1QDRA

2.1 a resolution structure of escherichia coli lytic transglycosylase slt35
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Binding of calcium in the EF-hand of Escherichia coli lytic transglycosylase Slt35 is important for stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qdrA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qdrA02
1KIPC 1G7MC 2YBLA 1IY4A 1XGUC 208LA 3AGIA 3J4GA 1C43A 4QDNA 1BGIA 2B5ZA 1CJ9A 1B7LA 4ET8A 3LYMA 1CKCA 1HHLA 4N1EI 2XJWA 2HU3A 4RLNA 3RT5X 1LHKA 1XEJA 5HNLA 4W96A 1A4VA 4XYYA 1GE0A 5KXWA 1LHMA 1IWXA 4NGYA 2CGIA 3AW7A 3A3QA 4NSJA 3A8ZA 3A90A 3B0IA 1B9OA 1GE3A 153LA 135LA 1IR7A 2ZNWY 3CSQA 4H90A 2CWIA 4XADA 3TXHA 5LVIA 5LA5A 1LHHA 4UWNA 2GV0A 2W1MA 4IJ4A 2BAAA 2XBSA 1B0DA 4H1PA 1TBYA 4DC4A 2D4KA 4B4JA 5LVJA 1IR8A 1BVXA 5HNCA 1IOCA 3TXGA 5LIOA 5KXKA 3OJPA 3ATOA 3ULRA 1VEDA 1IWYA 3N9AA 1JUGA 1CJ6A 2ZIJA 3A93A 3A92A 1EQ4A 2A7FA 4WM6A 1JKCA 1LJKA 1QQYA 1QDRA 4H92A 4N8ZA 4NGZA 5L3IA 1LJIA 1OUDA 3EXDA 3WW5A 1XGPC 207LA 1UACY 1GFUA 1LMAA 1OUGA 2N5ZA 4BAPA 4YM8A 1QTKA 4D9ZA 4DD3A 1YKYX 2ZQ3A 1PZYA 4GCFA 4NGLA 4HTNA 1NHEA 4ET9A 4DD1A 1TDYA 1J1PY 5B59A 3WH1A 4C3WA 1GF4A 1LPIA 1H87A 1GAYA 2Z2FA 1IOQA 1DZBX 3D9AC 1H6MA 1JSEA 1ZVHL 1LSPA 5KXRA 4WLTA 2XBRA 4CFOA 5KXTA 1D0KA 1GF8A 1E8LA 1DXJA 1LKSA 4TSCA 1VDQA 5I53A 2DQGY 1YL1X 5E4PA 1T3PA 3P66A 1AT6A 4J1AA 4J7VA 3WUNA 3BKVA 4GCDA 3W6AA 1VDTA 1FN5A 5LXWA 1CJ7A 3BKHA 1KXXA 1LSEA 4LYBA 2BQOA 3M18B 4B0DA 3WVXA 4LGKA 5C6JA 2HEFA 4GCEA 4KT3A 1TEWA 5LYTA 4WG1A 3B0OA 1UIAA 3ZEKA 5F9XA 2MEIA 4DWXA 1I20A 5FSTA 2RSCA 1FLQA 4EOFA 1GFJA 1A2YC 3CSZA 1Z55A 1RE2A 1WQPA 1HSWA 1NDMC 1UC0A 1D0LA 4WLXA 1N4FA 2DQEY 3WUAA 2EPEA 1YKZX 5F9UA 3HBHA 4NHSA 3A3RX 2BQLA 3WVYA 154LA 4QGZA 2YSSC 4B49A 1LZRA 1ALCA 4XJDA 4RW2A 1KIQC 4PRQA 2BQIA 3RW8A 4NHTA 3AW6A 1WQNA 2D91A 4ETAA 5HMVA 4WG7A 5L3HA 1FLWA 1LZEA 2BLYA 1LTMA 5KXYA 1WTMA 3N9CA 1DQJC 4LYTA 2BQDA 4DD7A 1NQIA 1IY3A 4NWHA 4GN5C 4LFXA 1WVVA 1ZMYL 4NGIA 4PGJB 5FDJA 1HFYA 2ZWBA 1B7PA 2EQLA 1UICA 1B5ZA 1LSCA 2LYOA 1F10A 1LZNA 4YEOA 4YOPA 2D4IA 4CHXA 1LHIA 3TXEA 3W6DA 2Y8PA 4WO6A 1B7MA 1GB8A 4ZFPA 2H5ZA 3P64A 4H9FA 7LYZA 1IP1A 4C5FA 2MEBA 1DPWA 3GXKA 1WTNA 4HV2A 1ZVYB 1OQMA 1HFZA 4ML7A 1LZ8A 5KJ9A 1HERA 1GBOA 1WQQA 1GWDA 2A7DA 1JTTL 1LOZA 4XJHA 1LMQA 1FLYA 4B4IA 3T36A 2DBTA 2YBNA 1HELA 4WM3A 1DKJA 4QY9A 1UBZA 1BB5A 4YENA 2G4QA 1JEFA 5KXSA 3EO5A 1BWIA 3CT1A 1QTEA 1IOSA 3EBAB 1JSFA 1WQMA 1LSMA 1RJCB 1JITA 1G7IC 1IP6A 1HEPA 4G4HA 5DLAA 2IFFY 1HFXA 5A3ZA 5AMYA 5LINA 4XN6A 4NGWA 5F14A 2BQGA 1BB3A 4ANRA 1G7JC 1AT5A 1YAPA 2HEAA 4AGAA 5M1YA 1YAQA 2HEBA 4G49A 3TXKA 1SQ2L 3LZ2A 1LSYA 3CQLA 1LSDA 2BQMA 5IDDA 2ZNXY 1BVKC 2MECA 2H9KA 5T3FA 1GB9A 1IC7Y 4OW1A 3A67Y 1JIYA 3OK0A 1OUFA 4IATA 1HMKA 1IWWA 1FLUA 1GF0A 1FKQA 4GN3A 3P4ZA 1IP4A 1YKXX 2YVBA 5DL9A 1REZA 4CGEA 4XJGA 1HEOA 1LZCA 1I1ZA 1KXYA 5LVHA 2YBIA 1GF5A 1IC5Y 3CSRA 3WPLA 4ETBA 3J6KA 4DDBA 3GXRA 1GFGA 3SP3A 1IEEA 1EQEA 4OWHA 3A6CY 1QSWA 1FBIX 4GCCA 4ETDA 3AB6A 5B06A 4WOAA 1HMLA 133LA 1GB7A 3EMSA 3G3AB 4NFVA 5I4YA 2F4AA 1J1XY 1UIGA 1IP7A 2FYCA 4HPIA 3TXJA 2Z38A 2H9JA 3HFMY 2LYMA 5HQ1A 1LZ6A 3HBEX 3N9EA 3WPJA 2BQJA 1B5VA 1GB2A 3TXDA 1YAMA 2CJLA 1RFPA 2FBBA 5D5FA 3CB7A 1NF5A 4UWVA 1INUA 2LYZA 1GDXA 1EQ5A 1LZSA 1QSAA 2Z39A 4TTDA 1LCNA 1C46A 4J1BA 4CFPA 1GHLA 5ILFA 4FJRA 4X3BA 1TAYA 1GAZA 1OUIA 2BQFA 2DQDY 1MLCE 2W1XA 3LZTA 4NG1A 4H8ZA 1YQVY 1GFTA 1XGQC 1HEQA 1LJ3A 1C08C 4WMGA 1OUAA 4GCBA 4BADA 4MSTA 1IO5A 4OWAA 4LZTA 5J7CA 4GN4A 4N9RA 1LZ9A 2Z2EA 1NMMA 4WLDA 1VDSA 2MEEA 2AUBA 5APCA 1OP9B 1IOTA 1WQRA 3LN2A 3IWRA 5ILCA 4WLYA 1BB7A 1BHZA 1RI8B 2LZ2A 2YDGA 2ZILA 3K3TA 2BPUA 4H93A 1GEVA 1KIRC 3HBDA 4NEBA 5KKIA 1IP3A 2DQJY 4NG8A 1GF7A 3AZ5A 1HF4A 2BQKA 3WULA 4H9EA 4HJVA 4H8YA 4PPOA 4LYCA 3W6BA 2ZYPA 4J0LA 5LA8A 5KXXA 1LSGA 3WU9A 3B0KA 1GB5A 4NGJA 1IP2A 5JENB 5KXLA 1UIHA 4NHIA 4WL7A 1JPOA 1LAAA 1LMCA 1LJGA 3AJNA 3LYZA 4HJYA 1VATA 3IJVA 4NSGA 3VWOA 4TX7A 5LAFA 4HTQA 5FEKA 5KXMA 4NGKA 1GD6A 2Z18A 2C8PA 4WL6A 3W6FA 4LYOA 1GDWA 2LZTA 1CKDA 4B4EA 4LYZA 1YIKA 4PJ2C 4WM1A 1D6PA 2WARA 3AZ4A 4MCKA 4U3XB 1LSBA 5DN5A 1JHLA 1BWHA 1XGTC 1GXXA 1LJEA 1LMOA 1LMNA 2G4PA 1JISA 4UWUA 5F16A 3T6UA 1HSXA 4RLMA 1D9UA 2X0AA 2HEEA 1UA6Y 3W3EA 4M6DA 4BAFA 1LYYA 4QEQA 1LJNA 4WM4A 1G7HC 1UUZC 3W6CA 2YBJA 1GE1A 4RDSA 4LFPA 4NSHA 1NWGA 1LZDA 1YROA 1OUEA 1F6RA 1LHLA 1GFHA 3A96A 1LZAA 1GFAA 1C45A 1AZFA 1JTOL 1LZTA 3F6ZA 1IR9A 1FKVA 3IJUA 2HU1A 4H9CA 1D0MA 1B5YA 5B07A 1TCYA 3A34A 4HPEA 4Z98A 2FYDA 1G7LC 3KAMA 6LYTA 3LHMA 1XFPL 1WVUA 2I6ZA 4I8SA 5D5CA 4ZIXA 4H9IA 1P2CC 1YL0X 1C7PA 1QUTA 2CDSA 1EL1A 1VAUA 2YBHA 4YEMA 4Z41A 5A3EA 5KXOA 1QDTA 1B7QA 4NHPA 4PRUA 1IVMA 1GEZA 4OWEA 1NKHA 1GE2A 3P68A 5E9RA 1B7NA 1JTPL 4EMNA 2IHLA 4HV1A 4H91A 4KXIA 2BQNA 1GFKA 1B7SA 4FDYA 4NGVA 5KXPA 1VFBC 1DI3A 1ZV5L 1IORA 4PHIA 5KXNA 194LA 1B7OA 4G4CA 3QNGA 2NWDX 1HNLA 3A95A 4NWEA 2MEAA 1LJJA 5EBHA 1JWRA 1LSNA 1GF9A 1IX0A 1F0WA 1IC4Y 5I5QA 3WMKA 4E3UA 8LYZA 4BS7A 4NSIA 4B1AA 2ZYCA 3RZ4A 4G9SA 4KL7A 2VB1A 1LHJA 2MEFA 5HLLA 1LSAA 1GB0A 3TMVA 4MR1A 4CJ2A 4OWCA 1LJFA 1B7RA 1CNSA 1F6SA 1UIBA 5C6LA 4WM5A 2BQHA 4N1CC 4H9BA 4XENA 3WL2A 3TXIA 4O34A 3AZ6A 2YBMA 1OUCA 3B6LA 4HTKA 1GBWA 3G3BB 4WM2A 1B5UA 5K7OA 2ZQ4A 3A91A 1T6VL 5DN4A 5APDA 1GFRA 3RNXA 4OOTA 2XTHA 4I0CA 3A94A 1BWJA 1GE4A 1DKKA 1JKAA 2DQIY 4AXTA 4DDAA 2F4GA 5B05A 2D6BA 2BQAA 2HUBA 1XEIA 4L41A 5LVKA 1LZGA 4N0JA 2MEDA 4Z46A 1HENA 1LYZA 2ZIKA 1BQLY 1GXV2 1LZ5A 1XEKA 2PC2A 5L9JA 1GBXA 1IWUA 3QY4A 4NIJA 1XSFA 2I25L 1LZYA 3M3UA 1LYOA 1XGRC 4H9AA 4NGOA 1V7SA 1YAOA 4G4BA 1IP5A 1CKHA 1DPXA 2W1YA 3TMXA 4Z3MA 5KY1A 1GB6A 1QUSA 2HTXA 5LAGA 5LVGA 5FCPA 1MELL 5DM9A 1HEWA 1GBZA 2DKVA 3E3DA 5I4XA 1GBYA 3WYHA 1BB6A 1LJ4A 5B1FA 1B5XA 1W08A 4A7DA 4DD2A 1REMA 1JJ3A 1WQOA 2MEGA 1LZ4A 2W1LA 3WUMA 4WO9A 5APFA 1REYA 1B5WA 1LMPA 3CT0A 1UCOA 2BLXA 2C8OA 4N5RA 3A6BY 3WU7A 4YF2A 5IELA 1B2KA 1LSZA 3W6EA 1C10A 5LYZA 2Z19A 1CKGA 1YANA 4H94A 1CKFA 6LYZA 4M4OA 193LA 3LYOA 3ZVQB 4DDCA 1GPQC 1KXWA 2I26L 5F81A 4H8XA 3AYQA 1GF3A 1IIZA 3QE8A 3RU5A 4ETCA 1LZBA 4TWSA 2BQBA 1LSFA 4OOOA 4HJZA 3TXBA 1DI5A 1GB3A 4NY5A 2FBDA 4ZEEA 3CT5A 1NBZC 2BQEA 3AGGG 1DI4A 5IHGA 4W94A 2EIZC 3WXUA 1JKBA 2D4JA 1UIFA 2BQCA 3LYTA 4XJIA 5KXZA 5KKJA 5I54A 1PS5A 2HECA 4II8A 1NBYC 1D6QA 4TUNA 5APEA 2F2NA 134LA 5C6IA 2DQHY 2HEDA 1OUJA 2LHMA 4R6CA 1LJHA 2G4NA 1CJ8A 1QIOA 4H9HA 4GLVA 1JJ0A 3MGWA 2MEHA 4R0FA 5B1GA 4HP0A 9LYZA 1JKDA 1GBSA 2DQAA 5HMJA 3TXFA 3WW6A 1GFEA 1W6ZA 2EKSC 4P2EA 4XJFA 5II3A 4DD0A 1UIEA 2Z12A 4RW1A 1GF6A 1LYSA 1V7TA 1LZ1A 3ATNA 1FDLY 4DD9A 1O23A 1IWZA 5FELA 4TSBA 1LKRA 1VDPA 4LT2A 4DT3A 2F30A 3B72A 4LT1A 2DQCY 1GFVA 1NDGC 3FI7A 132LA 4LYMA 1HEMA 3WU8A 4NHQA 4OWBA 1OUHA 4ETEA 1BB4A 1OUBA 1YILA 3TMWA 3WXTA 3D3DA 3FE0A 4GLAA 3ZVQA 4DYGA 3WPKA 4KPMA 2DQFC 4XJBA 5FHWA 1AM7A 4IASA 2Q0MX 5I4WA 5LYMA 1JJ1A 3AGHA 4HSFA 1LMTA 1REXA 1UIDA 4LT3A 1I56A 1IWTA 3AZ7A 1SLYA 2Z37A 1HC0A 3TMUA 4LT0A 1IWVA 1J1OY 1AKIA 1RCMA 3P65A
