1QDRA

2.1 a resolution structure of escherichia coli lytic transglycosylase slt35
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
b'MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Binding of calcium in the EF-hand of Escherichia coli lytic transglycosylase Slt35 is important for stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qdrA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qdrA02
4ETEA 4DD2A 1IC4Y 2DQAA 4UWVA 4XENA 4C3WA 4H94A 1B7QA 1OUIA 1GEVA 1LHJA 2N5ZA 4E3UA 2BAAA 1KIRC 2FBDA 1JKDA 1LMNA 2GV0A 1LZRA 1AM7A 3A6CY 2FYDA 1GBYA 1NDMC 1SQ2L 3N9AA 5KXTA 4ET9A 4DD9A 1LHHA 208LA 1LJFA 1MELL 4WM1A 1CKHA 2H5ZA 5C6JA 3B0OA 5KXLA 1OUFA 4MR1A 1HFXA 3KAMA 1GF3A 5I5QA 1B7OA 2LHMA 4QEQA 4H9HA 3AZ5A 1UICA 4N0JA 3AW7A 1IOCA 3TMXA 1LHKA 1GF4A 1NWGA 2CGIA 1KXYA 4B4EA 4WL6A 1UIFA 1EQEA 2A7DA 3P65A 5F9UA 4LGKA 1NMMA 4HPEA 3LYZA 4H92A 1LSEA 3CT0A 1C46A 1GXXA 1I56A 1LJIA 2BQBA 1QUTA 5KKIA 4NWHA 1DKJA 1HC0A 4H8ZA 1FN5A 4RDSA 4ETAA 1IP2A 1JKBA 1GE4A 4O34A 3VWOA 2MEFA 1WQRA 5D5CA 2ZQ3A 4OW1A 1YAQA 4LFXA 4P2EA 5LAFA 1D6QA 1ZVYB 3ZVQB 1HEOA 4WLDA 1YILA 1WQPA 4RLMA 3GXKA 4U3XB 1RFPA 1I1ZA 1NHEA 5B06A 1QTKA 1REXA 2EQLA 1E8LA 4YM8A 3N9CA 5I4YA 1OUBA 1IP4A 3WXUA 1G7HC 4DD1A 2BQEA 1UBZA 1B5ZA 1LHIA 2BQKA 2DKVA 3ZVQA 134LA 3TMVA 1NF5A 3WW6A 1KIPC 4ML7A 5T3FA 5DN5A 5HLLA 9LYZA 4XN6A 4TTDA 1IWYA 4NEBA 5A3ZA 5E4PA 5F81A 6LYZA 4OWHA 1XFPL 1B7NA 3M3UA 3W6BA 2ZILA 4GN3A 5APFA 5LVJA 4FJRA 4C5FA 1BWJA 1DPXA 1N4FA 4LYMA 1BB7A 4B4JA 1BWHA 1NBZC 5F9XA 4N1CC 1GFJA 4YOPA 4Z41A 3A95A 5LYTA 1D0LA 1LZ5A 2LZTA 3G3BB 1D0MA 4M4OA 5APDA 5LXWA 3LYMA 2I6ZA 4BAPA 1TDYA 4PJ2C 4RW1A 4HJYA 1TEWA 1JITA 3K3TA 1IY3A 5E9RA 4EOFA 3IWRA 4AXTA 3EMSA 1GB9A 2F4GA 3LZ2A 2BQHA 1XGRC 1GFKA 4GN4A 1GPQC 1SLYA 5FELA 1KXWA 5FCPA 4ET8A 1OUGA 1F6RA 1IWVA 1UACY 1RJCB 4DDCA 2F30A 1LSGA 2MEEA 2MEGA 3A93A 3P66A 4NSIA 4ETCA 3FE0A 193LA 1HEQA 1CKDA 2Z38A 1LKSA 2Z19A 2LYMA 5LVKA 3T36A 2YBHA 4DT3A 1G7MC 2C8PA 4LYCA 5LA8A 1LJHA 2G4QA 4LFPA 4NIJA 4GLVA 1GBXA 4A7DA 7LYZA 2DQDY 3HBEX 2FBBA 5DLAA 3WULA 2MEHA 1LSYA 5L9JA 5EBHA 1JUGA 1LZ4A 3LHMA 2XTHA 3OJPA 1DKKA 1EQ5A 3ZEKA 1VDTA 2BQNA 3A90A 2PC2A 5C6LA 4WM3A 1GFVA 3HBDA 1EL1A 1GF8A 1LSZA 4PHIA 4FDYA 4N8ZA 4PRUA 3W6DA 3WU9A 4Z3MA 1GFHA 3WL2A 5HMVA 4I8SA 4LYOA 1B9OA 1GB6A 1IWXA 1CJ6A 1GB2A 4YEMA 5LVGA 5KKJA 2HU1A 1GFAA 1PS5A 2WARA 4XJHA 5HNLA 1IORA 2FYCA 4H9EA 1GBOA 4IATA 1TBYA 4LT3A 1JJ1A 1GFRA 1WQQA 4NGVA 5KXXA 4WMGA 4H93A 1GEZA 1GE0A 1WTNA 2ZIJA 2W1MA 1LYSA 1DI3A 1IY4A 1V7SA 4Z98A 4G4BA 1MLCE 2DQEY 3AZ6A 2MEIA 3TXGA 1LTMA 4R6CA 1NQIA 2HECA 5B05A 1HFYA 2ZYPA 1TAYA 1JISA 1Z55A 2MEDA 4BS7A 2BLYA 1IVMA 1LCNA 4NHTA 4H9IA 4DYGA 4J7VA 4ANRA 1T3PA 1IP5A 153LA 5KXNA 1GF7A 1LHLA 1XGTC 3MGWA 5DM9A 1C08C 4YEOA 4WLTA 2LYOA 1HEWA 1UUZC 2MECA 1CNSA 4GLAA 4IASA 1YANA 1VAUA 3AB6A 3GXRA 5L3HA 2HEDA 1WVVA 4H9CA 1DXJA 1IEEA 1UIBA 1C45A 4WM2A 3AW6A 4NSHA 3W6FA 4KXIA 4OOTA 1HHLA 1UIAA 5F14A 4CFOA 4J1BA 1IR8A 1UCOA 4NWEA 1GAZA 1AZFA 1G7LC 1B7SA 1P2CC 1OUJA 4DDBA 2MEBA 1BB6A 3W3EA 1NDGC 2BPUA 1LJKA 4B1AA 1LJ3A 3T6UA 207LA 4DWXA 4KPMA 4OWBA 1XGPC 2HTXA 4WLYA 2F2NA 4IJ4A 1GB8A 2CJLA 1LSBA 1I20A 1JEFA 1LMOA 4NHSA 3RT5X 4GCEA 1TCYA 5M1YA 1GFUA 4DD0A 4WM6A 1GFTA 1OUHA 1B7LA 1LZ9A 1DZBX 1FLYA 4WL7A 1A2YC 2BQGA 3QE8A 4UWUA 3EBAB 3W6EA 3WUNA 1T6VL 3BKHA 3WU7A 1G7JC 2Z39A 4TSBA 2EPEA 2HEAA 4TX7A 1JSFA 1BVKC 3AYQA 4NGOA 1C43A 1WQNA 4NGIA 2AUBA 1GAYA 1DI4A 1LZ8A 1LMPA 2CWIA 4KT3A 4XJFA 1GB3A 3AGHA 1FBIX 1LOZA 2EKSC 1IP7A 1IWUA 2DQIY 4GCCA 1D6PA 1LSAA 1LZAA 1OQMA 3CSZA 2LZ2A 3LYTA 1B5UA 1IOQA 4GCDA 3TMWA 3WH1A 1LJ4A 1VEDA 4WOAA 5D5FA 1GWDA 1IX0A 2ZYCA 2EIZC 4B0DA 5LAGA 1LPIA 1YL0X 4NY5A 1ALCA 1GB5A 1JWRA 1IO5A 4OWAA 1BHZA 2HEEA 1H87A 3SP3A 1LSFA 4CJ2A 2F4AA 2I26L 4TUNA 1CKFA 4NSJA 2H9KA 1KIQC 5KXSA 5KY1A 1HMLA 1IP3A 1PZYA 4H8YA 4XADA 1B7MA 4LYTA 4N9RA 4NHPA 4X3BA 5LVHA 1D0KA 4GCBA 1EQ4A 2ZQ4A 5AMYA 1YROA 1GB0A 1VFBC 1RCMA 1B7RA 1LMQA 2ZNWY 1IIZA 3WPJA 1F6SA 4CHXA 1LZYA 1QDRA 3HFMY 1JJ0A 1RE2A 1GHLA 5LYZA 4QGZA 1HNLA 4XYYA 2W1LA 5KXOA 1J1OY 1CKGA 4NG8A 3WUMA 5I54A 1HENA 1GDXA 1HSWA 1WQMA 1XEJA 3TXJA 1LJNA 2BQCA 2BQDA 1LYYA 4OWCA 4ZFPA 2Z12A 1DPWA 1QIOA 5FHWA 4LT2A 4DD3A 1AT5A 1BQLY 1QQYA 1LKRA 2CDSA 5KXMA 1GFGA 4NGZA 2IFFY 1GXV2 4XJIA 1XEIA 2DQCY 4N5RA 2ZWBA 5LYMA 1FLUA 1JJ3A 1WVUA 3RW8A 1QSAA 4H1PA 1IC5Y 1UIGA 4WM4A 1IOSA 2YBNA 5KXYA 5IELA 5KXRA 1O23A 1QTEA 1FLWA 1HF4A 4B4IA 2IHLA 5HMJA 3B0KA 4G4CA 1CJ9A 1QDTA 5B07A 3G3AB 4Z46A 4LYZA 1LJGA 4LT1A 2D6BA 2DQGY 2G4PA 1VATA 1YQVY 4HV2A 1B5VA 2DQJY 4D9ZA 2A7FA 1GF5A 1LZDA 2Z37A 4G49A 4NSGA 1AKIA 1NBYC 4YENA 1D9UA 1IWTA 3TXDA 4AGAA 8LYZA 1BVXA 3TXFA 1LZNA 3E3DA 4W94A 3AJNA 4YF2A 1HFZA 5I53A 4QDNA 2BQIA 4RW2A 3RZ4A 2HU3A 2BLXA 4H91A 1HELA 2YSSC 3RU5A 1CJ8A 4KL7A 3P68A 1FLQA 194LA 1REZA 3HBHA 1IP1A 1WTMA 1B2KA 1GBWA 1H6MA 1LHMA 5F16A 1LSCA 2G4NA 1HERA 5KXZA 5B59A 1JTOL 1YKZX 1UIDA 2W1YA 3W6CA 3AZ4A 3EXDA 5KXPA 1VDQA 1LSPA 2BQJA 1GF6A 4M6DA 3TXBA 3D3DA 1LJJA 1JPOA 1JKCA 1LYZA 1OUAA 5IHGA 1DI5A 2ZIKA 3A67Y 2YBJA 4PRQA 1B5WA 2H9JA 154LA 1GE1A 1FKVA 4H9FA 3WW5A 4CFPA 1INUA 1VDSA 3J6KA 3QY4A 2HUBA 2RSCA 1GD6A 3BKVA 4NGYA 1LSNA 3M18B 4RLNA 2X0AA 1YKXX 1UC0A 3LN2A 2D4KA 4NGJA 3EO5A 3CT1A 5LINA 1JKAA 1IR7A 4QY9A 2Z2EA 3A94A 1CJ7A 4HP0A 1REMA 1XEKA 1LZBA 3P64A 4WM5A 1IWWA 3A34A 2D4JA 3CT5A 5APEA 5FEKA 1ZMYL 4NG1A 2XJWA 4PPOA 4HV1A 1J1XY 1KXXA 4HJVA 4MCKA 5LA5A 4ZIXA 132LA 3W6AA 3CSQA 1DQJC 1LAAA 2HEBA 1GE3A 4WO9A 5II3A 5HNCA 3TXHA 5JENB 2BQFA 3WVXA 4B49A 4ETDA 1BWIA 4LT0A 1LSMA 1UIEA 2XBSA 4GCFA 1B5XA 2D4IA 4J0LA 4BADA 3TXEA 1YAMA 3FI7A 3TXIA 1J1PY 2VB1A 3A3QA 1FKQA 1YKYX 4HTNA 4NHQA 1OP9B 5KXKA 2YBLA 1LZCA 3A6BY 1IOTA 3AGGG 5LVIA 1GFEA 1OUCA 3RNXA 1BGIA 3B72A 3IJUA 4WG1A 5FSTA 1GBSA 3B6LA 4NGKA 3WPLA 4HTQA 2BQMA 4WG7A 3WXTA 1GF0A 5DL9A 4GN5C 1B5YA 1JTTL 1HSXA 2Q0MX 3AGIA 3P4ZA 5HQ1A 1UIHA 3B0IA 5I4XA 1G7IC 1YAPA 5DN4A 1ZV5L 3A91A 3N9EA 4I0CA 3TMUA 5B1FA 5ILFA 3TXKA 4ETBA 3AZ7A 4UWNA 1BB5A 1GF9A 1F10A 3D9AC 1FDLY 3QNGA 1B7PA 4DD7A 3A8ZA 2C8OA 5K7OA 1XGQC 4NHIA 1YL1X 1GBZA 4WO6A 5APCA 2YBIA 3CQLA 3J4GA 4OOOA 4R0FA 1WQOA 5J7CA 1YIKA 1AT6A 1XGUC 4H9AA 4TWSA 5C6IA 1LZTA 2D91A 1HEMA 1NKHA 2Z2FA 5KJ9A 5ILCA 4EMNA 2NWDX 1LYOA 4L41A 3WMKA 4HJZA 1F0WA 4G4HA 1A4VA 3WPKA 2YBMA 3A96A 4PGJB 4DDAA 4ZEEA 2Z18A 2Y8PA 2DQHY 4DC4A 1XSFA 4MSTA 2BQOA 1LMTA 133LA 1C7PA 3ULRA 1VDPA 1LZ6A 1JIYA 4G9SA 5FDJA 3LZTA 4OWEA 4XJBA 5LIOA 4NFVA 1OUDA 3LYOA 2BQAA 1CKCA 3WU8A 1GE2A 1JTPL 3ATNA 4N1EI 4W96A 2W1XA 4WLXA 1IP6A 4XJGA 4H90A 2LYZA 1GDWA 1OUEA 4LZTA 4XJDA 4LYBA 1LMCA 135LA 3IJVA 1LMAA 1QSWA 1HMKA 1YAOA 5B1GA 5A3EA 5L3IA 4NGWA 6LYTA 1REYA 2MEAA 1HEPA 1LSDA 4NGLA 2XBRA 4TSCA 2HEFA 1LJEA 1W6ZA 2I25L 1C10A 3WUAA 4BAFA 1JHLA 2ZNXY 3WVYA 1V7TA 1BB4A 3A3RX 1LZEA 2YVBA 1QUSA 3A92A 3ATOA 4II8A 4HSFA 2B5ZA 5I4WA 1LZGA 1LZSA 4H9BA 1JSEA 4HPIA 1UA6Y 1ZVHL 2DQFC 1GB7A 1IWZA 1RI8B 4HTKA 5IDDA 2BQLA 5KXWA 1W08A 1IR9A 1IC7Y 2DBTA 4CGEA 1LZ1A 3CSRA 3WYHA 4J1AA 3OK0A 3CB7A 2YDGA 1B0DA 1BB3A 4H8XA 3F6ZA
chains in the Genus database with same CATH superfamily
4ETEA 1QAQA 1VEGA 4UWVA 3KVWA 2N35A 5ITUA 253LA 1QZEA 2CUZA 2FYDA 4QOZC 2XFTA 3N9AA 4ET9A 4DD9A 4DR2M 5KXLA 4OVZB 4WM1A 3ZC7B 2H5ZA 1OUFA 1CV6A 1HFXA 3KAMA 5I5QA 3TE6A 1B7OA 3HDEA 2LVPC 1JTNA 4QEQA 1L41A 1CV3A 1UICA 1IOCA 1C6AA 4FD2A 1L44A 1GF4A 2L2DA 3CDOA 2FFJA 1PJSA 1IM2A 2DHRA 4H92A 1YE9A 1KYIA 1C46A 3DMZA 4LGMA 4AI6A 4JI5M 2YR0A 2CV2A 4RDSA 1KW5A 4G4NA 1GE4A 3T1YM 1L17A 1XXHA 3UONA 1WQPA 2O25A 1RFPA 1L93A 4B3TM 4XK8F 141LA 1OAIA 4II7A 131LA 1LHIA 2DKVA 2BQKA 1KFVA 3ZVQA 2YQZA 1IFYA 3OE8A 1L83A 9LYZA 4TTDA 4NEBA 1L0JA 5E4PA 3NY8A 4LJ4A 4G3OA 4RNAA 3KOYE 5APFA 4ARJA 2OE4X 1F4IA 2F5QA 1DPXA 1L76A 1L70A 4B4JA 3HGIA 3BOSA 3U6DA 1NBZC 5F9XA 4N1CC 3A95A 1D0LA 3VK8A 5APDA 5LXWA 2I6ZA 5EXPA 3GRUA 1L68A 3FYDA 4IBJA 1JITA 3U6EA 2XFSA 240LA 1P46A 3B74A 2BQHA 1XGRC 3V2WA 3I01M 5FCPA 1F6RA 3GLIE 4AG5A 1RJCB 2KNVA 4NSIA 3FE0A 1CU5A 2Z19A 2OOAA 1L22A 2LYMA 5LVKA 1G7MC 4M9XA 2C99A 3L26A 1LJHA 4GLVA 4A7DA 1L27A 5DLAA 1QS9A 159LA 2XGNA 2XZUA 2XTHA 3OJPA 1EQ5A 1L89A 5FTMA 4W59A 3A90A 1GFVA 157LA 1J7KA 4FDYA 2JY6B 3WU9A 3SHFA 3T38A 5EP3A 4I8SA 4LYOA 1L31A 1B9OA 1IWXA 2LBCA 4YEMA 5LVGA 2LHCA 2HU1A 104LA 1GFAA 1PS5A 2WARA 4XJHA 2FYCA 1G06A 4IATA 1TBYA 4PK0A 1WQQA 4F1IA 3LCUA 2ZIJA 181LA 3WHKA 3U5ZB 1LYSA 2MEIA 1V7SA 3AZ6A 3GQ5A 3EIHA 152LA 1Z55A 177LA 2RBQA 1LCNA 4H9IA 4DYGA 4R3DA 1L97A 1C60A 1GF7A 1LHLA 1XGTC 4F2LA 4YEOA 4G4QA 4W57A 1P6YA 4B08A 1Z59A 172LA 3AB6A 3GXRA 2HL7A 1EPYA 3OTOM 1DXJA 1IEEA 1UIBA 1DGHA 4NSHA 4KXIA 1G1WA 1GVNA 1G0LA 4GMQA 1HR0M 4J1BA 1GAZA 1AZFA 1BB6A 151LA 1LJKA 2R4EA 1C6LA 2DWMA 190LA 1G0QA 1C61A 2HTXA 3I04M 2CJLA 3DN6A 3IG8A 3JAMS 2ZBKB 5KO3A 4R71A 1L36A 1B7LA 1N32M 1HNWM 3U61A 3FKEA 4TSBA 2HEAA 4PDIA 1BVKC 1WQNA 1QYRA 1JQUA 1X37A 1GAYA 3HT6A 4YXAC 2O7AA 1ZMWA 1GB3A 1GKIA 3L27A 1FBIX 1IWUA 2CV1A 4X3BA 1OQMA 3U6SA 3TMWA 1IOQA 184LA 3WH1A 1XNRM 1LJ4A 4JI8M 170LA 4EJ4A 4JXJA 2RB2X 4IBCA 1TTEA 2ZYCA 2D7EA 4B0DA 1YL0X 4NY5A 3AOEA 4JI2M 4OWAA 1JWRA 3JR5A 1BHZA 3FUWA 3SP3A 2RAYX 1L75A 3KP0E 1XB2B 3UMMA 2H9KA 5KXSA 182LA 1PZYA 4XADA 2DAKA 3KOZE 4LYTA 4N9RA 2C98A 5AMYA 3FUXA 1GLNA 1P37A 3HT9A 1IIZA 1F6SA 1T43A 3DNAA 1LZYA 1ZWNA 1QDRA 4IBDA 4QGZA 3B7NA 4I7RA 4IBGA 2H5XA 109LA 4DR3M 1L02A 1J1OY 2W1LA 4XYYA 5KXOA 1GDXA 3DMVA 3SARA 1HSWA 1XEJA 108LA 1C6JA 1LJNA 4ZFPA 1C6QA 4AKHA 5FHWA 4DD3A 1QQYA 4NGZA 3R8FA 1GABA 4AW4A 1PQOA 2ZWBA 5LYMA 2QCUA 1JJ3A 1WVUA 1OIZA 4D80A 3LVVA 1LYEA 1QTEA 1PJIA 1MN3A 4G4CA 1PJQA 1CJ9A 2LXEA 1CUKA 3HDFA 3LQRA 1LW9A 3M6AA 3CDTA 1LJGA 3VKGA 4JI3M 2DQGY 1VATA 2RBNA 4DR7M 2JY8A 227LA 2C5RA 2WSCF 1LZDA 1OVHA 1BVXA 2CHVA 4LF9M 3E3DA 1D9WA 4YXCA 3SHGB 1NHWC 5I53A 1J09A 147LA 2B6ZA 1CJ8A 3P68A 3GLFE 4BBAA 1REZA 1T6OA 1L10A 1WTMA 5F16A 1L49A 1L67A 2QENA 1HERA 1L2CA 3DZDA 4FWHA 1L42A 4IBBA 1L26A 5KXPA 3GQ3A 2R45A 1JKCA 5IHGA 1DI5A 3A67Y 3I51A 3M0EA 173LA 2YBJA 3HUAA 4W54A 1R7RA 1D2YA 2A4TA 1GE1A 4CFPA 2HUKA 4LF7M 2QPAA 3WHLA 2V1CA 3GLIA 3IECA 1KSFX 1NV8A 4EPFA 2JZ0A 2Z7JA 1W5TA 3U61B 2QP9X 2FE8A 4HP0A 1P2LA 1XEKA 3SBBC 3U6MA 3P64A 4WM5A 3KP1E 2D4JA 2MH8A 4GH9A 1ZMYL 2XJWA 4HV1A 3B7QA 1Q39A 4MCKA 1QT7A 3W6AA 3HHZA 3FE3A 4M9SA 1DQJC 217LA 1GE3A 1P2RA 4I7NA 2RAZX 5JENB 4ETDA 3WVXA 4B49A 4LT0A 1UIEA 2V6ZM 2D4IA 2CWBA 4BADA 3FI7A 3A3QA 1IOTA 3GUIA 3J2PB 161LA 4WG1A 3HHYA 1GBSA 3B6LA 2RH1A 1C1KA 2BQMA 4WG7A 5BPVA 3WXTA 1G41A 4S12A 3KS8A 5C18A 3P4ZA 5I4XA 1HQCA 4QOSA 5HQ1A 1UIHA 1N78A 1L52A 4LF4M 4IBIA 3AZ7A 3E46A 1FDLY 1B7PA 1S3SA 4PDGA 1YL1X 1QUHA 1C6KA 3GRRA 1WQOA 1OFIA 168LA 2KW0A 5J7CA 4FCTA 1YIKA 1XC8A 3OE9A 1CTWA 1HEMA 5KJ9A 199LA 