXWA 2HU1A 1DZBX 1G7IC 4HV1A 2D4KA 2BQGA 1LZYA 1HHLA 3AZ6A 4NGWA 1GFAA 1LYYA 4NIJA 4ZIXA 1O23A 1GAZA 5KKJA 1NBZC 4DD0A 2H5ZA 2DQAA 1HSWA 4ETEA 1CJ7A 4TX7A 1LMTA 4H9IA 3QE8A 1BQLY 1JISA 1LZEA 1IP2A 2DQEY 1D9UA 2XJWA 4CJ2A 5KXTA 1VDPA 4DDBA 1GE0A 3RU5A 1GBZA 5HLLA 3CT1A 2YBIA 4WM3A 2MEHA 1IWVA 2CGIA 1CJ9A 4H92A 1NQIA 3KAMA 1XGPC 3LYMA 1REZA 2ZWBA 4KXIA 1B7SA 5I5QA 2MEDA 5LVIA 4I8SA 3B0IA 2C8PA 2W1YA 5DLAA 1RJCB 2GV0A 3EBAB 4TSBA 1LSNA 1JJ1A 5LVJA 1RCMA 3A91A 2Z19A 3ZVQB 5L9JA 1SLYA 4M6DA 1LMNA 4KPMA 1GE4A 4H9HA 4GCFA 2FBBA 1IWYA 4N5RA 4Z46A 1FLQA 4G4CA 1N4FA 1XGUC 2YBJA 3AGGG 4RLNA 4H9CA 3OK0A 4U3XB 1J1XY 5LVGA 1DXJA 1JKBA 194LA 1LZGA 5B59A 4N1CC 3IWRA 1REXA 4A7DA 5KXOA 1GB0A
chains in the Genus database with same CATH superfamily
5F14A 3IJUA 4P16A 3V2YA 1GF4A 1OUIA 2G3QA 3KS4A 3FE0A 4B08A 4DR4M 2N35A 1G59A 2R65A 1R4GA 1XNQM 1PJIA 5F81A 4AKHA 231LA 1QS5A 1L21A 1IN8A 3SAUA 1J09A 1GJSA 181LA 7LYZA 145LA 3KS8A 1LZ5A 5H37D 4D80A 1L77A 3SBJA 3FKEA 3CT0A 4HTQA 1WGLA 1L1TA 1C43A 1GDXA 4LZMA 1L16A 5F9XA 4GC5A 3UK6A 4GN5C 1KXYA 3WH1A 2L4FA 2KRKA 3AJIB 2UUBM 1L08A 2DQCY 4A3VB 1LI2A 1L89A 1IXZA 3GRUA 4I7QA 2HAKA 5BPVA 1GFRA 2K9DA 4G4HA 2RBSA 5ITYA 1CU2A 253LA 1L40A 2XTHA 3E4RA 1LGWA 4L41A 2HKJA 3F8VA 4IBJA 1LPYA 2YQZA 3DN4A 184LA 2I26L 1LKSA 214LA 4EOFA 186LA 1G06A 2KRUA 5LVKA 2KHHA 2X8AA 1LSFA 4II8A 4JV5M 2QBYA 1C6AA 1L83A 3NYAA 241LA 4ANRA 1L55A 1NHWC 4MGHA 1C6QA 1GEZA 4S0WA 2I7PA 1J5EM 1GB6A 1UM8A 1UFZA 1L8QA 3AJNA 1DYGA 3D8LA 2A7DA 5KQ8A 4FWHA 3A98B 5EXTA 3OE6A 1NWGA 2JY7A 3G3AB 4NSIA 1L42A 1PZYA 5K7OA 1X37A 2DWNA 1BVXA 2GQFA 1ZV5L 5LAFA 4RF1A 2RBNA 1EL1A 5HMVA 1TH4A 1WR1B 3WPLA 2RBOA 1I56A 1EQ5A 4N9RA 154LA 3I4VA 1A4VA 3B89A 4WM5A 1OUAA 4LJAA 1L60A 1QANA 2YBLA 1CV1A 3GLIB 1NHEA 2B7XA 4H9FA 1LLHA 2DBTA 1HEOA 4B7FA 1B7NA 5DL9A 4MR1A 3LCVB 2W1LA 3EIHA 1C6MA 3CB7A 3IECA 5KXXA 1R2ZA 2Y0QA 1SSYA 3GLGE 2ZBKB 1KW7A 3SYLA 4X65M 1I94M 3SB6A 2HECA 1OIZA 2Z8YM 3K3TA 4YF2A 1OUDA 2A5YB 5APDA 4ARMB 2MJ5B 3CSQA 1LSGA 3J4GA 1CNSA 4LDOA 1ZVYB 4DAJA 1GPQC 2CWIA 2HWJA 4YX7C 1DKKA 2ZTDA 255LA 1IBLM 2DQIY 1GEVA 1LJHA 1IX0A 4PJZA 1JTNA 234LA 1LWGA 3T38A 5KPRA 1UUZC 5LVHA 4DV3M 2ZYPA 4BB9A 1QTCA 2HULA 3WU8A 3KP0E 1LJEA 1UICA 1CKGA 5DYIA 2LVAA 4YOPA 2C9OA 3CSRA 1B5WA 4B4EA 5KXMA 4G6ZA 251LA 3FUXA 4I81A 5KXPA 1J1PY 2EIZC 2ZM6M 173LA 5E9RA 4IATA 3A6CY 158LA 2YVBA 3BXWA 5APEA 1B2KA 1C6EA 1XHBA 1C66A 1LGUA 4IBGA 1BWHA 2BJWA 1LMPA 4L4UA 5B1FA 1LSYA 1G0MA 1WQOA 4B3TM 4E97A 2DQJY 4F1IA 1ZQ9A 5LMNM 1JJ0A 4ETBA 4NHTA 2CUUA 3LYTA 4NHPA 1CU0A 3LN2A 3MGWA 3GLGA 5A3ZA 3CT5A 1IR8A 3HDEA 110LA 3A67Y 4PJ2C 3QYEA 1C6TA 2RGHA 4WL6A 3M6AA 3WL2A 4YM8A 4JI1M 1YKZX 2LYMA 2HHHM 232LA 4OWEA 3QY4A 2H9KA 3U6QA 3GQ3A 1PJQA 3SAVA 1XEIA 3LZTA 1XGQC 4EKQA 2R44A 3T6UA 5FLXS 4NWHA 4ZEEA 4DV1M 4KO8A 4AQYM 1L1ZA 1G0QA 2J5YA 2VDBB 4NHQA 4ARPA 1HEWA 4IBDA 1XJTA 1HFXA 167LA 3EO5A 3WUMA 4LJ5A 5KXLA 1LV7A 4LRSA 1GB7A 3GUKA 1L18A 2ZILA 1DPWA 1L46A 1LMOA 4BAFA 4B3SM 4GLAA 1LMQA 3LHMA 4LFPA 1HELA 2QB0B 4NXNM 4XJBA 3MMPA 1NVMA 4FW9A 1WTNA 153LA 3DN2A 3U61B 4H94A 2V6ZM 4TWSA 3GLHB 3C8RA 3IJVA 3GXKA 3FUWA 1PQJA 4LF5M 2LHCA 5APCA 2DAIA 4OVZB 2BQIA 3A92A 1OP9B 211LA 198LA 2LVNC 128LA 1LYOA 1G7MC 1LYDA 2R46A 4TTDA 2XSZD 4MGZE 1LYJA 3FE3A 1I6SA 3UONA 3ZVQA 1CX6A 3RZ4A 5IHGA 1XXHB 2Q9DA 3HJQA 4TUNA 1L99A 4I7NA 3D4SA 2BWEA 1HNZM 1INUA 236LA 2BQJA 3NY9A 3W6DA 3E3DA 1VG5A 4KT3A 3KXEC 4LG2A 1L54A 1C63A 2MEIA 3CF6E 4DQJA 2DQHY 4ML7A 1IP7A 2IFFY 1L29A 3KFUG 3AZ7A 226LA 2UUAM 3HU8A 1Z5AA 3W67A 215LA 3W6CA 2VQEM 2FS1A 2BQNA 4LJ8A 2BPUA 2XSZA 5T3FA 4DR7M 1P3NA 3V2WA 3WHLA 1LZ1A 1G0PA 1LAAA 133LA 2D4JA 168LA 1LJGA 1W5TA 1LZDA 157LA 1OUHA 3RNXA 4M9SA 1OUFA 1DO0A 190LA 4QHSA 1GB5A 3K9OA 1C6HA 4E3UA 4H8XA 1OFIA 1CU3A 2H5XA 4KHPM 2L6OA 2WSFF 2LVOC 4IJEA 3HUAA 4GHAA 1I20A 1HNXM 1LMAA 2XEPA 4JI3M 3GLHE 5KXRA 4F2LA 4HL4A 2L78A 1JR3E 2ANXA 3C8QA 1DO2A 1ALCA 175LA 1H87A 5FSWA 205LA 4LT1A 4B49A 3WHKA 191LA 1AM7A 2EQLA 4GCBA 3HU3A 3VKGA 4Z41A 1LYZA 1NNUC 3FI5A 3D3DA 1L48A 1HNLA 4DD2A 4WLYA 1OFHA 1XFPL 1AT6A 5KXYA 4LZJA 4WM1A 246LA 5E26A 1LJJA 1QT5A 4L15A 1T8AA 3SP3A 2NTHA 1L01A 1GL7A 3KVWA 4G49A 4AQNA 1R5LA 1GVNA 2QARC 2D7HA 1L87A 3U6SA 1RE2A 2OO9A 3J7BA 4HV2A 1GFEA 2GNOA 2QZ4A 1IIZA 1L98A 1OV7A 2XFTA 2LZTA 1JQJC 1LZTA 4GCDA 1L26A 1H6MA 4QNRA 1GB3A 1LHMA 220LA 2HEFA 3HTBA 192LA 1C6KA 207LA 3TMVA 5C6IA 2E5LM 2R4EA 1C6BA 2ZANA 3SB7A 4LRTA 3TXDA 3T1HM 1T8FA 4HJZA 1S3SA 2LYZA 3KP1E 3GLHA 2N5ZA 1JR3A 3AV0A 1NNJA 1L52A 1UC0A 1IBMM 1CKDA 1N75A 4J0LA 5LXWA 1SX7A 3G3XA 5EJCA 2D4KA 3C9PA 2BQGA 1HHLA 3AOGA 1T8GA 3VLFB 2R62A 1NBZC 2H5ZA 5FTLA 3TWMA 1IM2A 3PXGA 249LA 1V92A 2R45A 1NHBA 1OYUA 3QE8A 4DR2M 5HLLA 3CT1A 3PBLA 1CJ9A 1Q02A 3ZC7B 1NQIA 1REZA 139LA 3V76A 1B7SA 2MEDA 5LVIA 5DLAA 1P2RA 2W1YA 1JJ1A 1P36A 1CV0A 2ZAMA 1SLYA 1Y8GA 1WHCA 4H9HA 4GCFA 4YXCA 3QAUA 3FA0A 4Z46A 1FLQA 4G4NA 3E9SA 1C6CA 2LC9A 4RLNA 1JKBA 194LA 4XGIA 213LA 3HT6A 3SC3A 4N1CC 4A7DA 2Z18A 4NEBA 5B1GA 1LJKA 2CHGA 1LSPA 1IY3A 1CV3A 4DQ7A 1C67A 3HTFA 1NDMC 2D91A 4GEWA 3GXRA 1REMA 1J7KA 3L27A 4NGJA 1FLWA 2M60A 1ZURA 5KPZA 4HTKA 5D5FA 1DV0A 3NBIA 5EP2A 3PDSA 1YILA 4DDAA 4RW2A 3HX3A 1SXJB 244LA 1D3JA 6LYZA 3LQRA 4NG8A 2X49A 3FUVA 3JR4A 1LJIA 5B07A 2EO2A 4Y28F 4CHXA 1LZAA 1V33A 3GULA 4FWGA 3RUNA 5EP3A 1P2CC 1L95A 3TWLA 4XJDA 4LFCM 1CV4A 4HPIA 3KSXA 2C98A 108LA 2Z6BA 2BQFA 2CHVA 5I54A 5I4WA 4NGOA 1A2YC 4I7OA 1WXQA 1QAMA 4X3BA 3TL4X 3HBHA 5LIOA 1KIPC 1D0KA 1KS3A 172LA 2HUBA 1LJFA 2HCBA 1BB4A 1JUGA 2RB2X 1L82A 4M9ZA 1L2CA 1L41A 4H8ZA 2MR9A 2YFQA 2G4NA 4IAPA 2FYDA 3SARA 1L93A 2VIIA 5L3HA 2WARA 2RGOA 4LJ4A 2BQHA 4I7RA 3L25A 1LCNA 1AIPC 1Z5CA 3A90A 1NMMA 2RB1X 177LA 1NDGC 1FBIX 2FFJA 1JEFA 1QSWA 3G3VA 1GFKA 1HT1E 3LZMA 2K0BX 3T6PA 1QTBA 2HU3A 2DQGY 4GKJM 8LYZA 1TR8A 2KNZA 2DAMA 1LKRA 4WO6A 4I8OA 2WSCF 2LZMA 1QS9A 4LYCA 3B7ZA 2IHLA 1WVVA 4FCWA 4J1AA 1YAPA 144LA 3C7ZA 1LZ8A 3SATA 4NGIA 4ZPXA 1HEMA 1L75A 2R6FA 159LA 2EKSC 1DGFA 4M4OA 2CDSA 1GF0A 3K2RA 3HJSA 1OUGA 1PJJA 1G3IA 1G0GA 1LI3A 5B06A 2BWBA 4B1AA 1HEQA 2OOBA 1HENA 2CUZA 2JWSA 4QY9A 2HUKA 5LA5A 4TSCA 3FTCA 1N36M 1G1VA 1T97A 1EE8A 3C81A 3CDRA 1YKXX 4XYYA 4D81A 1XSFA 3WULA 1K3XA 5IWAM 2Z4RA 212LA 2BQMA 3HUKA 182LA 3HT9A 4DD9A 4EPFA 3VDUA 1PQDA 3TXIA 1I1ZA 4IIWA 3UGJA 2Q2EB 3BKHA 4YXAC 4G4RA 1XGRC 235LA 4B0DA 3DZDA 3HUQA 4XJIA 1C64A 1QTHA 1CU5A 1L59A 4DD1A 2QQ8A 5A2QS 1LZNA 4B7HA 2EKFA 169LA 2X0AA 174LA 1B7QA 3DFZA 1L27A 1IORA 4DUZM 2Z3XA 1EIJA 1L34A 4LDEA 1QT6A 4N0JA 1JQUA 1OV5A 132LA 1L72A 2OQ4A 1LHKA 1WVUA 2KXEA 1QSQA 1T3TA 3OE8A 3HDFA 2JY5A 2G4QA 2L09A 1C1KA 2DVWB 3CTWB 3HU2A 1TDZA 1ZMVA 2CWBA 2B73A 3GUOA 2MECA 1L43A 4NL4H 2DHYA 1DI5A 1GF5A 4I7LA 2XBRA 4II7A 4DYGA 5FSTA 3GRVA 2RAZX 1L80A 3W6BA 4JN6A 1LYSA 3P4ZA 3A34A 6LYTA 5L8RF 5F9UA 3IG5A 3P68A 1W6ZA 5KXWA 149LA 1DYDA 1LZBA 3WMKA 4DV5M 4GIPA 4DQ5A 4OU7A 1IFYA 1GF7A 1QVRA 160LA 4BS7A 3CDVA 134LA 1D9WA 1L03A 2XZUA 4YENA 1JPOA 1L05A 1L71A 1AZFA 2XGNA 1BVKC 1B7PA 1QUDA 1QZEA 1XWIA 238LA 252LA 3AW6A 4G4OA 4XJFA 5DN4A 2MEFA 3UZUA 3SBBC 1YUBA 4WL7A 2KDLA 4WO9A 1P2LA 3A94A 4LT0A 2CE7A 1WGNA 1L49A 1FN5A 2XQOA 4LZTA 5KXNA 4L6V6 109LA 1DYFA 2BQCA 1G4AE 1PRBA 2JA2A 2HEAA 2C9CA 137LA 3TXBA 4CISA 5C6JA 4RW1A 5LA8A 1SQ2L 4W58A 1T6OA 4DWXA 1OVKA 1L09A 4IBBA 3KOXE 4LT3A 2LVPC 1IWZA 4CHTB 5EP1A 3AYQA 1F4IA 3BOSA 3WXUA 3J80S 1QUTA 4LYBA 1SG9A 1B5VA 1IVMA 4LGYA 3TPZA 240LA 1GD6A 1IXSB 4LF8M 4B3RM 2EJSA 1Z6TA 4XK8F 4REZA 2ERCA 163LA 1LMCA 1SXJC 2KNAA 1R2YA 1LZSA 4J7VA 1BB3A 5J7CA 1IP5A 3T15A 178LA 3OTOM 1D2NA 1GFHA 2B5ZA 2C99A 3CSZA 4G4QA 1L47A 2L4EA 4R3DA 1CUPA 2B3TA 1R7RA 3K1JA 5I53A 3F9LA 3AZ5A 4ETDA 4J1BA 2F5NA 3F92A 3ATNA 4IBKA 3WYHA 3NBXX 4ETCA 1JTOL 3W6FA 4AKGA 1QAQA 3DMXA 1G1WA 3U60B 4NGZA 3HFMY 1IY0A 1HT2E 1JTPL 2Y21A 2VF8A 4LY6A 1IWTA 187LA 1D6QA 3GRYA 3CGWA 1BWJA 1L44A 1VDDA 3U6PA 4GRVA 1L97A 3AGHA 1TDYA 4LYTA 4I7SA 4AW4A 4W54A 2W1XA 4EKPA 1PS5A 3UMMA 3GLIE 3P65A 1P3QQ 3DA1A 3I51A 4MGKE 4HP0A 1F6RA 4W56A 2LCBA 2DNAA 259LA 4NRVA 5I14A 1LHHA 4LT2A 5ITQA 2VB1A 2D4IA 1L2DA 4I7MA 4ITQA 1C60A 1B0DA 1L10A 1QTVA 1SWZA 4JYAM 1QDTA 193LA 3FTFA 1XEPA 1YAMA 1LHIA 1YKYX 248LA 1LSMA 3U6LA 1TH3A 1OUBA 2OU0X 1HMKA 2LTUA 2KW0A 1V34A 1NHGC 1L63A 1DYCA 1JSEA 2BQLA 1IWUA 2O5RA 1VEGA 3JR6A 3LVVA 1GXV2 2ZNXY 3DN3A 4DC4A 2LWXA 4CFPA 1B5ZA 1NV9A 4RKUF 1UIBA 1QUSA 1TBYA 1QQWA 3WXTA 1LSEA 2JXNA 1PJTA 1L79A 1KXWA 3TE6A 4ARQB 4GN3A 3PNVA 3SHGB 162LA 1EFUB 4MGIE 2HEDA 4DD7A 5M1YA 4DV2M 239LA 3WUAA 1GF9A 4LYOA 1E9SA 3B7QA 1TF0B 2OTZX 3LZ2A 4LJ9A 2V1CA 4NGLA 5KY1A 3LYOA 4HJYA 5ILCA 1LJ3A 1PQIA 3P64A 1L53A 1ZAEA 3ODUA 4B3MM 1QTDA 2XF3A 1VQ1A 3SFZA 2FH0A 216LA 1EQEA 1QTZA 1C62A 3GLIA 1L45A 4IBIA 4OX9M 4AGAA 2JY8A 4I5SA 3P66A 2DWZB 233LA 4H9AA 3A42A 3T1YM 2HEBA 4W59A 1G7IC 126LA 4HV1A 1L17A 3FYCA 3AZ6A 4NIJA 4ZIXA 3GPXA 3C3DA 4JI5M 3FRIA 1CJ7A 4TX7A 3H4JA 1IXSA 1LMTA 3D8BA 2XJWA 1LZEA 5KXTA 4M9XA 4ARMA 4Z6YA 3RU5A 1NJFA 2MEHA 2VQFM 1IWVA 4I4LA 4L8RC 2OEAX 2ZWBA 5JI3E 3B0IA 2C8PA 2R0IA 3RGPA 2GV0A 3EBAB 2LVQD 4LZZA 4TSBA 2Y0TA 1RCMA 4HLQA 4KPMA 2FBBA 4W53A 2KEBA 4G4CA 1N4FA 1L00A 147LA 1L0KA 3AGGG 5IREB 3CDTA 3OK0A 2C96A 4FCVA 1L92A 5B59A 1L02A 3DN1A 1CV5A 3Q8XA 3SAWA 1OVHA 4WMGA 3WVYA 4FVMA 1QUHA 1GO5A 4RLMA 142LA 5FCPA 2DZOB 3B0OA 1GABA 4S12A 3AB6A 2Q9EA 9LYZA 3VDPA 1L31A 1B7LA 1GFVA 4IBEA 5JI2E 1TDHA 119LA 4DR1M 3U5ZB 4B4JA 1MELL 1A5TA 3RZEA 1C10A 2LNHC 1PQOA 3W6AA 4NXMM 3GO8A 3FTDA 4B4IA 4OWHA 3QWLA 1FDLY 4LFXA 2Q0MX 4OOTA 4Z8XA 3J2PB 3FTEA 1DI3A 1GAYA 1VEKA 3WUNA 3RE8A 2CV2A 165LA 2CEAA 1LZ9A 1C6NA 1LTMA 1IP4A 1XXHE 1Z59A 140LA 2YBHA 4IJFA 1GDWA 2FYCA 3HHWA 1L36A 3C83A 4XN6A 3LCUA 4BBAA 1AT5A 4W57A 3L28A 4GMQA 4G4BA 1DGGA 4QEQA 4DV7M 1DI4A 1L23A 4JI0M 2BQOA 4WG1A 1L65A 4DD3A 2XLJA 1YL0X 1L84A 1JR3D 3GLFB 2IGCA 3C3EA 4G3OA 1P64A 1C6DA 4NGKA 2VF7A 3A6BY 4DT3A 1L57A 1D2WA 4LJ6A 2F2QA 1DKJA 3FI7A 4UWUA 