chains in the Genus database with same CATH superfamily
1V33A 1T3TA 1OVKA 2LVPC 3JR4A 1G7MC 2YBLA 1L43A 4G4QA 3U5ZA 3CDOA 4QDNA 1I4WA 3HTFA 148LE 1CKCA 2LC9A 2V1CA 172LA 2HU3A 2J5YA 4W96A 3LQRA 1CV4A 1GE0A 2XFTA 114LA 2KEBA 3A90A 1B9OA 4L4UA 1GE3A 1IR7A 1VDDA 2ZNWY 4L15A 1XMQM 5LA5A 4W58A 1LGXA 1TBYA 5DYGA 1WJ7A 1I94M 1L91A 4DV7M 3I4YA 4HLQA 125LA 1QSBA 3ATOA 4R7GA 4NC6A 1IWYA 1L0KA 3N9AA 4X66M 1L96A 2CP8A 3A93A 1EQ4A 2KZUA 2XZUA 1LJKA 1E94E 1QDRA 2ANXA 4N8ZA 1XWIA 5EXTA 2LNHC 2YNMD 1OUGA 3CDTA 4YM8A 1QTKA 2B6TA 1UFZA 2D7GA 1TDYA 1J1PY 5B59A 1L73A 5LMNM 1IOQA 211LA 2OE7X 2OU8A 5DYIA 1ZVHL 2XBRA 1VEJA 4CFOA 161LA 2D7HA 2JY5A 1UM8A 3B74A 4TSCA 5I53A 5E4PA 4REZA 1EE8A 3WUNA 1L10A 4GCDA 2XSZA 1JR3A 4D80A 2DZNB 4DV2M 3SHFA 4LYBA 3M18B 2HEFA 2MJ5B 2R18A 1SWYA 1TEWA 3PXGA 1I20A 3HUKA 198LA 3L2AA 2RSCA 1FLQA 2J7OA 3HH3A 1Z55A 1NSFA 3WUAA 2OEAX 1D0LA 3VKGA 1C6TA 3C3EA 2EPEA 4DR7M 3HBHA 3B7NA 5FSWA 2M60A 3WVYA 184LA 2YSSC 4RKUF 1ALCA 138LA 1KIQC 4PRQA 2BQIA 4RW2A 2G8LA 3AW6A 1WQNA 4RF0A 4JXJA 2DWNA 2BLYA 3FE3A 3KOWE 1GJTA 1DQJC 4ZPUA 1L2DA 4LFXA 4JI0M 1L36A 4KHPM 2O5RA 3B7QA 2ZWBA 5GKNA 1B7PA 2EQLA 4CHXA 1B5ZA 2LYOA 1F10A 3W6DA 4ZFPA 1PQIA 3FYCA 1PM5A 3C8QA 1IP1A 4C5FA 1G0QA 3GXKA 2A5YB 1HERA 1GWDA 1L92A 4DQ7A 4XJHA 1LOZA 4MGZE 4OVZA 3T36A 4QOSA 2KHHA 2XZFA 1L56A 4NXMM 5EP4A 1XNQM 3DN0A 3ZCBB 173LA 3CT1A 1QQWA 5EQTA 3EBAB 1L00A 1XJUA 1QAQA 1G7IC 1HEPA 1GABA 1X37A 227LA 1L37A 209LA 4G4HA 220LA 1J5EM 2IFFY 4KT0F 1LI6A 5F14A 1DYGA 3HDFA 2ZTDA 4ANRA 1YAPA 2HEAA 1CU2A 1V34A 5FTKA 1CV5A 166LA 3DFZA 178LA 3CQLA 1LSDA 2MECA 242LA 1L23A 2P5TA 3HX3A 233LA 3OK0A 1OUFA 4IATA 1OJLA 1IY1A 180LA 2QBYB 4AG6A 1REZA 4B7HA 4EKQA 4CGEA 2QENA 3A42A 2YBIA 3WPLA 4B3RM 2GNOA 2XQOA 2DZLA 1FBIX 3AB6A 5C1BA 5ITRA 5FTMA 226LA 3EMSA 3QWLA 4NFVA 5I4YA 1T6OA 1SXJE 3TXJA 2H9JA 1LZ6A 260LA 2BQJA 2BWEA 2MGWA 3TXDA 1L12A 1RFPA 253LA 4LDLA 4LRTA 1XXHA 3CB7A 2C5RA 1NF5A 2DZOB 1LCNA 1YUBA 2F5QA 2DQDY 1MLCE 2W1XA 3LZTA 200LA 1GFTA 1XGQC 1C08C 2NTGA 4GCBA 4EKRA 1IN8A 1LYIA 1L25A 1NHBA 1CU5A 4N9RA 2Z2EA 1WQRA 1IOTA 5ILCA 2BPUA 1PGYA 1IP3A 5IT9S 5EP1A 1C62A 1HF4A 1NNUC 1L75A 4H9EA 4H8YA 1C6NA 1P36A 1L16A 2ZYPA 1LI2A 4BB9A 3WU9A 4X62M 1WTHA 119LA 2RBNA 3ODUA 1LJGA 3G3XA 236LA 3AJNA 2H5XA 3HHZA 2FFJA 4LJ6A 3VWOA 1NVMA 4TX7A 2WSCF 3VK7A 5LAFA 4NGKA 3W6FA 4WL6A 1L68A 1GDWA 4LYOA 1CKDA 4B4EA 3F8VA 3SB5A 3C8RA 2WARA 4U3XB 1PQOA 1KNIA 2B6YA 1BWHA 4AQYM 1LJEA 1LMNA 1HT2E 3GLFE 4S12A 1D9UA 3G3VA 1UA6Y 4M6DA 4Q7JA 4BLCA 1LYYA 4ARPA 1LJNA 3U60B 1G7HC 1GE1A 2B7XA 3WHKA 1LZDA 1NWGA 3C83A 4I7KA 1DGHB 3LCVB 3RGSA 1G1WA 3VLFB 187LA 1L39A 1L87A 1P37A 3MHVC 3GLGE 1L02A 126LA 1GVNA 2FYDA 3AJIB 1OWYA 1XFPL 4W55A 4H9IA 1P2CC 1YL0X 2YBHA 1DYDA 4YEMA 3T15A 146LA 1OV5A 4PDGA 1WR1B 191LA 3FTEA 1QT7A 3P68A 5E9RA 4EMNA 1DGFA 4KXIA 3GUKA 4FCVA 5KPTA 4LF8M 1GFKA 1IN7A 2FH0A 3CDRA 237LA 1VFBC 1C6LA 2DHRA 5I14A 4PT5A 1QT5A 1IORA 194LA 1B7OA 4G4CA 1PJIA 1SX7A 2NWDX 3IG5A 2JY8A 4LY6A 1LJJA 2EUCA 2R4EA 1F0WA 1R5LA 2R65A 2BNKA 189LA 3LQQA 2APLA 2F5NA 3SB7A 1LHJA 4Z8XA 168LA 1GKIA 1IN4A 1GB0A 1L42A 3J27B 1LJFA 1UIBA 4AKGA 4WM5A 3SATA 118LA 4N1CC 5A2QS 245LA 2YBMA 2LVOC 5K7OA 2KDLA 5APDA 3RUNA 1GFRA 3TQSA 4JI6M 3DZDA 1DKKA 1JKAA 1TGUA 4KLNA 3VDPA 2CV2A 2F4GA 1NY5A 5B05A 2D6BA 5LVKA 1ZYTA 2MEDA 4Z46A 4M9ZA 3VFDA 3C82A 2W82A 4NIJA 2HCBA 2K9DA 1VDLA 2K47A 1V7SA 3K9OA 4LFBM 4QOZC 1DPXA 4NRWA 3GO8A 1L17A 1L51A 4Z3MA 1Z59A 1P7SA 5ITXA 3DN4A 1C6IA 2L09A 3FI5A 4MGIE 5FCPA 241LA 4LZZA 1P2LA 123LA 1G0MA 1BB6A 5B1FA 1W08A 4A7DA 1REMA 1G0KA 2W1LA 145LA 3HH6A 5APFA 2B6ZA 5KPZA 1B5WA 2L78A 2C8OA 4ZPXA 1NY6A 1LYFA 3A6BY 1B2KA 4YF2A 2B73A 2Z19A 182LA 1CKFA 6LYZA 4I7OA 3ZVQB 4DDCA 1GPQC 5C18A 1KXWA 2I26L 4H8XA 1TTEA 1LYDA 1QUHA 3RU5A 2HL7A 2BQBA 1D2WA 4HJZA 1DI5A 4NY5A 108LA 1DGBA 4OW0A 1NJFA 1HR0M 2BQCA 1KW5A 3G3WA 3GP1A 3LYTA 5KXZA 5KKJA 1P46A 1VG5A 1G06A 171LA 1NBYC 3HU9A 1D6QA 4TUNA 5APEA 4ARMB 3SFZA 2HEDA 1CTWA 1OUJA 2LHMA 1LJHA 2RBRA 4R6CA 4H9HA 4GLVA 3MGWA 1CU6A 1L44A 4IIWA 2DQAA 1CU3A 2F5SA 1GFEA 1WHCA 4XJFA 2CFOA 2Z12A 152LA 2B74A 1Q3CA 1L95A 2R62A 4DD9A 1L04A 1O23A 3C80A 4B3MM 4DT3A 3GQ3A 4CISA 1L66A 3WU8A 1OUHA 2B3TA 3SC3A 3FE0A 4DYGA 2JNHA 5FHWA 4XJBA 4IBEA 4HSFA 1LMTA 1UIDA 4LT3A 2O01F 2L7IA 4MH0E 1AKIA 4XJGA 1IY2A 162LA 3ZH9B 1G0LA 1C67A 3J4GA 2B70A 1NHGC 1N75A 1LV7A 4RLNA 3HTGA 3KXEC 5EXXA 5HNLA 1A4VA 4M0WA 2WSEF 3AW7A 3A8ZA 4L16A 1LGWA 1DYCA 4DKLA 2L6OA 3Q8GA 4H90A 4XADA 2RBOA 7LZMA 4UWNA 3W68A 3UK6A 1OVJA 4IJ4A 1QT4A 4GRVA 2RGOA 156LA 1XXHE 4D82A 3PVSA 159LA 3U6EA 5HNCA 3OJPA 2QZ4A 3M0EA 3HJSA 3KS4A 2LBCA 2Q9EA 2ZIJA 4LG2A 4WM6A 1JKCA 1LYJA 1QQYA 3C7ZA 1LWKA 3EXDA 3WW5A 1XGPC 207LA 1UACY 1GFUA 4BAPA 4D9ZA 1G0JA 4P16A 1YKYX 2ZQ3A 4GCFA 3GLHB 1HNZM 1NHEA 4ET9A 3E46A 255LA 235LA 1L47A 3D9AC 4DR1M 1L31A 1LSPA 5KXRA 1NJGA 1E8LA 3FRIA 2QNJA 4AKHA 4LF7M 3W0FA 4DV1M 4I7SA 4J7VA 4ARQA 4FWHA 1FN5A 1DO0A 1L20A 2QPAA 5LXWA 183LA 1KXXA 1TLAA 4QNMA 4B0DA 3CF6E 5C6JA 2CHQA 4KT3A 2CHGA 1SG9A 5LYTA 2Q9DA 3LMMA 4WG1A 1L69A 2LTUA 5F9XA 1C6CA 2XGNA 1GFJA 1A2YC 1WQPA 1NDMC 4DV4M 1LW9A 3BXWA 3LVWA 4QGZA 5KQDA 1LZRA 4ITQA 2BJWA 2OOAA 1OTRA 3RW8A 195LA 3MMPA 4EJ4A 5HMVA 1LZEA 2HUKA 1WTMA 4LYTA 216LA 2BQDA 4LGYA 1IN5A 1ZMYL 3NY8A 1RU3A 5FDJA 3HU3A 2Y0QA 1UICA 1LSCA 1LZNA 3TL4X 3L27A 1LHIA 4WO6A 3NBIA 2H5ZA 1IXSA 3QYEA 1DPWA 5KJ9A 4DV0M 2KRKA 4ML7A 1LZ8A 1GBOA 3HZJA 1L2CA 2DAGA 4FCTA 3FTFA 1L71A 3C81A 1JB0F 2YBNA 4WM3A 1ZAEA 3IECA 2CEAA 4JI3M 3UONA 2G4QA 2I7PA 5KXSA 1BWIA 2DWZB 4MGYE 1GLNA 1JSFA 1TDHA 1QS9A 4PD2A 1WQMA 1IP6A 2QSFX 4B3TM 2F2QA 1R7RA 175LA 1Z5AA 1L62A 2OTYX 1OIPA 5AMYA 5LINA 3SMSA 4NGWA 2BQGA 1G7JC 1L76A 3LZMA 1SWZA 4G49A 2BQMA 5IDDA 181LA 5T3FA 2KZSA 3A67Y 1JIYA 2KNAA 1SX2A 4YX7C 1HMKA 1G07A 3P4ZA 2YVBA 1C6QA 5DL9A 5F3WA 1JQJC 3HU2A 2F5PA 3K1JA 3E9SA 5LVHA 3E4RA 3DMZA 4ETBA 4AKIA 243LA 2UXCM 3SP3A 2KXEA 4OWHA 1IBKM 4GCCA 1TH3A 225LA 1E32A 1HMLA 133LA 4I81A 1IP7A 3HFMY 1QANA 5HQ1A 4NSRA 3WPJA 3NYAA 2KW0A 228LA 1G8PA 4LJ4A 1YAMA 4LJ9A 5D5FA 144LA 4UWVA 1INUA 1LZSA 5ITXE 4CFPA 1C46A 4X3BA 1TAYA 1G0GA 224LA 1WXQA 4RF1A 3K2LA 3L64A 170LA 4OWAA 4GN4A 4EPFA 3K9PA 1V92A 3KP1E 4B7GA 214LA 1L79A 1OP9B 3LN2A 1BB7A 1RI8B 3AFHA 3W0LB 2YDGA 261LA 4H93A 5KKIA 2DQJY 4NG8A 3AZ5A 1CV6A 3WULA 2LHCA 1L58A 4PPOA 4LYCA 1C6AA 3W6BA 4GBRB 3SAWA 1PJTA 3B0KA 2UUCM 1GB5A 5JENB 5KXLA 4DJHA 2ZBKB 139LA 1P3NA 2F4VM 1C6FA 3GUIA 1P3QQ 3L26A 1L49A 1VATA 3HDEA 1L09A 252LA 3IJVA 4NSGA 