2IGCA 4P17A 1DYDA 2KHHA 4HJZA 3U60B 3HZJA 4PGJB 1G0GA 4DDAA 1HT1E 1D3NA 3HH4A 1XSFA 2H1RA 2KNZA 1MJGM 1LZ6A 4JI1M 2EKKA 4NSOB 3VFDA 201LA 2X49A 1GE2A 4N1EI 3TWLA 5EXXA 1GDWA 3FADA 1JR3D 4PCZA 3RGSA 1LMAA 3DKEX 4NGWA 4TSCA 3HT7A 4NRWA 4GIPA 4LJ8A 2I25L 2OO9A 4BAFA 2ZNXY 3WVYA 4TUWA 2YVBA 120LA 3A92A 4PT5A 5KQDA 3ATOA 1HNZM 3ZQJA 3DN4A 1UA6Y 3AL0C 1L92A 2BQLA 3I4VA 1W08A 2R44A 3L2AA 1IR9A 3V2YA 2XSZA 3CSRA 3WYHA 4J1AA 3K2LA 2YDGA 2QBYA 1ZAEA 4L15A 1R4GA 4MGHA 3C7WA 4H94A 1GEVA 3CDQA 1LHJA 214LA 4E3UA 2GV0A 3HU1A 4DUZM 5F3WA 2L78A 1GBYA 1NDMC 1SQ2L 4I7TA 5KXTA 4HLQA 1MELL 1SG9A 2BWBA 1CV5A 3B0OA 1L28A 1WXQA 4MR1A 1CV0A 1LWKA 4HL4A 2ERCA 2LHMA 1NNJA 3F92A 3AZ5A 107LA 4CIZA 4N0JA 3TMXA 4DV5M 1L19A 1LYGA 5LZMA 3EIEA 2UU9M 1DYBA 1UIFA 3TPZA 2J5YA 4B7HA 4AQYM 2F5SA 5F9UA 4K0KM 1L2BA 123LA 3PNVA 4NWHA 5IWAM 122LA 2WZJA 1HC0A 1SSYA 1L81A 1JKBA 4O34A 2B75A 4OW1A 1GL6A 4P2EA 1D6QA 174LA 1L61A 224LA 4DR6M 4WLDA 4RLMA 3GXKA 1WGLA 4U3XB 1J5EM 198LA 1QTKA 1REXA 2G5GX 3N9CA 1DGBA 1G7HC 4DD1A 2BQEA 3HU3A 1UBZA 3CGWA 1QTZA 3GPPA 5ITXE 1IN5A 3PVSA 4Q7JA 1QVRA 4BB9A 1XMQM 3HX3A 3EMLA 4I7MA 5F81A 3AOEC 1XFPL 4IIWA 1L04A 4KO8A 219LA 4C5FA 4DV6M 4LYMA 2VDBB 5LYTA 4ARLA 2LZTA 206LA 3G3BB 4W52A 2F5OA 3LYMA 1G4AE 1TDYA 178LA 4PJ2C 4RW1A 4HJYA 3UZUA 5E9RA 4AXTA 1GB9A 5L8RF 1P5CA 1GFKA 4GN4A 1SLYA 3F9LA 5FELA 2HCBA 1L80A 1IWVA 2W82A 2OTYX 4DDCA 4MGZE 1L20A 1XHBA 4EKPA 4ETCA 5KPRA 1L88A 1N36M 3MK6A 1LKSA 158LA 1E94E 1LWGA 1LYDA 5LA8A 2G4QA 4NIJA 2QSFX 1GBXA 1TGUA 5DYGA 2CRUA 2FBBA 3HBEX 2OOBA 3WULA 2MEHA 3U6LA 5L9JA 3FUVA 2APLA 3H4MA 4JI0M 3W68A 3QAKA 1GL7A 1HJPA 3LVWA 1JUGA 1LZ4A 3LHMA 1DKKA 1L82A 1A5TA 1L24A 1VDTA 2BQNA 103LA 1IBLM 2HWJA 4PHIA 3W6DA 3SYLA 3LMMA 3SBJA 5HMVA 4ARPA 2DXIA 3GUPA 1GB2A 5ITTA 5KKJA 2B73A 4DR1M 1IORA 4H9EA 1H6UA 1Q3BA 2GQFA 1L40A 5EP1A 1GFRA 1L46A 189LA 4NGVA 5KXXA 4D81A 254LA 1WTNA 250LA 1ORYB 3Q8XA 3AOGA 3DN3A 3R9XB 1HFYA 215LA 1QUOA 2Y0TA 4AKIA 229LA 2UXBM 4ANRA 2ZM6M 3U5ZA 4ARQB 3G3XA 3SAWA 3T15A 1GJSA 2KXEA 3C83A 4GKJM 1CNSA 4GLAA 3HKPA 1P7SA 1VAUA 2HEDA 113LA 2OU8A 2LVQD 4WM2A 1QT8A 4E97A 1C45A 1CU0A 3AW6A 3NBIA 4B3SM 2KRKA 4OOTA 1UIAA 1SXJE 185LA 4CFOA 3FTFA 4NWEA 1QQWA 1B7SA 4EKRA 1L99A 1OUJA 1L12A 1L56A 1HQYE 4B1AA 2XLJA 4LJ6A 3NBXX 1G59A 4KPMA 4AQNA 1XGPC 2V1UA 1T8GA 4IJ4A 2BJWA 4HEOA 1CUQA 3NYAA 1C6MA 4GCEA 2KDLA 1TCYA 4DD0A 4I7PA 1QT4A 1DZBX 1A2YC 1OQYA 3WUNA 3W0FA 2QNJA 1L1ZA 3GLFB 4NGOA 1JQJC 1L98A 4NGIA 4NL4H 2OPFA 2K6BA 2VIIA 2FOIC 2J7OA 2HULA 119LA 3AGHA 2K9DA 1DYEA 251LA 1LOZA 2EKSC 3PNYA 2DQIY 1LSAA 1D3FA 5KPZA 4GC5A 1C69A 1LI6A 1QS5A 1VEDA 1L96A 1GWDA 3RGPA 1I94M 3D8LA 3SATA 1HNXM 1LSFA 4CJ2A 1KY1A 1L66A 1TH4A 234LA 1KIQC 5KY1A 1HMLA 5I14A 4YX7C 3GLGE 4LRSA 1W5SA 4GCBA 2EKFA 2ZQ4A 1VFBC 4Z8XA 3HH6A 1B7RA 4CHXA 2P5TA 2E5LM 1RE2A 252LA 1GHLA 3HFMY 5LYZA 1HNLA 2B6TA 128LA 1NVMA 1CKGA 4NG8A 4NRVA 3WUMA 4GRVA 3I4YA 2Z8YM 2BQCA 4OWCA 1DPWA 2JNHA 4DUYM 1BQLY 1NY6A 2Z6BA 5KXMA 2QARC 3BXWA 1GXV2 3FUUA 2DZLA 1Y8GA 1L37A 3H4JA 1FLUA 1V92A 1IN7A 4Z6YA 2KEBA 2YBNA 5KXRA 1L35A 1O23A 4DAJA 1FLWA 2DKLA 2O79A 3GLHE 4B4IA 2IHLA 3D4SA 3E9SA 3B0KA 1OV5A 3DA1A 1QDTA 1LYJA 1C67A 1L69A 4LT1A 4MGKE 180LA 4HV2A 1L51A 5DFLA 1B5VA 1G8PA 4YENA 3HTDA 3JR4A 4G49A 3C8RA 5EXTA 3J80S 8LYZA 1QT5A 3TXFA 4W94A 3AJNA 1HFZA 1MX0A 3AFHA 3K9PA 1LGWA 2EJSA 1QT3A 2BQIA 3CF2A 4FWDA 1HELA 1C6BA 1SWZA 2K0BX 3HBHA 1IY0A 1IP1A 3L25A 1KW7A 1GBWA 1LHMA 1TDZA 232LA 3QWLA 4WW0A 1PQKA 5B59A 1E32A 1UIDA 3C8SA 3AZ4A 1DO2A 2LNHC 1PQDA 4L78A 4M6DA 3TXBA 1LJJA 1L90A 1C6PA 2ZIKA 4QNMA 1JTMA 1C6NA 1FNNA 5ITQA 1IY2A 3J7BA 1FKVA 260LA 4H9FA 3WW5A 1INUA 1VDSA 3J6KA 1GD6A 1LSNA 1IY1A 4AKGA 4RLNA 3SB5A 1IN4A 4NGJA 4FWGA 1CJ7A 4MGIE 1REMA 4LJ9A 1IN6A 4G6ZA 1OAOC 144LA 4LRTA 1PQIA 3SAVA 1J1XY 1KXXA 2MJ5B 1CUPA 4ZIXA 3CDVA 132LA 3E4RA 3VLFB 2VF7A 148LE 187LA 3B9PA 1QUDA 4WO9A 2DAGA 5II3A 4EXMA 3TXHA 1L50A 2O5RA 1LSMA 118LA 3HU2A 4J0LA 1YAMA 3TXIA 3VDUA 1YKYX 2RBOA 4JV5M 2YBLA 1LZCA 3AGGG 3RNXA 3B72A 3IJUA 195LA 5FSTA 1QT6A 1KY0A 1P64A 3WPLA 1B5YA 1JTTL 3KSXA 5DN4A 4LDEA 6LZMA 5B1FA 3ZCBB 3GQ4A 259LA 2Z4RA 1F10A 1L74A 3QNGA 3HJSA 4DD7A 3A8ZA 4LF5M 2C8OA 4WO6A 2YBIA 3J4GA 2BJVA 2KZUA 3SMPA 2Q2EB 139LA 211LA 239LA 4DJHA 1AT6A 5C6IA 4I7SA 165LA 1LZTA 3GP1A 1L8QA 4L8RC 2NWDX 4L41A 2XQOA 1F0WA 4G4HA 3B89A 112LA 2YBMA 1C63A 4ZEEA 2Y8PA 2DQHY 5FLXS 4DC4A 2RB1X 4MSTA 2C96A 4GHLA 1C7PA 1VDPA 3LZTA 4OWEA 5LIOA 4I81A 3U60A 1OUDA 2JWSA 3DN8A 1FJGM 4W96A 3HJQA 4WLXA 1IP6A 4H90A 2LYZA 1OUEA 2NQ8C 4LYBA 1D2NA 1JR3E 4CGYB 2D7GA 1DYAA 2B72A 5A3EA 3J27B 4CJ6A 1REYA 4NGLA 1C7YA 160LA 1LI3A 1W6ZA 2LTUA 3VW7A 1LZEA 5JI3E 1OJLA 5I4WA 4II8A 4HSFA 1LZGA 2DQFC 1GB7A 4HTKA 5IDDA 2L7HA 3DFZA 156LA 176LA 243LA 4DV1M 4LJAA 102LA 4LFCM 1B0DA 2C9OA 1BB3A 4H8XA 4DD2A 2LVOC 3M7GA 4REZA 1IC4Y 3MJ5A 2VF8A 142LA 4JI7M 3AV0A 1OUIA 3KFUG 2N5ZA 1MU5A 3CDRA 2R6FA 3U6OA 1KIRC 1JKDA 1LMNA 2FBDA 1L60A 1LZRA 1HT2E 4ZPXA 3ILKA 5IREB 2CHGA 4WURA 5DYIA 2L4FA 4W53A 2KRUA 1NO1A 4PD2A 1L39A 2DWZB 1L57A 3AW7A 163LA 1LHKA 5IT9S 2CGIA 1D2WA 1KXYA 1C6CA 1EQEA 2A7DA 4X64M 1NMMA 3E21A 235LA 3THGA 4HPEA 3LYZA 3HUQA 1LJIA 2BQBA 5KKIA 3SB6A 1FN5A 1IP2A 1C65A 3GLHA 3VWOA 2F5PA 3IG5A 2JXNA 5EP2A 4LF6M 1WQRA 4AG6A 5D5CA 2ZQ3A 2R65A 4LFXA 3ODUA 4NXNM 1G07A 1YILA 2I7PA 1I1ZA 137LA 5B06A 2EQLA 1E8LA 4YM8A 1L47A 5I4YA 1L09A 1OUBA 1QTCA 1OV7A 4UN2B 3DN1A 5EXSA 1LV7A 1WGNA 2ZTCA 2GNOA 134LA 1LYHA 256LA 3TMVA 3TL4X 1KIPC 230LA 4ML7A 5HLLA 1IWYA 1OKSA 6LYZA 4OWHA 3HWSA 4ZPUA 1BVSA 5FTKA 3M3UA 4M0DA 1SXJB 1WIVA 4GN3A 1E9RA 2XSZD 3LQQA 2Q9DA 1BWHA 3SC3A 4YOPA 4Z41A 4MM3B 2QB0B 1QSQA 1L84A 3GRYA 5H37D 2OE7X 4EOFA 213LA 2LCBA 1GPQC 1QANA 2BWEA 1KXWA 5FSWA 2LWXA 1OUGA 1DGGA 2B7XA 1UACY 1PQJA 2DWNA 1GJTA 2CP8A 4GRIA 2F30A 2MEEA 2MEGA 3A93A 3P66A 1LLHA 2YNMD 193LA 3RZEA 2ZTDA 3AJIB 1CKDA 2EO2A 2Z38A 2YBHA 2UUBM 3HHWA 1C6HA 1L05A 4LFPA 4LG2A 7LYZA 2DQDY 262LA 1LSYA 2CUUA 3T1HM 1TR8A 166LA 1XEPA 4WM3A 4JI4M 4PRUA 4Z3MA 2JP7A 3WL2A 1P3NA 4R7GA 4IJEA 236LA 1GB6A 1CJ6A 1NY5A 246LA 3GLGB 3A42A 2MR9A 2DNAA 1XXHE 1L00A 1L15A 5BR8M 4YHHM 1OIPA 4QHTA 4AZFA 4H93A 1GEZA 1GE0A 2YFQA 2CV0A 1DI3A 1IY4A 3TXGA 4I7LA 1N34M 5B05A 3GUKA 4QNRA 2ZAMA 2JY5A 4MB7A 1JISA 1TAYA 2R4JA 4BS7A 1IVMA 1R5LA 1T3PA 233LA 3MGWA 5DM9A 164LA 2G3QA 2LYOA 1G3IA 2MECA 4DQJA 2DAIA 4IASA 3KOXE 1YANA 3FUTA 2QZ4A 2J7NA 3TQSA 3FTEA 5L3HA 4ARQA 1WVVA 4H9CA 1AUAA 4LZZA 1R2YA 3CTWB 3GLHB 1IN8A 4DV3M 3K9OA 1CU6A 1NSFA 3W3EA 5EQTA 4LZMA 4LF8M 1LJ3A 3T6UA 1NJFA 207LA 4DWXA 4OWBA 4WLYA 2F2NA 1GB8A 1I20A 2F5NA 1LMOA 4LDOA 3L2XA 5M1YA 2Y21A 1GFUA 3PDSA 4NC6A 1XWIA 1LZ9A 237LA 1FLYA 4JN6A 2UXDM 2RB0X 2BQGA 3QE8A 4UWUA 3EBAB 192LA 3W6EA 1T6VL 1L32A 1LYFA 1G7JC 249LA 3WU7A 4TX7A 1R2ZA 4OO9A 1C43A 4EIWA 1OVKA 1VEJA 2AUBA 1DI4A 3SASA 1SWYA 2KA6B 3DOAA 1LMPA 4KT3A 4FVMA 5EP4A 4XJFA 155LA 3QYEA 1L03A 3GLFA 1L77A 3U6PA 1PJJA 1D6PA 4GHAA 3CSZA 2LZ2A 1B5UA 4LZJA 5ITRA 1G0MA 3J81S 2EIZC 5LAGA 1LPIA 1IO5A 2I26L 4W56A 4TUNA 1CKFA 2DI0A 4NSJA 4M0WA 2UUAM 1IP3A 4H8YA 5KQ8A 1TH3A 1IBMM 2Q9EA 1CV1A 2K47A 2R62A 1D0KA 1VEKA 3GUMA 3BBZA 1GB0A 1YUBA 1RCMA 1LMQA 2ZNWY 2LC9A 2X8AA 4IBFA 4YY3M 1NHGC 3FTCA 4XBOA 5LMNM 5I54A 3L64A 2Z3XA 4LY6A 228LA 3SMSA 3TXJA 4WP2A 1LYYA 1T8AA 5IZ7D 8CATA 1QIOA 4LT2A 1AT5A 2CDSA 1LKRA 4B7FA 3SAUA 1IXSB 1GFGA 1T97A 2IFFY 3IHPA 4XJIA 2OE9X 1XEIA 2DQCY 4N5RA 197LA 4H1PA 1IC5Y 4WM4A 1Z5BA 1KS3A 1IOSA 5KXYA 5IELA 162LA 1LPYA 1HF4A 4OU7A 5HMJA 3UGJA 3DN2A 5B07A 1IXRC 3G3AB 4Z46A 2KNAA 1V33A 1L2DA 1XMOM 2G4PA 4D9ZA 1GF5A 2LVNC 1NBYC 1D9UA 1QTVA 1T3TA 1EIJA 145LA 2A5YB 1L01A 1LZNA 4QDNA 2Y0QA 3RZ4A 212LA 1L06A 4H91A 2YSSC 2QHOB 1IXZA 194LA 150LA 4LCBA 1H6MA 1LSCA 1D3JA 5KXZA 3C82A 1JTOL 2W1YA 3W6CA 1ZYTA 2L4EA 1GF6A 3HWLA 4B3RM 1QTDA 5C1BA 3A46A 154LA 1L33A 2XF3A 4I5SA 1C62A 1IQPA 3QY4A 2HUBA 2RSCA 4LDLA 183LA 1L23A 1L95A 3M18B 2X0AA 3HTGA 3LN2A 3Q8GA 2JZ1A 1N33M 1JKAA 3GUOA 1C6IA 4QY9A 2R46A 4MH0E 5EJCA 3A94A 3KXEC 2B6YA 3GPXA 2X4AA 5APEA 4FCWA 1K28A 1L30A 4GBRB 2WSEF 2UXCM 2FNAA 4HJVA 4FCVA 4NSRA 3SFZA 1BWIA 2XBSA 1TLAA 1K3XA 1B5XA 3ZH9B 3G3VA 7CATA 3TXEA 4DV2M 3HH5A 2VB1A 4HTNA 1FKQA 2DZNB 1OP9B 5KXKA 1G1VA 2OEAX 2Y20A 4W5WA 1OUCA 1BGIA 4LJ5A 216LA 1L62A 3HH3A 4B7GA 4I7OA 3W0LB 1GF0A 4GN5C 1L34A 3D8BA 2OU9A 1YAPA 1ZV1A 1ZV5L 5ILFA 5FTLA 3TXKA 1QTBA 4UWNA 171LA 3F8VA 1G0JA 1L18A 3PFIA 1XGQC 4DQ5A 1L55A 4I7KA 4NHIA 5A2QS 5APCA 3CQLA 2DZOB 4R0FA 3UJNA 1CU3A 2ANXA 196LA 4LFBM 1L58A 3TWMA 1XGUC 4TWSA 2D91A 5E26A 1Q3CA 2DAMA 3MHVC 4I4LA 1DYFA 3C7ZA 3HUKA 3OE0A 3WMKA 1DO0A 1A4VA 110LA 4NOOB 2NTHA 3UK6A 133LA 1C68A 1QSBA 3SBAA 1PRBA 4G9SA 5FDJA 4X66M 3AKZA 1QAOA 3GUJA 1CKCA 2R0IA 3ATNA 2XZFA 4XJDA 1LMCA 3IJVA 5B1GA 5L3IA 3NY9A 1YAOA 3HJ8A 4I8OA 6LYTA 1I4WA 5FTNA 2MEAA 1LSDA 4ARMB 1L65A 2B6XA 4IBEA 1ZURA 5ITXA 1C10A 3WUAA 3FA0A 1JHLA 3SB7A 2RKOA 2RRUA 1QUSA 3FD9A 2LVAA 2B5ZA 1B6IA 1LZSA 1L72A 4A3VB 1ZVHL 5KXWA 1RI8B 2CE7A 3LZMA 175LA 200LA 1IC7Y 2AHMA 3CB7A 2BNKA 3FYCA 1P3QQ 2DQAA 4XENA 4C3WA 1B7QA 1EFUB 2BAAA 1AM7A 3A6CY 210LA 4JYAM 7LZMA 3HTBA 1LHHA 2DHYA 1WHCA 1LJFA 208LA 1CKHA 5C6JA 1C64A 1V34A 2MGWA 1GF3A 3K92A 169LA 1NJGA 3CF6E 4H9HA 5E6JA 3L28A 1NWGA 3C80A 4B4EA 4WL6A 3QAUA 3P65A 1SXJD 4LGKA 125LA 2RGOA 1LSEA 3CT0A 4JI6M 1GXXA 1I56A 1QUTA 3A45A 1DKJA 4H8ZA 1L63A 1XXHB 1GO5A 4ETAA 4DV4M 2MEFA 1VG5A 1L86A 1N77A 4DQ7A 1YAQA 5LAFA 3SB8A 1ZVYB 3ZVQB 1HEOA 5ITYA 4P16A 1NHEA 1C6TA 4IAPA 3FRIA 1VDDA 2KZSA 225LA 3WXUA 1IP4A 2B6WA 1VDLA 2DENA 1EE8A 255LA 4ITQA 1B5ZA 4IBKA 4DR4M 1NF5A 3WW6A 3CF0A 5T3FA 1Q02A 5DN5A 4XN6A 2FS1A 5A3ZA 242LA 1L85A 3SYKA 3HHXA 1B7NA 3W6BA 4QHSA 2ZILA 3G3WA 1ZMVA 5LVJA 2NTGA 4FJRA 2XH9A 1BWJA 1N4FA 1BB7A 245LA 1GFJA 2F2QA 1LZ5A 1D0MA 4M4OA 1SXJA 4I7QA 2EUCA 4BAPA 1C66A 3C58A 1TEWA 3K3TA 4XGIA 1IY3A 115LA 3IWRA 3EMSA 2JUJA 2F4GA 3LZ2A 1WJ7A 1I6SA 1L54A 2F32A 2HAKA 4L16A 1SSWA 4LGYA 4ET8A 1D3MA 1VQ1A 1WR1B 1LSGA 4KT0F 1HEQA 4X62M 2FH0A 4DT3A 3T36A 2C8PA 4LYCA 2CEAA 1WTHA 247LA 3JR6A 1OWZA 3T6PA 3L29A 4DR5M 5EBHA 2L6OA 2LH0A 3ZEKA 5C6LA 2PC2A 3FRHA 3V76A 3HBDA 4KLNA 1Z6TA 1EL1A 1GF8A 1LSZA 4N8ZA 1GFHA 3DMXA 1CVKA 127LA 2L09A 186LA 5HNLA 3PXGA 4G4RA 1GBOA 4LT3A 1JJ1A 2RBPA 4WMGA 2RBRA 3GLGA 2W1MA 1OFHA 221LA 4Z98A 4G4BA 1MLCE 2DQEY 1LTMA 1C6DA 4R6CA 1NQIA 2HECA 5LMUM 2ZYPA 2MEDA 2BLYA 4NHTA 1G0KA 1KNIA 4J7VA 1IP5A 153LA 1QTHA 5KXNA 1DGHB 4S0WA 4L4UA 1C08C 3HU8A 4WLTA 1HEWA 4NXMM 1UUZC 3C7YA 140LA 226LA 3MMPA 3W6FA 1HHLA 5F14A 3RE8A 1IR8A 1UCOA 1L14A 4GKKM 1G7LC 4CHTB 1P2CC 2HUMA 4IJFA 4DDBA 2MEBA 1E9SA 1NDGC 2BPUA 2JY7A 3GULA 1LGUA 3RT5X 1LSBA 1JEFA 1L25A 1L45A 4NHSA 4EKQA 2UUCM 4WM6A 1GFTA 3LW5F 4DV0M 1OUHA 