2Z39A 4MB7A 1L2BA 1C45A 1E32A 1HSXA 1G7HC 1ZYTA 199LA 4MCKA 2RRUA 2OU9A 2QPAA 5KXZA 4DUYM 227LA 1NY5A 4W51A 2AHMA 3U61A 1L06A 1JHLA 1QZMA 5BR8M 3HBEX 1QUGA 2LHMA 1C65A 4OVZA 1XNRM 3GPPA 3L64A 2HEEA 150LA 1RU3A 1XB2B 1PM5A 1OUCA 1C6PA 1CJ8A 3HT7A 3KOWE 2ZAOA 3AGIA 1OQMA 2J7NA 2Y20A 223LA 3L26A 3DN0A 1E94E 1XXHA 1QAOA 1YANA 2ZQ4A 1LYHA 2DAKA 141LA 4IASA 1IWXA 2BAAA 250LA 1WQMA 4QGZA 1L32A 3DOAA 3GP1A 1EPYA 4NGVA 2W82A 2NTGA 2DI0A 3EMSA 1L58A 1P7SA 3B74A 3CF2A 1NSFA 1UIHA 2EUCA 1L85A 3J6KA 4IBFA 1GBWA 4IJ4A 4CJ6A 5FHWA 2MH8A 1LJNA 1UIEA 1CUKA 138LA 4NSHA 4H93A 1L66A 1GKIA 3FD9A 2LHGA 5EQTA 1LZCA 1ZWNA 3SB9A 102LA 2R18A 3R8FA 1L94A 3LW5F 1HF4A 1QIOA 1KFVA 5LMUM 1L28A 1V7TA 2LH0A 3U6OA 2MEBA 1NF5A 1NY6A 4EJ4A 4QNMA 4PD2A 1TAYA 2KZSA 2BQDA 2OOAA 3VWOA 1JTTL 122LA 2O7AA 4H9BA 1ORYB 3U5ZA 5F3WA 1KYIA 2BJVA 3K9PA 1OAOC 4QDNA 201LA 1IN5A 2K6BA 1C46A 4I7JA 4XBOA 3GQ5A 3HH5A 2Z4SA 2PC2A 2B70A 2AUBA 218LA 1IR9A 3HT8A 3G3WA 1UIFA 1B6IA 2QP9X 4EKSA 2F5OA 1OUJA 1NBYC 1D3MA 4HJVA 1GE2A 1L73A 1GL6A 3HHYA 3SHFA 2G5GX 5DFLA 3MHVC 2ZTCA 3IHPA 2JZ1A 5C18A 4P2EA 1L0JA 4Z3MA 2JZ0A 4LFAM 3UJNA 1P56A 1KIRC 4KLNA 1L30A 1VFBC 1KSFX 2C5RA 1GE1A 2A7FA 2F5SA 1OIPA 4NSGA 1NO1A 1ZMYL 2YNMD 1QTEA 2MEEA 1N32M 1CJ6A 1HMLA 1L88A 2DENA 5ILFA 1XEJA 4MH0E 2BLXA 152LA 5JENB 1K28A 1QQYA 4UWNA 1QTKA 3WPKA 5GKNA 3HGIA 1BB6A 4JI8M 1IR7A 4LFBM 1JJ3A 120LA 257LA 4FDYA 1T6VL 1GLNA 3TWKA 1IC7Y 5HQ1A 1NKHA 2QBYB 1UCOA 1OVJA 4LF9M 1GWDA 1HC0A 1IXRC 2MGWA 5LYZA 206LA 4GHLA 4CIZA 7CATA 1IOSA 4PPOA 4MGYE 2F32A 1SXJE 2LBCA 210LA 8CATA 1K3WA 4GH9A 111LA 1L07A 1LSDA 3TMUA 1PQKA 3I04M 4GN4A 4W94A 1SSWA 2BQBA 2BQKA 7LZMA 3HTDA 1D6PA 3RT5X 3FUUA 4FJRA 1IP1A 1LGXA 2RH1A 3RW8A 2W1MA 3WU7A 2KZUA 4ET8A 2YBMA 3D9AC 3A3QA 3C82A 1P46A 4C5FA 1XC8A 1YQVY 4WOAA 1QT3A 2I7NA 1FNNA 1WTMA 3JAMS 5KO3A 2J7OA 3W6EA 4NGYA 4NSJA 4DJHA 3HH6A 1CU6A 1SXJD 3AZ4A 3C8SA 3HWLA 229LA 5D5CA 1KXXA 4JI4M 3HJ8A 2M5ZA 2JNHA 1LHLA 3A96A 3WW6A 1MU5A 3KOYE 4IBCA 2NQ8C 1L61A 2UXCM 2D6BA 4H90A 1YL1X 3TXGA 1MLCE 1TH2A 3VK8A 1OTRA 4MM3B 4UN2B 1K82A 1KY0A 1P5CA 2UUCM 2ZIJA 1AKIA 3C7WA 4HSFA 5L3IA 1WQQA 1G07A 1SXJA 4NRWA 1KW5A 3LVWA 1CKHA 3EIEA 5EP4A 2RSCA 4RDSA 1NV8A 4H91A 4GBRB 3I4YA 3W0LB 3M3UA 1DQJC 2EKKA 1MX0A 5FTNA 2ZIKA 2OU8A 5II3A 1CVKA 5KPTA 1ZVHL 1IEEA 4ZPUA 164LA 1GF3A 2B6YA 1D0LA 1L91A 2D7EA 2OPFA 2F5PA 1IOCA 2UXBM 3HHZA 4LDLA 2K47A 1FKVA 1GB2A 2DWLA 1QSBA 103LA 2YDGA 4GCEA 4JXJA 1DPXA 112LA 1WJ7A 3A3RX 3AW7A 155LA 1F6SA 1WIVA 4DR6M 4L78A 1GFGA 4OO9A 1IP6A 5E6JA 4LCBA 1C69A 4EXMA 3GLGB 5ITTA 3ZCBB 2LZ2A 1B7RA 4EMNA 5HNLA 2DAEA 1HFYA 2MEGA 4L16A 3E46A 1C6JA 2FBDA 4LGMA 4OWAA 1L62A 1SWYA 5DN5A 3ILKA 1YAQA 1HERA 2FNAA 4M0WA 3LYZA 1G0JA 1R6BX 3J27B 3JR5A 2DXIA 2V1UA 1Z5BA 3GQ4A 1D0MA 1G7JC 1H6UA 4MSTA 4YEOA 1HNWM 1XMQM 2ZYCA 1RFPA 2RBRA 5C6LA 5IT9S 3CDOA 1JKDA 4NC6A 1TLAA 3PFIA 1L81A 2H9JA 4OWCA 2Z12A 3TMXA 3TXKA 1WQNA 2L7HA 1G8PA 1TCYA 1PQMA 3KW6A 3B7NA 3IG8A 3C80A 4X66M 146LA 1P37A 1VDSA 3SB5A 4HEOA 4I7PA 4WLTA 2FE8A 1XJUA 3SBAA 4W52A 2HU1A 1YE9A 1LYFA 4NGWA 1LYYA 3VW7A 4I7KA 3GPUA 4DD0A 4EPIA 1CX7A 1HSWA 2HUMA 1L68A 1N33M 3GRRA 1IP2A 1D9UA 243LA 2YR0A 1L11A 4DDBA 1PJSA 2DHRA 3OE0A 4H92A 1XGPC 6LZMA 4KXIA 1CV6A 4I8SA 1DGHB 1IBKM 261LA 1LSNA 1SX2A 5LVJA 1D2YA 3A91A 3ZVQB 2CHQA 3FYDA 4YHHM 189LA 2O01F 118LA 1GE4A 1IWYA 3LMMA 4X64M 2B72A 2YBJA 4H9CA 5LVGA 1LZGA 2QHOB 1L13A 3IWRA 3C58A 4K0KM 3NWLA 1GB0A 3VKHA 3WU9A 1WTHA 1C6LA 1OQYA 183LA 1GHLA 4I7TA 1L86A 2OE9X 1NJGA 219LA 3RGSA 5LINA 3CQLA 3A93A 1YIKA 4DV0M 1V7SA 2P5TA 3SMSA 1YROA 242LA 4PT5A 2O4WA 2YSSC 2F4GA 3TMWA 4ET9A 4DV6M 2O25A 4NOOB 4WM4A 2RBQA 1L90A 4WW0A 3FRHA 2B6XA 2CFOA 2Z38A 1GFUA 2JY6B 2OE7X 4HPEA 1VATA 224LA 1QT4A 5KQDA 2Z2FA 2QSFX 3HTGA 3HWSA 208LA 2EA0A 1GE3A 1L33A 1ZMUA 3ZEKA 4WM6A 1EQ4A 1L35A 5EXSA 222LA 143LA 3WVXA 3DN8A 3SMPA 1MN3A 1L04A 113LA 3N9CA 3KOZE 3EMLA 4ARJA 4GCCA 3N9EA 3NY8A 3TXFA 5EXPA 170LA 3HU1A 3A45A 1F10A 2JP7A 1OJLA 4QOZC 1GXXA 3I01M 1W08A 2Z37A 3M18B 1I4WA 2DZLA 1VEDA 3AFHA 1BB7A 3GPYA 3KSJA 1LI6A 1VDTA 1HQCA 4NSRA 1UA6Y 1LHJA 4N1EI 2D7GA 2XZFA 2L2DA 129LA 5F16A 1C7PA 1GF8A 2R4JA 4LYZA 1L22A 4YEMA 1QT8A 4CGYB 4BAPA 1L15A 1XMOM 3K8ZA 195LA 1B5XA 1BHZA 1L37A 4NY5A 4XJGA 4TUWA 3H4MA 1IC5Y 4N8ZA 4DBGB 2F30A 1L25A 4H1PA 4ETAA 1LYIA 3TQSA 221LA 1IOTA 2O79A 1G71A 3QAKA 237LA 1VEJA 125LA 4WP2A 1L96A 2BQAA 1KIQC 4HTNA 4PRQA 5IZ7D 171LA 4H9EA 1REYA 3WPJA 4DKLA 1L19A 2APLA 1N77A 4AKIA 1IC4Y 3PNYA 4QOSA 4NHSA 2YBNA 3FUTA 3U6DA 3A46A 1HFZA 2RAYX 1G7LC 5HMJA 1L12A 2OTYX 1L56A 1N78A 1LPIA 1OKSA 1DGHA 2DZNB 4DV4M 1L50A 1GF6A 4GKKM 4NHIA 1E9RA 4XADA 4LGKA 2LYOA 2L7IA 3T36A 3AKZA 4DDCA 176LA 1CKFA 1QT7A 3B0KA 4K5YA 1IQPA 2QNJA 1LSAA 4I0CA 1KY1A 1L67A 3GUJA 1AUAA 1GFJA 3U60A 2BQEA 3M0EA 256LA 1FJGM 1C6GA 1LSBA 148LE 3VFDA 1UACY 1UBZA 5B05A 1OAIA 3QNGA 3SN6R 3MJ5A 161LA 1IO5A 4QHTA 3TXEA 2DKLA 104LA 1C61A 1VAUA 245LA 3A8ZA 2EPEA 5HNCA 1B7OA 4X62M 2ZNWY 3TXHA 3SYKA 1Q3CA 1CKCA 5FEKA 1XEKA 3ZQJA 4GC9A 2G8LA 127LA 1L70A 2Y8PA 3BKVA 1TEWA 1WQPA 1Z55A 1HEPA 2I25L 1B5UA 1L64A 1LZRA 3AOEA 258LA 2C8OA 3HU9A 4D9ZA 3ATOA 4DR5M 2F4VM 1D3NA 1IOQA 1QSAA 4WLDA 1OWYA 2A4TA 1HJPA 5IDDA 4W55A 4OOOA 4M0DA 2UXDM 3FADA 1MJGM 5KKIA 3A95A 4LF4M 4R6CA 4C3WA 3E21A 3B9PA 2F4AA 4AG5A 5ITRA 2CJLA 3QYBA 1YAOA 1LWKA 3HZJA 5KXKA 4WG7A 4ARQA 3L2AA 107LA 4BLCA 1G0KA 2JUJA 3LQQA 4RNAA 4B7GA 4PK0A 1IY4A 4NG1A 2CV1A 1L38A 1OUEA 4WM2A 4KODA 4PGJB 3PVSA 3U6MA 1GBOA 2RBPA 2Z7JA 3DMZA 3SASA 3EXDA 1LZ6A 2BNKA 1B5YA 1JKAA 3HH4A 217LA 196LA 1GBXA 4PDIA 2MEAA 5E4PA 4LF6M 3OE9A 2ZQ3A 1UIDA 2ANVA 1C68A 1CTWA 1L51A 2I6ZA 5LZMA 4OW0A 3L29A 1JSFA 4W96A 3C7YA 115LA 4YY3M 1ZV1A 5EXXA 1C08C 1PGYA 1Q3BA 1BB5A 1DGBA 3MK6A 2XBSA 2F5QA 4P17A 4NSOB 5KXSA 2HL7A 4NFVA 228LA 3TXJA 4FCTA 166LA 1XGTC 1FLUA 3G3BB 5FTJA 4G9SA 1E8LA 4CGEA 1FKQA 1IY2A 4CFOA 4OWBA 4XJHA 1GBYA 3F6ZA 2DQDY 3HHXA 1L74A 5LAGA 1VDLA 1LZ4A 4GLVA 3AL0C 156LA 5DYGA 123LA 3GLFE 1L24A 2HTXA 2BLYA 1N34M 1GB9A 1T6HA 1HQYE 1JKCA 1T3PA 2NWDX 3AOEC 2KA6B 2OE4X 3HY5A 5A3EA 3DNAA 3HBDA 4JI7M 1DYBA 1JWRA 1J1OY 3W0FA 4Q7JA 197LA 2MROB 5I4YA 1L39A 1P6YA 1UIGA 4PRUA 2B6WA 114LA 3W3EA 5AMYA 4BADA 2QENA 4UWVA 1Q39A 2LXEA 1JITA 1GBSA 1LYGA 4OW1A 1QUOA 2WZJA 1HR0M 4W5WA 262LA 2DWMA 5DM9A 3WW5A 3J7AS 3K92A 3RFWA 2B74A 5ITUA 1IWWA 188LA 4GITA 2Z2EA 2X4AA 4AXTA 3SB8A 3Q8GA 185LA 2B6ZA 3GUIA 5FELA 1C6FA 4PDGA 3DMVA 1WQRA 230LA 260LA 1G41A 1TTEA 5IELA 5EBHA 1ZMWA 1GB8A 4KL7A 2WSEF 5FDJA 5LYMA 247LA 1IN6A 4WLXA 5APFA 1RI8B 3L2XA 1G0LA 1T43A 3B72A 1LSCA 4LYMA 1KNIA 1UIAA 4H8YA 1FLYA 3GLFA 5ITXE 1IN7A 5KJ9A 1QYRA 4AI6A 4FD2A 4FWDA 5I4XA 3ULRA 1YLAA 1DYEA 3OJPA 4PHIA 5DNYA 131LA 4XENA 1IP3A 2CRUA 1LOZA 3N9AA 4AG6A 4EKRA 3GUNA 2B75A 1VDQA 1LYEA 4R0FA 4PCZA 4ARLA 254LA 4GRIA 4ZFPA 3BBZA 1DYAA 1GFTA 3VK7A 3KDSE 1LJ4A 2FOIC 1B7MA 209LA 2G4PA 135LA 3DN6A 1BWIA 3W68A 2RKOA 3GUPA 130LA 4NWEA 1L76A 2F47A 2UU9M 3K2LA 1LW9A 2DKVA 2RB0X 1F0WA 1QDRA 1L14A 4Z98A 1OWZA 2XH9A 1C7YA 1BGIA 3M7GA 1L69A 2DAGA 4LF7M 4RF0A 1B9OA 1LSZA 4O34A 2CV0A 3U6CA 3DKEX 1BVSA 1W5SA 4JI6M 2F2NA 3B6LA 5FTKA 5LYTA 5FTMA 1CUQA 5C1BA 1JIYA 4AZFA 2DQFC 1DZBX 4WURA 151LA 2XFSA 1LZYA 1GFAA 4EIWA 1O23A 1GAZA 5KKJA 3HKPA 2CP8A 2DQAA 200LA 3GUMA 1YSYA 4ETEA 5ITXA 1JTMA 1JB0F 4H9IA 1BQLY 1JISA 2DQEY 4CJ2A 3THGA 1VDPA 2KNVA 4R71A 1GE0A 1GBZA 2YBIA 4WM3A 1C6IA 2CGIA 2B6TA 1GJTA 3KAMA 3LYMA 4KT0F 5I5QA 3ZH9B 3J81S 180LA 3U6EA 3HH3A 4R7GA 3CF0A 1TGUA 1RJCB 225LA 1IY1A 2QCUA 4LJ7A 4JI2M 2Z19A 5L9JA 4M6DA 1IN4A 1LMNA 3CDQA 1D3FA 2H1RA 4N5RA 3R9XB 1L20A 1XGUC 4DR3M 4U3XB 1J1XY 1DXJA 1REXA 5KXOA 4D82A
chains in the Genus database with same CATH topology
5F14A 3IJUA 3V2YA 1GF4A 1OUIA 3FE0A 5F81A 231LA 1QS5A 1L21A 181LA 7LYZA 145LA 1LZ5A 1L77A 3CT0A 4HTQA 1C43A 1GDXA 4LZMA 1L16A 5F9XA 4GN5C 1KXYA 3WH1A 1L08A 2DQCY 1LI2A 1L89A 4I7QA 1GFRA 4G4HA 2RBSA 1CU2A 253LA 1L40A 2XTHA 1LGWA 4L41A 3F8VA 1LPYA 3DN4A 184LA 2I26L 1LKSA 214LA 4EOFA 186LA 1G06A 5LVKA 1LSFA 4II8A 1C6AA 1L83A 3NYAA 241LA 4ANRA 1L55A 1C6QA 1GEZA 4S0WA 1GB6A 3AJNA 1DYGA 2A7DA 3OE6A 1NWGA 3G3AB 4NSIA 1L42A 1PZYA 5K7OA 1BVXA 1ZV5L 5LAFA 2RBNA 1EL1A 5HMVA 3WPLA 2RBOA 1I56A 1EQ5A 4N9RA 154LA 1A4VA 4WM5A 1OUAA 1L60A 2YBLA 1CV1A 1NHEA 2B7XA 4H9FA 1LLHA 2DBTA 1HEOA 1B7NA 5DL9A 4MR1A 2W1LA 1C6MA 3CB7A 5KXXA 1SSYA 1KW7A 3SB6A 2HECA 3K3TA 4YF2A 1OUDA 5APDA 4ARMB 3CSQA 1LSGA 3J4GA 1CNSA 4LDOA 1ZVYB 4DAJA 1GPQC 2CWIA 4YX7C 1DKKA 255LA 2DQIY 1GEVA 1LJHA 1IX0A 4PJZA 1JTNA 234LA 1LWGA 1UUZC 5LVHA 2ZYPA 1QTCA 2HULA 3WU8A 1LJEA 1UICA 1CKGA 4YOPA 3CSRA 1B5WA 4B4EA 5KXMA 251LA 5KXPA 1J1PY 2EIZC 173LA 5E9RA 4IATA 3A6CY 158LA 2YVBA 5APEA 1B2KA 1C6EA 1C66A 1LGUA 1BWHA 1LMPA 5B1FA 1LSYA 1G0MA 1WQOA 4E97A 2DQJY 1JJ0A 4ETBA 4NHTA 2CUUA 3LYTA 4NHPA 1CU0A 3LN2A 3MGWA 5A3ZA 3CT5A 1IR8A 3HDEA 110LA 3A67Y 4PJ2C 1C6TA 4WL6A 3WL2A 4YM8A 1YKZX 2LYMA 232LA 4OWEA 3QY4A 2H9KA 1XEIA 3LZTA 1XGQC 4EKQA 3T6UA 4NWHA 4ZEEA 1G0QA 4NHQA 4ARPA 1HEWA 1XJTA 1HFXA 167LA 3EO5A 3WUMA 5KXLA 1GB7A 3GUKA 1L18A 2ZILA 1DPWA 1L46A 1LMOA 4BAFA 4GLAA 1LMQA 3LHMA 4LFPA 1HELA 2QB0B 4XJBA 1WTNA 153LA 3DN2A 4H94A 4TWSA 3C8RA 3IJVA 3GXKA 1PQJA 5APCA 2BQIA 3A92A 1OP9B 211LA 198LA 128LA 1LYOA 1G7MC 1LYDA 4TTDA 1LYJA 1I6SA 3UONA 3ZVQA 1CX6A 3RZ4A 5IHGA 2Q9DA 4TUNA 1L99A 4I7NA 3D4SA 236LA 1INUA 2BQJA 3NY9A 3W6DA 3E3DA 4KT3A 1L54A 1C63A 2MEIA 4DQJA 2DQHY 4ML7A 1IP7A 2IFFY 1L29A 3AZ7A 226LA 3HU8A 215LA 3W6CA 2BQNA 2BPUA 5T3FA 1P3NA 3V2WA 1LZ1A 1G0PA 1LAAA 133LA 2D4JA 168LA 1LJGA 1LZDA 157LA 1OUHA 3RNXA 1OUFA 190LA 1GB5A 1C6HA 4E3UA 4H8XA 1CU3A 3HUAA 1I20A 1LMAA 5KXRA 2L78A 2ANXA 3C8QA 1ALCA 175LA 1H87A 205LA 4LT1A 4B49A 191LA 1AM7A 2EQLA 4GCBA 4Z41A 1LYZA 3FI5A 3D3DA 1L48A 1HNLA 4DD2A 4WLYA 1XFPL 1AT6A 5KXYA 4WM1A 246LA 1LJJA 1QT5A 1T8AA 3SP3A 2NTHA 1L01A 4G49A 4AQNA 2QARC 1L87A 1RE2A 4HV2A 1GFEA 1IIZA 1L98A 1OV7A 