1L52A 2QP9X 217LA 4LYZA 1YIKA 3T6PA 4PJ2C 4WM1A 1LSBA 1JHLA 1XGTC 2OE4X 1PJQA 2O7AA 5F16A 4KODA 1LLHA 1YE9A 3BBZA 3DN3A 2HEEA 190LA 4GITA 5IZ7D 4XBOA 1QZMA 4QEQA 1UUZC 3GUJA 1OUEA 169LA 1T97A 1IY0A 3A96A 1GFAA 2DI0A 1C45A 1AZFA 4H9CA 2KRUA 2CHVA 1QTDA 1D0MA 2FE8A 4HPEA 3KAMA 137LA 1DGGA 2RGHA 5D5CA 4ZIXA 1N78A 2Z8YM 1EL1A 1VAUA 5KXOA 1GEZA 1GE2A 1I6SA 4HL4A 3AL0C 4HV1A 4M9SA 3K8ZA 1OVHA 2BQNA 4DQ5A 2MROB 1CUKA 1B7SA 1OYUA 3RFWA 1LPYA 230LA 4FDYA 4NGVA 5KXPA 3VW7A 1L35A 1SXJB 3A46A 1DV0A 1G71A 1HNLA 5EP3A 2L4FA 5EBHA 1JWRA 1IX0A 4GMQA 2RRUA 4E3UA 3GLIB 1LSAA 4OWCA 1C6PA 4W53A 3D4SA 3WL2A 1KS3A 3TXIA 4O34A 3AZ6A 1PQJA 205LA 3I01M 1GBWA 4WM2A 1B5UA 2ZQ4A 1OQYA 1IFYA 1L64A 5E6JA 2OE9X 2XTHA 4I0CA 4OOTA 1GE4A 2K6BA 1N36M 1LGUA 3FD9A 3T38A 1Q02A 2C98A 1CVKA 5BR8M 2DAMA 197LA 2R46A 2DAEA 1XEIA 4FVMA 4I7LA 1HENA 1BQLY 1GBXA 3QY4A 2DXIA 1XHBA 2XH9A 1XSFA 1N34M 4JI5M 1XGRC 192LA 1GO5A 232LA 1YAOA 4OU7A 4AW4A 1IP5A 1CV0A 1CKHA 2W1YA 5KY1A 3K92A 1L83A 1QUSA 103LA 1L45A 4L78A 3GRUA 2RBPA 262LA 1L84A 1MELL 5DM9A 1D2NA 4QHTA 1GBYA 4IBJA 1WQOA 3AOEC 3GLFB 1LZ4A 259LA 4JI1M 4WO9A 1REYA 1ORYB 1LMPA 3JAMS 3LW5F 4MGKE 1HNWM 115LA 1LYEA 4N5RA 5IELA 3W6EA 5LYZA 4FWGA 4KO8A 4D81A 2LZMA 1BVSA 2LWXA 1L86A 5F81A 1GF3A 3DNAA 3BOSA 4YY3M 4ETCA 4UN2B 1C68A 3EIEA 3HWLA 1WIVA 4YXCA 2FOIC 1LSFA 4OOOA 3TXBA 248LA 1GB3A 4ZEEA 3GLGB 2FBDA 111LA 2BQEA 140LA 3FTDA 2EIZC 3QAKA 2D4JA 4ARLA 4PK0A 3U5ZB 2HECA 4II8A 3U6MA 2B6WA 2F2NA 4CIZA 4L6V6 134LA 3Q8XA 4JV5M 1QT8A 4NL4H 1L06A 4AI6A 3A45A 5B1GA 3DN6A 1JKDA 4P2EA 5II3A 4LF9M 1ZURA 4RW1A 1GF6A 4FWDA 1LYSA 1V7TA 3ATNA 3L25A 3R8FA 1IWZA 5FELA 1VDPA 3LCUA 2DQCY 1NDGC 2CUUA 1OFHA 1CUPA 2G3QA 4NHQA 4ETEA 1BB4A 1YILA 4IBIA 1W5TA 102LA 2DQFC 1Y8GA 3AGHA 1REXA 1GL6A 3AZ7A 1SLYA 1IWVA 2F5OA 1RCMA 1R2ZA 3HTDA 3U61A 4DR3M 1XB2B 2DNAA 1IY4A 1XGUC 208LA 231LA 1XEPA 4ET8A 3LYMA 1HHLA 4N1EI 2XJWA 4IBGA 3RT5X 4P17A 1LHKA 1XEJA 2LVQD 3CGWA 4XYYA 5KXWA 1LHMA 3THGA 2QB0B 4NSJA 3AKZA 153LA 135LA 2XEPA 3CSQA 3TXHA 3VDUA 2EA0A 5LVIA 109LA 3NWLA 2GV0A 2W1MA 1L19A 2BAAA 2XBSA 2JUJA 2JY6B 1B0DA 4H1PA 1C61A 4DC4A 3B9PA 2D4KA 1BVXA 1L01A 3TXGA 3WHLA 5KXKA 2JP7A 1ZV1A 3ULRA 2DHYA 1GJSA 1D3NA 1CJ6A 3DMVA 2F47A 4CJ6A 4NGZA 1C64A 1LJIA 1OUDA 5L3IA 1DYEA 2N5ZA 4JN6A 4DD3A 3HU1A 5DNYA 1PZYA 4HTNA 3SN6R 4DD1A 2HKJA 3CTWB 4XK8F 1GAYA 130LA 1DZBX 112LA 1L07A 1PQKA 1JSEA 2Z2FA 4JI2M 2JWSA 1VQ1A 4WLTA 1IXZA 1LYHA 1F4IA 5KXTA 1D0KA 1YL1X 1IN6A 1T3PA 3P66A 1AT6A 4J1AA 1HQCA 2CV0A 2OTZX 1L8QA 3J7AS 1VDTA 2CUZA 1CJ7A 4JI8M 1L14A 4W5WA 3WVXA 4NXNM 4GCEA 3CF0A 1UIAA 3ZEKA 4DWXA 1J09A 1D3MA 2OU9A 4E97A 1UC0A 1C1KA 3HKPA 1N4FA 2DQEY 201LA 3U6CA 1L82A 164LA 4GH9A 4DR4M 4NHSA 3KVWA 1C69A 3A3RX 2BQLA 154LA 3LVVA 4AZFA 4NHTA 5FTLA 4IJEA 3TWMA 4GC5A 2J7NA 4DBGB 2D91A 4WG7A 3SMPA 1LTMA 5KXYA 2KA6B 3N9CA 1DYFA 1IY3A 4GN5C 1WVVA 2EJSA 1A5TA 4G6ZA 2C9CA 4YOPA 5ITYA 2ZTCA 4EXMA 1B7MA 2C9OA 3P64A 4MB7A 1G3IA 2RH1A 4HV2A 1WTNA 1JTNA 1ZVYB 3RE8A 2A7DA 1JTTL 1LMQA 1FLYA 1HELA 2VQFM 3FA0A 1TH4A 1DKJA 3SHGB 3F9LA 1UBZA 2BWBA 4YENA 3EO5A 1D3JA 1QTEA 1NNJA 1IOSA 1XC8A 177LA 1RJCB 1JITA 2DAKA 5DLAA 5A3ZA 4XN6A 4PJZA 1L08A 246LA 1XXHB 4K5YA 2IGCA 1BB3A 151LA 1MN3A 1AT5A 5M1YA 1L85A 3SAUA 1YAQA 2HEBA 4M0DA 4BBAA 1P2RA 3LZ2A 1LSYA 2RBQA 1L38A 2ZNXY 3AOEA 3HY5A 1L74A 1ZMVA 1GB9A 4W57A 1IWWA 1FLUA 1GF0A 1FKQA 4GN3A 4EKSA 1QZEA 2RB2X 1HEOA 1H6UA 1I1ZA 1LZCA 1KXYA 249LA 3CSRA 1IC5Y 4DDBA 3GXRA 1GFGA 3HU8A 1EQEA 2ZM6M 4QHSA 3V76A 2F32A 4ETDA 3CDVA 3EMLA 4IBFA 4WOAA 3G3AB 4R3DA 2F4AA 4Z6YA 157LA 1J1XY 4HPIA 3CDQA 104LA 2LYMA 3PBLA 3HBEX 2NQ8C 3N9EA 4WP2A 2EKFA 3KSJA 2CJLA 3T1YM 251LA 2FBBA 2LYZA 1EIJA 1EQ5A 1QSAA 1L0JA 2Z39A 1GHLA 4FJRA 3FUVA 1D9WA 1OUIA 2BQFA 3HJQA 1C6JA 1ZQ9A 1YQVY 1L1ZA 4LFAM 7CATA 1HEQA 3FUTA 2O4WA 2I7NA 2LH0A 4BADA 2RB0X 1R6BX 4LZTA 1Z5CA 5J7CA 4EKPA 4G3OA 2VF8A 1IBMM 2DWLA 2QBYA 2NTHA 3HH4A 4WLDA 2AUBA 1IM2A 3IWRA 2EKKA 3D8LA 1T8AA 4W52A 2LZ2A 2XLJA 1CX7A 2HAKA 3C58A 2LVAA 1KIRC 3HBDA 3K2RA 4NEBA 1C6MA 1GF7A 1FNNA 4HJVA 3DA1A 4JI4M 1HT1E 5KXXA 1LSGA 1CUQA 3UZUA 1L11A 4S0WA 4GKKM 4K0KM 4NGJA 1IP2A 1UIHA 2RBSA 5LMUM 1L89A 1P6YA 4IJFA 1LAAA 2Z4RA 2JZ0A 1L13A 1IBLM 4WURA 4HJYA 4HTQA 5FEKA 5KXMA 2R44A 2C8PA 4I7JA 4DV5M 3SBBC 4YHHM 1L41A 1D6PA 3AZ4A 3SBAA 4MCKA 1L21A 1TF0B 158LA 199LA 247LA 4UWUA 2G4PA 5FLXS 1E9SA 4DUZM 1L59A 4RLMA 3KS8A 2M5ZA 2X0AA 4CHTB 4FCWA 4BAFA 3KW6A 142LA 3DN1A 1L97A 1L70A 4WM4A 2YBJA 4RDSA 1L57A 1C6DA 4GKJM 1GFHA 3L29A 1ZWNA 1LZTA 2JY7A 1L30A 2XFSA 4G4NA 3NBXX 1B5YA 1T8GA 122LA 5B07A 5BPVA 4Z98A 1EPYA 3J2PB 3LHMA 1WVUA 2I6ZA 4I8SA 4EPIA 4DV6M 1MX0A 1QDTA 2O79A 4PRUA 3TE6A 4OWEA 1B7NA 1JTPL 186LA 4H91A 3GRYA 5IREB 1L80A 2LXEA 3KOYE 3KOZE 3FKEA 1KY1A 1DI3A 5EJCA 5KXNA 1P5CA 167LA 1VEKA 1L28A 5ITQA 2VQEM 1GF9A 1GL7A 1L15A 8LYZA 4B1AA 2Y20A 3U60A 3RZ4A 1N33M 4G9SA 1PJSA 5EXPA 1DGHA 149LA 2QQ8A 1B7RA 3SYLA 2BQHA 1C6HA 2G5GX 1E9RA 2UUAM 4NOOB 1OUCA 4HTKA 1QYRA 141LA 1OAOC 1C63A 5DN4A 2FNAA 3RNXA 1KW7A 3A94A 2L7HA 2DQIY 4AXTA 3OE0A 1C6GA 1OWZA 2BQAA 2HUBA 4N0JA 1LZ5A 3HT7A 1XEKA 2PC2A 3AV0A 1IWUA 2OOBA 240LA 215LA 2I25L 4L8RC 3M3UA 2MH8A 1JQUA 2WSFF 3T1HM 257LA 1S3SA 2R45A 3SASA 3SYKA 3AOGA 3OE6A 4X64M 3FYDA 3H4MA 3TWLA 2HTXA 1L33A 1VEGA 1N32M 5I4XA 2DKVA 3E3DA 2ERCA 4G4RA 212LA 2HUMA 4DD2A 3FUXA 223LA 1JJ3A 2BLXA 4I5SA 3WU7A 5KPRA 1CKGA 1L48A 1YANA 4DAJA 4DUYM 2JA2A 1L67A 4M4OA 3LYOA 1QUDA 1P56A 1JTMA 131LA 4YXAC 3V2YA 1L93A 1LZBA 4TWSA 3SB9A 1QT3A 2X8AA 4DR5M 1NBZC 2JXNA 3AGGG 1L72A 254LA 218LA 3WXUA 1UIFA 129LA 3U6DA 1PS5A 3FRHA 1B6IA 4NSOB 5C6IA 1P64A 2KNZA 4LZMA 2B6XA 1CJ8A 1G41A 1KY0A 2R0IA 1JJ0A 196LA 2MEHA 4HP0A 9LYZA 3UGJA 1GBSA 244LA 1R2YA 4GC9A 5HMJA 8CATA 3TXFA 1W6ZA 1XNRM 258LA 5EP2A 2UUBM 1NV8A 2F30A 3B72A 2ANVA 221LA 132LA 3I04M 4Y28F 1OUBA 3TMWA 3ZVQA 3WXTA 3D3DA 3OE8A 4KPMA 120LA 5I4WA 4JI7M 1I56A 3TMUA 1J1OY 5DN5A 3DMXA 1L61A 4W54A 4IBCA 1KIPC 2LHGA 3AGIA 1KYIA 2X49A 1C43A 1BGIA 2B5ZA 1CJ9A 1B7LA 1Q39A 4ARMA 1C6EA 1LYGA 4EIWA 1D3FA 1QTBA 3PNYA 1Z5BA 1L53A 1IWXA 3QAUA 1OIZA 4NGYA 2CGIA 1K3WA 1G59A 3A3QA 1MJGM 3B0IA 3GPXA 4ARQB 1NV9A 213LA 3B7ZA 2CWIA 1L54A 4GHAA 1LHHA 1L81A 2RKOA 1QAMA 1NHWC 2LVNC 1OKSA 1K82A 1C66A 4B4JA 5LVJA 1IR8A 1CX6A 1IOCA 5LIOA 185LA 5L8RF 3HHYA 4F1IA 4F2LA 3U6SA 1JUGA 1VEDA 2QARC 1L55A 4XGIA 3A92A 2A7FA 4H92A 4I7QA 3U6LA 3V2WA 1LMAA 3HHXA 1SSWA 3HH5A 3E21A 4NGLA 1QUGA 3WH1A 3A98B 5JI2E 1GF4A 1LPIA 3SARA 1H87A 2Z6BA 4LZJA 4AQNA 4C3WA 1IXRC 1HJPA 1H6MA 3GLIE 1L05A 3CF2A 1GF8A 4X65M 1DXJA 4I4LA 1LKSA 3U6QA 1VDQA 1WGNA 2H1RA 2DQGY 4GRIA 1TH2A 3BKVA 2Y0TA 1IXSB 229LA 3W6AA 2V1UA 4LRSA 6LZMA 3BKHA 1LSEA 2BQOA 4LGKA 2L2DA 2Z7JA 3HT6A 143LA 4M9XA 2RAYX 3B0OA 4I8OA 