2F47A 3RUNA 4WL7A 4K5YA 1DGFA 2CHQA 3BKHA 2Z39A 2EPEA 1JSFA 3AYQA 3GRVA 1SX2A 3DN0A 1CV4A 3RFWA 4PJZA 1LZ8A 2CWIA 1T6HA 3VK7A 5KPTA 4DV7M 1PGYA 3K1JA 1IP7A 3J7AS 3HTFA 4GCCA 1LZAA 3LYTA 4GCDA 3B7ZA 1L1TA 3NWLA 4WOAA 5D5FA 223LA 1IX0A 3PBLA 1Z5AA 1ALCA 1GB5A 2HEEA 1L08A 1H87A 3FI5A 4GITA 3GPYA 2JA2A 1L07A 2F4AA 1YSYA 2OQ4A 1C6FA 1DYCA 191LA 1L13A 1L16A 248LA 4G4OA 1B7MA 1L38A 4NHPA 1PM5A 1P56A 5LVHA 1EQ4A 1YROA 2DAEA 3K8ZA 188LA 2QQ8A 3WPJA 2HHHM 4KODA 2ZAOA 4M9ZA 2R18A 1L11A 1JJ0A 2EA0A 143LA 1L87A 2L7IA 1HENA 1L73A 4GEWA 1WQMA 2BQDA 138LA 2VQFM 2Z12A 3VDPA 4W55A 2D7HA 3GPUA 1L0KA 1AIPC 3LCVB 3C81A 167LA 1L21A 3U6CA 2B70A 3RW8A 1C6EA 4LJ7A 1R6BX 4Y28F 3U6QA 1LGXA 1QSAA 1UIGA 1XJTA 1IXSA 2M5ZA 2DVWB 1P36A 2XEPA 1IBKM 3A98B 2ANVA 1L29A 1CX7A 2ZANA 4LYZA 3GO8A 1L79A 1L43A 2D6BA 220LA 1YQVY 2DQJY 2A7FA 4NSGA 2Z37A 1NV9A 4AGAA 1AKIA 3TXDA 1IWTA 4I7JA 3HY5A 258LA 5FTJA 1XNQM 4YF2A 3SN6R 129LA 3C3EA 1QAMA 4RW2A 1DYGA 2BLXA 2HU3A 3RU5A 4KL7A 2CFOA 1FLQA 1UM8A 1B2KA 4RF1A 2G4NA 5GKNA 1JB0F 1YKZX 3EXDA 1VDQA 1LSPA 2BQJA 1N75A 3D3DA 130LA 1NNUC 1JPOA 1L71A 3GLIB 1LYZA 1OUAA 3C9PA 2B74A 1L53A 4PRQA 1B5WA 2H9JA 3TWKA 1NHBA 1PQMA 3BKVA 3QYBA 4NGYA 1L64A 205LA 1YKXX 3W67A 1UC0A 2D4KA 5LINA 3EO5A 3CT1A 3HU9A 1IR7A 2Z2EA 1JR3A 1LZBA 1IWWA 3A34A 4OVZA 3CT5A 4W58A 5FEKA 2I7NA 1T8FA 1YLAA 4NG1A 4PPOA 1L59A 4GC9A 5LA5A 1K82A 4X65M 2OU0X 3CSQA 1LAAA 2HEBA 1C6GA 1LYIA 244LA 5HNCA 3KOWE 2BQFA 4D82A 1OVJA 4GCFA 231LA 114LA 1J1PY 4NHQA 1Z5CA 1G0PA 1LI2A 238LA 2VQEM 4OX9M 4W51A 2MROB 3KW6A 1OWYA 3A6BY 4DKLA 5LVIA 1GFEA 4EPIA 3K2RA 4NGKA 4LFAM 4HTQA 5DL9A 1TDHA 2Q0MX 1HSXA 3AGIA 241LA 3B0IA 1L91A 1TH2A 1G7IC 3A91A 3TMUA 3N9EA 4I0CA 4RKUF 218LA 4ETBA 1L48A 3VKHA 4CISA 1BB5A 1GF9A 1CU2A 3D9AC 2Z4SA 4OW0A 5K7OA 2OTZX 1GBZA 3KSJA 4OOOA 4B3MM 1RU3A 3KDSE 4H9AA 1SXJC 2HKJA 1NKHA 2LHGA 2M60A 2Z2FA 5ILCA 4L6V6 4EMNA 2RGHA 1L94A 1LYOA 1OYUA 4MGYE 1PJTA 2G8LA 4BLCA 257LA 3WPKA 2F4VM 3A96A 1OTRA 2Z18A 2WSFF 1TF0B 3HT8A 1K3WA 4DBGB 2BQOA 1LMTA 2C9CA 3ULRA 2O4WA 3FTDA 4FW9A 1JIYA 2DWLA 3C8QA 4XJBA 1ZQ9A 1UFZA 149LA 4NFVA 2LZMA 4RF0A 126LA 111LA 2BQAA 3LYOA 3OE6A 3SB9A 3WU8A 1JTPL 2W1XA 4XJGA 4LZTA 135LA 5JI2E 209LA 1QSWA 1HMKA 1SX7A 1G71A 5DNYA 1HEPA 2RBSA 2XBRA 2HEFA 4KHPM 1LJEA 2B3TA 1CX6A 1QZMA 1V7TA 1BB4A 3A3RX 1DV0A 4EKSA 3KS4A 1ZMUA 1XJUA 1QUGA 4H9BA 2O01F 1JSEA 4ARMA 4HPIA 2QBYB 3GUNA 1IWZA 146LA 3C3DA 261LA 2DBTA 4CGEA 1LZ1A 222LA 3OK0A 3F6ZA
chains in the Genus database with same CATH topology
4ETEA 4UWVA 253LA 2FYDA 3N9AA 4ET9A 4DD9A 5KXLA 4WM1A 2H5ZA 1OUFA 1CV6A 1HFXA 3KAMA 5I5QA 1B7OA 3HDEA 1JTNA 4QEQA 1L41A 1CV3A 1UICA 1IOCA 1C6AA 1L44A 1GF4A 3CDOA 4H92A 1C46A 3DMZA 4RDSA 1KW5A 1GE4A 1L17A 3UONA 1WQPA 1RFPA 1L93A 141LA 131LA 1LHIA 2DKVA 2BQKA 3ZVQA 3OE8A 1L83A 9LYZA 4TTDA 4NEBA 1L0JA 5E4PA 3NY8A 5APFA 4ARJA 2OE4X 1DPXA 1L76A 1L70A 4B4JA 1NBZC 5F9XA 4N1CC 3A95A 1D0LA 5APDA 5LXWA 2I6ZA 1L68A 1JITA 240LA 1P46A 2BQHA 1XGRC 3V2WA 5FCPA 1F6RA 1RJCB 4NSIA 3FE0A 1CU5A 2Z19A 2LYMA 1L22A 5LVKA 1G7MC 1LJHA 4GLVA 4A7DA 1L27A 5DLAA 1QS9A 159LA 2XTHA 3OJPA 1EQ5A 1L89A 4W59A 3A90A 1GFVA 157LA 4FDYA 3WU9A 4I8SA 4LYOA 1L31A 1B9OA 1IWXA 4YEMA 5LVGA 2HU1A 104LA 1GFAA 1PS5A 2WARA 4XJHA 2FYCA 1G06A 4IATA 1TBYA 4PK0A 1WQQA 2ZIJA 181LA 1LYSA 2MEIA 1V7SA 3AZ6A 152LA 1Z55A 177LA 2RBQA 1LCNA 4H9IA 4DYGA 1L97A 1C60A 1GF7A 1LHLA 1XGTC 4YEOA 4W57A 1P6YA 172LA 3AB6A 3GXRA 1EPYA 1DXJA 1IEEA 1UIBA 4NSHA 4KXIA 1G1WA 1G0LA 4J1BA 1GAZA 1AZFA 1BB6A 151LA 1LJKA 1C6LA 190LA 1G0QA 1C61A 2HTXA 3DN6A 2CJLA 1L36A 1B7LA 4TSBA 2HEAA 1BVKC 1WQNA 1JQUA 1GAYA 3HT6A 4YXAC 2O7AA 1GB3A 1FBIX 1IWUA 4X3BA 1OQMA 3TMWA 3WH1A 1IOQA 184LA 1LJ4A 170LA 4EJ4A 2RB2X 2ZYCA 4B0DA 1YL0X 4NY5A 4OWAA 1JWRA 1BHZA 3SP3A 2RAYX 1L75A 2H9KA 5KXSA 182LA 1PZYA 4XADA 4LYTA 4N9RA 5AMYA 1P37A 3HT9A 1IIZA 1F6SA 3DNAA 1LZYA 1ZWNA 1QDRA 4QGZA 4I7RA 109LA 1L02A 4XYYA 2W1LA 5KXOA 1J1OY 1GDXA 3DMVA 1HSWA 1XEJA 108LA 1C6JA 1LJNA 4ZFPA 1C6QA 5FHWA 4DD3A 1QQYA 4NGZA 1PQOA 2ZWBA 5LYMA 1JJ3A 1WVUA 1LYEA 1QTEA 4G4CA 1CJ9A 3HDFA 1LW9A 3CDTA 1LJGA 2DQGY 1VATA 2RBNA 227LA 1LZDA 1OVHA 1BVXA 3E3DA 1D9WA 4YXCA 5I53A 147LA 2B6ZA 1CJ8A 3P68A 1REZA 1L10A 1WTMA 5F16A 1L49A 1L67A 1HERA 1L42A 1L26A 5KXPA 1JKCA 5IHGA 1DI5A 3A67Y 2YBJA 173LA 3HUAA 4W54A 1D2YA 2A4TA 1GE1A 4CFPA 2HUKA 4EPFA 4HP0A 1P2LA 1XEKA 3SBBC 3P64A 4WM5A 2D4JA 1ZMYL 2XJWA 4HV1A 4MCKA 1QT7A 3W6AA 217LA 1DQJC 1GE3A 1P2RA 4I7NA 2RAZX 5JENB 4ETDA 3WVXA 4B49A 4LT0A 1UIEA 2D4IA 4BADA 3FI7A 3A3QA 1IOTA 3GUIA 161LA 4WG1A 1GBSA 3B6LA 2RH1A 2BQMA 4WG7A 3WXTA 5I4XA 3P4ZA 5HQ1A 1UIHA 1L52A 3AZ7A 1FDLY 1B7PA 1YL1X 1QUHA 1C6KA 1WQOA 168LA 5J7CA 1YIKA 3OE9A 1CTWA 1HEMA 5KJ9A 199LA 2IGCA 1DYDA 4HJZA 4PGJB 1G0GA 4DDAA 1D3NA 3HH4A 1XSFA 1LZ6A 201LA 1GE2A 4N1EI 1GDWA 3FADA 1LMAA 3DKEX 4NGWA 4TSCA 3HT7A 2I25L 4BAFA 2ZNXY 3WVYA 2YVBA 120LA 3A92A 3ATOA 3DN4A 1UA6Y 1L92A 2BQLA 1W08A 1IR9A 3V2YA 3CSRA 3WYHA 4J1AA 2YDGA 3C7WA 4H94A 1GEVA 3CDQA 1LHJA 214LA 4E3UA 2GV0A 2L78A 1GBYA 1NDMC 1SQ2L 4I7TA 5KXTA 1MELL 1CV5A 3B0OA 1L28A 4MR1A 1CV0A 1LWKA 2LHMA 3AZ5A 107LA 4N0JA 3TMXA 1L19A 1LYGA 5LZMA 1DYBA 1UIFA 5F9UA 123LA 4NWHA 122LA 1HC0A 1SSYA 1L81A 1JKBA 4O34A 2B75A 4OW1A 4P2EA 1D6QA 174LA 1L61A 224LA 4WLDA 4RLMA 3GXKA 4U3XB 198LA 1QTKA 1REXA 3N9CA 1G7HC 4DD1A 2BQEA 1UBZA 1QTZA 3EMLA 4I7MA 5F81A 1XFPL 1L04A 219LA 4C5FA 4LYMA 5LYTA 4ARLA 2LZTA 206LA 3G3BB 4W52A 3LYMA 1TDYA 178LA 4PJ2C 4RW1A 4HJYA 5E9RA 4AXTA 1GB9A 1P5CA 1GFKA 4GN4A 1SLYA 3F9LA 5FELA 1L80A 1IWVA 2OTYX 4DDCA 1L20A 4EKPA 4ETCA 1L88A 1LKSA 158LA 1LWGA 1LYDA 5LA8A 2G4QA 4NIJA 1GBXA 3HBEX 2FBBA 3WULA 2MEHA 5L9JA 3QAKA 1JUGA 1LZ4A 3LHMA 1DKKA 1L82A 1L24A 1VDTA 2BQNA 103LA 4PHIA 3W6DA 5HMVA 4ARPA 3GUPA 1GB2A 5KKJA 2B73A 1IORA 4H9EA 1L40A 1GFRA 4NGVA 1L46A 189LA 5KXXA 254LA 1WTNA 250LA 3DN3A 1HFYA 215LA 1QUOA 229LA 4ANRA 4ARQB 3G3XA 3C83A 1CNSA 4GLAA 1P7SA 1VAUA 2HEDA 113LA 2OU8A 4WM2A 1QT8A 4E97A 1C45A 1CU0A 3AW6A 4OOTA 1UIAA 185LA 4CFOA 4NWEA 1B7SA 4EKRA 1L99A 1OUJA 1L12A 1L56A 4B1AA 4AQNA 4KPMA 1XGPC 1T8GA 4IJ4A 1CUQA 3NYAA 1C6MA 4GCEA 1TCYA 4DD0A 4I7PA 1QT4A 1DZBX 1A2YC 3WUNA 4NGOA 1L98A 4NGIA 2HULA 119LA 3AGHA 1DYEA 251LA 1LOZA 2EKSC 2DQIY 1LSAA 1D3FA 1C69A 1LI6A 1QS5A 1VEDA 1L96A 1GWDA 1LSFA 4CJ2A 1KY1A 1L66A 234LA 1KIQC 5KY1A 1HMLA 5I14A 4YX7C 4GCBA 2ZQ4A 1VFBC 3HH6A 1B7RA 4CHXA 252LA 1RE2A 3HFMY 1GHLA 5LYZA 1HNLA 2B6TA 128LA 1CKGA 4NG8A 3WUMA 4GRVA 2BQCA 4OWCA 1DPWA 1BQLY 2Z6BA 5KXMA 2QARC 1GXV2 1L37A 1FLUA 2YBNA 5KXRA 1L35A 1O23A 4DAJA 1FLWA 2O79A 4B4IA 2IHLA 3D4SA 3B0KA 1OV5A 1QDTA 1LYJA 1C67A 1L69A 4LT1A 180LA 4HV2A 1L51A 1B5VA 4YENA 3HTDA 4G49A 3C8RA 8LYZA 1QT5A 3TXFA 4W94A 3AJNA 1HFZA 1LGWA 1QT3A 2BQIA 1HELA 1C6BA 1SWZA 3HBHA 1IP1A 1KW7A 1GBWA 1LHMA 232LA 1PQKA 5B59A 1UIDA 3C8SA 3AZ4A 1PQDA 4M6DA 3TXBA 1LJJA 1L90A 1C6PA 2ZIKA 1JTMA 1C6NA 260LA 1FKVA 4H9FA 3WW5A 1INUA 1VDSA 3J6KA 1GD6A 1LSNA 4RLNA 3SB5A 4NGJA 1CJ7A 1REMA 144LA 1PQIA 1J1XY 1KXXA 1CUPA 4ZIXA 3CDVA 132LA 187LA 148LE 4WO9A 5II3A 1QUDA 4EXMA 3TXHA 1L50A 1LSMA 118LA 4J0LA 1YAMA 3TXIA 1YKYX 2RBOA 2YBLA 1LZCA 3AGGG 3RNXA 3B72A 3IJUA 195LA 5FSTA 1QT6A 1KY0A 1P64A 3WPLA 1B5YA 1JTTL 5DN4A 4LDEA 6LZMA 5B1FA 259LA 1F10A 1L74A 3QNGA 4DD7A 3A8ZA 2C8OA 4WO6A 2YBIA 3J4GA 139LA 211LA 239LA 4DJHA 1AT6A 5C6IA 4I7SA 165LA 1LZTA 2NWDX 4L41A 2XQOA 1F0WA 4G4HA 112LA 2YBMA 1C63A 4ZEEA 2Y8PA 2DQHY 4DC4A 2RB1X 4MSTA 1C7PA 1VDPA 3LZTA 4OWEA 5LIOA 1OUDA 3DN8A 4W96A 4WLXA 1IP6A 4H90A 2LYZA 1OUEA 4LYBA 2B72A 1DYAA 5A3EA 1REYA 4NGLA 160LA 1LI3A 1W6ZA 3VW7A 1LZEA 5I4WA 4II8A 4HSFA 1LZGA 2DQFC 1GB7A 4HTKA 5IDDA 156LA 176LA 243LA 102LA 1B0DA 1BB3A 4H8XA 4DD2A 1IC4Y 142LA 1OUIA 2N5ZA 3CDRA 1KIRC 2FBDA 1JKDA 1LMNA 1LZRA 1L60A 4W53A 1L39A 1L57A 3AW7A 163LA 1LHKA 2CGIA 1D2WA 1KXYA 1C6CA 1EQEA 2A7DA 1NMMA 235LA 4HPEA 3LYZA 3HUQA 1LJIA 2BQBA 5KKIA 3SB6A 1FN5A 1IP2A 1C65A 3VWOA 1WQRA 5D5CA 2ZQ3A 4LFXA 3ODUA 1G07A 1YILA 1I1ZA 137LA 5B06A 2EQLA 1E8LA 4YM8A 1L47A 5I4YA 1L09A 1OUBA 1QTCA 1OV7A 3DN1A 1LYHA 134LA 256LA 3TMVA 1KIPC 230LA 4ML7A 5HLLA 1IWYA 6LYZA 4OWHA 4ZPUA 3M3UA 4GN3A 2Q9DA 1BWHA 4Z41A 4YOPA 2QB0B 1QSQA 1L84A 2OE7X 4EOFA 213LA 2LCBA 1GPQC 1KXWA 1OUGA 2B7XA 1UACY 1PQJA 2F30A 2MEEA 2MEGA 3A93A 3P66A 1LLHA 193LA 3RZEA 1CKDA 2Z38A 2YBHA 1C6HA 1L05A 4LFPA 7LYZA 2DQDY 262LA 1LSYA 2CUUA 166LA 1XEPA 4WM3A 4PRUA 4Z3MA 3WL2A 1P3NA 236LA 1GB6A 1CJ6A 246LA 1L00A 1L15A 4H93A 1GEZA 1GE0A 1DI3A 1IY4A 3TXGA 4I7LA 5B05A 3GUKA 1TAYA 1JISA 1IVMA 4BS7A 1T3PA 233LA 3MGWA 5DM9A 164LA 2LYOA 2MECA 4DQJA 4IASA 1YANA 5L3HA 4ARQA 1WVVA 4H9CA 1CU6A 3W3EA 4LZMA 1LJ3A 3T6UA 207LA 4DWXA 4OWBA 4WLYA 2F2NA 1GB8A 1I20A 1LMOA 4LDOA 3L2XA 5M1YA 1GFUA 3PDSA 1LZ9A 237LA 1FLYA 2RB0X 2BQGA 3QE8A 4UWUA 3EBAB 192LA 3W6EA 1T6VL 1L32A 1LYFA 1G7JC 249LA 3WU7A 4TX7A 4OO9A 1C43A 1OVKA 2AUBA 1DI4A 1SWYA 1LMPA 4KT3A 4XJFA 155LA 1L03A 1L77A 1D6PA 3CSZA 2LZ2A 1B5UA 1G0MA 2EIZC 5LAGA 1LPIA 1IO5A 2I26L 4W56A 4TUNA 1CKFA 4NSJA 1IP3A 4H8YA 2Q9EA 1CV1A 1D0KA 3GUMA 1GB0A 1RCMA 1LMQA 2ZNWY 2LC9A 5I54A 3L64A 228LA 3TXJA 1LYYA 1T8AA 1QIOA 4LT2A 1AT5A 2CDSA 1LKRA 1GFGA 1T97A 2IFFY 4XJIA 2OE9X 1XEIA 2DQCY 4N5RA 197LA 4H1PA 1IC5Y 4WM4A 1KS3A 1IOSA 5KXYA 5IELA 162LA 1LPYA 1HF4A 5HMJA 3DN2A 5B07A 3G3AB 4Z46A 2G4PA 4D9ZA 1GF5A 1NBYC 1D9UA 1QTVA 145LA 1LZNA 1L01A 4QDNA 3RZ4A 212LA 1L06A 4H91A 2YSSC 194LA 150LA 1H6MA 1LSCA 1D3JA 5KXZA 3C82A 1JTOL 2W1YA 3W6CA 1ZYTA 1GF6A 3HWLA 1QTDA 154LA 1L33A 1C62A 3QY4A 2HUBA 2RSCA 4LDLA 183LA 1L23A 1L95A 3M18B 2X0AA 3HTGA 3LN2A 1JKAA 3GUOA 1C6IA 4QY9A 3A94A 2B6YA 5APEA 1K28A 1L30A 4GBRB 4HJVA 1BWIA 2XBSA 1TLAA 1B5XA 3G3VA 3TXEA 3HH5A 2VB1A 4HTNA 1FKQA 1OP9B 5KXKA 1G1VA 2OEAX 1OUCA 1BGIA 216LA 1L62A 3HH3A 4I7OA 1GF0A 4GN5C 1L34A 2OU9A 1YAPA 1ZV5L 5ILFA 3TXKA 1QTBA 4UWNA 171LA 3F8VA 1G0JA 1L18A 1XGQC 4DQ5A 1L55A 4I7KA 4NHIA 5APCA 3CQLA 4R0FA 1CU3A 2ANXA 196LA 1L58A 4TWSA 1XGUC 2D91A 1DYFA 3C7ZA 3HUKA 3OE0A 3WMKA 1A4VA 110LA 2NTHA 133LA 1C68A 1QSBA 3SBAA 4G9SA 5FDJA 3GUJA 1CKCA 3ATNA 4XJDA 1LMCA 3IJVA 5B1GA 5L3IA 3NY9A 1YAOA 6LYTA 2MEAA 1LSDA 4ARMB 1L65A 2B6XA 1ZURA 1C10A 3WUAA 3FA0A 1JHLA 3SB7A 1QUSA 2B5ZA 1B6IA 1LZSA 1L72A 1ZVHL 5KXWA 1RI8B 3LZMA 175LA 200LA 1IC7Y 3CB7A 2DQAA 4XENA 4C3WA 1B7QA 2BAAA 1AM7A 3A6CY 210LA 7LZMA 3HTBA 1LHHA 208LA 1LJFA 5C6JA 1CKHA 1C64A 1GF3A 169LA 4H9HA 1NWGA 3C80A 4B4EA 4WL6A 3P65A 4LGKA 125LA 1LSEA 3CT0A 1GXXA 1I56A 1QUTA 1DKJA 4H8ZA 1L63A 4ETAA 2MEFA 1L86A 4DQ7A 1YAQA 5LAFA 3SB8A 1ZVYB 3ZVQB 1HEOA 1NHEA 1C6TA 4IAPA 225LA 3WXUA 1IP4A 2B6WA 255LA 1B5ZA 1NF5A 3WW6A 5T3FA 5DN5A 4XN6A 5A3ZA 242LA 1L85A 1B7NA 3W6BA 2ZILA 3G3WA 5LVJA 2NTGA 