2LZTA 1LZTA 4GCDA 1L26A 1H6MA 1GB3A 1LHMA 220LA 2HEFA 3HTBA 192LA 1C6KA 207LA 3TMVA 5C6IA 1C6BA 3SB7A 3TXDA 1T8FA 4HJZA 2LYZA 2N5ZA 1L52A 1UC0A 1CKDA 4J0LA 5LXWA 1SX7A 3G3XA 2D4KA 2BQGA 1HHLA 1T8GA 1NBZC 2H5ZA 249LA 1NHBA 1OYUA 3QE8A 5HLLA 3CT1A 3PBLA 1CJ9A 1NQIA 1REZA 139LA 1B7SA 2MEDA 5LVIA 5DLAA 1P2RA 2W1YA 1JJ1A 1P36A 1CV0A 1SLYA 4H9HA 4GCFA 4YXCA 3FA0A 4Z46A 1FLQA 1C6CA 2LC9A 4RLNA 1JKBA 194LA 213LA 3HT6A 4N1CC 4A7DA 2Z18A 4NEBA 5B1GA 1LJKA 1LSPA 1IY3A 1CV3A 4DQ7A 1C67A 3HTFA 1NDMC 2D91A 3GXRA 1REMA 4NGJA 1FLWA 1ZURA 4HTKA 5D5FA 3PDSA 1YILA 4DDAA 4RW2A 244LA 1D3JA 6LYZA 4NG8A 1LJIA 5B07A 4CHXA 1LZAA 3GULA 3RUNA 1P2CC 1L95A 4XJDA 1CV4A 4HPIA 108LA 2Z6BA 2BQFA 5I54A 5I4WA 4NGOA 1A2YC 4I7OA 4X3BA 3HBHA 5LIOA 1KIPC 1D0KA 1KS3A 172LA 2HUBA 1LJFA 1BB4A 1JUGA 2RB2X 1L82A 1L41A 4H8ZA 2G4NA 4IAPA 2FYDA 1L93A 5L3HA 2WARA 2BQHA 4I7RA 1LCNA 3A90A 1NMMA 2RB1X 177LA 1NDGC 1FBIX 1JEFA 1QSWA 3G3VA 1GFKA 3LZMA 1QTBA 2HU3A 2DQGY 8LYZA 1LKRA 4WO6A 2LZMA 1QS9A 4LYCA 2IHLA 1WVVA 4J1AA 1YAPA 144LA 3C7ZA 1LZ8A 4NGIA 1HEMA 1L75A 159LA 2EKSC 4M4OA 2CDSA 1GF0A 3K2RA 1OUGA 1G0GA 1LI3A 5B06A 4B1AA 1HEQA 1HENA 4QY9A 2HUKA 5LA5A 4TSCA 1G1VA 1T97A 3C81A 3CDRA 1YKXX 4XYYA 1XSFA 3WULA 2BQMA 212LA 3HUKA 182LA 3HT9A 4DD9A 4EPFA 1PQDA 3TXIA 1I1ZA 3BKHA 4YXAC 1XGRC 235LA 4B0DA 3HUQA 4XJIA 1C64A 1QTHA 1CU5A 1L59A 4DD1A 1LZNA 169LA 2X0AA 174LA 1B7QA 1L27A 1IORA 1L34A 4LDEA 1QT6A 4N0JA 1JQUA 1OV5A 132LA 1L72A 1LHKA 1WVUA 1QSQA 3OE8A 3HDFA 2G4QA 2B73A 3GUOA 2MECA 1L43A 1DI5A 1GF5A 4I7LA 2XBRA 4DYGA 5FSTA 2RAZX 1L80A 3W6BA 1LYSA 3P4ZA 3A34A 6LYTA 5F9UA 3P68A 1W6ZA 5KXWA 149LA 1DYDA 1LZBA 3WMKA 4DQ5A 1GF7A 160LA 4BS7A 3CDVA 134LA 1D9WA 1L03A 4YENA 1JPOA 1L05A 1L71A 1AZFA 1BVKC 1B7PA 1QUDA 252LA 238LA 3AW6A 4XJFA 5DN4A 2MEFA 3SBBC 4WL7A 4WO9A 1P2LA 3A94A 4LT0A 1L49A 1FN5A 2XQOA 4LZTA 5KXNA 109LA 1DYFA 2BQCA 2HEAA 137LA 3TXBA 5C6JA 4RW1A 5LA8A 1SQ2L 4W58A 4DWXA 1OVKA 1L09A 4LT3A 1IWZA 3AYQA 3WXUA 4LYBA 1QUTA 1B5VA 1IVMA 240LA 1GD6A 1LMCA 163LA 1LZSA 4J7VA 1BB3A 5J7CA 1IP5A 178LA 1GFHA 2B5ZA 3CSZA 1L47A 1CUPA 5I53A 3F9LA 3AZ5A 4ETDA 4J1BA 3ATNA 3WYHA 4ETCA 1JTOL 3W6FA 3DMXA 1G1WA 4NGZA 3HFMY 1JTPL 1IWTA 187LA 1D6QA 1BWJA 1L44A 4GRVA 1L97A 3AGHA 1TDYA 4LYTA 4I7SA 4W54A 2W1XA 4EKPA 1PS5A 3P65A 4HP0A 1F6RA 4W56A 2LCBA 259LA 5I14A 1LHHA 4LT2A 2VB1A 2D4IA 4I7MA 1C60A 1B0DA 1L10A 1QTVA 1SWZA 1QDTA 193LA 1XEPA 1YKYX 1YAMA 1LHIA 248LA 1LSMA 1OUBA 2OU0X 1HMKA 1L63A 1DYCA 1JSEA 2BQLA 1IWUA 3JR6A 1GXV2 2ZNXY 3DN3A 4DC4A 4CFPA 1B5ZA 1UIBA 1QUSA 1TBYA 3WXTA 1LSEA 1L79A 1KXWA 4ARQB 4GN3A 162LA 2HEDA 4DD7A 5M1YA 239LA 3WUAA 1GF9A 4LYOA 2OTZX 3LZ2A 5KY1A 4NGLA 3LYOA 4HJYA 5ILCA 1LJ3A 1PQIA 3P64A 1L53A 3ODUA 1QTDA 216LA 1EQEA 1QTZA 1C62A 1L45A 4AGAA 3P66A 233LA 4H9AA 2HEBA 4W59A 1G7IC 126LA 4HV1A 1L17A 3AZ6A 4NIJA 4ZIXA 1CJ7A 4TX7A 1LMTA 2XJWA 1LZEA 5KXTA 4ARMA 3RU5A 2MEHA 1IWVA 2OEAX 2ZWBA 3B0IA 2C8PA 2GV0A 3EBAB 4TSBA 1RCMA 4KPMA 2FBBA 4W53A 4G4CA 1N4FA 1L00A 147LA 1L0KA 3AGGG 3CDTA 3OK0A 1L92A 5B59A 1L02A 3DN1A 1CV5A 1OVHA 4WMGA 3WVYA 1QUHA 4RLMA 142LA 5FCPA 3B0OA 3AB6A 2Q9EA 9LYZA 1L31A 1B7LA 1GFVA 119LA 4B4JA 1MELL 3RZEA 1C10A 1PQOA 3W6AA 4B4IA 4OWHA 1FDLY 4LFXA 2Q0MX 4OOTA 1DI3A 1GAYA 3WUNA 165LA 1LZ9A 1C6NA 1LTMA 1IP4A 140LA 2YBHA 1GDWA 2FYCA 1L36A 3C83A 4XN6A 1AT5A 4W57A 4G4BA 4QEQA 1DI4A 1L23A 2BQOA 4WG1A 1L65A 4DD3A 1YL0X 1L84A 2IGCA 1P64A 1C6DA 4NGKA 3A6BY 4DT3A 1L57A 1D2WA 2F2QA 1DKJA 3FI7A 4UWUA 2Z39A 1C45A 1HSXA 1G7HC 1ZYTA 199LA 4MCKA 2OU9A 5KXZA 227LA 4W51A 1L06A 1JHLA 3HBEX 1QUGA 2LHMA 1C65A 3L64A 2HEEA 150LA 1OUCA 1C6PA 1CJ8A 3HT7A 3AGIA 1OQMA 223LA 3DN0A 1YANA 2ZQ4A 1LYHA 141LA 4IASA 1IWXA 2BAAA 250LA 1WQMA 4QGZA 1L32A 1EPYA 4NGVA 2NTGA 3EMSA 1L58A 1P7SA 1UIHA 1L85A 3J6KA 1GBWA 4IJ4A 5FHWA 1LJNA 1UIEA 138LA 4NSHA 4H93A 1L66A 1LZCA 1ZWNA 3SB9A 102LA 1L94A 1HF4A 1QIOA 1L28A 1V7TA 2MEBA 1NF5A 4EJ4A 1TAYA 2BQDA 3VWOA 1JTTL 122LA 2O7AA 4H9BA 4QDNA 201LA 1C46A 4I7JA 3HH5A 2PC2A 2B70A 2AUBA 218LA 3HT8A 1IR9A 3G3WA 1UIFA 1B6IA 4EKSA 1OUJA 1NBYC 1D3MA 4HJVA 1GE2A 1L73A 4P2EA 1L0JA 4Z3MA 1P56A 1KIRC 1L30A 1VFBC 1GE1A 2A7FA 4NSGA 1ZMYL 1QTEA 2MEEA 1CJ6A 1HMLA 1L88A 5ILFA 1XEJA 2BLXA 152LA 5JENB 1K28A 1QQYA 4UWNA 1QTKA 3WPKA 1BB6A 1IR7A 1JJ3A 120LA 257LA 4FDYA 1T6VL 1IC7Y 5HQ1A 1NKHA 1UCOA 1OVJA 1GWDA 1HC0A 5LYZA 206LA 1IOSA 4PPOA 2F32A 210LA 111LA 1L07A 1LSDA 3TMUA 1PQKA 4GN4A 4W94A 1SSWA 2BQBA 2BQKA 7LZMA 3HTDA 1D6PA 3RT5X 4FJRA 1IP1A 1LGXA 2RH1A 3RW8A 2W1MA 3WU7A 4ET8A 2YBMA 3D9AC 3A3QA 3C82A 1P46A 4C5FA 1YQVY 4WOAA 1QT3A 1WTMA 3W6EA 4NGYA 4NSJA 4DJHA 3HH6A 1CU6A 3AZ4A 3C8SA 3HWLA 229LA 5D5CA 1KXXA 1LHLA 3A96A 3WW6A 1L61A 2D6BA 4H90A 1YL1X 3TXGA 1MLCE 1KY0A 1P5CA 2ZIJA 1AKIA 3C7WA 4HSFA 5L3IA 1WQQA 1G07A 1KW5A 1CKHA 2RSCA 4RDSA 4H91A 4GBRB 3M3UA 1DQJC 2ZIKA 2OU8A 5II3A 1CVKA 1ZVHL 1IEEA 4ZPUA 164LA 1GF3A 2B6YA 1D0LA 1L91A 1IOCA 4LDLA 1FKVA 1GB2A 1QSBA 103LA 2YDGA 4GCEA 1DPXA 112LA 3A3RX 3AW7A 155LA 1F6SA 1GFGA 4OO9A 1IP6A 1C69A 4EXMA 2LZ2A 1B7RA 4EMNA 5HNLA 1HFYA 2MEGA 1C6JA 2FBDA 4OWAA 1L62A 1SWYA 5DN5A 1YAQA 1HERA 3LYZA 1G0JA 1D0MA 1G7JC 4MSTA 4YEOA 2ZYCA 1RFPA 2RBRA 5C6LA 3CDOA 1JKDA 1TLAA 1L81A 2H9JA 4OWCA 2Z12A 3TMXA 3TXKA 1WQNA 1TCYA 1PQMA 3SB5A 3C80A 146LA 1P37A 1VDSA 4I7PA 4WLTA 1XJUA 3SBAA 4W52A 2HU1A 1LYFA 4NGWA 1LYYA 3VW7A 4I7KA 4DD0A 4EPIA 1CX7A 1HSWA 2HUMA 1L68A 1IP2A 1D9UA 243LA 1L11A 4DDBA 3OE0A 4H92A 1XGPC 6LZMA 4KXIA 1CV6A 4I8SA 261LA 1LSNA 1SX2A 5LVJA 1D2YA 3A91A 3ZVQB 189LA 118LA 1GE4A 1IWYA 2B72A 2YBJA 4H9CA 5LVGA 1LZGA 1L13A 3IWRA 1GB0A 3WU9A 1WTHA 1C6LA 1GHLA 183LA 4I7TA 1L86A 2OE9X 219LA 5LINA 3CQLA 3A93A 1YIKA 1V7SA 1YROA 242LA 2O4WA 2YSSC 3TMWA 2F4GA 4ET9A 4WM4A 2RBQA 1L90A 2B6XA 2Z38A 1GFUA 2OE7X 4HPEA 1VATA 224LA 1QT4A 2Z2FA 3HTGA 208LA 1GE3A 1L33A 3ZEKA 4WM6A 1EQ4A 1L35A 222LA 143LA 3WVXA 3DN8A 1L04A 113LA 3N9CA 3EMLA 4ARJA 4GCCA 3N9EA 3NY8A 3TXFA 170LA 1F10A 1GXXA 1W08A 2Z37A 3M18B 1VEDA 1BB7A 1LI6A 1VDTA 1UA6Y 1LHJA 4N1EI 129LA 5F16A 1C7PA 1GF8A 4LYZA 1L22A 4YEMA 1QT8A 4BAPA 1L15A 195LA 1BHZA 1B5XA 1L37A 4NY5A 4XJGA 1IC5Y 4N8ZA 2F30A 1L25A 4H1PA 4ETAA 1LYIA 221LA 1IOTA 2O79A 3QAKA 237LA 125LA 1L96A 2BQAA 1KIQC 4HTNA 4PRQA 171LA 4H9EA 1REYA 3WPJA 4DKLA 1L19A 1IC4Y 4NHSA 2YBNA 2RAYX 1HFZA 5HMJA 1G7LC 1L12A 2OTYX 1L56A 1LPIA 1L50A 1GF6A 4NHIA 4XADA 4LGKA 2LYOA 3T36A 4DDCA 176LA 1CKFA 1QT7A 3B0KA 4K5YA 1LSAA 4I0CA 1KY1A 1L67A 3GUJA 2BQEA 1GFJA 256LA 1C6GA 1LSBA 148LE 1UACY 1UBZA 5B05A 3QNGA 3SN6R 161LA 1IO5A 3TXEA 104LA 1C61A 1VAUA 245LA 3A8ZA 2EPEA 5HNCA 1B7OA 2ZNWY 3TXHA 1CKCA 5FEKA 1XEKA 127LA 1L70A 2Y8PA 3BKVA 1TEWA 1WQPA 1Z55A 1HEPA 2I25L 1B5UA 1L64A 1LZRA 258LA 2C8OA 3HU9A 4D9ZA 3ATOA 1D3NA 1IOQA 1QSAA 4WLDA 1OWYA 2A4TA 5IDDA 4W55A 4OOOA 3FADA 5KKIA 3A95A 4C3WA 4R6CA 2F4AA 2CJLA 1YAOA 1LWKA 5KXKA 4WG7A 4ARQA 107LA 1G0KA 4PK0A 1IY4A 4NG1A 1L38A 1OUEA 4WM2A 4PGJB 1GBOA 2RBPA 3DMZA 3EXDA 1LZ6A 1B5YA 1JKAA 3HH4A 217LA 196LA 1GBXA 2MEAA 5E4PA 3OE9A 2ZQ3A 1UIDA 2ANVA 1C68A 1CTWA 1L51A 2I6ZA 5LZMA 1JSFA 4W96A 3C7YA 115LA 1C08C 1BB5A 2XBSA 5KXSA 4NFVA 228LA 3TXJA 166LA 1XGTC 1FLUA 3G3BB 4G9SA 1E8LA 4CGEA 1FKQA 4CFOA 4OWBA 4XJHA 1GBYA 3F6ZA 2DQDY 1L74A 5LAGA 1LZ4A 4GLVA 156LA 123LA 1L24A 2HTXA 2BLYA 1GB9A 1T6HA 1JKCA 1T3PA 2NWDX 2OE4X 5A3EA 3DNAA 3HBDA 1DYBA 1JWRA 1J1OY 197LA 5I4YA 1L39A 1P6YA 1UIGA 4PRUA 2B6WA 114LA 3W3EA 5AMYA 4BADA 4UWVA 1JITA 1GBSA 1LYGA 4OW1A 1QUOA 262LA 5DM9A 3WW5A 2B74A 1IWWA 188LA 2Z2EA 4AXTA 3SB8A 5FELA 185LA 2B6ZA 3GUIA 1C6FA 3DMVA 1WQRA 230LA 260LA 5IELA 5EBHA 1GB8A 4KL7A 5FDJA 5LYMA 247LA 4WLXA 5APFA 1RI8B 3L2XA 1G0LA 3B72A 1LSCA 4LYMA 1KNIA 1UIAA 4H8YA 1FLYA 5KJ9A 5I4XA 3ULRA 1DYEA 3OJPA 4PHIA 4XENA 131LA 1IP3A 1LOZA 3N9AA 4EKRA 3GUNA 2B75A 1VDQA 1LYEA 4R0FA 4ARLA 254LA 4ZFPA 1DYAA 1GFTA 1LJ4A 2G4PA 1B7MA 209LA 135LA 3DN6A 1BWIA 3GUPA 130LA 4NWEA 1L76A 2F47A 1LW9A 2DKVA 2RB0X 1F0WA 1QDRA 1L14A 4Z98A 1OWZA 1BGIA 1L69A 1B9OA 1LSZA 4O34A 3DKEX 2F2NA 3B6LA 5LYTA 1CUQA 1JIYA 2DQFC 1DZBX 151LA 1LZYA 1GFAA 1O23A 1GAZA 5KKJA 2DQAA 200LA 3GUMA 4ETEA 1JTMA 4H9IA 1BQLY 1JISA 2DQEY 4CJ2A 1VDPA 1GE0A 1GBZA 2YBIA 4WM3A 1C6IA 2CGIA 2B6TA 3KAMA 3LYMA 5I5QA 180LA 3HH3A 1RJCB 225LA 2Z19A 5L9JA 4M6DA 1LMNA 3CDQA 1D3FA 4N5RA 1L20A 1XGUC 4U3XB 1J1XY 1DXJA 1REXA 5KXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU9 A;  2Z18 A;  5F14 A;  3IJU A;  1GHL A;  4NEB A;  5B1G A;  1GF4 A;  1OUI A;  1LJK A;  1LSP A;  4WMG A;  1IY3 A;  3WVY A;  4RLM A;  1NDM C;  5FCP A;  2D91 A;  3FE0 A;  3B0O A;  5LIN A;  3CQL A;  3A93 A;  3GXR A;  1YIK A;  1REM A;  1V7S A;  3AB6 A;  5KY1 A;  4NGJ A;  1FLW A;  9LYZ A;  1YRO A;  2YSS C;  4HTK A;  1B7L A;  1GFV A;  2F4G A;  5D5F A;  3TMW A;  4ET9 A;  5F81 A;  4WM4 A;  4B4J A;  1MEL L;  1YIL A;  4DDA A;  4RW2 A;  7LYZ A;  1C10 A;  2Z38 A;  1GFU A;  1LZ5 A;  3W6A A;  4B4I A;  3CT0 A;  6LYZ A;  4OWH A;  4NG8 A;  4HTQ A;  1FDL Y;  4HPE A;  4LFX A;  1C43 A;  1GDX A;  1LJI A;  1VAT A;  2Q0M X;  4OOT A;  5B07 A;  4CHX A;  1LZA A;  5F9X A;  4GN5 C;  1KXY A;  2Z2F A;  3WH1 A;  1P2C C;  4XJD A;  1DI3 A;  1GAY A;  208L A;  1GE3 A;  3WUN A;  1LZ9 A;  2DQC Y;  4HPI A;  3ZEK A;  1LTM A;  1IP4 A;  4WM6 A;  1EQ4 A;  2YBH A;  1GDW A;  2FYC A;  2BQF A;  1GFR A;  3WVX A;  5I54 A;  4XN6 A;  5I4W A;  4G4H A;  1AT5 A;  4NGO A;  1A2Y C;  4G4B A;  4QEQ A;  2XTH A;  1DI4 A;  4X3B A;  3HBH A;  5LIO A;  2BQO A;  3N9C A;  1KIP C;  4WG1 A;  1D0K A;  4DD3 A;  1YL0 X;  4GCC A;  4L41 A;  3N9E A;  3TXF A;  2HUB A;  1LJF A;  4ET8 A;  1BB4 A;  4NGK A;  1F10 A;  1JUG A;  1LKS A;  2I26 L;  3A6B Y;  4EOF A;  4DT3 A;  5LVK A;  4H8Z A;  1GXX A;  1DKJ A;  1LSF A;  1W08 A;  2G4N A;  2Z37 A;  2Z39 A;  3FI7 A;  4II8 A;  1C45 A;  2FYD A;  4UWU A;  3M18 B;  1HSX A;  5L3H A;  2WAR A;  1G7H C;  1VED A;  2BQH A;  4ANR A;  1BB7 A;  4MCK A;  1LCN A;  