2MEIA 5FSTA 1QAOA 4LF4M 176LA 4W51A 4ARJA 222LA 239LA 4EOFA 4MGHA 1L32A 3CSZA 1RE2A 3HUAA 1L99A 1HSWA 1L50A 4WLXA 3PNVA 1YKZX 5F9UA 1LWGA 1L22A 3GUPA 3HJ8A 4B49A 1KSFX 4XJDA 4W59A 1FJGM 1K28A 4IBKA 3GLHA 4LJAA 2RAZX 4ETAA 5L3HA 4A3VB 1FLWA 3IG8A 1PRBA 2YR0A 2B72A 3W67A 3C8SA 150LA 3I4VA 1NQIA 4DD7A 4DQJA 4NWHA 4IBBA 4NGIA 4PGJB 4G4OA 1HFYA 4LDEA 4YEOA 4LF6M 2D4IA 3TXEA 3GQ5A 2DWMA 2QHOB 1GB8A 2Y8PA 7LYZA 4H9FA 1SXJC 1KFVA 2MEBA 1OQMA 1HFZA 4DR2M 2E5LM 1WQQA 3NY9A 4MM3B 3DOAA 5LZMA 4GIPA 2AHMA 4B4IA 2C99A 2DBTA 3FTCA 4QY9A 1BB5A 1JEFA 1CU0A 5ITUA 1CV3A 3UMMA 2RB1X 3GQ4A 1LSMA 2ZAOA 3U6OA 1T6HA 1QTCA 1HFXA 3GUNA 4QNRA 3J80S 1QSQA 1C65A 4AGAA 1WGLA 4I7MA 2GQFA 2CE7A 1EFUB 3TXKA 1SQ2L 2B75A 3GPPA 1BVKC 4PCZA 2H9KA 1IC7Y 4OW1A 113LA 206LA 5FTJA 4OO9A 4LGMA 3J7BA 1IP4A 1YKXX 2YFQA 3KSXA 4IBDA 1YSYA 1GF5A 2WZJA 3J6KA 4AG5A 1IEEA 3A6CY 1QSWA 1D2YA 1QTVA 5B06A 1ZMWA 1TR8A 1GB7A 1L18A 1UIGA 4I7PA 2FYCA 2ZANA 4B7FA 2Z38A 3U6PA 3VK8A 1TDZA 3SAVA 3D8BA 1B5VA 2HHHM 3JR5A 1GB2A 3TPZA 1GDXA 1L2BA 3GUOA 4J1BA 4TTDA 2JZ1A 3R9XB 5ILFA 3PFIA 3UJNA 1GAZA 3OTOM 4NG1A 2OPFA 4H8ZA 1L77A 1LJ3A 4WMGA 238LA 1OUAA 5DFLA 3HT8A 1JR3E 4MSTA 3FADA 1IO5A 3DKEX 2EO2A 4B08A 2CV1A 2VIIA 3MJ5A 1LZ9A 1NMMA 4GHLA 1VDSA 2MEEA 1DO2A 4OVZB 5APCA 4WLYA 1BHZA 1QUOA 107LA 2ZILA 1L24A 3C7YA 3K3TA 3M6AA 1GEVA 3HWSA 127LA 1L63A 2BQKA 2HWJA 3HT9A 2Q2EB 2L4EA 2CWBA 1N77A 4J0LA 163LA 1AIPC 1L46A 5LA8A 250LA 5FTNA 1C60A 4NHIA 4WL7A 1JPOA 1LMCA 3MK6A 1DYAA 3LYZA 2UXDM 2A4TA 3GULA 1GD6A 2Z18A 3GUMA 3F92A 2LZTA 2KNVA 1L03A 1G0PA 2VDBB 3OE9A 1OAIA 1GXXA 1LMOA 3T6UA 4CGYB 1JISA 1L98A 256LA 1HSXA 2V6ZM 3W3EA 3H4JA 1PJJA 1C7YA 2R4JA 3GRRA 4GEWA 2O25A 5EXSA 5JI3E 1SXJD 3W6CA 3KFUG 4B3SM 4LFPA 4NSHA 1NO1A 1YROA 2VF7A 1F6RA 2QCUA 110LA 1LHLA 2OU0X 2UU9M 3SB8A 4LJ7A 1LZAA 2DENA 1JTOL 4LFCM 2LCBA 3F6ZA 1IR9A 1FKVA 3IJUA 1DYBA 2HU1A 1MU5A 1TCYA 3A34A 1G7LC 6LYTA 2XF3A 4FD2A 1C7PA 1QUTA 234LA 2CDSA 5KO3A 4Z41A 3L28A 5A3EA 1L94A 1B7QA 4I7TA 4NHPA 1IVMA 2BJVA 3M7GA 1NKHA 3ZC7B 2K0BX 2HULA 2IHLA 3HTBA 4HEOA 3SBJA 3KP0E 3GPUA 2FS1A 1XJTA 2X4AA 2DVWB 4LJ5A 4JYAM 3VKHA 3B89A 4DV3M 1ZV5L 4PHIA 2OQ4A 1QT6A 3QNGA 3RZEA 3A95A 4NWEA 2MEAA 4I7NA 3HGIA 2Z3XA 1LSNA 3KDSE 5I5QA 1IC4Y 3WMKA 1LI3A 3SB6A 1YLAA 4BS7A 4NSIA 3HUQA 1ZMUA 2ZYCA 128LA 4KL7A 2VB1A 5KQ8A 2Y21A 4PDIA 1QS5A 2MEFA 5HLLA 3QYBA 3TMVA 4MR1A 4CJ2A 2OO9A 1PQMA 1Z6TA 1CNSA 1F6SA 5C6LA 2YQZA 3JR6A 4XENA 4H9BA 147LA 1IQPA 3GRVA 3DN8A 3B6LA 2N35A 2C96A 3G3BB 1K3XA 3HHWA 3A91A 3GPYA 1T6VL 4WW0A 1BWJA 165LA 3L2XA 3FUUA 1QTZA 1L60A 3C3DA 5H37D 4DDAA 3DN2A 3RGPA 4LDOA 4R71A 4L41A 1L90A 1LZGA 1LYZA 2ZIKA 1GXV2 4RNAA 1L26A 3IHPA 1SXJA 5L9JA 2ZAMA 5IWAM 1HNXM 2Z4SA 3C9PA 1LZYA 1R4GA 1XMOM 1LYOA 210LA 4H9AA 1T43A 2CRUA 4NGOA 4LJ8A 4G4BA 3TMXA 1C6BA 1L65A 1J7KA 188LA 1GB6A 4NRVA 1SSYA 1T8FA 2MR9A 3GLIA 4DR6M 5LAGA 5LVGA 1HEWA 1GBZA 3WYHA 1L29A 1LJ4A 1B5XA 3TWKA 2R6FA 2MEGA 4TUWA 3WUMA 1G4AE 219LA 1L34A 3CT0A 1UCOA 4W56A 1LSZA 3EIHA 1L1TA 1C10A 4I7RA 1OFIA 3I51A 4H94A 1PQDA 193LA 3GLHE 2DAIA 3AYQA 1HQYE 1QTHA 1IIZA 3QE8A 4IAPA 4LCBA 1OV7A 3CT5A 3PDSA 4LF5M 4II7A 1DI4A 5IHGA 3U61B 4W94A 2UXBM 1JKBA 4OX9M 4XJIA 155LA 5I54A 3J81S 1G1VA 2DQHY 4FW9A 1QIOA 3KOXE 2G4NA 4R0FA 160LA 3WW6A 2EKSC 1CV1A 4DD0A 1UIEA 1Q3BA 1AUAA 3GLFA 5E26A 1LZ1A 1FDLY 1L88A 4TSBA 1LKRA 4LT2A 5ITTA 4LT1A 1GFVA 1QVRA 3FI7A 3C7WA 3ZQJA 4LYMA 1HEMA 4OWBA 2XSZD 1JR3D 3ILKA 4GLAA 2DKLA 3WPKA 1AM7A 4IASA 2D7EA 2Q0MX 1C6KA 5LYMA 1JJ1A 1W5SA 3FUWA 1IWTA 2Z37A 3GLGA 1L27A 1L40A 4LT0A 1HC0A 174LA 3P65A
chains in the Genus database with same CATH topology
1OVKA 1G7MC 2YBLA 1L43A 3CDOA 4QDNA 3HTFA 148LE 1CKCA 2LC9A 172LA 2HU3A 4W96A 1CV4A 1GE0A 114LA 3A90A 1B9OA 1GE3A 1IR7A 2ZNWY 5LA5A 4W58A 1LGXA 1TBYA 1L91A 125LA 3ATOA 1QSBA 1IWYA 1L0KA 3N9AA 1L96A 3A93A 1EQ4A 1LJKA 2ANXA 1QDRA 4N8ZA 1OUGA 3CDTA 4YM8A 1QTKA 2B6TA 1TDYA 1J1PY 5B59A 1L73A 1IOQA 211LA 2OE7X 2OU8A 1ZVHL 2XBRA 4CFOA 161LA 4TSCA 5I53A 5E4PA 3WUNA 1L10A 4GCDA 4LYBA 3M18B 2HEFA 1SWYA 1TEWA 1I20A 3HUKA 198LA 2RSCA 1FLQA 3HH3A 1Z55A 3WUAA 2OEAX 1D0LA 1C6TA 2EPEA 3HBHA 3WVYA 184LA 2YSSC 1ALCA 138LA 1KIQC 4PRQA 2BQIA 4RW2A 3AW6A 1WQNA 2BLYA 1DQJC 4ZPUA 4LFXA 1L36A 2ZWBA 1B7PA 2EQLA 4CHXA 1B5ZA 2LYOA 1F10A 3W6DA 4ZFPA 1PQIA 3C8QA 1IP1A 4C5FA 1G0QA 3GXKA 1HERA 1GWDA 1L92A 4DQ7A 4XJHA 1LOZA 3T36A 1L56A 3DN0A 173LA 3CT1A 3EBAB 1L00A 1XJUA 1G7IC 1HEPA 227LA 1L37A 209LA 4G4HA 220LA 2IFFY 1LI6A 5F14A 1DYGA 3HDFA 4ANRA 1YAPA 2HEAA 1CU2A 1CV5A 166LA 178LA 3CQLA 1LSDA 2MECA 242LA 1L23A 233LA 3OK0A 1OUFA 4IATA 180LA 1REZA 4EKQA 4CGEA 2YBIA 3WPLA 2XQOA 1FBIX 3AB6A 226LA 3EMSA 4NFVA 5I4YA 3TXJA 2H9JA 1LZ6A 260LA 2BQJA 3TXDA 1L12A 1RFPA 253LA 4LDLA 3CB7A 1NF5A 1LCNA 2DQDY 1MLCE 2W1XA 3LZTA 200LA 1GFTA 1XGQC 1C08C 2NTGA 4GCBA 4EKRA 1LYIA 1L25A 1NHBA 1CU5A 4N9RA 2Z2EA 1WQRA 1IOTA 5ILCA 2BPUA 1IP3A 1C62A 1HF4A 1L75A 4H9EA 4H8YA 1C6NA 1P36A 1L16A 2ZYPA 1LI2A 3WU9A 1WTHA 119LA 2RBNA 3ODUA 1LJGA 3G3XA 236LA 3AJNA 3VWOA 4TX7A 5LAFA 4NGKA 3W6FA 4WL6A 1L68A 1GDWA 4LYOA 1CKDA 4B4EA 3F8VA 3SB5A 3C8RA 2WARA 4U3XB 1PQOA 1KNIA 2B6YA 1BWHA 1LJEA 1LMNA 1D9UA 3G3VA 1UA6Y 4M6DA 1LYYA 4ARPA 1LJNA 1G7HC 1GE1A 2B7XA 1NWGA 1LZDA 3C83A 4I7KA 1G1WA 187LA 1L39A 1L87A 1P37A 1L02A 126LA 2FYDA 1OWYA 1XFPL 4W55A 4H9IA 1P2CC 1YL0X 2YBHA 1DYDA 4YEMA 146LA 1OV5A 191LA 1QT7A 3P68A 5E9RA 4EMNA 4KXIA 3GUKA 1GFKA 3CDRA 237LA 1VFBC 1C6LA 5I14A 1QT5A 1IORA 194LA 1B7OA 4G4CA 1SX7A 2NWDX 1LJJA 1F0WA 189LA 3SB7A 1LHJA 168LA 1GB0A 1L42A 1LJFA 1UIBA 4WM5A 118LA 4N1CC 245LA 2YBMA 5K7OA 5APDA 3RUNA 1GFRA 1DKKA 1JKAA 2F4GA 5B05A 2D6BA 5LVKA 1ZYTA 2MEDA 4Z46A 3C82A 4NIJA 1V7SA 1DPXA 1L17A 1L51A 4Z3MA 1P7SA 3DN4A 1C6IA 3FI5A 5FCPA 241LA 1P2LA 123LA 1G0MA 1BB6A 5B1FA 1W08A 4A7DA 1REMA 1G0KA 2W1LA 145LA 3HH6A 5APFA 2B6ZA 1B5WA 2L78A 2C8OA 1LYFA 3A6BY 4YF2A 1B2KA 2B73A 2Z19A 182LA 1CKFA 6LYZA 4I7OA 3ZVQB 4DDCA 1GPQC 1KXWA 2I26L 4H8XA 1LYDA 1QUHA 3RU5A 2BQBA 1D2WA 4HJZA 1DI5A 4NY5A 108LA 3G3WA 3LYTA 2BQCA 1KW5A 5KXZA 5KKJA 1P46A 1G06A 171LA 1NBYC 3HU9A 1D6QA 4TUNA 5APEA 4ARMB 2RBRA 2HEDA 1CTWA 1OUJA 2LHMA 1LJHA 4R6CA 4H9HA 4GLVA 3MGWA 1CU6A 1L44A 2DQAA 1CU3A 1GFEA 4XJFA 2Z12A 152LA 2B74A 1L95A 4DD9A 1L04A 1O23A 3C80A 4DT3A 1L66A 3WU8A 1OUHA 3FE0A 4DYGA 5FHWA 4XJBA 4HSFA 1LMTA 1UIDA 4LT3A 1AKIA 4XJGA 162LA 1G0LA 1C67A 3J4GA 2B70A 4RLNA 3HTGA 5HNLA 1A4VA 3AW7A 3A8ZA 1LGWA 1DYCA 4DKLA 4H90A 4XADA 2RBOA 7LZMA 4UWNA 1OVJA 4IJ4A 1QT4A 4GRVA 156LA 159LA 5HNCA 3OJPA 2Q9EA 2ZIJA 4WM6A 1JKCA 1LYJA 1QQYA 3C7ZA 1LWKA 3EXDA 3WW5A 1XGPC 207LA 1UACY 1GFUA 4BAPA 4D9ZA 1G0JA 1YKYX 2ZQ3A 4GCFA 1NHEA 4ET9A 255LA 235LA 1L47A 3D9AC 1L31A 1LSPA 5KXRA 1E8LA 4I7SA 4J7VA 4ARQA 