4FJRA 1BWJA 1N4FA 1BB7A 245LA 1GFJA 2F2QA 1LZ5A 1D0MA 4M4OA 4I7QA 4BAPA 1C66A 1TEWA 3K3TA 1IY3A 3IWRA 115LA 3EMSA 2F4GA 3LZ2A 1I6SA 1L54A 2F32A 1SSWA 4ET8A 1D3MA 1LSGA 1HEQA 4DT3A 3T36A 2C8PA 4LYCA 1WTHA 247LA 3JR6A 1OWZA 5EBHA 3ZEKA 5C6LA 2PC2A 3HBDA 1EL1A 1GF8A 1LSZA 4N8ZA 1GFHA 3DMXA 1CVKA 127LA 186LA 5HNLA 1GBOA 4LT3A 1JJ1A 2RBPA 4WMGA 2RBRA 2W1MA 221LA 4Z98A 4G4BA 1MLCE 2DQEY 1LTMA 1C6DA 4R6CA 1NQIA 2HECA 2ZYPA 2MEDA 2BLYA 4NHTA 1G0KA 1KNIA 4J7VA 1IP5A 153LA 1QTHA 5KXNA 4S0WA 1C08C 3HU8A 4WLTA 1HEWA 1UUZC 3C7YA 140LA 226LA 3W6FA 1HHLA 5F14A 1IR8A 1UCOA 1L14A 1P2CC 1G7LC 2HUMA 4DDBA 2MEBA 1NDGC 2BPUA 3GULA 1LGUA 3RT5X 1LSBA 1JEFA 1L25A 1L45A 4NHSA 4EKQA 4WM6A 1GFTA 1OUHA 2F47A 3RUNA 4WL7A 4K5YA 3BKHA 2Z39A 2EPEA 1JSFA 3AYQA 1SX2A 3DN0A 1CV4A 4PJZA 1LZ8A 2CWIA 1T6HA 1IP7A 3HTFA 4GCCA 1LZAA 3LYTA 4GCDA 4WOAA 5D5FA 223LA 1IX0A 3PBLA 1ALCA 1GB5A 2HEEA 1L08A 1H87A 3FI5A 1L07A 2F4AA 1C6FA 1DYCA 191LA 1L13A 1L16A 248LA 1B7MA 1L38A 4NHPA 1P56A 5LVHA 1EQ4A 1YROA 188LA 3WPJA 1L11A 1JJ0A 143LA 1L87A 1HENA 1L73A 1WQMA 2BQDA 138LA 2Z12A 4W55A 1L0KA 3C81A 167LA 1L21A 2B70A 3RW8A 1C6EA 1QSAA 1LGXA 1UIGA 1XJTA 1P36A 2ANVA 1L29A 1CX7A 4LYZA 1L79A 1L43A 2D6BA 220LA 1YQVY 2DQJY 2A7FA 4NSGA 2Z37A 4AGAA 1AKIA 3TXDA 1IWTA 4I7JA 258LA 4YF2A 3SN6R 129LA 4RW2A 1DYGA 2BLXA 2HU3A 3RU5A 4KL7A 1FLQA 1B2KA 2G4NA 1YKZX 3EXDA 1VDQA 1LSPA 2BQJA 3D3DA 130LA 1JPOA 1L71A 1LYZA 1OUAA 2B74A 1L53A 4PRQA 1B5WA 2H9JA 1NHBA 1PQMA 3BKVA 4NGYA 1L64A 205LA 1YKXX 1UC0A 2D4KA 5LINA 3EO5A 3CT1A 3HU9A 1IR7A 2Z2EA 1LZBA 1IWWA 3A34A 3CT5A 4W58A 5FEKA 1T8FA 4NG1A 4PPOA 1L59A 5LA5A 2OU0X 3CSQA 1LAAA 2HEBA 1C6GA 1LYIA 244LA 5HNCA 2BQFA 1OVJA 4GCFA 231LA 114LA 1J1PY 4NHQA 1G0PA 1LI2A 238LA 4DKLA 4W51A 3A6BY 1OWYA 5LVIA 1GFEA 4EPIA 3K2RA 4NGKA 4HTQA 5DL9A 2Q0MX 1HSXA 3AGIA 241LA 3B0IA 1L91A 1G7IC 3TMUA 3A91A 3N9EA 4I0CA 218LA 4ETBA 1L48A 1BB5A 1GF9A 3D9AC 1CU2A 5K7OA 2OTZX 1GBZA 4OOOA 4H9AA 1NKHA 2Z2FA 5ILCA 4EMNA 1L94A 1LYOA 1OYUA 257LA 3WPKA 3A96A 2Z18A 3HT8A 2BQOA 1LMTA 3ULRA 2O4WA 1JIYA 3C8QA 4XJBA 149LA 4NFVA 2LZMA 126LA 2BQAA 111LA 3LYOA 3OE6A 3SB9A 3WU8A 1JTPL 2W1XA 4XJGA 4LZTA 135LA 209LA 1QSWA 1HMKA 1SX7A 1HEPA 2RBSA 2XBRA 2HEFA 1LJEA 1CX6A 1V7TA 1BB4A 3A3RX 4EKSA 1XJUA 1QUGA 4H9BA 1JSEA 4ARMA 4HPIA 3GUNA 1IWZA 146LA 261LA 2DBTA 4CGEA 1LZ1A 222LA 3OK0A 3F6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ETE A;  4DD2 A;  1IC4 Y;  2DQA A;  4UWV A;  4XEN A;  4C3W A;  4H94 A;  1B7Q A;  1OUI A;  1GEV A;  1LHJ A;  2N5Z A;  4E3U A;  2BAA A;  1KIR C;  2FBD A;  1JKD A;  1LMN A;  2GV0 A;  1LZR A;  1AM7 A;  3A6C Y;  2FYD A;  1GBY A;  1NDM C;  1SQ2 L;  3N9A A;  5KXT A;  4ET9 A;  4DD9 A;  1LHH A;  208L A;  1LJF A;  1MEL L;  4WM1 A;  1CKH A;  2H5Z A;  5C6J A;  3B0O A;  5KXL A;  1OUF A;  4MR1 A;  1HFX A;  3KAM A;  1GF3 A;  5I5Q A;  1B7O A;  2LHM A;  4QEQ A;  4H9H A;  3AZ5 A;  1UIC A;  4N0J A;  3AW7 A;  1IOC A;  3TMX A;  1LHK A;  1GF4 A;  1NWG A;  2CGI A;  1KXY A;  4B4E A;  4WL6 A;  1UIF A;  1EQE A;  2A7D A;  3P65 A;  5F9U A;  4LGK A;  1NMM A;  4HPE A;  3LYZ A;  4H92 A;  1LSE A;  3CT0 A;  1C46 A;  1GXX A;  1I56 A;  1LJI A;  2BQB A;  1QUT A;  5KKI A;  4NWH A;  1DKJ A;  1HC0 A;  4H8Z A;  1FN5 A;  4RDS A;  4ETA A;  1IP2 A;  1JKB A;  1GE4 A;  4O34 A;  3VWO A;  2MEF A;  1WQR A;  5D5C A;  2ZQ3 A;  4OW1 A;  1YAQ A;  4LFX A;  4P2E A;  5LAF A;  1D6Q A;  1ZVY B;  3ZVQ B;  1HEO A;  4WLD A;  1YIL A;  1WQP A;  4RLM A;  3GXK A;  4U3X B;  1RFP A;  1I1Z A;  1NHE A;  5B06 A;  1QTK A;  1REX A;  2EQL A;  1E8L A;  4YM8 A;  3N9C A;  5I4Y A;  1OUB A;  1IP4 A;  3WXU A;  1G7H C;  4DD1 A;  2BQE A;  1UBZ A;  1B5Z A;  1LHI A;  2BQK A;  2DKV A;  3ZVQ A;  134L A;  3TMV A;  1NF5 A;  3WW6 A;  1KIP C;  4ML7 A;  5T3F A;  5DN5 A;  5HLL A;  9LYZ A;  4XN6 A;  4TTD A;  1IWY A;  4NEB A;  5A3Z A;  5E4P A;  5F81 A;  6LYZ A;  4OWH A;  1XFP L;  1B7N A;  3M3U A;  3W6B A;  2ZIL A;  4GN3 A;  5APF A;  5LVJ A;  4FJR A;  4C5F A;  1BWJ A;  1DPX A;  1N4F A;  4LYM A;  1BB7 A;  4B4J A;  1BWH A;  1NBZ C;  5F9X A;  4N1C C;  1GFJ A;  4YOP A;  4Z41 A;  3A95 A;  5LYT A;  1D0L A;  1LZ5 A;  2LZT A;  3G3B B;  1D0M A;  4M4O A;  5APD A;  5LXW A;  3LYM A;  2I6Z A;  4BAP A;  1TDY A;  4PJ2 C;  4RW1 A;  4HJY A;  1TEW A;  1JIT A;  3K3T A;  1IY3 A;  5E9R A;  4EOF A;  3IWR A;  4AXT A;  3EMS A;  1GB9 A;  2F4G A;  3LZ2 A;  2BQH A;  1XGR C;  1GFK A;  4GN4 A;  1GPQ C;  1SLY A;  5FEL A;  1KXW A;  5FCP A;  4ET8 A;  1OUG A;  1F6R A;  1IWV A;  1UAC Y;  1RJC B;  4DDC A;  2F30 A;  1LSG A;  2MEE A;  2MEG A;  3A93 A;  3P66 A;  4NSI A;  4ETC A;  3FE0 A;  193L A;  1HEQ A;  1CKD A;  2Z38 A;  1LKS A;  2Z19 A;  2LYM A;  5LVK A;  3T36 A;  2YBH A;  4DT3 A;  1G7M C;  2C8P A;  4LYC A;  5LA8 A;  1LJH A;  2G4Q A;  4LFP A;  4NIJ A;  4GLV A;  1GBX A;  4A7D A;  7LYZ A;  2DQD Y;  3HBE X;  2FBB A;  5DLA A;  3WUL A;  2MEH A;  1LSY A;  5L9J A;  5EBH A;  1JUG A;  1LZ4 A;  3LHM A;  2XTH A;  3OJP A;  1DKK A;  1EQ5 A;  3ZEK A;  1VDT A;  2BQN A;  3A90 A;  2PC2 A;  5C6L A;  4WM3 A;  1GFV A;  3HBD A;  1EL1 A;  1GF8 A;  1LSZ A;  4PHI A;  4FDY A;  4N8Z A;  4PRU A;  3W6D A;  3WU9 A;  4Z3M A;  1GFH A;  3WL2 A;  5HMV A;  4I8S A;  4LYO A;  1B9O A;  1GB6 A;  1IWX A;  1CJ6 A;  1GB2 A;  4YEM A;  5LVG A;  5KKJ A;  2HU1 A;  1GFA A;  1PS5 A;  2WAR A;  4XJH A;  5HNL A;  1IOR A;  2FYC A;  4H9E A;  1GBO A;  4IAT A;  1TBY A;  4LT3 A;  1JJ1 A;  1GFR A;  1WQQ A;  4NGV A;  5KXX A;  4WMG A;  4H93 A;  1GEZ A;  1GE0 A;  1WTN A;  2ZIJ A;  2W1M A;  1LYS A;  1DI3 A;  1IY4 A;  1V7S A;  4Z98 A;  4G4B A;  1MLC E;  2DQE Y;  3AZ6 A;  2MEI A;  3TXG A;  1LTM A;  4R6C A;  1NQI A;  2HEC A;  5B05 A;  1HFY A;  2ZYP A;  1TAY A;  1JIS A;  1Z55 A;  2MED A;  4BS7 A;  2BLY A;  1IVM A;  1LCN A;  4NHT A;  4H9I A;  4DYG A;  4J7V A;  4ANR A;  1T3P A;  1IP5 A;  153L A;  5KXN A;  1GF7 A;  1LHL A;  1XGT C;  3MGW A;  5DM9 A;  1C08 C;  4YEO A;  4WLT A;  2LYO A;  1HEW A;  1UUZ C;  2MEC A;  1CNS A;  4GLA A;  4IAS A;  1YAN A;  1VAU A;  3AB6 A;  3GXR A;  5L3H A;  2HED A;  1WVV A;  4H9C A;  1DXJ A;  1IEE A;  1UIB A;  1C45 A;  4WM2 A;  3AW6 A;  4NSH A;  3W6F A;  4KXI A;  4OOT A;  1HHL A;  1UIA A;  5F14 A;  4CFO A;  4J1B A;  1IR8 A;  1UCO A;  4NWE A;  1GAZ A;  1AZF A;  1G7L C;  1B7S A;  1P2C C;  1OUJ A;  4DDB A;  2MEB A;  1BB6 A;  3W3E A;  1NDG C;  2BPU A;  1LJK A;  4B1A A;  1LJ3 A;  3T6U A;  207L A;  4DWX A;  4KPM A;  4OWB A;  1XGP C;  2HTX A;  4WLY A;  2F2N A;  4IJ4 A;  1GB8 A;  2CJL A;  1LSB A;  1I20 A;  1JEF A;  1LMO A;  4NHS A;  3RT5 X;  4GCE A;  1TCY A;  5M1Y A;  1GFU A;  4DD0 A;  4WM6 A;  1GFT A;  1OUH A;  1B7L A;  1LZ9 A;  1DZB X;  1FLY A;  4WL7 A;  1A2Y C;  2BQG A;  3QE8 A;  4UWU A;  3EBA B;  3W6E A;  3WUN A;  1T6V L;  3BKH A;  3WU7 A;  1G7J C;  2Z39 A;  4TSB A;  2EPE A;  2HEA A;  4TX7 A;  1JSF A;  1BVK C;  3AYQ A;  4NGO A;  1C43 A;  1WQN A;  4NGI A;  2AUB A;  1GAY A;  1DI4 A;  1LZ8 A;  1LMP A;  2CWI A;  4KT3 A;  4XJF A;  1GB3 A;  3AGH A;  1FBI X;  1LOZ A;  2EKS C;  1IP7 A;  1IWU A;  2DQI Y;  4GCC A;  1D6P A;  1LSA A;  1LZA A;  1OQM A;  3CSZ A;  2LZ2 A;  3LYT A;  1B5U A;  1IOQ A;  4GCD A;  3TMW A;  3WH1 A;  1LJ4 A;  1VED A;  4WOA A;  5D5F A;  1GWD A;  1IX0 A;  2ZYC A;  2EIZ C;  4B0D A;  5LAG A;  1LPI A;  1YL0 X;  4NY5 A;  1ALC A;  1GB5 A;  1JWR A;  1IO5 A;  4OWA A;  1BHZ A;  2HEE A;  1H87 A;  3SP3 A;  1LSF A;  4CJ2 A;  2F4A A;  2I26 L;  4TUN A;  1CKF A;  4NSJ A;  2H9K A;  1KIQ C;  5KXS A;  5KY1 A;  1HML A;  1IP3 A;  1PZY A;  4H8Y A;  4XAD A;  1B7M A;  4LYT A;  4N9R A;  4NHP A;  4X3B A;  5LVH A;  1D0K A;  4GCB A;  1EQ4 A;  2ZQ4 A;  5AMY A;  1YRO A;  1GB0 A;  1VFB C;  1RCM A;  1B7R A;  1LMQ A;  2ZNW Y;  1IIZ A;  3WPJ A;  1F6S A;  4CHX A;  1LZY A;  1QDR A;  3HFM Y;  1JJ0 A;  1RE2 A;  1GHL A;  5LYZ A;  4QGZ A;  1HNL A;  4XYY A;  2W1L A;  5KXO A;  1J1O Y;  1CKG A;  4NG8 A;  3WUM A;  5I54 A;  1HEN A;  1GDX A;  1HSW A;  1WQM A;  1XEJ A;  3TXJ A;  1LJN A;  2BQC A;  2BQD A;  1LYY A;  4OWC A;  4ZFP A;  2Z12 A;  1DPW A;  1QIO A;  5FHW A;  4LT2 A;  4DD3 A;  1AT5 A;  1BQL Y;  1QQY A;  1LKR A;  2CDS A;  5KXM A;  1GFG A;  4NGZ A;  2IFF Y;  1GXV 2;  4XJI A;  1XEI A;  2DQC Y;  4N5R A;  2ZWB A;  5LYM A;  1FLU A;  1JJ3 A;  1WVU A;  3RW8 A;  1QSA A;  4H1P A;  1IC5 Y;  1UIG A;  4WM4 A;  1IOS A;  2YBN A;  5KXY A;  5IEL A;  5KXR A;  1O23 A;  1QTE A;  1FLW A;  1HF4 A;  4B4I A;  2IHL A;  5HMJ A;  3B0K A;  4G4C A;  1CJ9 A;  1QDT A;  5B07 A;  3G3A B;  4Z46 A;  4LYZ A;  1LJG A;  4LT1 A;  2D6B A;  2DQG Y;  2G4P A;  1VAT A;  1YQV Y;  4HV2 A;  1B5V A;  2DQJ Y;  4D9Z A;  2A7F A;  1GF5 A;  1LZD A;  2Z37 A;  4G49 A;  4NSG A;  1AKI A;  1NBY C;  4YEN A;  1D9U A;  1IWT A;  3TXD A;  4AGA A;  8LYZ A;  1BVX A;  3TXF A;  1LZN A;  3E3D A;  4W94 A;  3AJN A;  4YF2 A;  1HFZ A;  5I53 A;  4QDN A;  2BQI A;  4RW2 A;  3RZ4 A;  2HU3 A;  2BLX A;  4H91 A;  1HEL A;  2YSS C;  3RU5 A;  1CJ8 A;  4KL7 A;  3P68 A;  1FLQ A;  194L A;  1REZ A;  3HBH A;  1IP1 A;  1WTM A;  1B2K A;  1GBW A;  1H6M A;  1LHM A;  5F16 A;  1LSC A;  2G4N A;  1HER A;  5KXZ A;  5B59 A;  1JTO L;  1YKZ X;  1UID A;  2W1Y A;  3W6C A;  3AZ4 A;  3EXD A;  5KXP A;  1VDQ A;  1LSP A;  2BQJ A;  1GF6 A;  4M6D A;  3TXB A;  3D3D A;  1LJJ A;  1JPO A;  1JKC A;  1LYZ A;  1OUA A;  5IHG A;  1DI5 A;  2ZIK A;  3A67 Y;  2YBJ A;  4PRQ A;  1B5W A;  2H9J A;  154L A;  1GE1 A;  1FKV A;  4H9F A;  3WW5 A;  4CFP A;  1INU A;  1VDS A;  3J6K A;  3QY4 A;  2HUB A;  2RSC A;  1GD6 A;  3BKV A;  4NGY A;  1LSN A;  3M18 B;  4RLN A;  2X0A A;  1YKX X;  1UC0 A;  3LN2 A;  2D4K A;  4NGJ A;  3EO5 A;  3CT1 A;  5LIN A;  1JKA A;  1IR7 A;  4QY9 A;  2Z2E A;  3A94 A;  1CJ7 A;  4HP0 A;  1REM A;  1XEK A;  1LZB A;  3P64 A;  4WM5 A;  1IWW A;  3A34 A;  2D4J A;  3CT5 A;  5APE A;  5FEK A;  1ZMY L;  4NG1 A;  2XJW A;  4PPO A;  4HV1 A;  1J1X Y;  1KXX A;  4HJV A;  4MCK A;  5LA5 A;  4ZIX A;  132L A;  3W6A A;  3CSQ A;  1DQJ C;  1LAA A;  2HEB A;  1GE3 A;  4WO9 A;  5II3 A;  5HNC A;  3TXH A;  5JEN B;  2BQF A;  3WVX A;  4B49 A;  4ETD A;  1BWI A;  4LT0 A;  1LSM A;  1UIE A;  2XBS A;  4GCF A;  1B5X A;  2D4I A;  4J0L A;  4BAD A;  3TXE A;  1YAM A;  3FI7 A;  3TXI A;  1J1P Y;  2VB1 A;  3A3Q A;  1FKQ A;  1YKY X;  4HTN A;  4NHQ A;  1OP9 B;  5KXK A;  2YBL A;  1LZC A;  3A6B Y;  1IOT A;  3AGG G;  5LVI A;  1GFE A;  1OUC A;  3RNX A;  1BGI A;  3B72 A;  3IJU A;  4WG1 A;  5FST A;  1GBS A;  3B6L A;  4NGK A;  3WPL A;  4HTQ A;  2BQM A;  4WG7 A;  3WXT A;  1GF0 A;  5DL9 A;  4GN5 C;  1B5Y A;  1JTT L;  1HSX A;  2Q0M X;  3AGI A;  3P4Z A;  5HQ1 A;  1UIH A;  3B0I A;  5I4X A;  1G7I C;  1YAP A;  5DN4 A;  1ZV5 L;  3A91 A;  3N9E A;  4I0C