1GEZ A;  1VDT A;  1UA6 Y;  5KXZ A;  1LHJ A;  1GB6 A;  3A90 A;  4N1E I;  1NMM A;  1NDG C;  1FBI X;  3AJN A;  1JEF A;  1QSW A;  2A7D A;  1GFK A;  1JHL A;  1NWG A;  2HU3 A;  5F16 A;  1C7P A;  2DQG Y;  8LYZ A;  1GF8 A;  3HBE X;  4LYZ A;  3G3A B;  4NSI A;  4YEM A;  1PZY A;  4BAP A;  1LKR A;  4WO6 A;  2LHM A;  5K7O A;  4NY5 A;  1BHZ A;  1B5X A;  1BVX A;  4XJG A;  1ZV5 L;  1IC5 Y;  5LAF A;  4LYC A;  2IHL A;  4N8Z A;  1EL1 A;  1WVV A;  2F30 A;  5HMV A;  4H1P A;  2HEE A;  3WPL A;  4ETA A;  1I56 A;  4J1A A;  1EQ5 A;  1IOT A;  4N9R A;  1OUC A;  1YAP A;  1A4V A;  154L A;  1CJ8 A;  1LZ8 A;  3AGI A;  2BQA A;  4NGI A;  4WM5 A;  1OUA A;  1HEM A;  1KIQ C;  1OQM A;  2EKS C;  4HTN A;  4PRQ A;  4H9E A;  1REY A;  4M4O A;  2CDS A;  2YBL A;  3WPJ A;  1GF0 A;  1NHE A;  4H9F A;  1IC4 Y;  2DBT A;  1HEO A;  1YAN A;  2ZQ4 A;  1OUG A;  1B7N A;  4NHS A;  5DL9 A;  2YBN A;  4IAS A;  4MR1 A;  1IWX A;  2BAA A;  2W1L A;  1WQM A;  4QGZ A;  1HFZ A;  3CB7 A;  5B06 A;  1G7L C;  1HEQ A;  5HMJ A;  4B1A A;  1HEN A;  5KXX A;  4NGV A;  4QY9 A;  1LPI A;  5LA5 A;  4TSC A;  3EMS A;  1GF6 A;  4NHI A;  4XAD A;  2HEC A;  4LGK A;  1UIH A;  1YKX X;  3K3T A;  2LYO A;  4XYY A;  1OUD A;  3T36 A;  4DDC A;  4YF2 A;  3J6K A;  1CKF A;  1GBW A;  5APD A;  4IJ4 A;  3B0K A;  1LSA A;  5FHW A;  1LJN A;  1XSF A;  3CSQ A;  1UIE A;  4I0C A;  3WUL A;  2BQM A;  4NSH A;  1LSG A;  4H93 A;  3J4G A;  1CNS A;  1GFJ A;  1LZC A;  2BQE A;  1ZVY B;  1GPQ C;  2CWI A;  1LSB A;  4DD9 A;  1HF4 A;  1DKK A;  1QIO A;  1UAC Y;  1UBZ A;  1V7T A;  2DQI Y;  1GEV A;  1LJH A;  3TXI A;  1I1Z A;  1IX0 A;  5B05 A;  3QNG A;  3BKH A;  2MEB A;  1NF5 A;  1XGR C;  4B0D A;  1IO5 A;  3TXE A;  4XJI A;  1UUZ C;  1VAU A;  5LVH A;  2ZYP A;  4DD1 A;  1LZN A;  1TAY A;  3WU8 A;  2BQD A;  1LJE A;  3VWO A;  1UIC A;  1CKG A;  3A8Z A;  2X0A A;  1JTT L;  2EPE A;  4YOP A;  3CSR A;  1B5W A;  4H9B A;  1B7Q A;  4B4E A;  1IOR A;  5HNC A;  5KXM A;  1B7O A;  2ZNW Y;  4QDN A;  3TXH A;  1C46 A;  4N0J A;  1CKC A;  5FEK A;  5KXP A;  1J1P Y;  1XEK A;  2EIZ C;  132L A;  2PC2 A;  1LHK A;  5E9R A;  2Y8P A;  4IAT A;  2AUB A;  1WVU A;  1IR9 A;  3A6C Y;  3BKV A;  1TEW A;  2YVB A;  1UIF A;  1WQP A;  1Z55 A;  5APE A;  1B2K A;  1HEP A;  2G4Q A;  2I25 L;  1B5U A;  1LZR A;  1OUJ A;  2C8O A;  1NBY C;  4D9Z A;  4HJV A;  3ATO A;  1GE2 A;  1BWH A;  2MEC A;  1LMP A;  5B1F A;  1LSY A;  1WQO A;  2DQJ Y;  1IOQ A;  1JJ0 A;  1QSA A;  4WLD A;  4ETB A;  4NHT A;  3LYT A;  4NHP A;  3LN2 A;  3MGW A;  1DI5 A;  1GF5 A;  5A3Z A;  2XBR A;  3CT5 A;  5IDD A;  1IR8 A;  4P2E A;  3A67 Y;  4OOO A;  4PJ2 C;  4Z3M A;  4DYG A;  5KKI A;  3A95 A;  5FST A;  4R6C A;  4C3W A;  1KIR C;  4WL6 A;  1VFB C;  3WL2 A;  4YM8 A;  2F4A A;  3W6B A;  2CJL A;  1YKZ X;  2LYM A;  1LYS A;  1YAO A;  3P4Z A;  1GE1 A;  2A7F A;  3A34 A;  4NSG A;  5F9U A;  6LYT A;  5KXK A;  4WG7 A;  3P68 A;  1W6Z A;  3QY4 A;  2H9K A;  4OWE A;  5KXW A;  1ZMY L;  1QTE A;  1IY4 A;  1LZB A;  3WMK A;  1XEI A;  2MEE A;  3LZT A;  1XGQ C;  4NG1 A;  1CJ6 A;  1HML A;  1OUE A;  3T6U A;  4NWH A;  1GF7 A;  4PGJ B;  4WM2 A;  4ZEE A;  5ILF A;  1XEJ A;  4BS7 A;  134L A;  1GBO A;  2BLX A;  5JEN B;  1QQY A;  4YEN A;  4NHQ A;  1JPO A;  4UWN A;  1HEW A;  1QTK A;  3WPK A;  3EXD A;  1LZ6 A;  1HFX A;  1B5Y A;  1BB6 A;  1JKA A;  1AZF A;  3EO5 A;  3WUM A;  1BVK C;  1B7P A;  3AW6 A;  1IR7 A;  1GBX A;  1JJ3 A;  5KXL A;  4FDY A;  1GB7 A;  4XJF A;  1T6V L;  2MEA A;  1IC7 Y;  5E4P A;  2ZQ3 A;  1NKH A;  1UID A;  5DN4 A;  2MEF A;  1UCO A;  5HQ1 A;  2ZIL A;  1DPW A;  2I6Z A;  1GWD A;  1LMO A;  4WL7 A;  4BAF A;  1HC0 A;  1JSF A;  4WO9 A;  4W96 A;  5LYZ A;  3A94 A;  4LT0 A;  1IOS A;  4GLA A;  1LMQ A;  3LHM A;  4LFP A;  4PPO A;  1FN5 A;  1HEL A;  1C08 C;  1BB5 A;  4LZT A;  2XBS A;  4XJB A;  5KXN A;  1WTN A;  153L A;  2BQC A;  4H94 A;  4TWS A;  5KXS A;  3TMU A;  1LSD A;  3IJV A;  2HEA A;  3GXK A;  4NFV A;  3TXJ A;  4GN4 A;  4W94 A;  3TXB A;  2BQB A;  5C6J A;  2BQK A;  5APC A;  4RW1 A;  1XGT C;  5LA8 A;  1SQ2 L;  1FLU A;  1D6P A;  2BQI A;  3A92 A;  3RT5 X;  4DWX A;  1OP9 B;  3G3B B;  4FJR A;  1IP1 A;  4G9S A;  3RW8 A;  3WU7 A;  2W1M A;  1E8L A;  4LT3 A;  4CGE A;  1IWZ A;  3AYQ A;  1FKQ A;  1LYO A;  4CFO A;  1G7M C;  4OWB A;  4XJH A;  1GBY A;  2YBM A;  2DQD Y;  3F6Z A;  1QUT A;  3D9A C;  3A3Q A;  1B5V A;  4LYB A;  1IVM A;  4TTD A;  5LAG A;  1LZ4 A;  4GLV A;  1GD6 A;  4C5F A;  1YQV Y;  4WOA A;  3ZVQ A;  1LMC A;  3RZ4 A;  5IHG A;  5J7C A;  1WTM A;  4TUN A;  2HTX A;  3W6E A;  1LZS A;  1INU A;  1BB3 A;  2BLY A;  2BQJ A;  1IP5 A;  1GB9 A;  3E3D A;  4J7V A;  4NGY A;  4NSJ A;  3W6D A;  4KT3 A;  1GFH A;  3AZ4 A;  1JKC A;  1T3P A;  2B5Z A;  2NWD X;  2MEI A;  3CSZ A;  5D5C A;  1KXX A;  2DQH Y;  4ML7 A;  1IP7 A;  2IFF Y;  5A3E A;  3HBD A;  1LHL A;  3A96 A;  3WW6 A;  1JWR A;  5I53 A;  3AZ7 A;  1J1O Y;  3AZ5 A;  4ETD A;  4J1B A;  2D6B A;  3ATN A;  3W6C A;  4H90 A;  3WYH A;  1YL1 X;  5I4Y A;  3TXG A;  1UIG A;  4PRU A;  4ETC A;  1JTO L;  1MLC E;  3W6F A;  2BQN A;  3W3E A;  2BPU A;  5AMY A;  5T3F A;  4BAD A;  4UWV A;  4NGZ A;  3HFM Y;  1JIT A;  1GBS A;  1JTP L;  4OW1 A;  1LZ1 A;  2ZIJ A;  1LAA A;  133L A;  1AKI A;  2D4J A;  4HSF A;  1LJG A;  5L3I A;  1IWT A;  1LZD A;  1D6Q A;  1WQQ A;  1OUH A;  3RNX A;  5DM9 A;  1OUF A;  1BWJ A;  1CKH A;  3WW5 A;  1GB5 A;  2RSC A;  4E3U A;  4H8X A;  4RDS A;  3AGH A;  1IWW A;  1TDY A;  4H91 A;  4LYT A;  2Z2E A;  4AXT A;  1I20 A;  3M3U A;  1DQJ C;  5FEL A;  1LMA A;  2W1X A;  1WQR A;  5KXR A;  1PS5 A;  2ZIK A;  5II3 A;  3P65 A;  1ALC A;  3WXU A;  1H87 A;  1IEE A;  1ZVH L;  4HP0 A;  5IEL A;  5EBH A;  1F6R A;  1GB8 A;  4LT1 A;  1GF3 A;  4KL7 A;  1AM7 A;  1D0L A;  4B49 A;  2EQL A;  5FDJ A;  4GCB A;  1LHH A;  1IOC A;  5LYM A;  4LT2 A;  4Z41 A;  2VB1 A;  2D4I A;  1LYZ A;  4WLX A;  3D3D A;  5APF A;  1B0D A;  1FKV A;  1RI8 B;  1GB2 A;  1HNL A;  3B72 A;  1LSC A;  1QDT A;  4LYM A;  4DD2 A;  193L A;  1UIA A;  1YKY X;  1YAM A;  1LHI A;  2YDG A;  1FLY A;  1DPX A;  4GCE A;  4H8Y A;  4WLY A;  1LSM A;  1OUB A;  5KJ9 A;  1XFP L;  1AT6 A;  3A3R X;  5KXY A;  5I4X A;  1HMK A;  3AW7 A;  4WM1 A;  3ULR A;  1F6S A;  1LJJ A;  3OJP A;  4PHI A;  1GFG A;  4XEN A;  1JSE A;  2BQL A;  1IWU A;  1IP6 A;  3SP3 A;  1IP3 A;  1LOZ A;  3N9A A;  2LZ2 A;  4G49 A;  1B7R A;  4EMN A;  5HNL A;  1HFY A;  1VDQ A;  2MEG A;  4R0F A;  1GXV 2;  2ZNX Y;  2FBD A;  4DC4 A;  4CFP A;  4OWA A;  1B5Z A;  1RE2 A;  5DN5 A;  4HV2 A;  4ZFP A;  1YAQ A;  1GFE A;  1HER A;  1UIB A;  1QUS A;  3LYZ A;  1TBY A;  3WXT A;  1LSE A;  1GFT A;  1IIZ A;  1KXW A;  1LJ4 A;  2G4P A;  1B7M A;  4GN3 A;  135L A;  2LZT A;  1LZT A;  1D0M A;  4GCD A;  1BWI A;  1H6M A;  2HED A;  3WUA A;  4DD7 A;  5M1Y A;  1G7J C;  1GB3 A;  1GF9 A;  4LYO A;  1LHM A;  4NWE A;  4MST A;  4YEO A;  2HEF A;  2DKV A;  3LZ2 A;  2ZYC A;  4NGL A;  207L A;  1F0W A;  1RFP A;  3LYO A;  1QDR A;  5C6I A;  3TMV A;  4HJY A;  5C6L A;  5ILC A;  1JKD A;  1LJ3 A;  4Z98 A;  3P64 A;  1BGI A;  2H9J A;  3TXD A;  4OWC A;  2Z12 A;  4HJZ A;  3TMX A;  1WQN A;  3TXK A;  2LYZ A;  1TCY A;  1B9O A;  2N5Z A;  1LSZ A;  4O34 A;  1EQE A;  2F2N A;  3B6L A;  1VDS A;  1UC0 A;  4AGA A;  3P66 A;  4WLT A;  5LYT A;  1JIY A;  1CKD A;  4H9A A;  2HEB A;  4J0L A;  2DQF C;  5LXW A;  2HU1 A;  1DZB X;  1G7I C;  4HV1 A;  2D4K A;  2BQG A;  1LZY A;  1HHL A;  3AZ6 A;  4NGW A;  1GFA A;  1LYY A;  4NIJ A;  4ZIX A;  1O23 A;  1GAZ A;  5KKJ A;  1NBZ C;  4DD0 A;  2H5Z A;  2DQA A;  1HSW A;  4ETE A;  1CJ7 A;  4TX7 A;  1LMT A;  4H9I A;  3QE8 A;  1BQL Y;  1JIS A;  1LZE A;  1IP2 A;  2DQE Y;  1D9U A;  2XJW A;  4CJ2 A;  5KXT A;  1VDP A;  4DDB A;  1GE0 A;  3RU5 A;  1GBZ A;  5HLL A;  3CT1 A;  2YBI A;  4WM3 A;  2MEH A;  1IWV A;  2CGI A;  1CJ9 A;  4H92 A;  1NQI A;  3KAM A;  1XGP C;  3LYM A;  1REZ A;  2ZWB A;  4KXI A;  1B7S A;  5I5Q A;  2MED A;  5LVI A;  4I8S A;  3B0I A;  2C8P A;  2W1Y A;  5DLA A;  1RJC B;  2GV0 A;  3EBA B;  4TSB A;  1LSN A;  1JJ1 A;  5LVJ A;  1RCM A;  3A91 A;  2Z19 A;  3ZVQ B;  5L9J A;  1SLY A;  4M6D A;  1LMN A;  4KPM A;  1GE4 A;  4H9H A;  4GCF A;  2FBB A;  1IWY A;  4N5R A;  4Z46 A;  1FLQ A;  4G4C A;  1N4F A;  1XGU C;  2YBJ A;  3AGG G;  4RLN A;  4H9C A;  3OK0 A;  4U3X B;  1J1X Y;  5LVG A;  1DXJ A;  1JKB A;  194L A;  1LZG A;  5B59 A;  4N1C C;  3IWR A;  1REX A;  4A7D A;  5KXO A;  1GB0 A; 
#chains in the Genus database with same CATH topology