1FN5A 1L20A 5LXWA 183LA 1KXXA 1TLAA 4B0DA 5C6JA 4KT3A 5LYTA 2Q9DA 4WG1A 1L69A 5F9XA 1C6CA 1GFJA 1A2YC 1WQPA 1NDMC 1LW9A 4QGZA 1LZRA 3RW8A 195LA 4EJ4A 5HMVA 1LZEA 2HUKA 1WTMA 4LYTA 216LA 2BQDA 1ZMYL 3NY8A 5FDJA 1UICA 1LSCA 1LZNA 1LHIA 4WO6A 2H5ZA 1DPWA 5KJ9A 4ML7A 1LZ8A 1GBOA 1L71A 3C81A 2YBNA 4WM3A 3UONA 2G4QA 5KXSA 1BWIA 1JSFA 1QS9A 1WQMA 1IP6A 2F2QA 175LA 1L62A 2OTYX 5AMYA 5LINA 4NGWA 2BQGA 1G7JC 1L76A 3LZMA 1SWZA 4G49A 2BQMA 5IDDA 181LA 5T3FA 3A67Y 1JIYA 1SX2A 4YX7C 1HMKA 1G07A 3P4ZA 2YVBA 1C6QA 5DL9A 5LVHA 3DMZA 4ETBA 243LA 3SP3A 4OWHA 4GCCA 225LA 1HMLA 133LA 1IP7A 3HFMY 5HQ1A 3WPJA 3NYAA 228LA 1YAMA 5D5FA 144LA 4UWVA 1INUA 1LZSA 4CFPA 1C46A 4X3BA 1TAYA 1G0GA 224LA 3L64A 170LA 4OWAA 4GN4A 4EPFA 214LA 1L79A 1OP9B 3LN2A 1BB7A 1RI8B 2YDGA 261LA 4H93A 5KKIA 2DQJY 4NG8A 3AZ5A 1CV6A 3WULA 1L58A 4PPOA 4LYCA 1C6AA 3W6BA 4GBRB 3B0KA 1GB5A 5JENB 5KXLA 4DJHA 139LA 1P3NA 1C6FA 3GUIA 1VATA 1L49A 3HDEA 3IJVA 1L09A 252LA 4NSGA 1L52A 217LA 4LYZA 1YIKA 4PJ2C 4WM1A 1LSBA 2OE4X 1JHLA 1XGTC 2O7AA 5F16A 1LLHA 3DN3A 2HEEA 190LA 4QEQA 1UUZC 3GUJA 1OUEA 169LA 1T97A 3A96A 1GFAA 1C45A 1AZFA 4H9CA 1QTDA 1D0MA 4HPEA 3KAMA 137LA 5D5CA 4ZIXA 1EL1A 1VAUA 5KXOA 1GEZA 1GE2A 1I6SA 4HV1A 1OVHA 2BQNA 4DQ5A 4FDYA 1B7SA 1OYUA 1LPYA 230LA 4NGVA 5KXPA 3VW7A 1L35A 1HNLA 5EBHA 1JWRA 1IX0A 4E3UA 1LSAA 4OWCA 1C6PA 4W53A 3D4SA 3WL2A 1KS3A 3TXIA 4O34A 3AZ6A 1PQJA 205LA 1GBWA 4WM2A 1B5UA 2ZQ4A 1L64A 2OE9X 2XTHA 4I0CA 4OOTA 1GE4A 1LGUA 1CVKA 197LA 1XEIA 4I7LA 1HENA 1BQLY 1GBXA 3QY4A 1XSFA 1XGRC 192LA 232LA 1YAOA 1IP5A 1CV0A 1CKHA 2W1YA 5KY1A 1L83A 1QUSA 103LA 1L45A 2RBPA 262LA 1L84A 1MELL 5DM9A 1GBYA 1WQOA 1LZ4A 259LA 4WO9A 1REYA 1LMPA 115LA 4N5RA 1LYEA 5IELA 3W6EA 5LYZA 2LZMA 1L86A 5F81A 1GF3A 3DNAA 4ETCA 1C68A 3HWLA 4YXCA 1LSFA 4OOOA 3TXBA 248LA 1GB3A 4ZEEA 2FBDA 111LA 2BQEA 140LA 2EIZC 3QAKA 2D4JA 4ARLA 4PK0A 2HECA 4II8A 2B6WA 2F2NA 134LA 1QT8A 1L06A 5B1GA 3DN6A 1JKDA 4P2EA 5II3A 1ZURA 4RW1A 1GF6A 1LYSA 1V7TA 3ATNA 1IWZA 5FELA 1VDPA 2DQCY 1NDGC 2CUUA 1CUPA 4NHQA 4ETEA 1BB4A 1YILA 102LA 2DQFC 3AGHA 1REXA 3AZ7A 1SLYA 1IWVA 1RCMA 3HTDA 1IY4A 1XGUC 208LA 231LA 1XEPA 4ET8A 3LYMA 1HHLA 4N1EI 2XJWA 3RT5X 1LHKA 1XEJA 4XYYA 5KXWA 1LHMA 2QB0B 4NSJA 153LA 135LA 3CSQA 3TXHA 5LVIA 109LA 2GV0A 2W1MA 1L19A 2BAAA 2XBSA 1B0DA 4H1PA 1C61A 4DC4A 2D4KA 1BVXA 1L01A 3TXGA 5KXKA 3ULRA 1D3NA 1CJ6A 3DMVA 2F47A 4NGZA 1C64A 1LJIA 1OUDA 5L3IA 1DYEA 2N5ZA 4DD3A 1PZYA 4HTNA 3SN6R 4DD1A 1GAYA 2Z2FA 130LA 1DZBX 112LA 1L07A 1PQKA 1JSEA 4WLTA 1LYHA 5KXTA 1D0KA 1YL1X 1T3PA 3P66A 1AT6A 4J1AA 2OTZX 1VDTA 1CJ7A 1L14A 3WVXA 4GCEA 1UIAA 3ZEKA 4DWXA 1D3MA 2OU9A 4E97A 1UC0A 1N4FA 2DQEY 201LA 1L82A 164LA 4NHSA 1C69A 3A3RX 2BQLA 154LA 4NHTA 2D91A 4WG7A 1LTMA 5KXYA 3N9CA 1DYFA 1IY3A 4GN5C 1WVVA 4YOPA 4EXMA 1B7MA 3P64A 4HV2A 2RH1A 1WTNA 1JTNA 1ZVYB 2A7DA 1JTTL 1LMQA 1FLYA 1HELA 3FA0A 1DKJA 3F9LA 1UBZA 4YENA 3EO5A 1D3JA 1QTEA 1IOSA 177LA 1RJCB 1JITA 5DLAA 5A3ZA 4XN6A 4PJZA 1L08A 246LA 4K5YA 2IGCA 1BB3A 151LA 1AT5A 5M1YA 1L85A 1YAQA 2HEBA 1P2RA 3LZ2A 1LSYA 2RBQA 1L38A 2ZNXY 1L74A 1GB9A 4W57A 1IWWA 1FLUA 1GF0A 1FKQA 4GN3A 4EKSA 2RB2X 1HEOA 1LZCA 1I1ZA 1KXYA 249LA 3CSRA 1IC5Y 4DDBA 3GXRA 1GFGA 3HU8A 1EQEA 2F32A 4ETDA 3CDVA 3EMLA 4WOAA 3G3AB 2F4AA 157LA 1J1XY 4HPIA 3CDQA 104LA 2LYMA 3PBLA 3HBEX 3N9EA 2CJLA 251LA 2FBBA 2LYZA 1EQ5A 1QSAA 1L0JA 2Z39A 1GHLA 4FJRA 1D9WA 1OUIA 2BQFA 1C6JA 1YQVY 1HEQA 2O4WA 4BADA 2RB0X 4LZTA 5J7CA 4EKPA 3HH4A 2NTHA 4WLDA 2AUBA 3IWRA 1T8AA 4W52A 2LZ2A 1CX7A 1KIRC 3HBDA 3K2RA 4NEBA 1C6MA 1GF7A 4HJVA 5KXXA 1LSGA 1CUQA 1L11A 4S0WA 4NGJA 1IP2A 1UIHA 2RBSA 1L89A 1P6YA 1LAAA 1L13A 4HJYA 4HTQA 5FEKA 5KXMA 2C8PA 4I7JA 3SBBC 1L41A 1D6PA 3AZ4A 3SBAA 4MCKA 1L21A 158LA 199LA 247LA 4UWUA 2G4PA 1L59A 4RLMA 2X0AA 4BAFA 142LA 3DN1A 1L97A 1L70A 4WM4A 2YBJA 4RDSA 1L57A 1C6DA 1GFHA 1ZWNA 1LZTA 1L30A 1B5YA 1T8GA 5B07A 122LA 4Z98A 1EPYA 3LHMA 1WVUA 2I6ZA 4I8SA 4EPIA 1QDTA 2O79A 4PRUA 4OWEA 1B7NA 1JTPL 186LA 4H91A 1L80A 1KY1A 1DI3A 5KXNA 1P5CA 167LA 1L28A 1GF9A 1L15A 8LYZA 4B1AA 3RZ4A 4G9SA 149LA 1B7RA 2BQHA 1C6HA 1OUCA 4HTKA 141LA 1C63A 5DN4A 3RNXA 1KW7A 3A94A 2DQIY 4AXTA 3OE0A 1C6GA 1OWZA 2BQAA 2HUBA 4N0JA 1LZ5A 3HT7A 1XEKA 2PC2A 1IWUA 240LA 215LA 2I25L 3M3UA 1JQUA 257LA 3OE6A 2HTXA 1L33A 5I4XA 2DKVA 3E3DA 212LA 2HUMA 4DD2A 223LA 1JJ3A 2BLXA 3WU7A 1CKGA 1L48A 1YANA 4DAJA 1L67A 4M4OA 3LYOA 1QUDA 1P56A 1JTMA 131LA 4YXAC 3V2YA 1L93A 1LZBA 4TWSA 3SB9A 1QT3A 1NBZC 3AGGG 1L72A 254LA 218LA 3WXUA 1UIFA 129LA 1PS5A 1B6IA 5C6IA 1P64A 4LZMA 2B6XA 1CJ8A 1KY0A 1JJ0A 196LA 2MEHA 4HP0A 9LYZA 1GBSA 244LA 5HMJA 3TXFA 1W6ZA 258LA 2F30A 3B72A 2ANVA 221LA 132LA 1OUBA 3TMWA 3ZVQA 3WXTA 3D3DA 3OE8A 4KPMA 120LA 5I4WA 1I56A 3TMUA 1J1OY 5DN5A 3DMXA 1L61A 4W54A 1KIPC 3AGIA 1C43A 1BGIA 2B5ZA 1CJ9A 1B7LA 4ARMA 1C6EA 1LYGA 1D3FA 1QTBA 1L53A 1IWXA 4NGYA 2CGIA 3A3QA 3B0IA 4ARQB 213LA 2CWIA 1L54A 1LHHA 1L81A 1C66A 4B4JA 5LVJA 1IR8A 1CX6A 1IOCA 5LIOA 185LA 1VEDA 2QARC 1JUGA 1L55A 3A92A 2A7FA 4H92A 4I7QA 3V2WA 1LMAA 1SSWA 3HH5A 4NGLA 1QUGA 3WH1A 4AQNA 1GF4A 1LPIA 4C3WA 1H87A 2Z6BA 1H6MA 1L05A 1GF8A 1DXJA 1LKSA 1VDQA 2DQGY 3BKVA 3W6AA 229LA 6LZMA 3BKHA 1LSEA 2BQOA 4LGKA 3HT6A 143LA 3B0OA 2RAYX 2MEIA 5FSTA 4W51A 176LA 4ARJA 222LA 239LA 4EOFA 3CSZA 1L32A 1RE2A 3HUAA 1L99A 1HSWA 1L50A 4WLXA 1YKZX 5F9UA 1LWGA 1L22A 3GUPA 4B49A 4XJDA 4W59A 1K28A 2RAZX 4ETAA 5L3HA 1FLWA 2B72A 3C8SA 150LA 4DD7A 1NQIA 4DQJA 4NWHA 4NGIA 4PGJB 1HFYA 4LDEA 4YEOA 2D4IA 3TXEA 2Y8PA 7LYZA 1GB8A 4H9FA 2MEBA 1OQMA 1HFZA 1WQQA 3NY9A 5LZMA 4B4IA 2DBTA 4QY9A 1BB5A 1JEFA 1CU0A 1CV3A 2RB1X 1LSMA 1T6HA 1QTCA 1HFXA 3GUNA 1QSQA 1C65A 4AGAA 4I7MA 3TXKA 1SQ2L 2B75A 1BVKC 2H9KA 1IC7Y 4OW1A 113LA 206LA 4OO9A 1IP4A 1YKXX 1GF5A 3J6KA 1IEEA 3A6CY 1QSWA 1D2YA 1QTVA 5B06A 1GB7A 1L18A 1UIGA 4I7PA 2FYCA 2Z38A 1B5VA 1GB2A 1GDXA 3GUOA 4J1BA 4TTDA 5ILFA 1GAZA 4NG1A 4H8ZA 1L77A 1LJ3A 4WMGA 238LA 1OUAA 3HT8A 4MSTA 3FADA 1IO5A 3DKEX 1LZ9A 1NMMA 1VDSA 2MEEA 5APCA 4WLYA 1BHZA 1QUOA 107LA 2ZILA 1L24A 3C7YA 3K3TA 1GEVA 127LA 1L63A 2BQKA 3HT9A 4J0LA 5LA8A 163LA 1L46A 250LA 1C60A 4NHIA 4WL7A 1JPOA 1LMCA 1DYAA 3LYZA 2A4TA 3GULA 1GD6A 2Z18A 3GUMA 2LZTA 1L03A 1G0PA 3OE9A 1GXXA 1LMOA 3T6UA 1JISA 1L98A 256LA 1HSXA 3W3EA 3W6CA 4LFPA 4NSHA 1YROA 1F6RA 110LA 1LHLA 2OU0X 3SB8A 1LZAA 1JTOL 3F6ZA 2LCBA 1IR9A 1FKVA 3IJUA 1DYBA 2HU1A 1TCYA 3A34A 1G7LC 6LYTA 1C7PA 1QUTA 234LA 2CDSA 4Z41A 5A3EA 1L94A 1B7QA 4I7TA 4NHPA 1IVMA 1NKHA 2HULA 2IHLA 3HTBA 1XJTA 1ZV5L 4PHIA 1QT6A 3QNGA 3RZEA 3A95A 4NWEA 2MEAA 4I7NA 1LSNA 5I5QA 1IC4Y 3WMKA 1LI3A 3SB6A 4BS7A 4NSIA 3HUQA 2ZYCA 128LA 4KL7A 2VB1A 1QS5A 2MEFA 5HLLA 3TMVA 4MR1A 4CJ2A 1PQMA 5C6LA 1CNSA 1F6SA 3JR6A 4XENA 4H9BA 147LA 3DN8A 