A;  3TMU A;  5B1F A;  5ILF A;  3TXK A;  4ETB A;  3AZ7 A;  4UWN A;  1BB5 A;  1GF9 A;  1F10 A;  3D9A C;  1FDL Y;  3QNG A;  1B7P A;  4DD7 A;  3A8Z A;  2C8O A;  5K7O A;  1XGQ C;  4NHI A;  1YL1 X;  1GBZ A;  4WO6 A;  5APC A;  2YBI A;  3CQL A;  3J4G A;  4OOO A;  4R0F A;  1WQO A;  5J7C A;  1YIK A;  1AT6 A;  1XGU C;  4H9A A;  4TWS A;  5C6I A;  1LZT A;  2D91 A;  1HEM A;  1NKH A;  2Z2F A;  5KJ9 A;  5ILC A;  4EMN A;  2NWD X;  1LYO A;  4L41 A;  3WMK A;  4HJZ A;  1F0W A;  4G4H A;  1A4V A;  3WPK A;  2YBM A;  3A96 A;  4PGJ B;  4DDA A;  4ZEE A;  2Z18 A;  2Y8P A;  2DQH Y;  4DC4 A;  1XSF A;  4MST A;  2BQO A;  1LMT A;  133L A;  1C7P A;  3ULR A;  1VDP A;  1LZ6 A;  1JIY A;  4G9S A;  5FDJ A;  3LZT A;  4OWE A;  4XJB A;  5LIO A;  4NFV A;  1OUD A;  3LYO A;  2BQA A;  1CKC A;  3WU8 A;  1GE2 A;  1JTP L;  3ATN A;  4N1E I;  4W96 A;  2W1X A;  4WLX A;  1IP6 A;  4XJG A;  4H90 A;  2LYZ A;  1GDW A;  1OUE A;  4LZT A;  4XJD A;  4LYB A;  1LMC A;  135L A;  3IJV A;  1LMA A;  1QSW A;  1HMK A;  1YAO A;  5B1G A;  5A3E A;  5L3I A;  4NGW A;  6LYT A;  1REY A;  2MEA A;  1HEP A;  1LSD A;  4NGL A;  2XBR A;  4TSC A;  2HEF A;  1LJE A;  1W6Z A;  2I25 L;  1C10 A;  3WUA A;  4BAF A;  1JHL A;  2ZNX Y;  3WVY A;  1V7T A;  1BB4 A;  3A3R X;  1LZE A;  2YVB A;  1QUS A;  3A92 A;  3ATO A;  4II8 A;  4HSF A;  2B5Z A;  5I4W A;  1LZG A;  1LZS A;  4H9B A;  1JSE A;  4HPI A;  1UA6 Y;  1ZVH L;  2DQF C;  1GB7 A;  1IWZ A;  1RI8 B;  4HTK A;  5IDD A;  2BQL A;  5KXW A;  1W08 A;  1IR9 A;  1IC7 Y;  2DBT A;  4CGE A;  1LZ1 A;  3CSR A;  3WYH A;  4J1A A;  3OK0 A;  3CB7 A;  2YDG A;  1B0D A;  1BB3 A;  4H8X A;  3F6Z A; 
#chains in the Genus database with same CATH topology
 4ETE A;  1QAQ A;  1VEG A;  4UWV A;  3KVW A;  2N35 A;  5ITU A;  253L A;  1QZE A;  2CUZ A;  2FYD A;  4QOZ C;  2XFT A;  3N9A A;  4ET9 A;  4DD9 A;  4DR2 M;  5KXL A;  4OVZ B;  4WM1 A;  3ZC7 B;  2H5Z A;  1OUF A;  1CV6 A;  1HFX A;  3KAM A;  5I5Q A;  3TE6 A;  1B7O A;  3HDE A;  2LVP C;  1JTN A;  4QEQ A;  1L41 A;  1CV3 A;  1UIC A;  1IOC A;  1C6A A;  4FD2 A;  1L44 A;  1GF4 A;  2L2D A;  3CDO A;  2FFJ A;  1PJS A;  1IM2 A;  2DHR A;  4H92 A;  1YE9 A;  1KYI A;  1C46 A;  3DMZ A;  4LGM A;  4AI6 A;  4JI5 M;  2YR0 A;  2CV2 A;  4RDS A;  1KW5 A;  4G4N A;  1GE4 A;  3T1Y M;  1L17 A;  1XXH A;  3UON A;  1WQP A;  2O25 A;  1RFP A;  1L93 A;  4B3T M;  4XK8 F;  141L A;  1OAI A;  4II7 A;  131L A;  1LHI A;  2DKV A;  2BQK A;  1KFV A;  3ZVQ A;  2YQZ A;  1IFY A;  3OE8 A;  1L83 A;  9LYZ A;  4TTD A;  4NEB A;  1L0J A;  5E4P A;  3NY8 A;  4LJ4 A;  4G3O A;  4RNA A;  3KOY E;  5APF A;  4ARJ A;  2OE4 X;  1F4I A;  2F5Q A;  1DPX A;  1L76 A;  1L70 A;  4B4J A;  3HGI A;  3BOS A;  3U6D A;  1NBZ C;  5F9X A;  4N1C C;  3A95 A;  1D0L A;  3VK8 A;  5APD A;  5LXW A;  2I6Z A;  5EXP A;  3GRU A;  1L68 A;  3FYD A;  4IBJ A;  1JIT A;  3U6E A;  2XFS A;  240L A;  1P46 A;  3B74 A;  2BQH A;  1XGR C;  3V2W A;  3I01 M;  5FCP A;  1F6R A;  3GLI E;  4AG5 A;  1RJC B;  2KNV A;  4NSI A;  3FE0 A;  1CU5 A;  2Z19 A;  2OOA A;  1L22 A;  2LYM A;  5LVK A;  1G7M C;  4M9X A;  2C99 A;  3L26 A;  1LJH A;  4GLV A;  4A7D A;  1L27 A;  5DLA A;  1QS9 A;  159L A;  2XGN A;  2XZU A;  2XTH A;  3OJP A;  1EQ5 A;  1L89 A;  5FTM A;  4W59 A;  3A90 A;  1GFV A;  157L A;  1J7K A;  4FDY A;  2JY6 B;  3WU9 A;  3SHF A;  3T38 A;  5EP3 A;  4I8S A;  4LYO A;  1L31 A;  1B9O A;  1IWX A;  2LBC A;  4YEM A;  5LVG A;  2LHC A;  2HU1 A;  104L A;  1GFA A;  1PS5 A;  2WAR A;  4XJH A;  2FYC A;  1G06 A;  4IAT A;  1TBY A;  4PK0 A;  1WQQ A;  4F1I A;  3LCU A;  2ZIJ A;  181L A;  3WHK A;  3U5Z B;  1LYS A;  2MEI A;  1V7S A;  3AZ6 A;  3GQ5 A;  3EIH A;  152L A;  1Z55 A;  177L A;  2RBQ A;  1LCN A;  4H9I A;  4DYG A;  4R3D A;  1L97 A;  1C60 A;  1GF7 A;  1LHL A;  1XGT C;  4F2L A;  4YEO A;  4G4Q A;  4W57 A;  1P6Y A;  4B08 A;  1Z59 A;  172L A;  3AB6 A;  3GXR A;  2HL7 A;  1EPY A;  3OTO M;  1DXJ A;  1IEE A;  1UIB A;  1DGH A;  4NSH A;  4KXI A;  1G1W A;  1GVN A;  1G0L A;  4GMQ A;  1HR0 M;  4J1B A;  1GAZ A;  1AZF A;  1BB6 A;  151L A;  1LJK A;  2R4E A;  1C6L A;  2DWM A;  190L A;  1G0Q A;  1C61 A;  2HTX A;  3I04 M;  2CJL A;  3DN6 A;  3IG8 A;  3JAM S;  2ZBK B;  5KO3 A;  4R71 A;  1L36 A;  1B7L A;  1N32 M;  1HNW M;  3U61 A;  3FKE A;  4TSB A;  2HEA A;  4PDI A;  1BVK C;  1WQN A;  1QYR A;  1JQU A;  1X37 A;  1GAY A;  3HT6 A;  4YXA C;  2O7A A;  1ZMW A;  1GB3 A;  1GKI A;  3L27 A;  1FBI X;  1IWU A;  2CV1 A;  4X3B A;  1OQM A;  3U6S A;  3TMW A;  1IOQ A;  184L A;  3WH1 A;  1XNR M;  1LJ4 A;  4JI8 M;  170L A;  4EJ4 A;  4JXJ A;  2RB2 X;  4IBC A;  1TTE A;  2ZYC A;  2D7E A;  4B0D A;  1YL0 X;  4NY5 A;  3AOE A;  4JI2 M;  4OWA A;  1JWR A;  3JR5 A;  1BHZ A;  3FUW A;  3SP3 A;  2RAY X;  1L75 A;  3KP0 E;  1XB2 B;  3UMM A;  2H9K A;  5KXS A;  182L A;  1PZY A;  4XAD A;  2DAK A;  3KOZ E;  4LYT A;  4N9R A;  2C98 A;  5AMY A;  3FUX A;  1GLN A;  1P37 A;  3HT9 A;  1IIZ A;  1F6S A;  1T43 A;  3DNA A;  1LZY A;  1ZWN A;  1QDR A;  4IBD A;  4QGZ A;  3B7N A;  4I7R A;  4IBG A;  2H5X A;  109L A;  4DR3 M;  1L02 A;  1J1O Y;  2W1L A;  4XYY A;  5KXO A;  1GDX A;  3DMV A;  3SAR A;  1HSW A;  1XEJ A;  108L A;  1C6J A;  1LJN A;  4ZFP A;  1C6Q A;  4AKH A;  5FHW A;  4DD3 A;  1QQY A;  4NGZ A;  3R8F A;  1GAB A;  4AW4 A;  1PQO A;  2ZWB A;  5LYM A;  2QCU A;  1JJ3 A;  1WVU A;  1OIZ A;  4D80 A;  3LVV A;  1LYE A;  1QTE A;  1PJI A;  1MN3 A;  4G4C A;  1PJQ A;  1CJ9 A;  2LXE A;  1CUK A;  3HDF A;  3LQR A;  1LW9 A;  3M6A A;  3CDT A;  1LJG A;  3VKG A;  4JI3 M;  2DQG Y;  1VAT A;  2RBN A;  4DR7 M;  2JY8 A;  227L A;  2C5R A;  2WSC F;  1LZD A;  1OVH A;  1BVX A;  2CHV A;  4LF9 M;  3E3D A;  1D9W A;  4YXC A;  3SHG B;  1NHW C;  5I53 A;  1J09 A;  147L A;  2B6Z A;  1CJ8 A;  3P68 A;  3GLF E;  4BBA A;  1REZ A;  1T6O A;  1L10 A;  1WTM A;  5F16 A;  1L49 A;  1L67 A;  2QEN A;  1HER A;  1L2C A;  3DZD A;  4FWH A;  1L42 A;  4IBB A;  1L26 A;  5KXP A;  3GQ3 A;  2R45 A;  1JKC A;  5IHG A;  1DI5 A;  3A67 Y;  3I51 A;  3M0E A;  173L A;  2YBJ A;  3HUA A;  4W54 A;  1R7R A;  1D2Y A;  2A4T A;  1GE1 A;  4CFP A;  2HUK A;  4LF7 M;  2QPA A;  3WHL A;  2V1C A;  3GLI A;  3IEC A;  1KSF X;  1NV8 A;  4EPF A;  2JZ0 A;  2Z7J A;  1W5T A;  3U61 B;  2QP9 X;  2FE8 A;  4HP0 A;  1P2L A;  1XEK A;  3SBB C;  3U6M A;  3P64 A;  4WM5 A;  3KP1 E;  2D4J A;  2MH8 A;  4GH9 A;  1ZMY L;  2XJW A;  4HV1 A;  3B7Q A;  1Q39 A;  4MCK A;  1QT7 A;  3W6A A;  3HHZ A;  3FE3 A;  4M9S A;  1DQJ C;  217L A;  1GE3 A;  1P2R A;  4I7N A;  2RAZ X;  5JEN B;  4ETD A;  3WVX A;  4B49 A;  4LT0 A;  1UIE A;  2V6Z M;  2D4I A;  2CWB A;  4BAD A;  3FI7 A;  3A3Q A;  1IOT A;  3GUI A;  3J2P B;  161L A;  4WG1 A;  3HHY A;  1GBS A;  3B6L A;  2RH1 A;  1C1K A;  2BQM A;  4WG7 A;  5BPV A;  3WXT A;  1G41 A;  4S12 A;  3KS8 A;  5C18 A;  3P4Z A;  5I4X A;  1HQC A;  4QOS A;  5HQ1 A;  1UIH A;  1N78 A;  1L52 A;  4LF4 M;  4IBI A;  3AZ7 A;  3E46 A;  1FDL Y;  1B7P A;  1S3S A;  4PDG A;  1YL1 X;  1QUH A;  1C6K A;  3GRR A;  1WQO A;  1OFI A;  168L A;  2KW0 A;  5J7C A;  4FCT A;  1YIK A;  1XC8 A;  3OE9 A;  1CTW A;  1HEM A;  5KJ9 A;  199L A;  2IGC A;  4P17 A;  1DYD A;  2KHH A;  4HJZ A;  3U60 B;  3HZJ A;  4PGJ B;  1G0G A;  4DDA A;  1HT1 E;  1D3N A;  3HH4 A;  1XSF A;  2H1R A;  2KNZ A;  1MJG M;  1LZ6 A;  4JI1 M;  2EKK A;  4NSO B;  3VFD A;  201L A;  2X49 A;  1GE2 A;  4N1E I;  3TWL A;  5EXX A;  1GDW A;  3FAD A;  1JR3 D;  4PCZ A;  3RGS A;  1LMA A;  3DKE X;  4NGW A;  4TSC A;  3HT7 A;  4NRW A;  4GIP A;  4LJ8 A;  2I25 L;  2OO9 A;  4BAF A;  2ZNX Y;  3WVY A;  4TUW A;  2YVB A;  120L A;  3A92 A;  4PT5 A;  5KQD A;  3ATO A;  1HNZ M;  3ZQJ A;  3DN4 A;  1UA6 Y;  3AL0 C;  1L92 A;  2BQL A;  3I4V A;  1W08 A;  2R44 A;  3L2A A;  1IR9 A;  3V2Y A;  2XSZ A;  3CSR A;  3WYH A;  4J1A A;  3K2L A;  2YDG A;  2QBY A;  1ZAE A;  4L15 A;  1R4G A;  4MGH A;  3C7W A;  4H94 A;  1GEV A;  3CDQ A;  1LHJ A;  214L A;  4E3U A;  2GV0 A;  3HU1 A;  4DUZ M;  5F3W A;  2L78 A;  1GBY A;  1NDM C;  1SQ2 L;  4I7T A;  5KXT A;  4HLQ A;  1MEL L;  1SG9 A;  2BWB A;  1CV5 A;  3B0O A;  1L28 A;  1WXQ A;  4MR1 A;  1CV0 A;  1LWK A;  4HL4 A;  2ERC A;  2LHM A;  1NNJ A;  3F92 A;  3AZ5 A;  107L A;  4CIZ A;  4N0J A;  3TMX A;  4DV5 M;  1L19 A;  1LYG A;  5LZM A;  3EIE A;  2UU9 M;  1DYB A;  1UIF A;  3TPZ A;  2J5Y A;  4B7H A;  4AQY M;  2F5S A;  5F9U A;  4K0K M;  1L2B A;  123L A;  3PNV A;  4NWH A;  5IWA M;  122L A;  2WZJ A;  1HC0 A;  1SSY A;  1L81 A;  1JKB A;  4O34 A;  2B75 A;  4OW1 A;  1GL6 A;  4P2E A;  1D6Q A;  174L A;  1L61 A;  224L A;  4DR6 M;  4WLD A;  4RLM A;  3GXK A;  1WGL A;  4U3X B;  1J5E M;  198L A;  1QTK A;  1REX A;  2G5G X;  3N9C A;  1DGB A;  1G7H C;  4DD1 A;  2BQE A;  3HU3 A;  1UBZ A;  3CGW A;  1QTZ A;  3GPP A;  5ITX E;  1IN5 A;  3PVS A;  4Q7J A;  1QVR A;  4BB9 A;  1XMQ M;  3HX3 A;  3EML A;  4I7M A;  5F81 A;  3AOE C;  1XFP L;  4IIW A;  1L04 A;  4KO8 A;  219L A;  4C5F A;  4DV6 M;  4LYM A;  2VDB B;  5LYT A;  4ARL A;  2LZT A;  206L A;  3G3B B;  4W52 A;  2F5O A;  3LYM A;  1G4A E;  1TDY A;  178L A;  4PJ2 C;  4RW1 A;  4HJY A;  3UZU A;  5E9R A;  4AXT A;  1GB9 A;  5L8R F;  1P5C A;  1GFK A;  4GN4 A;  1SLY A;  3F9L A;  5FEL A;  2HCB A;  1L80 A;  1IWV A;  2W82 A;  2OTY X;  4DDC A;  4MGZ E;  1L20 A;  1XHB A;  4EKP A;  4ETC A;  5KPR A;  1L88 A;  1N36 M;  3MK6 A;  1LKS A;  158L A;  1E94 E;  1LWG A;  1LYD A;  5LA8 A;  2G4Q A;  4NIJ A;  2QSF X;  1GBX A;  1TGU A;  5DYG A;  2CRU A;  2FBB A;  3HBE X;  2OOB A;  3WUL A;  2MEH A;  3U6L A;  5L9J A;  3FUV A;  2APL A;  3H4M A;  4JI0 M;  3W68 A;  3QAK A;  1GL7 A;  1HJP A;  3LVW A;  1JUG A;  1LZ4 A;  3LHM A;  1DKK A;  1L82 A;  1A5T A;  1L24 A;  1VDT A;  2BQN A;  103L A;  1IBL M;  2HWJ A;  4PHI A;  3W6D A;  3SYL A;  3LMM A;  3SBJ A;  5HMV A;  4ARP A;  2DXI A;  3GUP A;  1GB2 A;  5ITT A;  5KKJ A;  2B73 A;  4DR1 M;  1IOR A;  4H9E A;  1H6U A;  1Q3B A;  2GQF A;  1L40 A;  5EP1 A;  1GFR A;  1L46 A;  189L A;  4NGV A;  5KXX A;  4D81 A;  254L A;  1WTN A;  250L A;  1ORY B;  3Q8X A;  3AOG A;  3DN3 A;  3R9X B;  1HFY A;  215L A;  1QUO A;  2Y0T A;  4AKI A;  229L A;  2UXB M;  4ANR A;  2ZM6 M;  3U5Z A;  4ARQ B;  3G3X A;  3SAW A;  3T15 A;  1GJS A;  2KXE A;  3C83 A;  4GKJ M;  1CNS A;  4GLA A;  3HKP A;  1P7S A;  1VAU A;  2HED A;  113L A;  2OU8 A;  2LVQ D;  4WM2 A;  1QT8 A;  4E97 A;  1C45 A;  1CU0 A;  3AW6 A;  3NBI A;  4B3S M;  2KRK A;  4OOT A;  1UIA A;  1SXJ E;  185L A;  4CFO A;  3FTF A;  4NWE A;  1QQW A;  1B7S A;  4EKR A;  1L99 A;  1OUJ A;  1L12 A;  1L56 A;  1HQY E;  4B1A A;  2XLJ A;  4LJ6 A;  3NBX X;  1G59 A;  4KPM A;  4AQN A;  1XGP C;  2V1U A;  1T8G A;  4IJ4 A;  2BJW A;  4HEO A;  1CUQ A;  3NYA A;  1C6M A;  4GCE A;  2KDL A;  1TCY A;  4DD0 A;  