 5F14 A;  3IJU A;  4P16 A;  3V2Y A;  1GF4 A;  1OUI A;  2G3Q A;  3KS4 A;  3FE0 A;  4B08 A;  4DR4 M;  2N35 A;  1G59 A;  2R65 A;  1R4G A;  1XNQ M;  1PJI A;  5F81 A;  4AKH A;  231L A;  1QS5 A;  1L21 A;  1IN8 A;  3SAU A;  1J09 A;  1GJS A;  181L A;  7LYZ A;  145L A;  3KS8 A;  1LZ5 A;  5H37 D;  4D80 A;  1L77 A;  3SBJ A;  3FKE A;  3CT0 A;  4HTQ A;  1WGL A;  1L1T A;  1C43 A;  1GDX A;  4LZM A;  1L16 A;  5F9X A;  4GC5 A;  3UK6 A;  4GN5 C;  1KXY A;  3WH1 A;  2L4F A;  2KRK A;  3AJI B;  2UUB M;  1L08 A;  2DQC Y;  4A3V B;  1LI2 A;  1L89 A;  1IXZ A;  3GRU A;  4I7Q A;  2HAK A;  5BPV A;  1GFR A;  2K9D A;  4G4H A;  2RBS A;  5ITY A;  1CU2 A;  253L A;  1L40 A;  2XTH A;  3E4R A;  1LGW A;  4L41 A;  2HKJ A;  3F8V A;  4IBJ A;  1LPY A;  2YQZ A;  3DN4 A;  184L A;  2I26 L;  1LKS A;  214L A;  4EOF A;  186L A;  1G06 A;  2KRU A;  5LVK A;  2KHH A;  2X8A A;  1LSF A;  4II8 A;  4JV5 M;  2QBY A;  1C6A A;  1L83 A;  3NYA A;  241L A;  4ANR A;  1L55 A;  1NHW C;  4MGH A;  1C6Q A;  1GEZ A;  4S0W A;  2I7P A;  1J5E M;  1GB6 A;  1UM8 A;  1UFZ A;  1L8Q A;  3AJN A;  1DYG A;  3D8L A;  2A7D A;  5KQ8 A;  4FWH A;  3A98 B;  5EXT A;  3OE6 A;  1NWG A;  2JY7 A;  3G3A B;  4NSI A;  1L42 A;  1PZY A;  5K7O A;  1X37 A;  2DWN A;  1BVX A;  2GQF A;  1ZV5 L;  5LAF A;  4RF1 A;  2RBN A;  1EL1 A;  5HMV A;  1TH4 A;  1WR1 B;  3WPL A;  2RBO A;  1I56 A;  1EQ5 A;  4N9R A;  154L A;  3I4V A;  1A4V A;  3B89 A;  4WM5 A;  1OUA A;  4LJA A;  1L60 A;  1QAN A;  2YBL A;  1CV1 A;  3GLI B;  1NHE A;  2B7X A;  4H9F A;  1LLH A;  2DBT A;  1HEO A;  4B7F A;  1B7N A;  5DL9 A;  4MR1 A;  3LCV B;  2W1L A;  3EIH A;  1C6M A;  3CB7 A;  3IEC A;  5KXX A;  1R2Z A;  2Y0Q A;  1SSY A;  3GLG E;  2ZBK B;  1KW7 A;  3SYL A;  4X65 M;  1I94 M;  3SB6 A;  2HEC A;  1OIZ A;  2Z8Y M;  3K3T A;  4YF2 A;  1OUD A;  2A5Y B;  5APD A;  4ARM B;  2MJ5 B;  3CSQ A;  1LSG A;  3J4G A;  1CNS A;  4LDO A;  1ZVY B;  4DAJ A;  1GPQ C;  2CWI A;  2HWJ A;  4YX7 C;  1DKK A;  2ZTD A;  255L A;  1IBL M;  2DQI Y;  1GEV A;  1LJH A;  1IX0 A;  4PJZ A;  1JTN A;  234L A;  1LWG A;  3T38 A;  5KPR A;  1UUZ C;  5LVH A;  4DV3 M;  2ZYP A;  4BB9 A;  1QTC A;  2HUL A;  3WU8 A;  3KP0 E;  1LJE A;  1UIC A;  1CKG A;  5DYI A;  2LVA A;  4YOP A;  2C9O A;  3CSR A;  1B5W A;  4B4E A;  5KXM A;  4G6Z A;  251L A;  3FUX A;  4I81 A;  5KXP A;  1J1P Y;  2EIZ C;  2ZM6 M;  173L A;  5E9R A;  4IAT A;  3A6C Y;  158L A;  2YVB A;  3BXW A;  5APE A;  1B2K A;  1C6E A;  1XHB A;  1C66 A;  1LGU A;  4IBG A;  1BWH A;  2BJW A;  1LMP A;  4L4U A;  5B1F A;  1LSY A;  1G0M A;  1WQO A;  4B3T M;  4E97 A;  2DQJ Y;  4F1I A;  1ZQ9 A;  5LMN M;  1JJ0 A;  4ETB A;  4NHT A;  2CUU A;  3LYT A;  4NHP A;  1CU0 A;  3LN2 A;  3MGW A;  3GLG A;  5A3Z A;  3CT5 A;  1IR8 A;  3HDE A;  110L A;  3A67 Y;  4PJ2 C;  3QYE A;  1C6T A;  2RGH A;  4WL6 A;  3M6A A;  3WL2 A;  4YM8 A;  4JI1 M;  1YKZ X;  2LYM A;  2HHH M;  232L A;  4OWE A;  3QY4 A;  2H9K A;  3U6Q A;  3GQ3 A;  1PJQ A;  3SAV A;  1XEI A;  3LZT A;  1XGQ C;  4EKQ A;  2R44 A;  3T6U A;  5FLX S;  4NWH A;  4ZEE A;  4DV1 M;  4KO8 A;  4AQY M;  1L1Z A;  1G0Q A;  2J5Y A;  2VDB B;  4NHQ A;  4ARP A;  1HEW A;  4IBD A;  1XJT A;  1HFX A;  167L A;  3EO5 A;  3WUM A;  4LJ5 A;  5KXL A;  1LV7 A;  4LRS A;  1GB7 A;  3GUK A;  1L18 A;  2ZIL A;  1DPW A;  1L46 A;  1LMO A;  4BAF A;  4B3S M;  4GLA A;  1LMQ A;  3LHM A;  4LFP A;  1HEL A;  2QB0 B;  4NXN M;  4XJB A;  3MMP A;  1NVM A;  4FW9 A;  1WTN A;  153L A;  3DN2 A;  3U61 B;  4H94 A;  2V6Z M;  4TWS A;  3GLH B;  3C8R A;  3IJV A;  3GXK A;  3FUW A;  1PQJ A;  4LF5 M;  2LHC A;  5APC A;  2DAI A;  4OVZ B;  2BQI A;  3A92 A;  1OP9 B;  211L A;  198L A;  2LVN C;  128L A;  1LYO A;  1G7M C;  1LYD A;  2R46 A;  4TTD A;  2XSZ D;  4MGZ E;  1LYJ A;  3FE3 A;  1I6S A;  3UON A;  3ZVQ A;  1CX6 A;  3RZ4 A;  5IHG A;  1XXH B;  2Q9D A;  3HJQ A;  4TUN A;  1L99 A;  4I7N A;  3D4S A;  2BWE A;  1HNZ M;  1INU A;  236L A;  2BQJ A;  3NY9 A;  3W6D A;  3E3D A;  1VG5 A;  4KT3 A;  3KXE C;  4LG2 A;  1L54 A;  1C63 A;  2MEI A;  3CF6 E;  4DQJ A;  2DQH Y;  4ML7 A;  1IP7 A;  2IFF Y;  1L29 A;  3KFU G;  3AZ7 A;  226L A;  2UUA M;  3HU8 A;  1Z5A A;  3W67 A;  215L A;  3W6C A;  2VQE M;  2FS1 A;  2BQN A;  4LJ8 A;  2BPU A;  2XSZ A;  5T3F A;  4DR7 M;  1P3N A;  3V2W A;  3WHL A;  1LZ1 A;  1G0P A;  1LAA A;  133L A;  2D4J A;  168L A;  1LJG A;  1W5T A;  1LZD A;  157L A;  1OUH A;  3RNX A;  4M9S A;  1OUF A;  1DO0 A;  190L A;  4QHS A;  1GB5 A;  3K9O A;  1C6H A;  4E3U A;  4H8X A;  1OFI A;  1CU3 A;  2H5X A;  4KHP M;  2L6O A;  2WSF F;  2LVO C;  4IJE A;  3HUA A;  4GHA A;  1I20 A;  1HNX M;  1LMA A;  2XEP A;  4JI3 M;  3GLH E;  5KXR A;  4F2L A;  4HL4 A;  2L78 A;  1JR3 E;  2ANX A;  3C8Q A;  1DO2 A;  1ALC A;  175L A;  1H87 A;  5FSW A;  205L A;  4LT1 A;  4B49 A;  3WHK A;  191L A;  1AM7 A;  2EQL A;  4GCB A;  3HU3 A;  3VKG A;  4Z41 A;  1LYZ A;  1NNU C;  3FI5 A;  3D3D A;  1L48 A;  1HNL A;  4DD2 A;  4WLY A;  1OFH A;  1XFP L;  1AT6 A;  5KXY A;  4LZJ A;  4WM1 A;  246L A;  5E26 A;  1LJJ A;  1QT5 A;  4L15 A;  1T8A A;  3SP3 A;  2NTH A;  1L01 A;  1GL7 A;  3KVW A;  4G49 A;  4AQN A;  1R5L A;  1GVN A;  2QAR C;  2D7H A;  1L87 A;  3U6S A;  1RE2 A;  2OO9 A;  3J7B A;  4HV2 A;  1GFE A;  2GNO A;  2QZ4 A;  1IIZ A;  1L98 A;  1OV7 A;  2XFT A;  2LZT A;  1JQJ C;  1LZT A;  4GCD A;  1L26 A;  1H6M A;  4QNR A;  1GB3 A;  1LHM A;  220L A;  2HEF A;  3HTB A;  192L A;  1C6K A;  207L A;  3TMV A;  5C6I A;  2E5L M;  2R4E A;  1C6B A;  2ZAN A;  3SB7 A;  4LRT A;  3TXD A;  3T1H M;  1T8F A;  4HJZ A;  1S3S A;  2LYZ A;  3KP1 E;  3GLH A;  2N5Z A;  1JR3 A;  3AV0 A;  1NNJ A;  1L52 A;  1UC0 A;  1IBM M;  1CKD A;  1N75 A;  4J0L A;  5LXW A;  1SX7 A;  3G3X A;  5EJC A;  2D4K A;  3C9P A;  2BQG A;  1HHL A;  3AOG A;  1T8G A;  3VLF B;  2R62 A;  1NBZ C;  2H5Z A;  5FTL A;  3TWM A;  1IM2 A;  3PXG A;  249L A;  1V92 A;  2R45 A;  1NHB A;  1OYU A;  3QE8 A;  4DR2 M;  5HLL A;  3CT1 A;  3PBL A;  1CJ9 A;  1Q02 A;  3ZC7 B;  1NQI A;  1REZ A;  139L A;  3V76 A;  1B7S A;  2MED A;  5LVI A;  5DLA A;  1P2R A;  2W1Y A;  1JJ1 A;  1P36 A;  1CV0 A;  2ZAM A;  1SLY A;  1Y8G A;  1WHC A;  4H9H A;  4GCF A;  4YXC A;  3QAU A;  3FA0 A;  4Z46 A;  1FLQ A;  4G4N A;  3E9S A;  1C6C A;  2LC9 A;  4RLN A;  1JKB A;  194L A;  4XGI A;  213L A;  3HT6 A;  3SC3 A;  4N1C C;  4A7D A;  2Z18 A;  4NEB A;  5B1G A;  1LJK A;  2CHG A;  1LSP A;  1IY3 A;  1CV3 A;  4DQ7 A;  1C67 A;  3HTF A;  1NDM C;  2D91 A;  4GEW A;  3GXR A;  1REM A;  1J7K A;  3L27 A;  4NGJ A;  1FLW A;  2M60 A;  1ZUR A;  5KPZ A;  4HTK A;  5D5F A;  1DV0 A;  3NBI A;  5EP2 A;  3PDS A;  1YIL A;  4DDA A;  4RW2 A;  3HX3 A;  1SXJ B;  244L A;  1D3J A;  6LYZ A;  3LQR A;  4NG8 A;  2X49 A;  3FUV A;  3JR4 A;  1LJI A;  5B07 A;  2EO2 A;  4Y28 F;  4CHX A;  1LZA A;  1V33 A;  3GUL A;  4FWG A;  3RUN A;  5EP3 A;  1P2C C;  1L95 A;  3TWL A;  4XJD A;  4LFC M;  1CV4 A;  4HPI A;  3KSX A;  2C98 A;  108L A;  2Z6B A;  2BQF A;  2CHV A;  5I54 A;  5I4W A;  4NGO A;  1A2Y C;  4I7O A;  1WXQ A;  1QAM A;  4X3B A;  3TL4 X;  3HBH A;  5LIO A;  1KIP C;  1D0K A;  1KS3 A;  172L A;  2HUB A;  1LJF A;  2HCB A;  1BB4 A;  1JUG A;  2RB2 X;  1L82 A;  4M9Z A;  1L2C A;  1L41 A;  4H8Z A;  2MR9 A;  2YFQ A;  2G4N A;  4IAP A;  2FYD A;  3SAR A;  1L93 A;  2VII A;  5L3H A;  2WAR A;  2RGO A;  4LJ4 A;  2BQH A;  4I7R A;  3L25 A;  1LCN A;  1AIP C;  1Z5C A;  3A90 A;  1NMM A;  2RB1 X;  177L A;  1NDG C;  1FBI X;  2FFJ A;  1JEF A;  1QSW A;  3G3V A;  1GFK A;  1HT1 E;  3LZM A;  2K0B X;  3T6P A;  1QTB A;  2HU3 A;  2DQG Y;  4GKJ M;  8LYZ A;  1TR8 A;  2KNZ A;  2DAM A;  1LKR A;  4WO6 A;  4I8O A;  2WSC F;  2LZM A;  1QS9 A;  4LYC A;  3B7Z A;  2IHL A;  1WVV A;  4FCW A;  4J1A A;  1YAP A;  144L A;  3C7Z A;  1LZ8 A;  3SAT A;  4NGI A;  4ZPX A;  1HEM A;  1L75 A;  2R6F A;  159L A;  2EKS C;  1DGF A;  4M4O A;  2CDS A;  1GF0 A;  3K2R A;  3HJS A;  1OUG A;  1PJJ A;  1G3I A;  1G0G A;  1LI3 A;  5B06 A;  2BWB A;  4B1A A;  1HEQ A;  2OOB A;  1HEN A;  2CUZ A;  2JWS A;  4QY9 A;  2HUK A;  5LA5 A;  4TSC A;  3FTC A;  1N36 M;  1G1V A;  1T97 A;  1EE8 A;  3C81 A;  3CDR A;  1YKX X;  4XYY A;  4D81 A;  1XSF A;  3WUL A;  1K3X A;  5IWA M;  2Z4R A;  212L A;  2BQM A;  3HUK A;  182L A;  3HT9 A;  4DD9 A;  4EPF A;  3VDU A;  1PQD A;  3TXI A;  1I1Z A;  4IIW A;  3UGJ A;  2Q2E B;  3BKH A;  4YXA C;  4G4R A;  1XGR C;  235L A;  4B0D A;  3DZD A;  3HUQ A;  4XJI A;  1C64 A;  1QTH A;  1CU5 A;  1L59 A;  4DD1 A;  2QQ8 A;  5A2Q S;  1LZN A;  4B7H A;  2EKF A;  169L A;  2X0A A;  174L A;  1B7Q A;  3DFZ A;  1L27 A;  1IOR A;  4DUZ M;  2Z3X A;  1EIJ A;  1L34 A;  4LDE A;  1QT6 A;  4N0J A;  1JQU A;  1OV5 A;  132L A;  1L72 A;  2OQ4 A;  1LHK A;  1WVU A;  2KXE A;  1QSQ A;  1T3T A;  3OE8 A;  3HDF A;  2JY5 A;  2G4Q A;  2L09 A;  1C1K A;  2DVW B;  3CTW B;  3HU2 A;  1TDZ A;  1ZMV A;  2CWB A;  2B73 A;  3GUO A;  2MEC A;  1L43 A;  4NL4 H;  2DHY A;  1DI5 A;  1GF5 A;  4I7L A;  2XBR A;  4II7 A;  4DYG A;  5FST A;  3GRV A;  2RAZ X;  1L80 A;  3W6B A;  4JN6 A;  1LYS A;  3P4Z A;  3A34 A;  6LYT A;  5L8R F;  5F9U A;  3IG5 A;  3P68 A;  1W6Z A;  5KXW A;  149L A;  1DYD A;  1LZB A;  3WMK A;  4DV5 M;  4GIP A;  4DQ5 A;  4OU7 A;  1IFY A;  1GF7 A;  1QVR A;  160L A;  4BS7 A;  3CDV A;  134L A;  1D9W A;  1L03 A;  2XZU A;  4YEN A;  1JPO A;  1L05 A;  1L71 A;  1AZF A;  2XGN A;  1BVK C;  1B7P A;  1QUD A;  1QZE A;  1XWI A;  238L A;  252L A;  3AW6 A;  4G4O A;  4XJF A;  5DN4 A;  2MEF A;  3UZU A;  3SBB C;  1YUB A;  4WL7 A;  2KDL A;  4WO9 A;  1P2L A;  3A94 A;  4LT0 A;  2CE7 A;  1WGN A;  1L49 A;  1FN5 A;  2XQO A;  4LZT A;  5KXN A;  4L6V 6;  109L A;  1DYF A;  2BQC A;  1G4A E;  1PRB A;  2JA2 A;  2HEA A;  2C9C A;  137L A;  3TXB A;  4CIS A;  5C6J A;  4RW1 A;  5LA8 A;  1SQ2 L;  4W58 A;  1T6O A;  4DWX A;  1OVK A;  1L09 A;  4IBB A;  3KOX E;  4LT3 A;  2LVP C;  1IWZ A;  4CHT B;  5EP1 A;  3AYQ A;  1F4I A;  3BOS A;  3WXU A;  3J80 S;  1QUT A;  4LYB A;  1SG9 A;  1B5V A;  1IVM A;  4LGY A;  3TPZ A;  240L A;  1GD6 A;  1IXS B;  4LF8 M;  4B3R M;  2EJS A;  1Z6T A;  4XK8 F;  4REZ A;  2ERC A;  163L A;  1LMC A;  1SXJ C;  2KNA A;  1R2Y A;  1LZS A;  4J7V A;  1BB3 A;  5J7C A;  1IP5 A;  3T15 A;  178L A;  3OTO M;  1D2N A;  1GFH A;  2B5Z A;  2C99 A;  3CSZ A;  4G4Q A;  1L47 A;  2L4E A;  4R3D A;  1CUP A;  2B3T A;  1R7R A;  3K1J A;  5I53 A;  3F9L A;  3AZ5 A;  4ETD A;  4J1B A;  2F5N A;  3F92 A;  3ATN A;  4IBK A;  3WYH A;  3NBX X;  4ETC A;  1JTO L;  3W6F A;  4AKG A;  1QAQ A;  3DMX A;  1G1W A;  3U60 B;  4NGZ A;  3HFM Y;  1IY0 A;  1HT2 E;  1JTP L;  2Y21 A;  2VF8 A;  4LY6 A;  1IWT A;  187L A;  1D6Q A;  3GRY A;  3CGW A;  1BWJ A;  1L44 A;  1VDD A;  3U6P A;  4GRV A;  1L97 A;  3AGH A;  1TDY A;  4LYT A;  4I7S A;  4AW4 A;  4W54 A;  2W1X A;  4EKP A;  1PS5 A;  3UMM A;  3GLI E;  3P65 A;  1P3Q Q;  3DA1 A;  3I51 A;  4MGK E;  4HP0 A;  1F6R A;  4W56 A;  2LCB A;  2DNA A;  259L A;  4NRV A;  5I14 A;  1LHH A;  4LT2 A;  5ITQ A;  2VB1 A;  2D4I A;  1L2D A;  4I7M A;  4ITQ A;  1C60 A;  1B0D A;  1L10 A;  1QTV A;  1SWZ A;  4JYA M;  1QDT A;  193L A;  3FTF A;  1XEP A;  1YAM A;  1LHI A;  1YKY X;  248L A;  1LSM A;  3U6L A;  1TH3 A;  1OUB A;  2OU0 X;  1HMK A;  2LTU A;  2KW0 A;  1V34 A;  1NHG C;  1L63 A;  1DYC A;  1JSE A;  2BQL A;  1IWU A;  2O5R A;  1VEG A;  3JR6 A;  3LVV A;  1GXV 2;  2ZNX Y;  3DN3 A;  4DC4 A;  2LWX A;  4CFP A;  1B5Z A;  1NV9 A;  4RKU F;  