3B6LA 3G3BB 3A91A 1T6VL 1BWJA 165LA 3L2XA 1QTZA 1L60A 4DDAA 3DN2A 4LDOA 4L41A 1L90A 1LZGA 1LYZA 2ZIKA 1GXV2 1L26A 5L9JA 1LZYA 1LYOA 210LA 4H9AA 4NGOA 4G4BA 3TMXA 1C6BA 1L65A 1T8FA 188LA 1GB6A 1SSYA 5LAGA 5LVGA 1HEWA 1GBZA 3WYHA 1L29A 1LJ4A 1B5XA 2MEGA 3WUMA 219LA 1L34A 3CT0A 1UCOA 4W56A 1LSZA 1C10A 4I7RA 4H94A 1PQDA 193LA 3AYQA 1QTHA 1IIZA 3QE8A 4IAPA 1OV7A 3CT5A 3PDSA 1DI4A 5IHGA 4W94A 1JKBA 4XJIA 155LA 5I54A 1G1VA 2DQHY 2G4NA 1QIOA 4R0FA 160LA 3WW6A 2EKSC 1CV1A 4DD0A 1UIEA 1LZ1A 1FDLY 1L88A 4TSBA 1LKRA 4LT2A 4LT1A 1GFVA 3FI7A 3C7WA 4LYMA 1HEMA 4OWBA 4GLAA 3WPKA 1AM7A 4IASA 2Q0MX 1C6KA 5LYMA 1JJ1A 1IWTA 2Z37A 1HC0A 1L27A 1L40A 4LT0A 174LA 3P65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIP C;  1G7M C;  2YBL A;  1IY4 A;  1XGU C;  208L A;  3AGI A;  3J4G A;  1C43 A;  4QDN A;  1BGI A;  2B5Z A;  1CJ9 A;  1B7L A;  4ET8 A;  3LYM A;  1CKC A;  1HHL A;  4N1E I;  2XJW A;  2HU3 A;  4RLN A;  3RT5 X;  1LHK A;  1XEJ A;  5HNL A;  4W96 A;  1A4V A;  4XYY A;  1GE0 A;  5KXW A;  1LHM A;  1IWX A;  4NGY A;  2CGI A;  3AW7 A;  3A3Q A;  4NSJ A;  3A8Z A;  3A90 A;  3B0I A;  1B9O A;  1GE3 A;  153L A;  135L A;  1IR7 A;  2ZNW Y;  3CSQ A;  4H90 A;  2CWI A;  4XAD A;  3TXH A;  5LVI A;  5LA5 A;  1LHH A;  4UWN A;  2GV0 A;  2W1M A;  4IJ4 A;  2BAA A;  2XBS A;  1B0D A;  4H1P A;  1TBY A;  4DC4 A;  2D4K A;  4B4J A;  5LVJ A;  1IR8 A;  1BVX A;  5HNC A;  1IOC A;  3TXG A;  5LIO A;  5KXK A;  3OJP A;  3ATO A;  3ULR A;  1VED A;  1IWY A;  3N9A A;  1JUG A;  1CJ6 A;  2ZIJ A;  3A93 A;  3A92 A;  1EQ4 A;  2A7F A;  4WM6 A;  1JKC A;  1LJK A;  1QQY A;  1QDR A;  4H92 A;  4N8Z A;  4NGZ A;  5L3I A;  1LJI A;  1OUD A;  3EXD A;  3WW5 A;  1XGP C;  207L A;  1UAC Y;  1GFU A;  1LMA A;  1OUG A;  2N5Z A;  4BAP A;  4YM8 A;  1QTK A;  4D9Z A;  4DD3 A;  1YKY X;  2ZQ3 A;  1PZY A;  4GCF A;  4NGL A;  4HTN A;  1NHE A;  4ET9 A;  4DD1 A;  1TDY A;  1J1P Y;  5B59 A;  3WH1 A;  4C3W A;  1GF4 A;  1LPI A;  1H87 A;  1GAY A;  2Z2F A;  1IOQ A;  1DZB X;  3D9A C;  1H6M A;  1JSE A;  1ZVH L;  1LSP A;  5KXR A;  4WLT A;  2XBR A;  4CFO A;  5KXT A;  1D0K A;  1GF8 A;  1E8L A;  1DXJ A;  1LKS A;  4TSC A;  1VDQ A;  5I53 A;  2DQG Y;  1YL1 X;  5E4P A;  1T3P A;  3P66 A;  1AT6 A;  4J1A A;  4J7V A;  3WUN A;  3BKV A;  4GCD A;  3W6A A;  1VDT A;  1FN5 A;  5LXW A;  1CJ7 A;  3BKH A;  1KXX A;  1LSE A;  4LYB A;  2BQO A;  3M18 B;  4B0D A;  3WVX A;  4LGK A;  5C6J A;  2HEF A;  4GCE A;  4KT3 A;  1TEW A;  5LYT A;  4WG1 A;  3B0O A;  1UIA A;  3ZEK A;  5F9X A;  2MEI A;  4DWX A;  1I20 A;  5FST A;  2RSC A;  1FLQ A;  4EOF A;  1GFJ A;  1A2Y C;  3CSZ A;  1Z55 A;  1RE2 A;  1WQP A;  1HSW A;  1NDM C;  1UC0 A;  1D0L A;  4WLX A;  1N4F A;  2DQE Y;  3WUA A;  2EPE A;  1YKZ X;  5F9U A;  3HBH A;  4NHS A;  3A3R X;  2BQL A;  3WVY A;  154L A;  4QGZ A;  2YSS C;  4B49 A;  1LZR A;  1ALC A;  4XJD A;  4RW2 A;  1KIQ C;  4PRQ A;  2BQI A;  3RW8 A;  4NHT A;  3AW6 A;  1WQN A;  2D91 A;  4ETA A;  5HMV A;  4WG7 A;  5L3H A;  1FLW A;  1LZE A;  2BLY A;  1LTM A;  5KXY A;  1WTM A;  3N9C A;  1DQJ C;  4LYT A;  2BQD A;  4DD7 A;  1NQI A;  1IY3 A;  4NWH A;  4GN5 C;  4LFX A;  1WVV A;  1ZMY L;  4NGI A;  4PGJ B;  5FDJ A;  1HFY A;  2ZWB A;  1B7P A;  2EQL A;  1UIC A;  1B5Z A;  1LSC A;  2LYO A;  1F10 A;  1LZN A;  4YEO A;  4YOP A;  2D4I A;  4CHX A;  1LHI A;  3TXE A;  3W6D A;  2Y8P A;  4WO6 A;  1B7M A;  1GB8 A;  4ZFP A;  2H5Z A;  3P64 A;  4H9F A;  7LYZ A;  1IP1 A;  4C5F A;  2MEB A;  1DPW A;  3GXK A;  1WTN A;  4HV2 A;  1ZVY B;  1OQM A;  1HFZ A;  4ML7 A;  1LZ8 A;  5KJ9 A;  1HER A;  1GBO A;  1WQQ A;  1GWD A;  2A7D A;  1JTT L;  1LOZ A;  4XJH A;  1LMQ A;  1FLY A;  4B4I A;  3T36 A;  2DBT A;  2YBN A;  1HEL A;  4WM3 A;  1DKJ A;  4QY9 A;  1UBZ A;  1BB5 A;  4YEN A;  2G4Q A;  1JEF A;  5KXS A;  3EO5 A;  1BWI A;  3CT1 A;  1QTE A;  1IOS A;  3EBA B;  1JSF A;  1WQM A;  1LSM A;  1RJC B;  1JIT A;  1G7I C;  1IP6 A;  1HEP A;  4G4H A;  5DLA A;  2IFF Y;  1HFX A;  5A3Z A;  5AMY A;  5LIN A;  4XN6 A;  4NGW A;  5F14 A;  2BQG A;  1BB3 A;  4ANR A;  1G7J C;  1AT5 A;  1YAP A;  2HEA A;  4AGA A;  5M1Y A;  1YAQ A;  2HEB A;  4G49 A;  3TXK A;  1SQ2 L;  3LZ2 A;  1LSY A;  3CQL A;  1LSD A;  2BQM A;  5IDD A;  2ZNX Y;  1BVK C;  2MEC A;  2H9K A;  5T3F A;  1GB9 A;  1IC7 Y;  4OW1 A;  3A67 Y;  1JIY A;  3OK0 A;  1OUF A;  4IAT A;  1HMK A;  1IWW A;  1FLU A;  1GF0 A;  1FKQ A;  4GN3 A;  3P4Z A;  1IP4 A;  1YKX X;  2YVB A;  5DL9 A;  1REZ A;  4CGE A;  4XJG A;  1HEO A;  1LZC A;  1I1Z A;  1KXY A;  5LVH A;  2YBI A;  1GF5 A;  1IC5 Y;  3CSR A;  3WPL A;  4ETB A;  3J6K A;  4DDB A;  3GXR A;  1GFG A;  3SP3 A;  1IEE A;  1EQE A;  4OWH A;  3A6C Y;  1QSW A;  1FBI X;  4GCC A;  4ETD A;  3AB6 A;  5B06 A;  4WOA A;  1HML A;  133L A;  1GB7 A;  3EMS A;  3G3A B;  4NFV A;  5I4Y A;  2F4A A;  1J1X Y;  1UIG A;  1IP7 A;  2FYC A;  4HPI A;  3TXJ A;  2Z38 A;  2H9J A;  3HFM Y;  2LYM A;  5HQ1 A;  1LZ6 A;  3HBE X;  3N9E A;  3WPJ A;  2BQJ A;  1B5V A;  1GB2 A;  3TXD A;  1YAM A;  2CJL A;  1RFP A;  2FBB A;  5D5F A;  3CB7 A;  1NF5 A;  4UWV A;  1INU A;  2LYZ A;  1GDX A;  1EQ5 A;  1LZS A;  1QSA A;  2Z39 A;  4TTD A;  1LCN A;  1C46 A;  4J1B A;  4CFP A;  1GHL A;  5ILF A;  4FJR A;  4X3B A;  1TAY A;  1GAZ A;  1OUI A;  2BQF A;  2DQD Y;  1MLC E;  2W1X A;  3LZT A;  4NG1 A;  4H8Z A;  1YQV Y;  1GFT A;  1XGQ C;  1HEQ A;  1LJ3 A;  1C08 C;  4WMG A;  1OUA A;  4GCB A;  4BAD A;  4MST A;  1IO5 A;  4OWA A;  4LZT A;  5J7C A;  4GN4 A;  4N9R A;  1LZ9 A;  2Z2E A;  1NMM A;  4WLD A;  1VDS A;  2MEE A;  2AUB A;  5APC A;  1OP9 B;  1IOT A;  1WQR A;  3LN2 A;  3IWR A;  5ILC A;  4WLY A;  1BB7 A;  1BHZ A;  1RI8 B;  2LZ2 A;  2YDG A;  2ZIL A;  3K3T A;  2BPU A;  4H93 A;  1GEV A;  1KIR C;  3HBD A;  4NEB A;  5KKI A;  1IP3 A;  2DQJ Y;  4NG8 A;  1GF7 A;  3AZ5 A;  1HF4 A;  2BQK A;  3WUL A;  4H9E A;  4HJV A;  4H8Y A;  4PPO A;  4LYC A;  3W6B A;  2ZYP A;  4J0L A;  5LA8 A;  5KXX A;  1LSG A;  3WU9 A;  3B0K A;  1GB5 A;  4NGJ A;  1IP2 A;  5JEN B;  5KXL A;  1UIH A;  4NHI A;  4WL7 A;  1JPO A;  1LAA A;  1LMC A;  1LJG A;  3AJN A;  3LYZ A;  4HJY A;  1VAT A;  3IJV A;  4NSG A;  3VWO A;  4TX7 A;  5LAF A;  4HTQ A;  5FEK A;  5KXM A;  4NGK A;  1GD6 A;  2Z18 A;  2C8P A;  4WL6 A;  3W6F A;  4LYO A;  1GDW A;  2LZT A;  1CKD A;  4B4E A;  4LYZ A;  1YIK A;  4PJ2 C;  4WM1 A;  1D6P A;  2WAR A;  3AZ4 A;  4MCK A;  4U3X B;  1LSB A;  5DN5 A;  1JHL A;  1BWH A;  1XGT C;  1GXX A;  1LJE A;  1LMO A;  1LMN A;  2G4P A;  1JIS A;  4UWU A;  5F16 A;  3T6U A;  1HSX A;  4RLM A;  1D9U A;  2X0A A;  2HEE A;  1UA6 Y;  3W3E A;  4M6D A;  4BAF A;  1LYY A;  4QEQ A;  1LJN A;  4WM4 A;  1G7H C;  1UUZ C;  3W6C A;  2YBJ A;  1GE1 A;  4RDS A;  4LFP A;  4NSH A;  1NWG A;  1LZD A;  1YRO A;  1OUE A;  1F6R A;  1LHL A;  