4I7P A;  1QT4 A;  1DZB X;  1A2Y C;  1OQY A;  3WUN A;  3W0F A;  2QNJ A;  1L1Z A;  3GLF B;  4NGO A;  1JQJ C;  1L98 A;  4NGI A;  4NL4 H;  2OPF A;  2K6B A;  2VII A;  2FOI C;  2J7O A;  2HUL A;  119L A;  3AGH A;  2K9D A;  1DYE A;  251L A;  1LOZ A;  2EKS C;  3PNY A;  2DQI Y;  1LSA A;  1D3F A;  5KPZ A;  4GC5 A;  1C69 A;  1LI6 A;  1QS5 A;  1VED A;  1L96 A;  1GWD A;  3RGP A;  1I94 M;  3D8L A;  3SAT A;  1HNX M;  1LSF A;  4CJ2 A;  1KY1 A;  1L66 A;  1TH4 A;  234L A;  1KIQ C;  5KY1 A;  1HML A;  5I14 A;  4YX7 C;  3GLG E;  4LRS A;  1W5S A;  4GCB A;  2EKF A;  2ZQ4 A;  1VFB C;  4Z8X A;  3HH6 A;  1B7R A;  4CHX A;  2P5T A;  2E5L M;  1RE2 A;  252L A;  1GHL A;  3HFM Y;  5LYZ A;  1HNL A;  2B6T A;  128L A;  1NVM A;  1CKG A;  4NG8 A;  4NRV A;  3WUM A;  4GRV A;  3I4Y A;  2Z8Y M;  2BQC A;  4OWC A;  1DPW A;  2JNH A;  4DUY M;  1BQL Y;  1NY6 A;  2Z6B A;  5KXM A;  2QAR C;  3BXW A;  1GXV 2;  3FUU A;  2DZL A;  1Y8G A;  1L37 A;  3H4J A;  1FLU A;  1V92 A;  1IN7 A;  4Z6Y A;  2KEB A;  2YBN A;  5KXR A;  1L35 A;  1O23 A;  4DAJ A;  1FLW A;  2DKL A;  2O79 A;  3GLH E;  4B4I A;  2IHL A;  3D4S A;  3E9S A;  3B0K A;  1OV5 A;  3DA1 A;  1QDT A;  1LYJ A;  1C67 A;  1L69 A;  4LT1 A;  4MGK E;  180L A;  4HV2 A;  1L51 A;  5DFL A;  1B5V A;  1G8P A;  4YEN A;  3HTD A;  3JR4 A;  4G49 A;  3C8R A;  5EXT A;  3J80 S;  8LYZ A;  1QT5 A;  3TXF A;  4W94 A;  3AJN A;  1HFZ A;  1MX0 A;  3AFH A;  3K9P A;  1LGW A;  2EJS A;  1QT3 A;  2BQI A;  3CF2 A;  4FWD A;  1HEL A;  1C6B A;  1SWZ A;  2K0B X;  3HBH A;  1IY0 A;  1IP1 A;  3L25 A;  1KW7 A;  1GBW A;  1LHM A;  1TDZ A;  232L A;  3QWL A;  4WW0 A;  1PQK A;  5B59 A;  1E32 A;  1UID A;  3C8S A;  3AZ4 A;  1DO2 A;  2LNH C;  1PQD A;  4L78 A;  4M6D A;  3TXB A;  1LJJ A;  1L90 A;  1C6P A;  2ZIK A;  4QNM A;  1JTM A;  1C6N A;  1FNN A;  5ITQ A;  1IY2 A;  3J7B A;  1FKV A;  260L A;  4H9F A;  3WW5 A;  1INU A;  1VDS A;  3J6K A;  1GD6 A;  1LSN A;  1IY1 A;  4AKG A;  4RLN A;  3SB5 A;  1IN4 A;  4NGJ A;  4FWG A;  1CJ7 A;  4MGI E;  1REM A;  4LJ9 A;  1IN6 A;  4G6Z A;  1OAO C;  144L A;  4LRT A;  1PQI A;  3SAV A;  1J1X Y;  1KXX A;  2MJ5 B;  1CUP A;  4ZIX A;  3CDV A;  132L A;  3E4R A;  3VLF B;  2VF7 A;  148L E;  187L A;  3B9P A;  1QUD A;  4WO9 A;  2DAG A;  5II3 A;  4EXM A;  3TXH A;  1L50 A;  2O5R A;  1LSM A;  118L A;  3HU2 A;  4J0L A;  1YAM A;  3TXI A;  3VDU A;  1YKY X;  2RBO A;  4JV5 M;  2YBL A;  1LZC A;  3AGG G;  3RNX A;  3B72 A;  3IJU A;  195L A;  5FST A;  1QT6 A;  1KY0 A;  1P64 A;  3WPL A;  1B5Y A;  1JTT L;  3KSX A;  5DN4 A;  4LDE A;  6LZM A;  5B1F A;  3ZCB B;  3GQ4 A;  259L A;  2Z4R A;  1F10 A;  1L74 A;  3QNG A;  3HJS A;  4DD7 A;  3A8Z A;  4LF5 M;  2C8O A;  4WO6 A;  2YBI A;  3J4G A;  2BJV A;  2KZU A;  3SMP A;  2Q2E B;  139L A;  211L A;  239L A;  4DJH A;  1AT6 A;  5C6I A;  4I7S A;  165L A;  1LZT A;  3GP1 A;  1L8Q A;  4L8R C;  2NWD X;  4L41 A;  2XQO A;  1F0W A;  4G4H A;  3B89 A;  112L A;  2YBM A;  1C63 A;  4ZEE A;  2Y8P A;  2DQH Y;  5FLX S;  4DC4 A;  2RB1 X;  4MST A;  2C96 A;  4GHL A;  1C7P A;  1VDP A;  3LZT A;  4OWE A;  5LIO A;  4I81 A;  3U60 A;  1OUD A;  2JWS A;  3DN8 A;  1FJG M;  4W96 A;  3HJQ A;  4WLX A;  1IP6 A;  4H90 A;  2LYZ A;  1OUE A;  2NQ8 C;  4LYB A;  1D2N A;  1JR3 E;  4CGY B;  2D7G A;  1DYA A;  2B72 A;  5A3E A;  3J27 B;  4CJ6 A;  1REY A;  4NGL A;  1C7Y A;  160L A;  1LI3 A;  1W6Z A;  2LTU A;  3VW7 A;  1LZE A;  5JI3 E;  1OJL A;  5I4W A;  4II8 A;  4HSF A;  1LZG A;  2DQF C;  1GB7 A;  4HTK A;  5IDD A;  2L7H A;  3DFZ A;  156L A;  176L A;  243L A;  4DV1 M;  4LJA A;  102L A;  4LFC M;  1B0D A;  2C9O A;  1BB3 A;  4H8X A;  4DD2 A;  2LVO C;  3M7G A;  4REZ A;  1IC4 Y;  3MJ5 A;  2VF8 A;  142L A;  4JI7 M;  3AV0 A;  1OUI A;  3KFU G;  2N5Z A;  1MU5 A;  3CDR A;  2R6F A;  3U6O A;  1KIR C;  1JKD A;  1LMN A;  2FBD A;  1L60 A;  1LZR A;  1HT2 E;  4ZPX A;  3ILK A;  5IRE B;  2CHG A;  4WUR A;  5DYI A;  2L4F A;  4W53 A;  2KRU A;  1NO1 A;  4PD2 A;  1L39 A;  2DWZ B;  1L57 A;  3AW7 A;  163L A;  1LHK A;  5IT9 S;  2CGI A;  1D2W A;  1KXY A;  1C6C A;  1EQE A;  2A7D A;  4X64 M;  1NMM A;  3E21 A;  235L A;  3THG A;  4HPE A;  3LYZ A;  3HUQ A;  1LJI A;  2BQB A;  5KKI A;  3SB6 A;  1FN5 A;  1IP2 A;  1C65 A;  3GLH A;  3VWO A;  2F5P A;  3IG5 A;  2JXN A;  5EP2 A;  4LF6 M;  1WQR A;  4AG6 A;  5D5C A;  2ZQ3 A;  2R65 A;  4LFX A;  3ODU A;  4NXN M;  1G07 A;  1YIL A;  2I7P A;  1I1Z A;  137L A;  5B06 A;  2EQL A;  1E8L A;  4YM8 A;  1L47 A;  5I4Y A;  1L09 A;  1OUB A;  1QTC A;  1OV7 A;  4UN2 B;  3DN1 A;  5EXS A;  1LV7 A;  1WGN A;  2ZTC A;  2GNO A;  134L A;  1LYH A;  256L A;  3TMV A;  3TL4 X;  1KIP C;  230L A;  4ML7 A;  5HLL A;  1IWY A;  1OKS A;  6LYZ A;  4OWH A;  3HWS A;  4ZPU A;  1BVS A;  5FTK A;  3M3U A;  4M0D A;  1SXJ B;  1WIV A;  4GN3 A;  1E9R A;  2XSZ D;  3LQQ A;  2Q9D A;  1BWH A;  3SC3 A;  4YOP A;  4Z41 A;  4MM3 B;  2QB0 B;  1QSQ A;  1L84 A;  3GRY A;  5H37 D;  2OE7 X;  4EOF A;  213L A;  2LCB A;  1GPQ C;  1QAN A;  2BWE A;  1KXW A;  5FSW A;  2LWX A;  1OUG A;  1DGG A;  2B7X A;  1UAC Y;  1PQJ A;  2DWN A;  1GJT A;  2CP8 A;  4GRI A;  2F30 A;  2MEE A;  2MEG A;  3A93 A;  3P66 A;  1LLH A;  2YNM D;  193L A;  3RZE A;  2ZTD A;  3AJI B;  1CKD A;  2EO2 A;  2Z38 A;  2YBH A;  2UUB M;  3HHW A;  1C6H A;  1L05 A;  4LFP A;  4LG2 A;  7LYZ A;  2DQD Y;  262L A;  1LSY A;  2CUU A;  3T1H M;  1TR8 A;  166L A;  1XEP A;  4WM3 A;  4JI4 M;  4PRU A;  4Z3M A;  2JP7 A;  3WL2 A;  1P3N A;  4R7G A;  4IJE A;  236L A;  1GB6 A;  1CJ6 A;  1NY5 A;  246L A;  3GLG B;  3A42 A;  2MR9 A;  2DNA A;  1XXH E;  1L00 A;  1L15 A;  5BR8 M;  4YHH M;  1OIP A;  4QHT A;  4AZF A;  4H93 A;  1GEZ A;  1GE0 A;  2YFQ A;  2CV0 A;  1DI3 A;  1IY4 A;  3TXG A;  4I7L A;  1N34 M;  5B05 A;  3GUK A;  4QNR A;  2ZAM A;  2JY5 A;  4MB7 A;  1JIS A;  1TAY A;  2R4J A;  4BS7 A;  1IVM A;  1R5L A;  1T3P A;  233L A;  3MGW A;  5DM9 A;  164L A;  2G3Q A;  2LYO A;  1G3I A;  2MEC A;  4DQJ A;  2DAI A;  4IAS A;  3KOX E;  1YAN A;  3FUT A;  2QZ4 A;  2J7N A;  3TQS A;  3FTE A;  5L3H A;  4ARQ A;  1WVV A;  4H9C A;  1AUA A;  4LZZ A;  1R2Y A;  3CTW B;  3GLH B;  1IN8 A;  4DV3 M;  3K9O A;  1CU6 A;  1NSF A;  3W3E A;  5EQT A;  4LZM A;  4LF8 M;  1LJ3 A;  3T6U A;  1NJF A;  207L A;  4DWX A;  4OWB A;  4WLY A;  2F2N A;  1GB8 A;  1I20 A;  2F5N A;  1LMO A;  4LDO A;  3L2X A;  5M1Y A;  2Y21 A;  1GFU A;  3PDS A;  4NC6 A;  1XWI A;  1LZ9 A;  237L A;  1FLY A;  4JN6 A;  2UXD M;  2RB0 X;  2BQG A;  3QE8 A;  4UWU A;  3EBA B;  192L A;  3W6E A;  1T6V L;  1L32 A;  1LYF A;  1G7J C;  249L A;  3WU7 A;  4TX7 A;  1R2Z A;  4OO9 A;  1C43 A;  4EIW A;  1OVK A;  1VEJ A;  2AUB A;  1DI4 A;  3SAS A;  1SWY A;  2KA6 B;  3DOA A;  1LMP A;  4KT3 A;  4FVM A;  5EP4 A;  4XJF A;  155L A;  3QYE A;  1L03 A;  3GLF A;  1L77 A;  3U6P A;  1PJJ A;  1D6P A;  4GHA A;  3CSZ A;  2LZ2 A;  1B5U A;  4LZJ A;  5ITR A;  1G0M A;  3J81 S;  2EIZ C;  5LAG A;  1LPI A;  1IO5 A;  2I26 L;  4W56 A;  4TUN A;  1CKF A;  2DI0 A;  4NSJ A;  4M0W A;  2UUA M;  1IP3 A;  4H8Y A;  5KQ8 A;  1TH3 A;  1IBM M;  2Q9E A;  1CV1 A;  2K47 A;  2R62 A;  1D0K A;  1VEK A;  3GUM A;  3BBZ A;  1GB0 A;  1YUB A;  1RCM A;  1LMQ A;  2ZNW Y;  2LC9 A;  2X8A A;  4IBF A;  4YY3 M;  1NHG C;  3FTC A;  4XBO A;  5LMN M;  5I54 A;  3L64 A;  2Z3X A;  4LY6 A;  228L A;  3SMS A;  3TXJ A;  4WP2 A;  1LYY A;  1T8A A;  5IZ7 D;  8CAT A;  1QIO A;  4LT2 A;  1AT5 A;  2CDS A;  1LKR A;  4B7F A;  3SAU A;  1IXS B;  1GFG A;  1T97 A;  2IFF Y;  3IHP A;  4XJI A;  2OE9 X;  1XEI A;  2DQC Y;  4N5R A;  197L A;  4H1P A;  1IC5 Y;  4WM4 A;  1Z5B A;  1KS3 A;  1IOS A;  5KXY A;  5IEL A;  162L A;  1LPY A;  1HF4 A;  4OU7 A;  5HMJ A;  3UGJ A;  3DN2 A;  5B07 A;  1IXR C;  3G3A B;  4Z46 A;  2KNA A;  1V33 A;  1L2D A;  1XMO M;  2G4P A;  4D9Z A;  1GF5 A;  2LVN C;  1NBY C;  1D9U A;  1QTV A;  1T3T A;  1EIJ A;  145L A;  2A5Y B;  1L01 A;  1LZN A;  4QDN A;  2Y0Q A;  3RZ4 A;  212L A;  1L06 A;  4H91 A;  2YSS C;  2QHO B;  1IXZ A;  194L A;  150L A;  4LCB A;  1H6M A;  1LSC A;  1D3J A;  5KXZ A;  3C82 A;  1JTO L;  2W1Y A;  3W6C A;  1ZYT A;  2L4E A;  1GF6 A;  3HWL A;  4B3R M;  1QTD A;  5C1B A;  3A46 A;  154L A;  1L33 A;  2XF3 A;  4I5S A;  1C62 A;  1IQP A;  3QY4 A;  2HUB A;  2RSC A;  4LDL A;  183L A;  1L23 A;  1L95 A;  3M18 B;  2X0A A;  3HTG A;  3LN2 A;  3Q8G A;  2JZ1 A;  1N33 M;  1JKA A;  3GUO A;  1C6I A;  4QY9 A;  2R46 A;  4MH0 E;  5EJC A;  3A94 A;  3KXE C;  2B6Y A;  3GPX A;  2X4A A;  5APE A;  4FCW A;  1K28 A;  1L30 A;  4GBR B;  2WSE F;  2UXC M;  2FNA A;  4HJV A;  4FCV A;  4NSR A;  3SFZ A;  1BWI A;  2XBS A;  1TLA A;  1K3X A;  1B5X A;  3ZH9 B;  3G3V A;  7CAT A;  3TXE A;  4DV2 M;  3HH5 A;  2VB1 A;  4HTN A;  1FKQ A;  2DZN B;  1OP9 B;  5KXK A;  1G1V A;  2OEA X;  2Y20 A;  4W5W A;  1OUC A;  1BGI A;  4LJ5 A;  216L A;  1L62 A;  3HH3 A;  4B7G A;  4I7O A;  3W0L B;  1GF0 A;  4GN5 C;  1L34 A;  3D8B A;  2OU9 A;  1YAP A;  1ZV1 A;  1ZV5 L;  5ILF A;  5FTL A;  3TXK A;  1QTB A;  4UWN A;  171L A;  3F8V A;  1G0J A;  1L18 A;  3PFI A;  1XGQ C;  4DQ5 A;  1L55 A;  4I7K A;  4NHI A;  5A2Q S;  5APC A;  3CQL A;  2DZO B;  4R0F A;  3UJN A;  1CU3 A;  2ANX A;  196L A;  4LFB M;  1L58 A;  3TWM A;  1XGU C;  4TWS A;  2D91 A;  5E26 A;  1Q3C A;  2DAM A;  3MHV C;  4I4L A;  1DYF A;  3C7Z A;  3HUK A;  3OE0 A;  3WMK A;  1DO0 A;  1A4V A;  110L A;  4NOO B;  2NTH A;  3UK6 A;  133L A;  1C68 A;  1QSB A;  3SBA A;  1PRB A;  4G9S A;  5FDJ A;  4X66 M;  3AKZ A;  1QAO A;  3GUJ A;  1CKC A;  2R0I A;  3ATN A;  2XZF A;  4XJD A;  1LMC A;  3IJV A;  5B1G A;  5L3I A;  3NY9 A;  1YAO A;  3HJ8 A;  4I8O A;  6LYT A;  1I4W A;  5FTN A;  2MEA A;  1LSD A;  4ARM B;  1L65 A;  2B6X A;  4IBE A;  1ZUR A;  5ITX A;  1C10 A;  3WUA A;  3FA0 A;  1JHL A;  3SB7 A;  2RKO A;  2RRU A;  1QUS A;  3FD9 A;  2LVA A;  2B5Z A;  1B6I A;  1LZS A;  1L72 A;  4A3V B;  1ZVH L;  5KXW A;  1RI8 B;  2CE7 A;  3LZM A;  175L A;  200L A;  1IC7 Y;  2AHM A;  3CB7 A;  2BNK A;  3FYC A;  1P3Q Q;  2DQA A;  4XEN A;  4C3W A;  1B7Q A;  1EFU B;  2BAA A;  1AM7 A;  3A6C Y;  210L A;  4JYA M;  7LZM A;  3HTB A;  1LHH A;  2DHY A;  1WHC A;  1LJF A;  208L A;  1CKH A;  5C6J A;  1C64 A;  1V34 A;  2MGW A;  1GF3 A;  3K92 A;  169L A;  1NJG A;  3CF6 E;  4H9H A;  5E6J A;  3L28 A;  1NWG A;  3C80 A;  4B4E A;  4WL6 A;  3QAU A;  3P65 A;  1SXJ D;  4LGK A;  125L A;  2RGO A;  1LSE A;  3CT0 A;  4JI6 M;  1GXX A;  1I56 A;  1QUT A;  3A45 A;  1DKJ A;  4H8Z A;  1L63 A;  1XXH B;  1GO5 A;  4ETA A;  4DV4 M;  2MEF A;  1VG5 A;  1L86 A;  1N77 A;  4DQ7 A;  1YAQ A;  5LAF A;  3SB8 A;  1ZVY B;  3ZVQ B;  1HEO A;  5ITY A;  4P16 A;  1NHE A;  1C6T A;  4IAP A;  3FRI A;  1VDD A;  2KZS A;  225L A;  3WXU A;  1IP4 A;  2B6W A;  1VDL A;  2DEN A;  1EE8 A;  