1UIB A;  1QUS A;  1TBY A;  1QQW A;  3WXT A;  1LSE A;  2JXN A;  1PJT A;  1L79 A;  1KXW A;  3TE6 A;  4ARQ B;  4GN3 A;  3PNV A;  3SHG B;  162L A;  1EFU B;  4MGI E;  2HED A;  4DD7 A;  5M1Y A;  4DV2 M;  239L A;  3WUA A;  1GF9 A;  4LYO A;  1E9S A;  3B7Q A;  1TF0 B;  2OTZ X;  3LZ2 A;  4LJ9 A;  2V1C A;  4NGL A;  5KY1 A;  3LYO A;  4HJY A;  5ILC A;  1LJ3 A;  1PQI A;  3P64 A;  1L53 A;  1ZAE A;  3ODU A;  4B3M M;  1QTD A;  2XF3 A;  1VQ1 A;  3SFZ A;  2FH0 A;  216L A;  1EQE A;  1QTZ A;  1C62 A;  3GLI A;  1L45 A;  4IBI A;  4OX9 M;  4AGA A;  2JY8 A;  4I5S A;  3P66 A;  2DWZ B;  233L A;  4H9A A;  3A42 A;  3T1Y M;  2HEB A;  4W59 A;  1G7I C;  126L A;  4HV1 A;  1L17 A;  3FYC A;  3AZ6 A;  4NIJ A;  4ZIX A;  3GPX A;  3C3D A;  4JI5 M;  3FRI A;  1CJ7 A;  4TX7 A;  3H4J A;  1IXS A;  1LMT A;  3D8B A;  2XJW A;  1LZE A;  5KXT A;  4M9X A;  4ARM A;  4Z6Y A;  3RU5 A;  1NJF A;  2MEH A;  2VQF M;  1IWV A;  4I4L A;  4L8R C;  2OEA X;  2ZWB A;  5JI3 E;  3B0I A;  2C8P A;  2R0I A;  3RGP A;  2GV0 A;  3EBA B;  2LVQ D;  4LZZ A;  4TSB A;  2Y0T A;  1RCM A;  4HLQ A;  4KPM A;  2FBB A;  4W53 A;  2KEB A;  4G4C A;  1N4F A;  1L00 A;  147L A;  1L0K A;  3AGG G;  5IRE B;  3CDT A;  3OK0 A;  2C96 A;  4FCV A;  1L92 A;  5B59 A;  1L02 A;  3DN1 A;  1CV5 A;  3Q8X A;  3SAW A;  1OVH A;  4WMG A;  3WVY A;  4FVM A;  1QUH A;  1GO5 A;  4RLM A;  142L A;  5FCP A;  2DZO B;  3B0O A;  1GAB A;  4S12 A;  3AB6 A;  2Q9E A;  9LYZ A;  3VDP A;  1L31 A;  1B7L A;  1GFV A;  4IBE A;  5JI2 E;  1TDH A;  119L A;  4DR1 M;  3U5Z B;  4B4J A;  1MEL L;  1A5T A;  3RZE A;  1C10 A;  2LNH C;  1PQO A;  3W6A A;  4NXM M;  3GO8 A;  3FTD A;  4B4I A;  4OWH A;  3QWL A;  1FDL Y;  4LFX A;  2Q0M X;  4OOT A;  4Z8X A;  3J2P B;  3FTE A;  1DI3 A;  1GAY A;  1VEK A;  3WUN A;  3RE8 A;  2CV2 A;  165L A;  2CEA A;  1LZ9 A;  1C6N A;  1LTM A;  1IP4 A;  1XXH E;  1Z59 A;  140L A;  2YBH A;  4IJF A;  1GDW A;  2FYC A;  3HHW A;  1L36 A;  3C83 A;  4XN6 A;  3LCU A;  4BBA A;  1AT5 A;  4W57 A;  3L28 A;  4GMQ A;  4G4B A;  1DGG A;  4QEQ A;  4DV7 M;  1DI4 A;  1L23 A;  4JI0 M;  2BQO A;  4WG1 A;  1L65 A;  4DD3 A;  2XLJ A;  1YL0 X;  1L84 A;  1JR3 D;  3GLF B;  2IGC A;  3C3E A;  4G3O A;  1P64 A;  1C6D A;  4NGK A;  2VF7 A;  3A6B Y;  4DT3 A;  1L57 A;  1D2W A;  4LJ6 A;  2F2Q A;  1DKJ A;  3FI7 A;  4UWU A;  2Z39 A;  4MB7 A;  1L2B A;  1C45 A;  1E32 A;  1HSX A;  1G7H C;  1ZYT A;  199L A;  4MCK A;  2RRU A;  2OU9 A;  2QPA A;  5KXZ A;  4DUY M;  227L A;  1NY5 A;  4W51 A;  2AHM A;  3U61 A;  1L06 A;  1JHL A;  1QZM A;  5BR8 M;  3HBE X;  1QUG A;  2LHM A;  1C65 A;  4OVZ A;  1XNR M;  3GPP A;  3L64 A;  2HEE A;  150L A;  1RU3 A;  1XB2 B;  1PM5 A;  1OUC A;  1C6P A;  1CJ8 A;  3HT7 A;  3KOW E;  2ZAO A;  3AGI A;  1OQM A;  2J7N A;  2Y20 A;  223L A;  3L26 A;  3DN0 A;  1E94 E;  1XXH A;  1QAO A;  1YAN A;  2ZQ4 A;  1LYH A;  2DAK A;  141L A;  4IAS A;  1IWX A;  2BAA A;  250L A;  1WQM A;  4QGZ A;  1L32 A;  3DOA A;  3GP1 A;  1EPY A;  4NGV A;  2W82 A;  2NTG A;  2DI0 A;  3EMS A;  1L58 A;  1P7S A;  3B74 A;  3CF2 A;  1NSF A;  1UIH A;  2EUC A;  1L85 A;  3J6K A;  4IBF A;  1GBW A;  4IJ4 A;  4CJ6 A;  5FHW A;  2MH8 A;  1LJN A;  1UIE A;  1CUK A;  138L A;  4NSH A;  4H93 A;  1L66 A;  1GKI A;  3FD9 A;  2LHG A;  5EQT A;  1LZC A;  1ZWN A;  3SB9 A;  102L A;  2R18 A;  3R8F A;  1L94 A;  3LW5 F;  1HF4 A;  1QIO A;  1KFV A;  5LMU M;  1L28 A;  1V7T A;  2LH0 A;  3U6O A;  2MEB A;  1NF5 A;  1NY6 A;  4EJ4 A;  4QNM A;  4PD2 A;  1TAY A;  2KZS A;  2BQD A;  2OOA A;  3VWO A;  1JTT L;  122L A;  2O7A A;  4H9B A;  1ORY B;  3U5Z A;  5F3W A;  1KYI A;  2BJV A;  3K9P A;  1OAO C;  4QDN A;  201L A;  1IN5 A;  2K6B A;  1C46 A;  4I7J A;  4XBO A;  3GQ5 A;  3HH5 A;  2Z4S A;  2PC2 A;  2B70 A;  2AUB A;  218L A;  1IR9 A;  3HT8 A;  3G3W A;  1UIF A;  1B6I A;  2QP9 X;  4EKS A;  2F5O A;  1OUJ A;  1NBY C;  1D3M A;  4HJV A;  1GE2 A;  1L73 A;  1GL6 A;  3HHY A;  3SHF A;  2G5G X;  5DFL A;  3MHV C;  2ZTC A;  3IHP A;  2JZ1 A;  5C18 A;  4P2E A;  1L0J A;  4Z3M A;  2JZ0 A;  4LFA M;  3UJN A;  1P56 A;  1KIR C;  4KLN A;  1L30 A;  1VFB C;  1KSF X;  2C5R A;  1GE1 A;  2A7F A;  2F5S A;  1OIP A;  4NSG A;  1NO1 A;  1ZMY L;  2YNM D;  1QTE A;  2MEE A;  1N32 M;  1CJ6 A;  1HML A;  1L88 A;  2DEN A;  5ILF A;  1XEJ A;  4MH0 E;  2BLX A;  152L A;  5JEN B;  1K28 A;  1QQY A;  4UWN A;  1QTK A;  3WPK A;  5GKN A;  3HGI A;  1BB6 A;  4JI8 M;  1IR7 A;  4LFB M;  1JJ3 A;  120L A;  257L A;  4FDY A;  1T6V L;  1GLN A;  3TWK A;  1IC7 Y;  5HQ1 A;  1NKH A;  2QBY B;  1UCO A;  1OVJ A;  4LF9 M;  1GWD A;  1HC0 A;  1IXR C;  2MGW A;  5LYZ A;  206L A;  4GHL A;  4CIZ A;  7CAT A;  1IOS A;  4PPO A;  4MGY E;  2F32 A;  1SXJ E;  2LBC A;  210L A;  8CAT A;  1K3W A;  4GH9 A;  111L A;  1L07 A;  1LSD A;  3TMU A;  1PQK A;  3I04 M;  4GN4 A;  4W94 A;  1SSW A;  2BQB A;  2BQK A;  7LZM A;  3HTD A;  1D6P A;  3RT5 X;  3FUU A;  4FJR A;  1IP1 A;  1LGX A;  2RH1 A;  3RW8 A;  2W1M A;  3WU7 A;  2KZU A;  4ET8 A;  2YBM A;  3D9A C;  3A3Q A;  3C82 A;  1P46 A;  4C5F A;  1XC8 A;  1YQV Y;  4WOA A;  1QT3 A;  2I7N A;  1FNN A;  1WTM A;  3JAM S;  5KO3 A;  2J7O A;  3W6E A;  4NGY A;  4NSJ A;  4DJH A;  3HH6 A;  1CU6 A;  1SXJ D;  3AZ4 A;  3C8S A;  3HWL A;  229L A;  5D5C A;  1KXX A;  4JI4 M;  3HJ8 A;  2M5Z A;  2JNH A;  1LHL A;  3A96 A;  3WW6 A;  1MU5 A;  3KOY E;  4IBC A;  2NQ8 C;  1L61 A;  2UXC M;  2D6B A;  4H90 A;  1YL1 X;  3TXG A;  1MLC E;  1TH2 A;  3VK8 A;  1OTR A;  4MM3 B;  4UN2 B;  1K82 A;  1KY0 A;  1P5C A;  2UUC M;  2ZIJ A;  1AKI A;  3C7W A;  4HSF A;  5L3I A;  1WQQ A;  1G07 A;  1SXJ A;  4NRW A;  1KW5 A;  3LVW A;  1CKH A;  3EIE A;  5EP4 A;  2RSC A;  4RDS A;  1NV8 A;  4H91 A;  4GBR B;  3I4Y A;  3W0L B;  3M3U A;  1DQJ C;  2EKK A;  1MX0 A;  5FTN A;  2ZIK A;  2OU8 A;  5II3 A;  1CVK A;  5KPT A;  1ZVH L;  1IEE A;  4ZPU A;  164L A;  1GF3 A;  2B6Y A;  1D0L A;  1L91 A;  2D7E A;  2OPF A;  2F5P A;  1IOC A;  2UXB M;  3HHZ A;  4LDL A;  2K47 A;  1FKV A;  1GB2 A;  2DWL A;  1QSB A;  103L A;  2YDG A;  4GCE A;  4JXJ A;  1DPX A;  112L A;  1WJ7 A;  3A3R X;  3AW7 A;  155L A;  1F6S A;  1WIV A;  4DR6 M;  4L78 A;  1GFG A;  4OO9 A;  1IP6 A;  5E6J A;  4LCB A;  1C69 A;  4EXM A;  3GLG B;  5ITT A;  3ZCB B;  2LZ2 A;  1B7R A;  4EMN A;  5HNL A;  2DAE A;  1HFY A;  2MEG A;  4L16 A;  3E46 A;  1C6J A;  2FBD A;  4LGM A;  4OWA A;  1L62 A;  1SWY A;  5DN5 A;  3ILK A;  1YAQ A;  1HER A;  2FNA A;  4M0W A;  3LYZ A;  1G0J A;  1R6B X;  3J27 B;  3JR5 A;  2DXI A;  2V1U A;  1Z5B A;  3GQ4 A;  1D0M A;  1G7J C;  1H6U A;  4MST A;  4YEO A;  1HNW M;  1XMQ M;  2ZYC A;  1RFP A;  2RBR A;  5C6L A;  5IT9 S;  3CDO A;  1JKD A;  4NC6 A;  1TLA A;  3PFI A;  1L81 A;  2H9J A;  4OWC A;  2Z12 A;  3TMX A;  3TXK A;  1WQN A;  2L7H A;  1G8P A;  1TCY A;  1PQM A;  3KW6 A;  3B7N A;  3IG8 A;  3C80 A;  4X66 M;  146L A;  1P37 A;  1VDS A;  3SB5 A;  4HEO A;  4I7P A;  4WLT A;  2FE8 A;  1XJU A;  3SBA A;  4W52 A;  2HU1 A;  1YE9 A;  1LYF A;  4NGW A;  1LYY A;  3VW7 A;  4I7K A;  3GPU A;  4DD0 A;  4EPI A;  1CX7 A;  1HSW A;  2HUM A;  1L68 A;  1N33 M;  3GRR A;  1IP2 A;  1D9U A;  243L A;  2YR0 A;  1L11 A;  4DDB A;  1PJS A;  2DHR A;  3OE0 A;  4H92 A;  1XGP C;  6LZM A;  4KXI A;  1CV6 A;  4I8S A;  1DGH B;  1IBK M;  261L A;  1LSN A;  1SX2 A;  5LVJ A;  1D2Y A;  3A91 A;  3ZVQ B;  2CHQ A;  3FYD A;  4YHH M;  189L A;  2O01 F;  118L A;  1GE4 A;  1IWY A;  3LMM A;  4X64 M;  2B72 A;  2YBJ A;  4H9C A;  5LVG A;  1LZG A;  2QHO B;  1L13 A;  3IWR A;  3C58 A;  4K0K M;  3NWL A;  1GB0 A;  3VKH A;  3WU9 A;  1WTH A;  1C6L A;  1OQY A;  183L A;  1GHL A;  4I7T A;  1L86 A;  2OE9 X;  1NJG A;  219L A;  3RGS A;  5LIN A;  3CQL A;  3A93 A;  1YIK A;  4DV0 M;  1V7S A;  2P5T A;  3SMS A;  1YRO A;  242L A;  4PT5 A;  2O4W A;  2YSS C;  2F4G A;  3TMW A;  4ET9 A;  4DV6 M;  2O25 A;  4NOO B;  4WM4 A;  2RBQ A;  1L90 A;  4WW0 A;  3FRH A;  2B6X A;  2CFO A;  2Z38 A;  1GFU A;  2JY6 B;  2OE7 X;  4HPE A;  1VAT A;  224L A;  1QT4 A;  5KQD A;  2Z2F A;  2QSF X;  3HTG A;  3HWS A;  208L A;  2EA0 A;  1GE3 A;  1L33 A;  1ZMU A;  3ZEK A;  4WM6 A;  1EQ4 A;  1L35 A;  5EXS A;  222L A;  143L A;  3WVX A;  3DN8 A;  3SMP A;  1MN3 A;  1L04 A;  113L A;  3N9C A;  3KOZ E;  3EML A;  4ARJ A;  4GCC A;  3N9E A;  3NY8 A;  3TXF A;  5EXP A;  170L A;  3HU1 A;  3A45 A;  1F10 A;  2JP7 A;  1OJL A;  4QOZ C;  1GXX A;  3I01 M;  1W08 A;  2Z37 A;  3M18 B;  1I4W A;  2DZL A;  1VED A;  3AFH A;  1BB7 A;  3GPY A;  3KSJ A;  1LI6 A;  1VDT A;  1HQC A;  4NSR A;  1UA6 Y;  1LHJ A;  4N1E I;  2D7G A;  2XZF A;  2L2D A;  129L A;  5F16 A;  1C7P A;  1GF8 A;  2R4J A;  4LYZ A;  1L22 A;  4YEM A;  1QT8 A;  4CGY B;  4BAP A;  1L15 A;  1XMO M;  3K8Z A;  195L A;  1B5X A;  1BHZ A;  1L37 A;  4NY5 A;  4XJG A;  4TUW A;  3H4M A;  1IC5 Y;  4N8Z A;  4DBG B;  2F30 A;  1L25 A;  4H1P A;  4ETA A;  1LYI A;  3TQS A;  221L A;  1IOT A;  2O79 A;  1G71 A;  3QAK A;  237L A;  1VEJ A;  125L A;  4WP2 A;  1L96 A;  2BQA A;  1KIQ C;  4HTN A;  4PRQ A;  5IZ7 D;  171L A;  4H9E A;  1REY A;  3WPJ A;  4DKL A;  1L19 A;  2APL A;  1N77 A;  4AKI A;  1IC4 Y;  3PNY A;  4QOS A;  4NHS A;  2YBN A;  3FUT A;  3U6D A;  3A46 A;  1HFZ A;  2RAY X;  1G7L C;  5HMJ A;  1L12 A;  2OTY X;  1L56 A;  1N78 A;  1LPI A;  1OKS A;  1DGH A;  2DZN B;  4DV4 M;  1L50 A;  1GF6 A;  4GKK M;  4NHI A;  1E9R A;  4XAD A;  4LGK A;  2LYO A;  2L7I A;  3T36 A;  3AKZ A;  4DDC A;  176L A;  1CKF A;  1QT7 A;  3B0K A;  4K5Y A;  1IQP A;  2QNJ A;  1LSA A;  4I0C A;  1KY1 A;  1L67 A;  3GUJ A;  1AUA A;  1GFJ A;  3U60 A;  2BQE A;  3M0E A;  256L A;  1FJG M;  1C6G A;  1LSB A;  148L E;  3VFD A;  1UAC Y;  1UBZ A;  5B05 A;  1OAI A;  3QNG A;  3SN6 R;  3MJ5 A;  161L A;  1IO5 A;  4QHT A;  3TXE A;  2DKL A;  104L A;  1C61 A;  1VAU A;  245L A;  3A8Z A;  2EPE A;  5HNC A;  1B7O A;  4X62 M;  2ZNW Y;  3TXH A;  3SYK A;  1Q3C A;  1CKC A;  5FEK A;  1XEK A;  3ZQJ A;  4GC9 A;  2G8L A;  127L A;  1L70 A;  2Y8P A;  3BKV