1GFH A;  3A96 A;  1LZA A;  1GFA A;  1C45 A;  1AZF A;  1JTO L;  1LZT A;  3F6Z A;  1IR9 A;  1FKV A;  3IJU A;  2HU1 A;  4H9C A;  1D0M A;  1B5Y A;  5B07 A;  1TCY A;  3A34 A;  4HPE A;  4Z98 A;  2FYD A;  1G7L C;  3KAM A;  6LYT A;  3LHM A;  1XFP L;  1WVU A;  2I6Z A;  4I8S A;  5D5C A;  4ZIX A;  4H9I A;  1P2C C;  1YL0 X;  1C7P A;  1QUT A;  2CDS A;  1EL1 A;  1VAU A;  2YBH A;  4YEM A;  4Z41 A;  5A3E A;  5KXO A;  1QDT A;  1B7Q A;  4NHP A;  4PRU A;  1IVM A;  1GEZ A;  4OWE A;  1NKH A;  1GE2 A;  3P68 A;  5E9R A;  1B7N A;  1JTP L;  4EMN A;  2IHL A;  4HV1 A;  4H91 A;  4KXI A;  2BQN A;  1GFK A;  1B7S A;  4FDY A;  4NGV A;  5KXP A;  1VFB C;  1DI3 A;  1ZV5 L;  1IOR A;  4PHI A;  5KXN A;  194L A;  1B7O A;  4G4C A;  3QNG A;  2NWD X;  1HNL A;  3A95 A;  4NWE A;  2MEA A;  1LJJ A;  5EBH A;  1JWR A;  1LSN A;  1GF9 A;  1IX0 A;  1F0W A;  1IC4 Y;  5I5Q A;  3WMK A;  4E3U A;  8LYZ A;  4BS7 A;  4NSI A;  4B1A A;  2ZYC A;  3RZ4 A;  4G9S A;  4KL7 A;  2VB1 A;  1LHJ A;  2MEF A;  5HLL A;  1LSA A;  1GB0 A;  3TMV A;  4MR1 A;  4CJ2 A;  4OWC A;  1LJF A;  1B7R A;  1CNS A;  1F6S A;  1UIB A;  5C6L A;  4WM5 A;  2BQH A;  4N1C C;  4H9B A;  4XEN A;  3WL2 A;  3TXI A;  4O34 A;  3AZ6 A;  2YBM A;  1OUC A;  3B6L A;  4HTK A;  1GBW A;  3G3B B;  4WM2 A;  1B5U A;  5K7O A;  2ZQ4 A;  3A91 A;  1T6V L;  5DN4 A;  5APD A;  1GFR A;  3RNX A;  4OOT A;  2XTH A;  4I0C A;  3A94 A;  1BWJ A;  1GE4 A;  1DKK A;  1JKA A;  2DQI Y;  4AXT A;  4DDA A;  2F4G A;  5B05 A;  2D6B A;  2BQA A;  2HUB A;  1XEI A;  4L41 A;  5LVK A;  1LZG A;  4N0J A;  2MED A;  4Z46 A;  1HEN A;  1LYZ A;  2ZIK A;  1BQL Y;  1GXV 2;  1LZ5 A;  1XEK A;  2PC2 A;  5L9J A;  1GBX A;  1IWU A;  3QY4 A;  4NIJ A;  1XSF A;  2I25 L;  1LZY A;  3M3U A;  1LYO A;  1XGR C;  4H9A A;  4NGO A;  1V7S A;  1YAO A;  4G4B A;  1IP5 A;  1CKH A;  1DPX A;  2W1Y A;  3TMX A;  4Z3M A;  5KY1 A;  1GB6 A;  1QUS A;  2HTX A;  5LAG A;  5LVG A;  5FCP A;  1MEL L;  5DM9 A;  1HEW A;  1GBZ A;  2DKV A;  3E3D A;  5I4X A;  1GBY A;  3WYH A;  1BB6 A;  1LJ4 A;  5B1F A;  1B5X A;  1W08 A;  4A7D A;  4DD2 A;  1REM A;  1JJ3 A;  1WQO A;  2MEG A;  1LZ4 A;  2W1L A;  3WUM A;  4WO9 A;  5APF A;  1REY A;  1B5W A;  1LMP A;  3CT0 A;  1UCO A;  2BLX A;  2C8O A;  4N5R A;  3A6B Y;  3WU7 A;  4YF2 A;  5IEL A;  1B2K A;  1LSZ A;  3W6E A;  1C10 A;  5LYZ A;  2Z19 A;  1CKG A;  1YAN A;  4H94 A;  1CKF A;  6LYZ A;  4M4O A;  193L A;  3LYO A;  3ZVQ B;  4DDC A;  1GPQ C;  1KXW A;  2I26 L;  5F81 A;  4H8X A;  3AYQ A;  1GF3 A;  1IIZ A;  3QE8 A;  3RU5 A;  4ETC A;  1LZB A;  4TWS A;  2BQB A;  1LSF A;  4OOO A;  4HJZ A;  3TXB A;  1DI5 A;  1GB3 A;  4NY5 A;  2FBD A;  4ZEE A;  3CT5 A;  1NBZ C;  2BQE A;  3AGG G;  1DI4 A;  5IHG A;  4W94 A;  2EIZ C;  3WXU A;  1JKB A;  2D4J A;  1UIF A;  2BQC A;  3LYT A;  4XJI A;  5KXZ A;  5KKJ A;  5I54 A;  1PS5 A;  2HEC A;  4II8 A;  1NBY C;  1D6Q A;  4TUN A;  5APE A;  2F2N A;  134L A;  5C6I A;  2DQH Y;  2HED A;  1OUJ A;  2LHM A;  4R6C A;  1LJH A;  2G4N A;  1CJ8 A;  1QIO A;  4H9H A;  4GLV A;  1JJ0 A;  3MGW A;  2MEH A;  4R0F A;  5B1G A;  4HP0 A;  9LYZ A;  1JKD A;  1GBS A;  2DQA A;  5HMJ A;  3TXF A;  3WW6 A;  1GFE A;  1W6Z A;  2EKS C;  4P2E A;  4XJF A;  5II3 A;  4DD0 A;  1UIE A;  2Z12 A;  4RW1 A;  1GF6 A;  1LYS A;  1V7T A;  1LZ1 A;  3ATN A;  1FDL Y;  4DD9 A;  1O23 A;  1IWZ A;  5FEL A;  4TSB A;  1LKR A;  1VDP A;  4LT2 A;  4DT3 A;  2F30 A;  3B72 A;  4LT1 A;  2DQC Y;  1GFV A;  1NDG C;  3FI7 A;  132L A;  4LYM A;  1HEM A;  3WU8 A;  4NHQ A;  4OWB A;  1OUH A;  4ETE A;  1BB4 A;  1OUB A;  1YIL A;  3TMW A;  3WXT A;  3D3D A;  3FE0 A;  4GLA A;  3ZVQ A;  4DYG A;  3WPK A;  4KPM A;  2DQF C;  4XJB A;  5FHW A;  1AM7 A;  4IAS A;  2Q0M X;  5I4W A;  5LYM A;  1JJ1 A;  3AGH A;  4HSF A;  1LMT A;  1REX A;  1UID A;  4LT3 A;  1I56 A;  1IWT A;  3AZ7 A;  1SLY A;  2Z37 A;  1HC0 A;  3TMU A;  4LT0 A;  1IWV A;  1J1O Y;  1AKI A;  1RCM A;  3P65 A; 
#chains in the Genus database with same CATH topology
 1V33 A;  1T3T A;  1OVK A;  2LVP C;  3JR4 A;  1G7M C;  2YBL A;  1L43 A;  4G4Q A;  3U5Z A;  3CDO A;  4QDN A;  1I4W A;  3HTF A;  148L E;  1CKC A;  2LC9 A;  2V1C A;  172L A;  2HU3 A;  2J5Y A;  4W96 A;  3LQR A;  1CV4 A;  1GE0 A;  2XFT A;  114L A;  2KEB A;  3A90 A;  1B9O A;  4L4U A;  1GE3 A;  1IR7 A;  1VDD A;  2ZNW Y;  4L15 A;  1XMQ M;  5LA5 A;  4W58 A;  1LGX A;  1TBY A;  5DYG A;  1WJ7 A;  1I94 M;  1L91 A;  4DV7 M;  3I4Y A;  4HLQ A;  125L A;  1QSB A;  3ATO A;  4R7G A;  4NC6 A;  1IWY A;  1L0K A;  3N9A A;  4X66 M;  1L96 A;  2CP8 A;  3A93 A;  1EQ4 A;  2KZU A;  2XZU A;  1LJK A;  1E94 E;  1QDR A;  2ANX A;  4N8Z A;  1XWI A;  5EXT A;  2LNH C;  2YNM D;  1OUG A;  3CDT A;  4YM8 A;  1QTK A;  2B6T A;  1UFZ A;  2D7G A;  1TDY A;  1J1P Y;  5B59 A;  1L73 A;  5LMN M;  1IOQ A;  211L A;  2OE7 X;  2OU8 A;  5DYI A;  1ZVH L;  2XBR A;  1VEJ A;  4CFO A;  161L A;  2D7H A;  2JY5 A;  1UM8 A;  3B74 A;  4TSC A;  5I53 A;  5E4P A;  4REZ A;  1EE8 A;  3WUN A;  1L10 A;  4GCD A;  2XSZ A;  1JR3 A;  4D80 A;  2DZN B;  4DV2 M;  3SHF A;  4LYB A;  3M18 B;  2HEF A;  2MJ5 B;  2R18 A;  1SWY A;  1TEW A;  3PXG A;  1I20 A;  3HUK A;  198L A;  3L2A A;  2RSC A;  1FLQ A;  2J7O A;  3HH3 A;  1Z55 A;  1NSF A;  3WUA A;  2OEA X;  1D0L A;  3VKG A;  1C6T A;  3C3E A;  2EPE A;  4DR7 M;  3HBH A;  3B7N A;  5FSW A;  2M60 A;  3WVY A;  184L A;  2YSS C;  4RKU F;  1ALC A;  138L A;  1KIQ C;  4PRQ A;  2BQI A;  4RW2 A;  2G8L A;  3AW6 A;  1WQN A;  4RF0 A;  4JXJ A;  2DWN A;  2BLY A;  3FE3 A;  3KOW E;  1GJT A;  1DQJ C;  4ZPU A;  1L2D A;  4LFX A;  4JI0 M;  1L36 A;  4KHP M;  2O5R A;  3B7Q A;  2ZWB A;  5GKN A;  1B7P A;  2EQL A;  4CHX A;  1B5Z A;  2LYO A;  1F10 A;  3W6D A;  4ZFP A;  1PQI A;  3FYC A;  1PM5 A;  3C8Q A;  1IP1 A;  4C5F A;  1G0Q A;  3GXK A;  2A5Y B;  1HER A;  1GWD A;  1L92 A;  4DQ7 A;  4XJH A;  1LOZ A;  4MGZ E;  4OVZ A;  3T36 A;  4QOS A;  2KHH A;  2XZF A;  1L56 A;  4NXM M;  5EP4 A;  1XNQ M;  3DN0 A;  3ZCB B;  173L A;  3CT1 A;  1QQW A;  5EQT A;  3EBA B;  1L00 A;  1XJU A;  1QAQ A;  1G7I C;  1HEP A;  1GAB A;  1X37 A;  227L A;  1L37 A;  209L A;  4G4H A;  220L A;  1J5E M;  2IFF Y;  4KT0 F;  1LI6 A;  5F14 A;  1DYG A;  3HDF A;  2ZTD A;  4ANR A;  1YAP A;  2HEA A;  1CU2 A;  1V34 A;  5FTK A;  1CV5 A;  166L A;  3DFZ A;  178L A;  3CQL A;  1LSD A;  2MEC A;  242L A;  1L23 A;  2P5T A;  3HX3 A;  233L A;  3OK0 A;  1OUF A;  4IAT A;  1OJL A;  1IY1 A;  180L A;  2QBY B;  4AG6 A;  1REZ A;  4B7H A;  4EKQ A;  4CGE A;  2QEN A;  3A42 A;  2YBI A;  3WPL A;  4B3R M;  2GNO A;  2XQO A;  2DZL A;  1FBI X;  3AB6 A;  5C1B A;  5ITR A;  5FTM A;  226L A;  3EMS A;  3QWL A;  4NFV A;  5I4Y A;  1T6O A;  1SXJ E;  3TXJ A;  2H9J A;  1LZ6 A;  260L A;  2BQJ A;  2BWE A;  2MGW A;  3TXD A;  1L12 A;  1RFP