255L A;  4ITQ A;  1B5Z A;  4IBK A;  4DR4 M;  1NF5 A;  3WW6 A;  3CF0 A;  5T3F A;  1Q02 A;  5DN5 A;  4XN6 A;  2FS1 A;  5A3Z A;  242L A;  1L85 A;  3SYK A;  3HHX A;  1B7N A;  3W6B A;  4QHS A;  2ZIL A;  3G3W A;  1ZMV A;  5LVJ A;  2NTG A;  4FJR A;  2XH9 A;  1BWJ A;  1N4F A;  1BB7 A;  245L A;  1GFJ A;  2F2Q A;  1LZ5 A;  1D0M A;  4M4O A;  1SXJ A;  4I7Q A;  2EUC A;  4BAP A;  1C66 A;  3C58 A;  1TEW A;  3K3T A;  4XGI A;  1IY3 A;  115L A;  3IWR A;  3EMS A;  2JUJ A;  2F4G A;  3LZ2 A;  1WJ7 A;  1I6S A;  1L54 A;  2F32 A;  2HAK A;  4L16 A;  1SSW A;  4LGY A;  4ET8 A;  1D3M A;  1VQ1 A;  1WR1 B;  1LSG A;  4KT0 F;  1HEQ A;  4X62 M;  2FH0 A;  4DT3 A;  3T36 A;  2C8P A;  4LYC A;  2CEA A;  1WTH A;  247L A;  3JR6 A;  1OWZ A;  3T6P A;  3L29 A;  4DR5 M;  5EBH A;  2L6O A;  2LH0 A;  3ZEK A;  5C6L A;  2PC2 A;  3FRH A;  3V76 A;  3HBD A;  4KLN A;  1Z6T A;  1EL1 A;  1GF8 A;  1LSZ A;  4N8Z A;  1GFH A;  3DMX A;  1CVK A;  127L A;  2L09 A;  186L A;  5HNL A;  3PXG A;  4G4R A;  1GBO A;  4LT3 A;  1JJ1 A;  2RBP A;  4WMG A;  2RBR A;  3GLG A;  2W1M A;  1OFH A;  221L A;  4Z98 A;  4G4B A;  1MLC E;  2DQE Y;  1LTM A;  1C6D A;  4R6C A;  1NQI A;  2HEC A;  5LMU M;  2ZYP A;  2MED A;  2BLY A;  4NHT A;  1G0K A;  1KNI A;  4J7V A;  1IP5 A;  153L A;  1QTH A;  5KXN A;  1DGH B;  4S0W A;  4L4U A;  1C08 C;  3HU8 A;  4WLT A;  1HEW A;  4NXM M;  1UUZ C;  3C7Y A;  140L A;  226L A;  3MMP A;  3W6F A;  1HHL A;  5F14 A;  3RE8 A;  1IR8 A;  1UCO A;  1L14 A;  4GKK M;  1G7L C;  4CHT B;  1P2C C;  2HUM A;  4IJF A;  4DDB A;  2MEB A;  1E9S A;  1NDG C;  2BPU A;  2JY7 A;  3GUL A;  1LGU A;  3RT5 X;  1LSB A;  1JEF A;  1L25 A;  1L45 A;  4NHS A;  4EKQ A;  2UUC M;  4WM6 A;  1GFT A;  3LW5 F;  4DV0 M;  1OUH A;  2F47 A;  3RUN A;  4WL7 A;  4K5Y A;  1DGF A;  2CHQ A;  3BKH A;  2Z39 A;  2EPE A;  1JSF A;  3AYQ A;  3GRV A;  1SX2 A;  3DN0 A;  1CV4 A;  3RFW A;  4PJZ A;  1LZ8 A;  2CWI A;  1T6H A;  3VK7 A;  5KPT A;  4DV7 M;  1PGY A;  3K1J A;  1IP7 A;  3J7A S;  3HTF A;  4GCC A;  1LZA A;  3LYT A;  4GCD A;  3B7Z A;  1L1T A;  3NWL A;  4WOA A;  5D5F A;  223L A;  1IX0 A;  3PBL A;  1Z5A A;  1ALC A;  1GB5 A;  2HEE A;  1L08 A;  1H87 A;  3FI5 A;  4GIT A;  3GPY A;  2JA2 A;  1L07 A;  2F4A A;  1YSY A;  2OQ4 A;  1C6F A;  1DYC A;  191L A;  1L13 A;  1L16 A;  248L A;  4G4O A;  1B7M A;  1L38 A;  4NHP A;  1PM5 A;  1P56 A;  5LVH A;  1EQ4 A;  1YRO A;  2DAE A;  3K8Z A;  188L A;  2QQ8 A;  3WPJ A;  2HHH M;  4KOD A;  2ZAO A;  4M9Z A;  2R18 A;  1L11 A;  1JJ0 A;  2EA0 A;  143L A;  1L87 A;  2L7I A;  1HEN A;  1L73 A;  4GEW A;  1WQM A;  2BQD A;  138L A;  2VQF M;  2Z12 A;  3VDP A;  4W55 A;  2D7H A;  3GPU A;  1L0K A;  1AIP C;  3LCV B;  3C81 A;  167L A;  1L21 A;  3U6C A;  2B70 A;  3RW8 A;  1C6E A;  4LJ7 A;  1R6B X;  4Y28 F;  3U6Q A;  1LGX A;  1QSA A;  1UIG A;  1XJT A;  1IXS A;  2M5Z A;  2DVW B;  1P36 A;  2XEP A;  1IBK M;  3A98 B;  2ANV A;  1L29 A;  1CX7 A;  2ZAN A;  4LYZ A;  3GO8 A;  1L79 A;  1L43 A;  2D6B A;  220L A;  1YQV Y;  2DQJ Y;  2A7F A;  4NSG A;  2Z37 A;  1NV9 A;  4AGA A;  1AKI A;  3TXD A;  1IWT A;  4I7J A;  3HY5 A;  258L A;  5FTJ A;  1XNQ M;  4YF2 A;  3SN6 R;  129L A;  3C3E A;  1QAM A;  4RW2 A;  1DYG A;  2BLX A;  2HU3 A;  3RU5 A;  4KL7 A;  2CFO A;  1FLQ A;  1UM8 A;  1B2K A;  4RF1 A;  2G4N A;  5GKN A;  1JB0 F;  1YKZ X;  3EXD A;  1VDQ A;  1LSP A;  2BQJ A;  1N75 A;  3D3D A;  130L A;  1NNU C;  1JPO A;  1L71 A;  3GLI B;  1LYZ A;  1OUA A;  3C9P A;  2B74 A;  1L53 A;  4PRQ A;  1B5W A;  2H9J A;  3TWK A;  1NHB A;  1PQM A;  3BKV A;  3QYB A;  4NGY A;  1L64 A;  205L A;  1YKX X;  3W67 A;  1UC0 A;  2D4K A;  5LIN A;  3EO5 A;  3CT1 A;  3HU9 A;  1IR7 A;  2Z2E A;  1JR3 A;  1LZB A;  1IWW A;  3A34 A;  4OVZ A;  3CT5 A;  4W58 A;  5FEK A;  2I7N A;  1T8F A;  1YLA A;  4NG1 A;  4PPO A;  1L59 A;  4GC9 A;  5LA5 A;  1K82 A;  4X65 M;  2OU0 X;  3CSQ A;  1LAA A;  2HEB A;  1C6G A;  1LYI A;  244L A;  5HNC A;  3KOW E;  2BQF A;  4D82 A;  1OVJ A;  4GCF A;  231L A;  114L A;  1J1P Y;  4NHQ A;  1Z5C A;  1G0P A;  1LI2 A;  238L A;  2VQE M;  4OX9 M;  4W51 A;  2MRO B;  3KW6 A;  1OWY A;  3A6B Y;  4DKL A;  5LVI A;  1GFE A;  4EPI A;  3K2R A;  4NGK A;  4LFA M;  4HTQ A;  5DL9 A;  1TDH A;  2Q0M X;  1HSX A;  3AGI A;  241L A;  3B0I A;  1L91 A;  1TH2 A;  1G7I C;  3A91 A;  3TMU A;  3N9E A;  4I0C A;  4RKU F;  218L A;  4ETB A;  1L48 A;  3VKH A;  4CIS A;  1BB5 A;  1GF9 A;  1CU2 A;  3D9A C;  2Z4S A;  4OW0 A;  5K7O A;  2OTZ X;  1GBZ A;  3KSJ A;  4OOO A;  4B3M M;  1RU3 A;  3KDS E;  4H9A A;  1SXJ C;  2HKJ A;  1NKH A;  2LHG A;  2M60 A;  2Z2F A;  5ILC A;  4L6V 6;  4EMN A;  2RGH A;  1L94 A;  1LYO A;  1OYU A;  4MGY E;  1PJT A;  2G8L A;  4BLC A;  257L A;  3WPK A;  2F4V M;  3A96 A;  1OTR A;  2Z18 A;  2WSF F;  1TF0 B;  3HT8 A;  1K3W A;  4DBG B;  2BQO A;  1LMT A;  2C9C A;  3ULR A;  2O4W A;  3FTD A;  4FW9 A;  1JIY A;  2DWL A;  3C8Q A;  4XJB A;  1ZQ9 A;  1UFZ A;  149L A;  4NFV A;  2LZM A;  4RF0 A;  126L A;  111L A;  2BQA A;  3LYO A;  3OE6 A;  3SB9 A;  3WU8 A;  1JTP L;  2W1X A;  4XJG A;  4LZT A;  135L A;  5JI2 E;  209L A;  1QSW A;  1HMK A;  1SX7 A;  1G71 A;  5DNY A;  1HEP A;  2RBS A;  2XBR A;  2HEF A;  4KHP M;  1LJE A;  2B3T A;  1CX6 A;  1QZM A;  1V7T A;  1BB4 A;  3A3R X;  1DV0 A;  4EKS A;  3KS4 A;  1ZMU A;  1XJU A;  1QUG A;  4H9B A;  2O01 F;  1JSE A;  4ARM A;  4HPI A;  2QBY B;  3GUN A;  1IWZ A;  146L A;  3C3D A;  261L A;  2DBT A;  4CGE A;  1LZ1 A;  222L A;  3OK0 A;  3F6Z A; 
#chains in the Genus database with same CATH homology
 4ETE A;  4UWV A;  253L A;  2FYD A;  3N9A A;  4ET9 A;  4DD9 A;  5KXL A;  4WM1 A;  2H5Z A;  1OUF A;  1CV6 A;  1HFX A;  3KAM A;  5I5Q A;  1B7O A;  3HDE A;  1JTN A;  4QEQ A;  1L41 A;  1CV3 A;  1UIC A;  1IOC A;  1C6A A;  1L44 A;  1GF4 A;  3CDO A;  4H92 A;  1C46 A;  3DMZ A;  4RDS A;  1KW5 A;  1GE4 A;  1L17 A;  3UON A;  1WQP A;  1RFP A;  1L93 A;  141L A;  131L A;  1LHI A;  2DKV A;  2BQK A;  3ZVQ A;  3OE8 A;  1L83 A;  9LYZ A;  4TTD A;  4NEB A;  1L0J A;  5E4P A;  3NY8 A;  5APF A;  4ARJ A;  2OE4 X;  1DPX A;  1L76 A;  1L70 A;  4B4J A;  1NBZ C;  5F9X A;  4N1C C;  3A95 A;  1D0L A;  5APD A;  5LXW A;  2I6Z A;  1L68 A;  1JIT A;  240L A;  1P46 A;  2BQH A;  1XGR C;  3V2W A;  5FCP A;  1F6R A;  1RJC B;  4NSI A;  3FE0 A;  1CU5 A;  2Z19 A;  2LYM A;  1L22 A;  5LVK A;  1G7M C;  1LJH A;  4GLV A;  4A7D A;  1L27 A;  5DLA A;  1QS9 A;  159L A;  2XTH A;  3OJP A;  1EQ5 A;  1L89 A;  4W59 A;  3A90 A;  1GFV A;  157L A;  4FDY A;  3WU9 A;  4I8S A;  4LYO A;  1L31 A;  1B9O A;  1IWX A;  4YEM A;  5LVG A;  2HU1 A;  104L A;  1GFA A;  1PS5 A;  2WAR A;  4XJH A;  2FYC A;  1G06 A;  4IAT A;  1TBY A;  4PK0 A;  1WQQ A;  2ZIJ A;  181L A;  1LYS A;  2MEI A;  1V7S A;  3AZ6 A;  152L A;  1Z55 A;  177L A;  2RBQ A;  1LCN A;  4H9I A;  4DYG A;  1L97 A;  1C60 A;  1GF7 A;  1LHL A;  1XGT C;  4YEO A;  4W57 A;  1P6Y A;  172L A;  3AB6 A;  3GXR A;  1EPY A;  1DXJ A;  1IEE A;  1UIB A;  4NSH A;  4KXI A;  1G1W A;  1G0L A;  4J1B A;  1GAZ A;  1AZF A;  1BB6 A;  151L A;  1LJK A;  1C6L A;  190L A;  1G0Q A;  1C61 A;  2HTX A;  3DN6 A;  2CJL A;  1L36 A;  1B7L A;  4TSB A;  2HEA A;  1BVK C;  1WQN A;  1JQU A;  1GAY A;  3HT6 A;  4YXA C;  2O7A A;  1GB3 A;  1FBI X;  1IWU A;  4X3B A;  1OQM A;  3TMW A;  3WH1 A;  1IOQ A;  184L A;  1LJ4 A;  170L A;  4EJ4 A;  2RB2 X;  2ZYC A;  4B0D A;  1YL0 X;  4NY5 A;  4OWA A;  1JWR A;  1BHZ A;  3SP3 A;  2RAY X;  1L75 A;  2H9K A;  5KXS A;  182L A;  1PZY A;  4XAD A;  4LYT A;  4N9R A;  5AMY A;  1P37 A;  3HT9 A;  1IIZ A;  1F6S A;  3DNA A;  1LZY A;  1ZWN A;  1QDR A;  4QGZ A;  4I7R A;  109L A;  1L02 A;  4XYY A;  2W1L A;  5KXO A;  1J1O Y;  1GDX A;  3DMV A;  1HSW A;  1XEJ A;  108L A;  1C6J A;  1LJN A;  4ZFP A;  1C6Q A;  5FHW A;  4DD3 A;  1QQY A;  4NGZ A;  1PQO A;  2ZWB A;  5LYM A;  1JJ3 A;  1WVU A;  1LYE A;  1QTE A;  4G4C A;  1CJ9 A;  3HDF A;  1LW9 A;  3CDT A;  1LJG A;  2DQG Y;  1VAT A;  2RBN A;  227L A;  1LZD A;  1OVH A;  1BVX A;  3E3D A;  1D9W A;  4YXC A;  5I53 A;  147L A;  2B6Z A;  1CJ8 A;  3P68 A;  1REZ A;  1L10 A;  1WTM A;  5F16 A;  1L49 A;  1L67 A;  1HER A;  1L42 A;  1L26 A;  5KXP A;  1JKC A;  5IHG A;  1DI5 A;  3A67 Y;  2YBJ A;  173L A;  3HUA A;  4W54 A;  1D2Y A;  2A4T A;  1GE1 A;  4CFP A;  2HUK A;  4EPF A;  4HP0 A;  1P2L A;  1XEK A;  3SBB C;  3P64 A;  4WM5 A;  2D4J A;  1ZMY L;  2XJW A;  4HV1 A;  4MCK A;  1QT7 A;  3W6A A;  217L A;  1DQJ C;  1GE3 A;  1P2R A;  4I7N A;  2RAZ X;  5JEN B;  4ETD A;  3WVX A;  4B49 A;  4LT0 A;  1UIE A;  2D4I A;  4BAD A;  3FI7 A;  3A3Q A;  1IOT A;  3GUI A;  161L A;  4WG1 A;  1GBS A;  3B6L A;  2RH1 A;  2BQM A;  4WG7 A;  3WXT A;  5I4X A;  3P4Z A;  5HQ1 A;  1UIH A;  1L52 A;  3AZ7 A;  1FDL Y;  1B7P A;  1YL1 X;  1QUH A;  1C6K A;  1WQO A;  168L A;  5J7C A;  1YIK A;  3OE9 A;  1CTW A;  1HEM A;  5KJ9 A;  199L A;  2IGC A;  1DYD A;  4HJZ A;  4PGJ B;  1G0G A;  4DDA A;  1D3N A;  3HH4 A;  1XSF A;  1LZ6 A;  201L A;  1GE2 A;  4N1E I;  1GDW A;  3FAD A;  1LMA A;  3DKE X;  4NGW A;  4TSC A;  3HT7 A;  2I25 L;  4BAF A;  2ZNX Y;  3WVY A;  2YVB A;  120L A;  3A92 A;  3ATO A;  3DN4 A;  1UA6 Y;  1L92 A;  2BQL A;  1W08 A;  1IR9 A;  3V2Y A;  3CSR A;  3WYH A;  4J1A A;  2YDG A;  3C7W A;  4H94 A;  1GEV A;  3CDQ A;  1LHJ A;  214L A;  4E3U A;  2GV0 A;  2L78 A;  1GBY A;  1NDM C;  1SQ2 L;  4I7T A;  5KXT A;  1MEL L;  1CV5 A;  3B0O A;  1L28 A;  4MR1 A;  1CV0 A;  1LWK A;  2LHM A;  3AZ5 A;  107L A;  4N0J A;  3TMX A;  1L19 A;  1LYG A;  5LZM A;  1DYB A;  1UIF A;  5F9U A;  123L A;  4NWH A;  122L A;  1HC0 A;  1SSY A;  1L81 A;  1JKB A;  4O34 A;  2B75 A;  4OW1 A;  4P2E A;  1D6Q A;  174L A;  1L61 A;  224L A;  4WLD A;  4RLM A;  3GXK A;  4U3X B;  198L A;  1QTK A;  1REX A;  3N9C A;  1G7H C;  4DD1 A;  2BQE A;  1UBZ A;  1QTZ A;  3EML A;  4I7M A;  5F81 A;  1XFP L;  1L04 A;  219L A;  4C5F A;  4LYM A;  5LYT A;  4ARL A;  2LZT A;  206L A;  3G3B B;  4W52 A;  3LYM A;  1TDY A;  178L A;  4PJ2 C;  4RW1 A;  4HJY A;  5E9R A;  4AXT A;  1GB9 A;  1P5C A;  1GFK A;  4GN4 A;  1SLY A;  3F9L A;  5FEL A;  1L80 A;  1IWV A;  2OTY X;  4DDC A;  1L20 A;  4EKP A;  4ETC A;  1L88 A;  1LKS A;  158L A;  1LWG A;  1LYD A;  5LA8 A;  2G4Q A;  4NIJ A;  1GBX A;  3HBE X;  2FBB A;  3WUL A;  2MEH A;  5L9J A;  3QAK A;  1JUG A;  1LZ4 A;  3LHM A;  1DKK A;  1L82 A;  1L24 A;  1VDT A;  2BQN A;  103L A;  4PHI A;  3W6D A;  5HMV A;  4ARP A;  3GUP A;  1GB2 A;  5KKJ A;  2B73 A;  1IOR A;  4H9E A;  1L40 A;  1GFR A;  4NGV A;  1L46 A;  189L A;  5KXX A;  254L A;  1WTN A;  250L A;  3DN3 A;  1HFY A;  215L A;  1QUO A;  229L A;  4ANR A;  4ARQ B;  3G3X A;  3C83 A;  1CNS A;  4GLA A;  1P7S A;  1VAU A;  2HED A;  113L A;  2OU8 A;  4WM2 A;  1QT8 A;  4E97 