A;  1TEW A;  1WQP A;  1Z55 A;  1HEP A;  2I25 L;  1B5U A;  1L64 A;  1LZR A;  3AOE A;  258L A;  2C8O A;  3HU9 A;  4D9Z A;  3ATO A;  4DR5 M;  2F4V M;  1D3N A;  1IOQ A;  1QSA A;  4WLD A;  1OWY A;  2A4T A;  1HJP A;  5IDD A;  4W55 A;  4OOO A;  4M0D A;  2UXD M;  3FAD A;  1MJG M;  5KKI A;  3A95 A;  4LF4 M;  4R6C A;  4C3W A;  3E21 A;  3B9P A;  2F4A A;  4AG5 A;  5ITR A;  2CJL A;  3QYB A;  1YAO A;  1LWK A;  3HZJ A;  5KXK A;  4WG7 A;  4ARQ A;  3L2A A;  107L A;  4BLC A;  1G0K A;  2JUJ A;  3LQQ A;  4RNA A;  4B7G A;  4PK0 A;  1IY4 A;  4NG1 A;  2CV1 A;  1L38 A;  1OUE A;  4WM2 A;  4KOD A;  4PGJ B;  3PVS A;  3U6M A;  1GBO A;  2RBP A;  2Z7J A;  3DMZ A;  3SAS A;  3EXD A;  1LZ6 A;  2BNK A;  1B5Y A;  1JKA A;  3HH4 A;  217L A;  196L A;  1GBX A;  4PDI A;  2MEA A;  5E4P A;  4LF6 M;  3OE9 A;  2ZQ3 A;  1UID A;  2ANV A;  1C68 A;  1CTW A;  1L51 A;  2I6Z A;  5LZM A;  4OW0 A;  3L29 A;  1JSF A;  4W96 A;  3C7Y A;  115L A;  4YY3 M;  1ZV1 A;  5EXX A;  1C08 C;  1PGY A;  1Q3B A;  1BB5 A;  1DGB A;  3MK6 A;  2XBS A;  2F5Q A;  4P17 A;  4NSO B;  5KXS A;  2HL7 A;  4NFV A;  228L A;  3TXJ A;  4FCT A;  166L A;  1XGT C;  1FLU A;  3G3B B;  5FTJ A;  4G9S A;  1E8L A;  4CGE A;  1FKQ A;  1IY2 A;  4CFO A;  4OWB A;  4XJH A;  1GBY A;  3F6Z A;  2DQD Y;  3HHX A;  1L74 A;  5LAG A;  1VDL A;  1LZ4 A;  4GLV A;  3AL0 C;  156L A;  5DYG A;  123L A;  3GLF E;  1L24 A;  2HTX A;  2BLY A;  1N34 M;  1GB9 A;  1T6H A;  1HQY E;  1JKC A;  1T3P A;  2NWD X;  3AOE C;  2KA6 B;  2OE4 X;  3HY5 A;  5A3E A;  3DNA A;  3HBD A;  4JI7 M;  1DYB A;  1JWR A;  1J1O Y;  3W0F A;  4Q7J A;  197L A;  2MRO B;  5I4Y A;  1L39 A;  1P6Y A;  1UIG A;  4PRU A;  2B6W A;  114L A;  3W3E A;  5AMY A;  4BAD A;  2QEN A;  4UWV A;  1Q39 A;  2LXE A;  1JIT A;  1GBS A;  1LYG A;  4OW1 A;  1QUO A;  2WZJ A;  1HR0 M;  4W5W A;  262L A;  2DWM A;  5DM9 A;  3WW5 A;  3J7A S;  3K92 A;  3RFW A;  2B74 A;  5ITU A;  1IWW A;  188L A;  4GIT A;  2Z2E A;  2X4A A;  4AXT A;  3SB8 A;  3Q8G A;  185L A;  2B6Z A;  3GUI A;  5FEL A;  1C6F A;  4PDG A;  3DMV A;  1WQR A;  230L A;  260L A;  1G41 A;  1TTE A;  5IEL A;  5EBH A;  1ZMW A;  1GB8 A;  4KL7 A;  2WSE F;  5FDJ A;  5LYM A;  247L A;  1IN6 A;  4WLX A;  5APF A;  1RI8 B;  3L2X A;  1G0L A;  1T43 A;  3B72 A;  1LSC A;  4LYM A;  1KNI A;  1UIA A;  4H8Y A;  1FLY A;  3GLF A;  5ITX E;  1IN7 A;  5KJ9 A;  1QYR A;  4AI6 A;  4FD2 A;  4FWD A;  5I4X A;  3ULR A;  1YLA A;  1DYE A;  3OJP A;  4PHI A;  5DNY A;  131L A;  4XEN A;  1IP3 A;  2CRU A;  1LOZ A;  3N9A A;  4AG6 A;  4EKR A;  3GUN A;  2B75 A;  1VDQ A;  1LYE A;  4R0F A;  4PCZ A;  4ARL A;  254L A;  4GRI A;  4ZFP A;  3BBZ A;  1DYA A;  1GFT A;  3VK7 A;  3KDS E;  1LJ4 A;  2FOI C;  1B7M A;  209L A;  2G4P A;  135L A;  3DN6 A;  1BWI A;  3W68 A;  2RKO A;  3GUP A;  130L A;  4NWE A;  1L76 A;  2F47 A;  2UU9 M;  3K2L A;  1LW9 A;  2DKV A;  2RB0 X;  1F0W A;  1QDR A;  1L14 A;  4Z98 A;  1OWZ A;  2XH9 A;  1C7Y A;  1BGI A;  3M7G A;  1L69 A;  2DAG A;  4LF7 M;  4RF0 A;  1B9O A;  1LSZ A;  4O34 A;  2CV0 A;  3U6C A;  3DKE X;  1BVS A;  1W5S A;  4JI6 M;  2F2N A;  3B6L A;  5FTK A;  5LYT A;  5FTM A;  1CUQ A;  5C1B A;  1JIY A;  4AZF A;  2DQF C;  1DZB X;  4WUR A;  151L A;  2XFS A;  1LZY A;  1GFA A;  4EIW A;  1O23 A;  1GAZ A;  5KKJ A;  3HKP A;  2CP8 A;  2DQA A;  200L A;  3GUM A;  1YSY A;  4ETE A;  5ITX A;  1JTM A;  1JB0 F;  4H9I A;  1BQL Y;  1JIS A;  2DQE Y;  4CJ2 A;  3THG A;  1VDP A;  2KNV A;  4R71 A;  1GE0 A;  1GBZ A;  2YBI A;  4WM3 A;  1C6I A;  2CGI A;  2B6T A;  1GJT A;  3KAM A;  3LYM A;  4KT0 F;  5I5Q A;  3ZH9 B;  3J81 S;  180L A;  3U6E A;  3HH3 A;  4R7G A;  3CF0 A;  1TGU A;  1RJC B;  225L A;  1IY1 A;  2QCU A;  4LJ7 A;  4JI2 M;  2Z19 A;  5L9J A;  4M6D A;  1IN4 A;  1LMN A;  3CDQ A;  1D3F A;  2H1R A;  4N5R A;  3R9X B;  1L20 A;  1XGU C;  4DR3 M;  4U3X B;  1J1X Y;  1DXJ A;  1REX A;  5KXO A;  4D82 A; 
#chains in the Genus database with same CATH homology
 5F14 A;  3IJU A;  3V2Y A;  1GF4 A;  1OUI A;  3FE0 A;  5F81 A;  231L A;  1QS5 A;  1L21 A;  181L A;  7LYZ A;  145L A;  1LZ5 A;  1L77 A;  3CT0 A;  4HTQ A;  1C43 A;  1GDX A;  4LZM A;  1L16 A;  5F9X A;  4GN5 C;  1KXY A;  3WH1 A;  1L08 A;  2DQC Y;  1LI2 A;  1L89 A;  4I7Q A;  1GFR A;  4G4H A;  2RBS A;  1CU2 A;  253L A;  1L40 A;  2XTH A;  1LGW A;  4L41 A;  3F8V A;  1LPY A;  3DN4 A;  184L A;  2I26 L;  1LKS A;  214L A;  4EOF A;  186L A;  1G06 A;  5LVK A;  1LSF A;  4II8 A;  1C6A A;  1L83 A;  3NYA A;  241L A;  4ANR A;  1L55 A;  1C6Q A;  1GEZ A;  4S0W A;  1GB6 A;  3AJN A;  1DYG A;  2A7D A;  3OE6 A;  1NWG A;  3G3A B;  4NSI A;  1L42 A;  1PZY A;  5K7O A;  1BVX A;  1ZV5 L;  5LAF A;  2RBN A;  1EL1 A;  5HMV A;  3WPL A;  2RBO A;  1I56 A;  1EQ5 A;  4N9R A;  154L A;  1A4V A;  4WM5 A;  1OUA A;  1L60 A;  2YBL A;  1CV1 A;  1NHE A;  2B7X A;  4H9F A;  1LLH A;  2DBT A;  1HEO A;  1B7N A;  5DL9 A;  4MR1 A;  2W1L A;  1C6M A;  3CB7 A;  5KXX A;  1SSY A;  1KW7 A;  3SB6 A;  2HEC A;  3K3T A;  4YF2 A;  1OUD A;  5APD A;  4ARM B;  3CSQ A;  1LSG A;  3J4G A;  1CNS A;  4LDO A;  1ZVY B;  4DAJ A;  1GPQ C;  2CWI A;  4YX7 C;  1DKK A;  255L A;  2DQI Y;  1GEV A;  1LJH A;  1IX0 A;  4PJZ A;  1JTN A;  234L A;  1LWG A;  1UUZ C;  5LVH A;  2ZYP A;  1QTC A;  2HUL A;  3WU8 A;  1LJE A;  1UIC A;  1CKG A;  4YOP A;  3CSR A;  1B5W A;  4B4E A;  5KXM A;  251L A;  5KXP A;  1J1P Y;  2EIZ C;  173L A;  5E9R A;  4IAT A;  3A6C Y;  158L A;  2YVB A;  5APE A;  1B2K A;  1C6E A;  1C66 A;  1LGU A;  1BWH A;  1LMP A;  5B1F A;  1LSY A;  1G0M A;  1WQO A;  4E97 A;  2DQJ Y;  1JJ0 A;  4ETB A;  4NHT A;  2CUU A;  3LYT A;  4NHP A;  1CU0 A;  3LN2 A;  3MGW A;  5A3Z A;  3CT5 A;  1IR8 A;  3HDE A;  110L A;  3A67 Y;  4PJ2 C;  1C6T A;  4WL6 A;  3WL2 A;  4YM8 A;  1YKZ X;  2LYM A;  232L A;  4OWE A;  3QY4 A;  2H9K A;  1XEI A;  3LZT A;  1XGQ C;  4EKQ A;  3T6U A;  4NWH A;  4ZEE A;  1G0Q A;  4NHQ A;  4ARP A;  1HEW A;  1XJT A;  1HFX A;  167L A;  3EO5 A;  3WUM A;  5KXL A;  1GB7 A;  3GUK A;  1L18 A;  2ZIL A;  1DPW A;  1L46 A;  1LMO A;  4BAF A;  4GLA A;  1LMQ A;  3LHM A;  4LFP A;  1HEL A;  2QB0 B;  4XJB A;  1WTN A;  153L A;  3DN2 A;  4H94 A;  4TWS A;  3C8R A;  3IJV A;  3GXK A;  1PQJ A;  5APC A;  2BQI A;  3A92 A;  1OP9 B;  211L A;  198L A;  128L A;  1LYO A;  1G7M C;  1LYD A;  4TTD A;  1LYJ A;  1I6S A;  3UON A;  3ZVQ A;  1CX6 A;  3RZ4 A;  5IHG A;  2Q9D A;  4TUN A;  1L99 A;  4I7N A;  3D4S A;  236L A;  1INU A;  2BQJ A;  3NY9 A;  3W6D A;  3E3D A;  4KT3 A;  1L54 A;  1C63 A;  2MEI A;  4DQJ A;  2DQH Y;  4ML7 A;  1IP7 A;  2IFF Y;  1L29 A;  3AZ7 A;  226L A;  3HU8 A;  215L A;  3W6C A;  2BQN A;  2BPU A;  5T3F A;  1P3N A;  3V2W A;  1LZ1 A;  1G0P A;  1LAA A;  133L A;  2D4J A;  168L A;  1LJG A;  1LZD A;  157L A;  1OUH A;  3RNX A;  1OUF A;  190L A;  1GB5 A;  1C6H A;  4E3U A;  4H8X A;  1CU3 A;  3HUA A;  1I20 A;  1LMA A;  5KXR A;  2L78 A;  2ANX A;  3C8Q A;  1ALC A;  175L A;  1H87 A;  205L A;  4LT1 A;  4B49 A;  191L A;  1AM7 A;  2EQL A;  4GCB A;  4Z41 A;  1LYZ A;  3FI5 A;  3D3D A;  1L48 A;  1HNL A;  4DD2 A;  4WLY A;  1XFP L;  1AT6 A;  5KXY A;  4WM1 A;  246L A;  1LJJ A;  1QT5 A;  1T8A A;  3SP3 A;  2NTH A;  1L01 A;  4G49 A;  4AQN A;  2QAR C;  1L87 A;  1RE2 A;  4HV2 A;  1GFE A;  1IIZ A;  1L98 A;  1OV7 A;  2LZT A;  1LZT A;  4GCD A;  1L26 A;  1H6M A;  1GB3 A;  1LHM A;  220L A;  2HEF A;  3HTB A;  192L A;  1C6K A;  207L A;  3TMV A;  5C6I A;  1C6B A;  3SB7 A;  3TXD A;  1T8F A;  4HJZ A;  2LYZ A;  2N5Z A;  1L52 A;  1UC0 A;  1CKD A;  4J0L A;  5LXW A;  1SX7 A;  3G3X A;  2D4K A;  2BQG A;  1HHL A;  1T8G A;  1NBZ C;  2H5Z A;  249L A;  1NHB A;  1OYU A;  3QE8 A;  5HLL A;  3CT1 A;  3PBL A;  1CJ9 A;  1NQI A;  1REZ A;  139L A;  1B7S A;  2MED A;  5LVI A;  5DLA A;  1P2R A;  2W1Y A;  1JJ1 A;  1P36 A;  1CV0 A;  1SLY A;  4H9H A;  4GCF A;  4YXC A;  3FA0 A;  4Z46 A;  1FLQ A;  1C6C A;  2LC9 A;  4RLN A;  1JKB A;  194L A;  213L A;  3HT6 A;  4N1C C;  4A7D A;  2Z18 A;  4NEB A;  5B1G A;  1LJK A;  1LSP A;  1IY3 A;  1CV3 A;  4DQ7 A;  1C67 A;  3HTF A;  1NDM C;  2D91 A;  3GXR A;  1REM A;  4NGJ A;  1FLW A;  1ZUR A;  4HTK A;  5D5F A;  3PDS A;  1YIL A;  4DDA A;  4RW2 A;  244L A;  1D3J A;  6LYZ A;  4NG8 A;  1LJI A;  5B07 A;  4CHX A;  1LZA A;  3GUL A;  3RUN A;  1P2C C;  1L95 A;  4XJD A;  1CV4 A;  4HPI A;  108L A;  2Z6B A;  2BQF A;  5I54 A;  5I4W A;  4NGO A;  1A2Y C;  4I7O A;  4X3B A;  3HBH A;  5LIO A;  1KIP C;  1D0K A;  1KS3 A;  172L A;  2HUB A;  1LJF A;  1BB4 A;  1JUG A;  2RB2 X;  1L82 A;  1L41 A;  4H8Z A;  2G4N A;  4IAP A;  2FYD A;  1L93 A;  5L3H A;  2WAR A;  2BQH A;  4I7R A;  1LCN A;  3A90 A;  1NMM A;  2RB1 X;  177L A;  1NDG C;  1FBI X;  1JEF A;  1QSW A;  3G3V A;  1GFK A;  3LZM A;  1QTB A;  2HU3 A;  2DQG Y;  8LYZ A;  1LKR A;  4WO6 A;  2LZM A;  1QS9 A;  4LYC A;  2IHL A;  1WVV A;  4J1A A;  1YAP A;  144L A;  3C7Z A;  1LZ8 A;  4NGI A;  1HEM A;  1L75 A;  159L A;  2EKS C;  4M4O A;  2CDS A;  1GF0 A;  3K2R A;  1OUG A;  1G0G A;  1LI3 A;  5B06 A;  4B1A A;  1HEQ A;  1HEN A;  4QY9 A;  2HUK A;  5LA5 A;  4TSC A;  1G1V A;  1T97 A;  3C81 A;  3CDR A;  1YKX X;  4XYY A;  1XSF A;  3WUL A;  2BQM A;  212L A;  3HUK A;  182L A;  3HT9 A;  4DD9 A;  4EPF A;  1PQD A;  3TXI A;  1I1Z A;  3BKH A;  4YXA C;  1XGR C;  235L A;  4B0D A;  3HUQ A;  4XJI A;  1C64 A;  1QTH A;  1CU5 A;  1L59 A;  4DD1 A;  1LZN A;  169L A;  2X0A A;  174L A;  1B7Q A;  1L27 A;  1IOR A;  1L34 A;  4LDE A;  1QT6 A;  4N0J A;  1JQU A;  1OV5 A;  132L A;  1L72 A;  1LHK A;  1WVU A;  1QSQ A;  3OE8 A;  3HDF A;  2G4Q A;  2B73 A;  3GUO A;  2MEC A;  1L43 A;  1DI5 A;  1GF5 A;  4I7L A;  2XBR A;  4DYG A;  5FST A;  2RAZ X;  1L80 A;  3W6B A;  1LYS A;  3P4Z A;  3A34 A;  6LYT A;  5F9U A;  3P68 A;  1W6Z A;  5KXW A;  149L A;  1DYD A;  1LZB A;  3WMK A;  4DQ5 A;  1GF7 A;  160L A;  4BS7 A;  3CDV A;  134L A;  1D9W A;  1L03 A;  4YEN A;  1JPO A;  1L05 A;  1L71 A;  1AZF A;  1BVK C;  1B7P A;  1QUD A;  252L A;  238L A;  3AW6 A;  4XJF A;  5DN4 A;  2MEF A;  3SBB C;  4WL7 A;  4WO9 A;  1P2L A;  3A94 A;  4LT0 A;  1L49 A;  1FN5 A;  2XQO A;  4LZT A;  5KXN A;  109L A;  1DYF A;  2BQC A;  2HEA A;  137L A;  3TXB A;  5C6J A;  4RW1 A;  5LA8 A;  1SQ2 L;  4W58 A;  4DWX A;  1OVK A;  1L09 A;  4LT3 A;  1IWZ A;  3AYQ A;  3WXU A;  4LYB A;  1QUT A;  1B5V A;  1IVM A;  240L A;  1GD6 A;  1LMC A;  163L A;  1LZS A;  4J7V A;  1BB3 A;  5J7C A;  1IP5 A;  178L A;  1GFH A;  2B5Z A;  3CSZ A;  1L47 A;  1CUP A;  5I53 A;  3F9L A;  3AZ5 A;  4ETD A;  4J1B A;  3ATN A;  3WYH A;  4ETC A;  1JTO L;  3W6F A;  3DMX A;  1G1W A;  4NGZ A;  3HFM Y;  1JTP L;  1IWT A;  187L A;  1D6Q A;  1BWJ A;  1L44 A;  4GRV A;  1L97 A;  3AGH A;  1TDY A;  4LYT A;  4I7S A;  4W54 A;  2W1X A;  4EKP A;  1PS5 A;  3P65 A;  4HP0 A;  1F6R A;  4W56 A;  2LCB A;  259L A;  5I14 A;  1LHH A;  4LT2 A;  2VB1 A;  2D4I A;  4I7M A;  1C60 A;  1B0D A;  1L10 A;  1QTV A;  1SWZ A;  1QDT A;  193L A;  1XEP A;  1YKY X;  1YAM A;  1LHI A;  248L A;  1LSM A;  1OUB A;  2OU0 X;  1HMK A;  1L63 A;  1DYC A;  1JSE A;  2BQL A;  1IWU A;  3JR6 A;  1GXV 2;  2ZNX Y;  3DN3 A;  4DC4 A;  4CFP A;  1B5Z A;  1UIB A;  1QUS A;  1TBY A;  3WXT A;  1LSE A;  1L79 A;  1KXW A;  4ARQ B;  4GN3 A;  162L A;  2HED A;  4DD7 A;  5M1Y A;  239L A;  3WUA A;  1GF9 A;  4LYO A;  2OTZ X;  3LZ2 A;  5KY1 A;  4NGL A;  3LYO A;  4HJY A;  5ILC A;  1LJ3 A;  1PQI A;  3P64 A;  1L53 A;  3ODU A;  1QTD A;  216L A;  1EQE A;  1QTZ A;  1C62 A;  1L45 A;  4AGA A;  3P66 A;  233L A;  4H9A A;  2HEB A;  4W59 A;  1G7I C;  126L A;  4HV1 A;  1L17 A;  3AZ6 A;  4NIJ A;  4ZIX A;  1CJ7 A;  4TX7 A;  1LMT A;  2XJW A;  1LZE A;  5KXT A;  4ARM A;  3RU5 A;  2MEH A;  1IWV A;  2OEA X;  2ZWB A;  3B0I A;  2C8P A;  2GV0 A;  3EBA B;  4TSB A;  1RCM A;  4KPM A;  2FBB A;  4W53 A;  4G4C A;  1N4F A;  1L00 A;  147L A;  1L0K A;  3AGG G;  3CDT A;  3OK0 A;  1L92 A;  5B59 A;  1L02 A;  3DN1 A;  1CV5 A;  1OVH A;  4WMG A;  3WVY A;  1QUH A;  4RLM A;  142L A;  5FCP A;  3B0O A;  3AB6 A;  2Q9E A;  9LYZ A;  1L31 A;  1B7L A;  1GFV A;  119L A;  4B4J A;  1MEL L;  3RZE A;  1C10 A;  1PQO A;  3W6A A;  4B4I A;  4OWH A;  1FDL Y;  4LFX A;  2Q0M X;  4OOT A;  1DI3 A;  1GAY A;  3WUN A;  165L A;  1LZ9 A;  1C6N A;  1LTM A;  1IP4 A;  140L A;  2YBH A;  1GDW A;  2FYC A;  1L36 A;  3C83 A;  4XN6 A;  1AT5 A;  4W57 A;  4G4B A;  4QEQ A;  1DI4 A;  1L23 A;  2BQO A;  4WG1 A;  1L65 A;  4DD3 A;  1YL0 X;  1L84 A;  2IGC A;  1P64 A;  1C6D A;  4NGK A;  3A6B Y;  4DT3 A;  1L57 A;  1D2W A;  2F2Q A;  1DKJ A;  3FI7 A;  4UWU A;  2Z39 A;  1C45 A;  1HSX A;  1G7H C;  1ZYT A;  199L A;  4MCK A;  2OU9 A;  5KXZ A;  227L A;  4W51 A;  1L06 A;  1JHL A;  3HBE X;  1QUG A;  2LHM A;  1C65 A;  3L64 A;  2HEE A;  150L A;  1OUC A;  1C6P A;  1CJ8 A;  3HT7 A;  3AGI A;  1OQM A;  223L A;  3DN0 A;  1YAN A;  2ZQ4 A;  1LYH A;  141L A;  4IAS A;  1IWX A;  2BAA A;  250L A;  1WQM A;  4QGZ A;  1L32 A;  1EPY A;  4NGV A;  2NTG A;  3EMS A;  1L58 A;  1P7S A;  1UIH A;  1L85 A;  3J6K A;  1GBW A;  4IJ4 A;  5FHW A;  1LJN A;  1UIE A;  138L A;  4NSH A;  4H93 A;  1L66 A;  1LZC A;  1ZWN A;  3SB9 A;  102L A;  1L94 A;  1HF4 A;  1QIO A;  1L28 A;  1V7T A;  2MEB A;  1NF5 A;  4EJ4 A;  1TAY A;  2BQD A;  3VWO A;  1JTT L;  122L A;  2O7A A;  4H9B A;  4QDN A;  201L A;  1C46 A;  4I7J A;  3HH5 A;  2PC2 A;  2B70 A;  2AUB A;  218L A;  3HT8 A;  1IR9 A;  3G3W A;  1UIF A;  1B6I A;  4EKS A;  1OUJ A;  1NBY C;  1D3M A;  4HJV A;  1GE2 A;  1L73 A;  4P2E A;  1L0J A;  4Z3M A;  1P56 A;  1KIR C;  1L30 A;  1VFB C;  1GE1 A;  2A7F A;  4NSG A;  1ZMY L;  1QTE A;  2MEE A;  1CJ6 A;  1HML A;  1L88 A;  5ILF A;  1XEJ A;  2BLX A;  152L A;  5JEN B;  1K28 A;  1QQY A;  4UWN A;  1QTK A;  3WPK A;  1BB6 A;  1IR7 A;  1JJ3 A;  120L A;  257L A;  4FDY A;  1T6V L;  1IC7 Y;  5HQ1 A;  1NKH A;  1UCO A;  1OVJ A;  1GWD A;  1HC0 A;  5LYZ A;  206L A;  1IOS A;  4PPO A;  2F32 A;  210L A;  111L A;  1L07 A;  1LSD A;  3TMU A;  1PQK A;  4GN4 A;  4W94 A;  1SSW A;  2BQB A;  2BQK A;  7LZM A;  3HTD A;  1D6P A;  3RT5 X;  4FJR A;  1IP1 A;  1LGX A;  2RH1 A;  3RW8 A;  2W1M A;  3WU7 A;  4ET8 A;  2YBM A;  3D9A C;  3A3Q A;  3C82 A;  1P46 A;  4C5F A;  1YQV Y;  4WOA A;  1QT3 A;  1WTM A;  3W6E A;  4NGY A;  4NSJ A;  4DJH A;  3HH6 A;  1CU6 A;  3AZ4 A;  3C8S A;  3HWL A;  229L A;  5D5C A;  1KXX A;  1LHL A;  3A96 A;  3WW6 A;  1L61 A;  2D6B A;  4H90 A;  1YL1 X;  3TXG A;  1MLC E;  1KY0 A;  1P5C A;  2ZIJ A;  1AKI A;  3C7W A;  4HSF A;  5L3I A;  1WQQ A;  1G07 A;  1KW5 A;  1CKH A;  2RSC A;  4RDS A;  4H91 A;  4GBR B;  3M3U A;  1DQJ C;  2ZIK A;  2OU8 A;  5II3 A;  1CVK A;  1ZVH L;  1IEE A;  4ZPU A;  164L A;  1GF3 A;  2B6Y A;  1D0L A;  1L91 A;  1IOC A;  4LDL A;  1FKV A;  1GB2 A;  1QSB A;  103L A;  2YDG A;  4GCE A;  1DPX A;  112L A;  3A3R X;  3AW7 A;  155L A;  1F6S A;  1GFG A;  4OO9 A;  1IP6 A;  1C69 A;  4EXM A;  2LZ2 A;  1B7R A;  4EMN A;  5HNL A;  1HFY A;  2MEG A;  1C6J A;  2FBD A;  4OWA A;  1L62 A;  1SWY A;  5DN5 A;  1YAQ A;  1HER A;  3LYZ A;  1G0J A;  1D0M A;  1G7J C;  4MST A;  4YEO A;  2ZYC A;  1RFP A;  2RBR A;  5C6L A;  3CDO A;  1JKD A;  1TLA A;  1L81 A;  2H9J A;  4OWC A;  2Z12 A;  3TMX A;  3TXK A;  1WQN A;  1TCY A;  1PQM A;  3SB5 A;  3C80 A;  146L A;  1P37 A;  1VDS A;  4I7P A;  4WLT A;  1XJU A;  3SBA A;  4W52 A;  2HU1 A;  1LYF A;  4NGW A;  1LYY A;  3VW7 A;  4I7K A;  4DD0 A;  4EPI A;  1CX7 A;  1HSW A;  2HUM A;  1L68 A;  1IP2 A;  1D9U A;  243L A;  1L11 A;  4DDB A;  3OE0 A;  4H92 A;  1XGP C;  6LZM A;  4KXI A;  1CV6 A;  4I8S A;  261L A;  1LSN A;  1SX2 A;  5LVJ A;  1D2Y A;  3A91 A;  3ZVQ B;  189L A;  118L A;  1GE4 A;  1IWY A;  2B72 A;  2YBJ A;  4H9C A;  5LVG A;  1LZG A;  1L13 A;  3IWR A;  1GB0 A;  3WU9 A;  1WTH A;  1C6L A;  1GHL A;  183L A;  4I7T A;  1L86 A;  2OE9 X;  219L A;  5LIN A;  3CQL A;  3A93 A;  1YIK A;  1V7S A;  1YRO A;  242L A;  2O4W A;  2YSS C;  3TMW A;  2F4G A;  4ET9 A;  4WM4 A;  2RBQ A;  1L90 A;  2B6X A;  2Z38 A;  1GFU A;  2OE7 X;  4HPE A;  1VAT A;  224L A;  1QT4 A;  2Z2F A;  3HTG A;  208L A;  1GE3 A;  1L33 A;  3ZEK A;  4WM6 A;  1EQ4 A;  1L35 A;  222L A;  143L A;  3WVX A;  3DN8 A;  1L04 A;  113L A;  3N9C A;  3EML A;  4ARJ A;  4GCC A;  3N9E A;  3NY8 A;  3TXF A;  170L A;  1F10 A;  1GXX A;  1W08 A;  2Z37 A;  3M18 B;  1VED A;  1BB7 A;  1LI6 A;  1VDT A;  1UA6 Y;  1LHJ A;  4N1E I;  129L A;  5F16 A;  1C7P A;  1GF8 A;  4LYZ A;  1L22 A;  4YEM A;  1QT8 A;  4BAP A;  1L15 A;  195L A;  1BHZ A;  1B5X A;  1L37 A;  4NY5 A;  4XJG A;  1IC5 Y;  4N8Z A;  2F30 A;  1L25 A;  4H1P A;  4ETA A;  1LYI A;  221L A;  1IOT A;  2O79 A;  3QAK A;  237L A;  125L A;  1L96 A;  2BQA A;  1KIQ C;  4HTN A;  4PRQ A;  171L A;  4H9E A;  1REY A;  3WPJ A;  4DKL A;  1L19 A;  1IC4 Y;  4NHS A;  2YBN A;  2RAY X;  1HFZ A;  5HMJ A;  1G7L C;  1L12 A;  2OTY X;  1L56 A;  1LPI A;  1L50 A;  1GF6 A;  4NHI A;  4XAD A;  4LGK A;  2LYO A;  3T36 A;  4DDC A;  176L A;  1CKF A;  1QT7 A;  3B0K A;  4K5Y A;  1LSA A;  4I0C A;  1KY1 A;  1L67 A;  3GUJ A;  2BQE A;  1GFJ A;  256L A;  1C6G A;  1LSB A;  148L E;  1UAC Y;  1UBZ A;  5B05 A;  3QNG A;  3SN6 R;  161L A;  1IO5 A;  3TXE A;  104L A;  1C61 A;  1VAU A;  245L A;  3A8Z A;  2EPE A;  5HNC A;  1B7O A;  2ZNW Y;  3TXH A;  1CKC A;  5FEK A;  1XEK A;  127L A;  1L70 A;  2Y8P A;  3BKV A;  1TEW A;  1WQP A;  1Z55 A;  1HEP A;  2I25 L;  1B5U A;  1L64 A;  1LZR A;  258L A;  2C8O A;  3HU9 A;  4D9Z A;  3ATO A;  1D3N A;  1IOQ A;  1QSA A;  4WLD A;  1OWY A;  2A4T A;  5IDD A;  4W55 A;  4OOO A;  3FAD A;  5KKI A;  3A95 A;  4C3W A;  4R6C A;  2F4A A;  2CJL A;  1YAO A;  1LWK A;  5KXK A;  4WG7 A;  4ARQ A;  107L A;  1G0K A;  4PK0 A;  1IY4 A;  4NG1 A;  1L38 A;  1OUE A;  4WM2 A;  4PGJ B;  1GBO A;  2RBP A;  3DMZ A;  3EXD A;  1LZ6 A;  1B5Y A;  1JKA A;  3HH4 A;  217L A;  196L A;  1GBX A;  2MEA A;  5E4P A;  3OE9 A;  2ZQ3 A;  1UID A;  2ANV A;  1C68 A;  1CTW A;  1L51 A;  2I6Z A;  5LZM A;  1JSF A;  4W96 A;  3C7Y A;  115L A;  1C08 C;  1BB5 A;  2XBS A;  5KXS A;  4NFV A;  228L A;  3TXJ A;  166L A;  1XGT C;  1FLU A;  3G3B B;  4G9S A;  1E8L A;  4CGE A;  1FKQ A;  4CFO A;  4OWB A;  4XJH A;  1GBY A;  3F6Z A;  2DQD Y;  1L74 A;  5LAG A;  1LZ4 A;  4GLV A;  156L A;  123L A;  1L24 A;  2HTX A;  2BLY A;  1GB9 A;  1T6H A;  1JKC A;  1T3P A;  2NWD X;  2OE4 X;  5A3E A;  3DNA A;  3HBD A;  1DYB A;  1JWR A;  1J1O Y;  197L A;  5I4Y A;  1L39 A;  1P6Y A;  1UIG A;  4PRU A;  2B6W A;  114L A;  3W3E A;  5AMY A;  4BAD A;  4UWV A;  1JIT A;  1GBS A;  1LYG A;  4OW1 A;  1QUO A;  262L A;  5DM9 A;  3WW5 A;  2B74 A;  1IWW A;  188L A;  2Z2E A;  4AXT A;  3SB8 A;  5FEL A;  185L A;  2B6Z A;  3GUI A;  1C6F A;  3DMV A;  1WQR A;  230L A;  260L A;  5IEL A;  5EBH A;  1GB8 A;  4KL7 A;  5FDJ A;  5LYM A;  247L A;  4WLX A;  5APF A;  1RI8 B;  3L2X A;  1G0L A;  3B72 A;  1LSC A;  4LYM A;  1KNI A;  1UIA A;  4H8Y A;  1FLY A;  5KJ9 A;  5I4X A;  3ULR A;  1DYE A;  3OJP A;  4PHI A;  4XEN A;  131L A;  1IP3 A;  1LOZ A;  3N9A A;  4EKR A;  3GUN A;  2B75 A;  1VDQ A;  1LYE A;  4R0F A;  4ARL A;  254L A;  4ZFP A;  1DYA A;  1GFT A;  1LJ4 A;  2G4P A;  1B7M A;  209L A;  135L A;  3DN6 A;  1BWI A;  3GUP A;  130L A;  4NWE A;  1L76 A;  2F47 A;  1LW9 A;  2DKV A;  2RB0 X;  1F0W A;  1QDR A;  1L14 A;  4Z98 A;  1OWZ A;  1BGI A;  1L69 A;  1B9O A;  1LSZ A;  4O34 A;  3DKE X;  2F2N A;  3B6L A;  5LYT A;  1CUQ A;  1JIY A;  2DQF C;  1DZB X;  151L A;  1LZY A;  1GFA A;  1O23 A;  1GAZ A;  5KKJ A;  2DQA A;  200L A;  3GUM A;  4ETE A;  1JTM A;  4H9I A;  1BQL Y;  1JIS A;  2DQE Y;  4CJ2 A;  1VDP A;  1GE0 A;  1GBZ A;  2YBI A;  4WM3 A;  1C6I A;  2CGI A;  2B6T A;  3KAM A;  3LYM A;  5I5Q A;  180L A;  3HH3 A;  1RJC B;  225L A;  2Z19 A;  5L9J A;  4M6D A;  1LMN A;  3CDQ A;  1D3F A;  4N5R A;  1L20 A;  1XGU C;  4U3X B;  1J1X Y;  1DXJ A;  1REX A;  5KXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...