A;  1C45 A;  1CU0 A;  3AW6 A;  4OOT A;  1UIA A;  185L A;  4CFO A;  4NWE A;  1B7S A;  4EKR A;  1L99 A;  1OUJ A;  1L12 A;  1L56 A;  4B1A A;  4AQN A;  4KPM A;  1XGP C;  1T8G A;  4IJ4 A;  1CUQ A;  3NYA A;  1C6M A;  4GCE A;  1TCY A;  4DD0 A;  4I7P A;  1QT4 A;  1DZB X;  1A2Y C;  3WUN A;  4NGO A;  1L98 A;  4NGI A;  2HUL A;  119L A;  3AGH A;  1DYE A;  251L A;  1LOZ A;  2EKS C;  2DQI Y;  1LSA A;  1D3F A;  1C69 A;  1LI6 A;  1QS5 A;  1VED A;  1L96 A;  1GWD A;  1LSF A;  4CJ2 A;  1KY1 A;  1L66 A;  234L A;  1KIQ C;  5KY1 A;  1HML A;  5I14 A;  4YX7 C;  4GCB A;  2ZQ4 A;  1VFB C;  3HH6 A;  1B7R A;  4CHX A;  252L A;  1RE2 A;  3HFM Y;  1GHL A;  5LYZ A;  1HNL A;  2B6T A;  128L A;  1CKG A;  4NG8 A;  3WUM A;  4GRV A;  2BQC A;  4OWC A;  1DPW A;  1BQL Y;  2Z6B A;  5KXM A;  2QAR C;  1GXV 2;  1L37 A;  1FLU A;  2YBN A;  5KXR A;  1L35 A;  1O23 A;  4DAJ A;  1FLW A;  2O79 A;  4B4I A;  2IHL A;  3D4S A;  3B0K A;  1OV5 A;  1QDT A;  1LYJ A;  1C67 A;  1L69 A;  4LT1 A;  180L A;  4HV2 A;  1L51 A;  1B5V A;  4YEN A;  3HTD A;  4G49 A;  3C8R A;  8LYZ A;  1QT5 A;  3TXF A;  4W94 A;  3AJN A;  1HFZ A;  1LGW A;  1QT3 A;  2BQI A;  1HEL A;  1C6B A;  1SWZ A;  3HBH A;  1IP1 A;  1KW7 A;  1GBW A;  1LHM A;  232L A;  1PQK A;  5B59 A;  1UID A;  3C8S A;  3AZ4 A;  1PQD A;  4M6D A;  3TXB A;  1LJJ A;  1L90 A;  1C6P A;  2ZIK A;  1JTM A;  1C6N A;  260L A;  1FKV A;  4H9F A;  3WW5 A;  1INU A;  1VDS A;  3J6K A;  1GD6 A;  1LSN A;  4RLN A;  3SB5 A;  4NGJ A;  1CJ7 A;  1REM A;  144L A;  1PQI A;  1J1X Y;  1KXX A;  1CUP A;  4ZIX A;  3CDV A;  132L A;  187L A;  148L E;  4WO9 A;  5II3 A;  1QUD A;  4EXM A;  3TXH A;  1L50 A;  1LSM A;  118L A;  4J0L A;  1YAM A;  3TXI A;  1YKY X;  2RBO A;  2YBL A;  1LZC A;  3AGG G;  3RNX A;  3B72 A;  3IJU A;  195L A;  5FST A;  1QT6 A;  1KY0 A;  1P64 A;  3WPL A;  1B5Y A;  1JTT L;  5DN4 A;  4LDE A;  6LZM A;  5B1F A;  259L A;  1F10 A;  1L74 A;  3QNG A;  4DD7 A;  3A8Z A;  2C8O A;  4WO6 A;  2YBI A;  3J4G A;  139L A;  211L A;  239L A;  4DJH A;  1AT6 A;  5C6I A;  4I7S A;  165L A;  1LZT A;  2NWD X;  4L41 A;  2XQO A;  1F0W A;  4G4H A;  112L A;  2YBM A;  1C63 A;  4ZEE A;  2Y8P A;  2DQH Y;  4DC4 A;  2RB1 X;  4MST A;  1C7P A;  1VDP A;  3LZT A;  4OWE A;  5LIO A;  1OUD A;  3DN8 A;  4W96 A;  4WLX A;  1IP6 A;  4H90 A;  2LYZ A;  1OUE A;  4LYB A;  2B72 A;  1DYA A;  5A3E A;  1REY A;  4NGL A;  160L A;  1LI3 A;  1W6Z A;  3VW7 A;  1LZE A;  5I4W A;  4II8 A;  4HSF A;  1LZG A;  2DQF C;  1GB7 A;  4HTK A;  5IDD A;  156L A;  176L A;  243L A;  102L A;  1B0D A;  1BB3 A;  4H8X A;  4DD2 A;  1IC4 Y;  142L A;  1OUI A;  2N5Z A;  3CDR A;  1KIR C;  2FBD A;  1JKD A;  1LMN A;  1LZR A;  1L60 A;  4W53 A;  1L39 A;  1L57 A;  3AW7 A;  163L A;  1LHK A;  2CGI A;  1D2W A;  1KXY A;  1C6C A;  1EQE A;  2A7D A;  1NMM A;  235L A;  4HPE A;  3LYZ A;  3HUQ A;  1LJI A;  2BQB A;  5KKI A;  3SB6 A;  1FN5 A;  1IP2 A;  1C65 A;  3VWO A;  1WQR A;  5D5C A;  2ZQ3 A;  4LFX A;  3ODU A;  1G07 A;  1YIL A;  1I1Z A;  137L A;  5B06 A;  2EQL A;  1E8L A;  4YM8 A;  1L47 A;  5I4Y A;  1L09 A;  1OUB A;  1QTC A;  1OV7 A;  3DN1 A;  1LYH A;  134L A;  256L A;  3TMV A;  1KIP C;  230L A;  4ML7 A;  5HLL A;  1IWY A;  6LYZ A;  4OWH A;  4ZPU A;  3M3U A;  4GN3 A;  2Q9D A;  1BWH A;  4Z41 A;  4YOP A;  2QB0 B;  1QSQ A;  1L84 A;  2OE7 X;  4EOF A;  213L A;  2LCB A;  1GPQ C;  1KXW A;  1OUG A;  2B7X A;  1UAC Y;  1PQJ A;  2F30 A;  2MEE A;  2MEG A;  3A93 A;  3P66 A;  1LLH A;  193L A;  3RZE A;  1CKD A;  2Z38 A;  2YBH A;  1C6H A;  1L05 A;  4LFP A;  7LYZ A;  2DQD Y;  262L A;  1LSY A;  2CUU A;  166L A;  1XEP A;  4WM3 A;  4PRU A;  4Z3M A;  3WL2 A;  1P3N A;  236L A;  1GB6 A;  1CJ6 A;  246L A;  1L00 A;  1L15 A;  4H93 A;  1GEZ A;  1GE0 A;  1DI3 A;  1IY4 A;  3TXG A;  4I7L A;  5B05 A;  3GUK A;  1TAY A;  1JIS A;  1IVM A;  4BS7 A;  1T3P A;  233L A;  3MGW A;  5DM9 A;  164L A;  2LYO A;  2MEC A;  4DQJ A;  4IAS A;  1YAN A;  5L3H A;  4ARQ A;  1WVV A;  4H9C A;  1CU6 A;  3W3E A;  4LZM A;  1LJ3 A;  3T6U A;  207L A;  4DWX A;  4OWB A;  4WLY A;  2F2N A;  1GB8 A;  1I20 A;  1LMO A;  4LDO A;  3L2X A;  5M1Y A;  1GFU A;  3PDS A;  1LZ9 A;  237L A;  1FLY A;  2RB0 X;  2BQG A;  3QE8 A;  4UWU A;  3EBA B;  192L A;  3W6E A;  1T6V L;  1L32 A;  1LYF A;  1G7J C;  249L A;  3WU7 A;  4TX7 A;  4OO9 A;  1C43 A;  1OVK A;  2AUB A;  1DI4 A;  1SWY A;  1LMP A;  4KT3 A;  4XJF A;  155L A;  1L03 A;  1L77 A;  1D6P A;  3CSZ A;  2LZ2 A;  1B5U A;  1G0M A;  2EIZ C;  5LAG A;  1LPI A;  1IO5 A;  2I26 L;  4W56 A;  4TUN A;  1CKF A;  4NSJ A;  1IP3 A;  4H8Y A;  2Q9E A;  1CV1 A;  1D0K A;  3GUM A;  1GB0 A;  1RCM A;  1LMQ A;  2ZNW Y;  2LC9 A;  5I54 A;  3L64 A;  228L A;  3TXJ A;  1LYY A;  1T8A A;  1QIO A;  4LT2 A;  1AT5 A;  2CDS A;  1LKR A;  1GFG A;  1T97 A;  2IFF Y;  4XJI A;  2OE9 X;  1XEI A;  2DQC Y;  4N5R A;  197L A;  4H1P A;  1IC5 Y;  4WM4 A;  1KS3 A;  1IOS A;  5KXY A;  5IEL A;  162L A;  1LPY A;  1HF4 A;  5HMJ A;  3DN2 A;  5B07 A;  3G3A B;  4Z46 A;  2G4P A;  4D9Z A;  1GF5 A;  1NBY C;  1D9U A;  1QTV A;  145L A;  1LZN A;  1L01 A;  4QDN A;  3RZ4 A;  212L A;  1L06 A;  4H91 A;  2YSS C;  194L A;  150L A;  1H6M A;  1LSC A;  1D3J A;  5KXZ A;  3C82 A;  1JTO L;  2W1Y A;  3W6C A;  1ZYT A;  1GF6 A;  3HWL A;  1QTD A;  154L A;  1L33 A;  1C62 A;  3QY4 A;  2HUB A;  2RSC A;  4LDL A;  183L A;  1L23 A;  1L95 A;  3M18 B;  2X0A A;  3HTG A;  3LN2 A;  1JKA A;  3GUO A;  1C6I A;  4QY9 A;  3A94 A;  2B6Y A;  5APE A;  1K28 A;  1L30 A;  4GBR B;  4HJV A;  1BWI A;  2XBS A;  1TLA A;  1B5X A;  3G3V A;  3TXE A;  3HH5 A;  2VB1 A;  4HTN A;  1FKQ A;  1OP9 B;  5KXK A;  1G1V A;  2OEA X;  1OUC A;  1BGI A;  216L A;  1L62 A;  3HH3 A;  4I7O A;  1GF0 A;  4GN5 C;  1L34 A;  2OU9 A;  1YAP A;  1ZV5 L;  5ILF A;  3TXK A;  1QTB A;  4UWN A;  171L A;  3F8V A;  1G0J A;  1L18 A;  1XGQ C;  4DQ5 A;  1L55 A;  4I7K A;  4NHI A;  5APC A;  3CQL A;  4R0F A;  1CU3 A;  2ANX A;  196L A;  1L58 A;  4TWS A;  1XGU C;  2D91 A;  1DYF A;  3C7Z A;  3HUK A;  3OE0 A;  3WMK A;  1A4V A;  110L A;  2NTH A;  133L A;  1C68 A;  1QSB A;  3SBA A;  4G9S A;  5FDJ A;  3GUJ A;  1CKC A;  3ATN A;  4XJD A;  1LMC A;  3IJV A;  5B1G A;  5L3I A;  3NY9 A;  1YAO A;  6LYT A;  2MEA A;  1LSD A;  4ARM B;  1L65 A;  2B6X A;  1ZUR A;  1C10 A;  3WUA A;  3FA0 A;  1JHL A;  3SB7 A;  1QUS A;  2B5Z A;  1B6I A;  1LZS A;  1L72 A;  1ZVH L;  5KXW A;  1RI8 B;  3LZM A;  175L A;  200L A;  1IC7 Y;  3CB7 A;  2DQA A;  4XEN A;  4C3W A;  1B7Q A;  2BAA A;  1AM7 A;  3A6C Y;  210L A;  7LZM A;  3HTB A;  1LHH A;  208L A;  1LJF A;  5C6J A;  1CKH A;  1C64 A;  1GF3 A;  169L A;  4H9H A;  1NWG A;  3C80 A;  4B4E A;  4WL6 A;  3P65 A;  4LGK A;  125L A;  1LSE A;  3CT0 A;  1GXX A;  1I56 A;  1QUT A;  1DKJ A;  4H8Z A;  1L63 A;  4ETA A;  2MEF A;  1L86 A;  4DQ7 A;  1YAQ A;  5LAF A;  3SB8 A;  1ZVY B;  3ZVQ B;  1HEO A;  1NHE A;  1C6T A;  4IAP A;  225L A;  3WXU A;  1IP4 A;  2B6W A;  255L A;  1B5Z A;  1NF5 A;  3WW6 A;  5T3F A;  5DN5 A;  4XN6 A;  5A3Z A;  242L A;  1L85 A;  1B7N A;  3W6B A;  2ZIL A;  3G3W A;  5LVJ A;  2NTG A;  4FJR A;  1BWJ A;  1N4F A;  1BB7 A;  245L A;  1GFJ A;  2F2Q A;  1LZ5 A;  1D0M A;  4M4O A;  4I7Q A;  4BAP A;  1C66 A;  1TEW A;  3K3T A;  1IY3 A;  3IWR A;  115L A;  3EMS A;  2F4G A;  3LZ2 A;  1I6S A;  1L54 A;  2F32 A;  1SSW A;  4ET8 A;  1D3M A;  1LSG A;  1HEQ A;  4DT3 A;  3T36 A;  2C8P A;  4LYC A;  1WTH A;  247L A;  3JR6 A;  1OWZ A;  5EBH A;  3ZEK A;  5C6L A;  2PC2 A;  3HBD A;  1EL1 A;  1GF8 A;  1LSZ A;  4N8Z A;  1GFH A;  3DMX A;  1CVK A;  127L A;  186L A;  5HNL A;  1GBO A;  4LT3 A;  1JJ1 A;  2RBP A;  4WMG A;  2RBR A;  2W1M A;  221L A;  4Z98 A;  4G4B A;  1MLC E;  2DQE Y;  1LTM A;  1C6D A;  4R6C A;  1NQI A;  2HEC A;  2ZYP A;  2MED A;  2BLY A;  4NHT A;  1G0K A;  1KNI A;  4J7V A;  1IP5 A;  153L A;  1QTH A;  5KXN A;  4S0W A;  1C08 C;  3HU8 A;  4WLT A;  1HEW A;  1UUZ C;  3C7Y A;  140L A;  226L A;  3W6F A;  1HHL A;  5F14 A;  1IR8 A;  1UCO A;  1L14 A;  1P2C C;  1G7L C;  2HUM A;  4DDB A;  2MEB A;  1NDG C;  2BPU A;  3GUL A;  1LGU A;  3RT5 X;  1LSB A;  1JEF A;  1L25 A;  1L45 A;  4NHS A;  4EKQ A;  4WM6 A;  1GFT A;  1OUH A;  2F47 A;  3RUN A;  4WL7 A;  4K5Y A;  3BKH A;  2Z39 A;  2EPE A;  1JSF A;  3AYQ A;  1SX2 A;  3DN0 A;  1CV4 A;  4PJZ A;  1LZ8 A;  2CWI A;  1T6H A;  1IP7 A;  3HTF A;  4GCC A;  1LZA A;  3LYT A;  4GCD A;  4WOA A;  5D5F A;  223L A;  1IX0 A;  3PBL A;  1ALC A;  1GB5 A;  2HEE A;  1L08 A;  1H87 A;  3FI5 A;  1L07 A;  2F4A A;  1C6F A;  1DYC A;  191L A;  1L13 A;  1L16 A;  248L A;  1B7M A;  1L38 A;  4NHP A;  1P56 A;  5LVH A;  1EQ4 A;  1YRO A;  188L A;  3WPJ A;  1L11 A;  1JJ0 A;  143L A;  1L87 A;  1HEN A;  1L73 A;  1WQM A;  2BQD A;  138L A;  2Z12 A;  4W55 A;  1L0K A;  3C81 A;  167L A;  1L21 A;  2B70 A;  3RW8 A;  1C6E A;  1QSA A;  1LGX A;  1UIG A;  1XJT A;  1P36 A;  2ANV A;  1L29 A;  1CX7 A;  4LYZ A;  1L79 A;  1L43 A;  2D6B A;  220L A;  1YQV Y;  2DQJ Y;  2A7F A;  4NSG A;  2Z37 A;  4AGA A;  1AKI A;  3TXD A;  1IWT A;  4I7J A;  258L A;  4YF2 A;  3SN6 R;  129L A;  4RW2 A;  1DYG A;  2BLX A;  2HU3 A;  3RU5 A;  4KL7 A;  1FLQ A;  1B2K A;  2G4N A;  1YKZ X;  3EXD A;  1VDQ A;  1LSP A;  2BQJ A;  3D3D A;  130L A;  1JPO A;  1L71 A;  1LYZ A;  1OUA A;  2B74 A;  1L53 A;  4PRQ A;  1B5W A;  2H9J A;  1NHB A;  1PQM A;  3BKV A;  4NGY A;  1L64 A;  205L A;  1YKX X;  1UC0 A;  2D4K A;  5LIN A;  3EO5 A;  3CT1 A;  3HU9 A;  1IR7 A;  2Z2E A;  1LZB A;  1IWW A;  3A34 A;  3CT5 A;  4W58 A;  5FEK A;  1T8F A;  4NG1 A;  4PPO A;  1L59 A;  5LA5 A;  2OU0 X;  3CSQ A;  1LAA A;  2HEB A;  1C6G A;  1LYI A;  244L A;  5HNC A;  2BQF A;  1OVJ A;  4GCF A;  231L A;  114L A;  1J1P Y;  4NHQ A;  1G0P A;  1LI2 A;  238L A;  4DKL A;  4W51 A;  3A6B Y;  1OWY A;  5LVI A;  1GFE A;  4EPI A;  3K2R A;  4NGK A;  4HTQ A;  5DL9 A;  2Q0M X;  1HSX A;  3AGI A;  241L A;  3B0I A;  1L91 A;  1G7I C;  3TMU A;  3A91 A;  3N9E A;  4I0C A;  218L A;  4ETB A;  1L48 A;  1BB5 A;  1GF9 A;  3D9A C;  1CU2 A;  5K7O A;  2OTZ X;  1GBZ A;  4OOO A;  4H9A A;  1NKH A;  2Z2F A;  5ILC A;  4EMN A;  1L94 A;  1LYO A;  1OYU A;  257L A;  3WPK A;  3A96 A;  2Z18 A;  3HT8 A;  2BQO A;  1LMT A;  3ULR A;  2O4W A;  1JIY A;  3C8Q A;  4XJB A;  149L A;  4NFV A;  2LZM A;  126L A;  2BQA A;  111L A;  3LYO A;  3OE6 A;  3SB9 A;  3WU8 A;  1JTP L;  2W1X A;  4XJG A;  4LZT A;  135L A;  209L A;  1QSW A;  1HMK A;  1SX7 A;  1HEP A;  2RBS A;  2XBR A;  2HEF A;  1LJE A;  1CX6 A;  1V7T A;  1BB4 A;  3A3R X;  4EKS A;  1XJU A;  1QUG A;  4H9B A;  1JSE A;  4ARM A;  4HPI A;  3GUN A;  1IWZ A;  146L A;  261L A;  2DBT A;  4CGE A;  1LZ1 A;  222L A;  3OK0 A;  3F6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...