A;  253L A;  4LDL A;  4LRT A;  1XXH A;  3CB7 A;  2C5R A;  1NF5 A;  2DZO B;  1LCN A;  1YUB A;  2F5Q A;  2DQD Y;  1MLC E;  2W1X A;  3LZT A;  200L A;  1GFT A;  1XGQ C;  1C08 C;  2NTG A;  4GCB A;  4EKR A;  1IN8 A;  1LYI A;  1L25 A;  1NHB A;  1CU5 A;  4N9R A;  2Z2E A;  1WQR A;  1IOT A;  5ILC A;  2BPU A;  1PGY A;  1IP3 A;  5IT9 S;  5EP1 A;  1C62 A;  1HF4 A;  1NNU C;  1L75 A;  4H9E A;  4H8Y A;  1C6N A;  1P36 A;  1L16 A;  2ZYP A;  1LI2 A;  4BB9 A;  3WU9 A;  4X62 M;  1WTH A;  119L A;  2RBN A;  3ODU A;  1LJG A;  3G3X A;  236L A;  3AJN A;  2H5X A;  3HHZ A;  2FFJ A;  4LJ6 A;  3VWO A;  1NVM A;  4TX7 A;  2WSC F;  3VK7 A;  5LAF A;  4NGK A;  3W6F A;  4WL6 A;  1L68 A;  1GDW A;  4LYO A;  1CKD A;  4B4E A;  3F8V A;  3SB5 A;  3C8R A;  2WAR A;  4U3X B;  1PQO A;  1KNI A;  2B6Y A;  1BWH A;  4AQY M;  1LJE A;  1LMN A;  1HT2 E;  3GLF E;  4S12 A;  1D9U A;  3G3V A;  1UA6 Y;  4M6D A;  4Q7J A;  4BLC A;  1LYY A;  4ARP A;  1LJN A;  3U60 B;  1G7H C;  1GE1 A;  2B7X A;  3WHK A;  1LZD A;  1NWG A;  3C83 A;  4I7K A;  1DGH B;  3LCV B;  3RGS A;  1G1W A;  3VLF B;  187L A;  1L39 A;  1L87 A;  1P37 A;  3MHV C;  3GLG E;  1L02 A;  126L A;  1GVN A;  2FYD A;  3AJI B;  1OWY A;  1XFP L;  4W55 A;  4H9I A;  1P2C C;  1YL0 X;  2YBH A;  1DYD A;  4YEM A;  3T15 A;  146L A;  1OV5 A;  4PDG A;  1WR1 B;  191L A;  3FTE A;  1QT7 A;  3P68 A;  5E9R A;  4EMN A;  1DGF A;  4KXI A;  3GUK A;  4FCV A;  5KPT A;  4LF8 M;  1GFK A;  1IN7 A;  2FH0 A;  3CDR A;  237L A;  1VFB C;  1C6L A;  2DHR A;  5I14 A;  4PT5 A;  1QT5 A;  1IOR A;  194L A;  1B7O A;  4G4C A;  1PJI A;  1SX7 A;  2NWD X;  3IG5 A;  2JY8 A;  4LY6 A;  1LJJ A;  2EUC A;  2R4E A;  1F0W A;  1R5L A;  2R65 A;  2BNK A;  189L A;  3LQQ A;  2APL A;  2F5N A;  3SB7 A;  1LHJ A;  4Z8X A;  168L A;  1GKI A;  1IN4 A;  1GB0 A;  1L42 A;  3J27 B;  1LJF A;  1UIB A;  4AKG A;  4WM5 A;  3SAT A;  118L A;  4N1C C;  5A2Q S;  245L A;  2YBM A;  2LVO C;  5K7O A;  2KDL A;  5APD A;  3RUN A;  1GFR A;  3TQS A;  4JI6 M;  3DZD A;  1DKK A;  1JKA A;  1TGU A;  4KLN A;  3VDP A;  2CV2 A;  2F4G A;  1NY5 A;  5B05 A;  2D6B A;  5LVK A;  1ZYT A;  2MED A;  4Z46 A;  4M9Z A;  3VFD A;  3C82 A;  2W82 A;  4NIJ A;  2HCB A;  2K9D A;  1VDL A;  2K47 A;  1V7S A;  3K9O A;  4LFB M;  4QOZ C;  1DPX A;  4NRW A;  3GO8 A;  1L17 A;  1L51 A;  4Z3M A;  1Z59 A;  1P7S A;  5ITX A;  3DN4 A;  1C6I A;  2L09 A;  3FI5 A;  4MGI E;  5FCP A;  241L A;  4LZZ A;  1P2L A;  123L A;  1G0M A;  1BB6 A;  5B1F A;  1W08 A;  4A7D A;  1REM A;  1G0K A;  2W1L A;  145L A;  3HH6 A;  5APF A;  2B6Z A;  5KPZ A;  1B5W A;  2L78 A;  2C8O A;  4ZPX A;  1NY6 A;  1LYF A;  3A6B Y;  1B2K A;  4YF2 A;  2B73 A;  2Z19 A;  182L A;  1CKF A;  6LYZ A;  4I7O A;  3ZVQ B;  4DDC A;  1GPQ C;  5C18 A;  1KXW A;  2I26 L;  4H8X A;  1TTE A;  1LYD A;  1QUH A;  3RU5 A;  2HL7 A;  2BQB A;  1D2W A;  4HJZ A;  1DI5 A;  4NY5 A;  108L A;  1DGB A;  4OW0 A;  1NJF A;  1HR0 M;  2BQC A;  1KW5 A;  3G3W A;  3GP1 A;  3LYT A;  5KXZ A;  5KKJ A;  1P46 A;  1VG5 A;  1G06 A;  171L A;  1NBY C;  3HU9 A;  1D6Q A;  4TUN A;  5APE A;  4ARM B;  3SFZ A;  2HED A;  1CTW A;  1OUJ A;  2LHM A;  1LJH A;  2RBR A;  4R6C A;  4H9H A;  4GLV A;  3MGW A;  1CU6 A;  1L44 A;  4IIW A;  2DQA A;  1CU3 A;  2F5S A;  1GFE A;  1WHC A;  4XJF A;  2CFO A;  2Z12 A;  152L A;  2B74 A;  1Q3C A;  1L95 A;  2R62 A;  4DD9 A;  1L04 A;  1O23 A;  3C80 A;  4B3M M;  4DT3 A;  3GQ3 A;  4CIS A;  1L66 A;  3WU8 A;  1OUH A;  2B3T A;  3SC3 A;  3FE0 A;  4DYG A;  2JNH A;  5FHW A;  4XJB A;  4IBE A;  4HSF A;  1LMT A;  1UID A;  4LT3 A;  2O01 F;  2L7I A;  4MH0 E;  1AKI A;  4XJG A;  1IY2 A;  162L A;  3ZH9 B;  1G0L A;  1C67 A;  3J4G A;  2B70 A;  1NHG C;  1N75 A;  1LV7 A;  4RLN A;  3HTG A;  3KXE C;  5EXX A;  5HNL A;  1A4V A;  4M0W A;  2WSE F;  3AW7 A;  3A8Z A;  4L16 A;  1LGW A;  1DYC A;  4DKL A;  2L6O A;  3Q8G A;  4H90 A;  4XAD A;  2RBO A;  7LZM A;  4UWN A;  3W68 A;  3UK6 A;  1OVJ A;  4IJ4 A;  1QT4 A;  4GRV A;  2RGO A;  156L A;  1XXH E;  4D82 A;  3PVS A;  159L A;  3U6E A;  5HNC A;  3OJP A;  2QZ4 A;  3M0E A;  3HJS A;  3KS4 A;  2LBC A;  2Q9E A;  2ZIJ A;  4LG2 A;  4WM6 A;  1JKC A;  1LYJ A;  1QQY A;  3C7Z A;  1LWK A;  3EXD A;  3WW5 A;  1XGP C;  207L A;  1UAC Y;  1GFU A;  4BAP A;  4D9Z A;  1G0J A;  4P16 A;  1YKY X;  2ZQ3 A;  4GCF A;  3GLH B;  1HNZ M;  1NHE A;  4ET9 A;  3E46 A;  255L A;  235L A;  1L47 A;  3D9A C;  4DR1 M;  1L31 A;  1LSP A;  5KXR A;  1NJG A;  1E8L A;  3FRI A;  2QNJ A;  4AKH A;  4LF7 M;  3W0F A;  4DV1 M;  4I7S A;  4J7V A;  4ARQ A;  4FWH A;  1FN5 A;  1DO0 A;  1L20 A;  2QPA A;  5LXW A;  183L A;  1KXX A;  1TLA A;  4QNM A;  4B0D A;  3CF6 E;  5C6J A;  2CHQ A;  4KT3 A;  2CHG A;  1SG9 A;  5LYT A;  2Q9D A;  3LMM A;  4WG1 A;  1L69 A;  2LTU A;  5F9X A;  1C6C A;  2XGN A;  1GFJ A;  1A2Y C;  1WQP A;  1NDM C;  4DV4 M;  1LW9 A;  3BXW A;  3LVW A;  4QGZ A;  5KQD A;  1LZR A;  4ITQ A;  2BJW A;  2OOA A;  1OTR A;  3RW8 A;  195L A;  3MMP A;  4EJ4 A;  5HMV A;  1LZE A;  2HUK A;  1WTM A;  4LYT A;  216L A;  2BQD A;  4LGY A;  1IN5 A;  1ZMY L;  3NY8 A;  1RU3 A;  5FDJ A;  3HU3 A;  2Y0Q A;  1UIC A;  1LSC A;  1LZN A;  3TL4 X;  3L27 A;  1LHI A;  4WO6 A;  3NBI A;  2H5Z A;  1IXS A;  3QYE A;  1DPW A;  5KJ9 A;  4DV0 M;  2KRK A;  4ML7 A;  1LZ8 A;  1GBO A;  3HZJ A;  1L2C A;  2DAG A;  4FCT A;  3FTF A;  1L71 A;  3C81 A;  1JB0 F;  2YBN A;  4WM3 A;  1ZAE A;  3IEC A;  2CEA A;  4JI3 M;  3UON A;  2G4Q A;  2I7P A;  5KXS A;  1BWI A;  2DWZ B;  4MGY E;  1GLN A;  1JSF A;  1TDH A;  1QS9 A;  4PD2 A;  1WQM A;  1IP6 A;  2QSF X;  4B3T M;  2F2Q A;  1R7R A;  175L A;  1Z5A A;  1L62 A;  2OTY X;  1OIP A;  5AMY A;  5LIN A;  3SMS A;  4NGW A;  2BQG A;  1G7J C;  1L76 A;  3LZM A;  1SWZ A;  4G49 A;  2BQM A;  5IDD A;  181L A;  5T3F A;  2KZS A;  3A67 Y;  1JIY A;  2KNA A;  1SX2 A;  4YX7 C;  1HMK A;  1G07 A;  3P4Z A;  2YVB A;  1C6Q A;  5DL9 A;  5F3W A;  1JQJ C;  3HU2 A;  2F5P A;  3K1J A;  3E9S A;  5LVH A;  3E4R A;  3DMZ A;  4ETB A;  4AKI A;  243L A;  2UXC M;  3SP3 A;  2KXE A;  4OWH A;  1IBK M;  4GCC A;  1TH3 A;  225L A;  1E32 A;  1HML A;  133L A;  4I81 A;  1IP7 A;  3HFM Y;  1QAN A;  5HQ1 A;  4NSR A;  3WPJ A;  3NYA A;  2KW0 A;  228L A;  1G8P A;  4LJ4 A;  1YAM A;  4LJ9 A;  5D5F A;  144L A;  4UWV A;  1INU A;  1LZS A;  5ITX E;  4CFP A;  1C46 A;  4X3B A;  1TAY A;  1G0G A;  224L A;  1WXQ A;  4RF1 A;  3K2L A;  3L64 A;  170L A;  4OWA A;  4GN4 A;  4EPF A;  3K9P A;  1V92 A;  3KP1 E;  4B7G A;  214L A;  1L79 A;  1OP9 B;  3LN2 A;  1BB7 A;  1RI8 B;  3AFH A;  3W0L B;  2YDG A;  261L A;  4H93 A;  5KKI A;  2DQJ Y;  4NG8 A;  3AZ5 A;  1CV6 A;  3WUL A;  2LHC A;  1L58 A;  4PPO A;  4LYC A;  1C6A A;  3W6B A;  4GBR B;  3SAW A;  1PJT A;  3B0K A;  2UUC M;  1GB5 A;  5JEN B;  5KXL A;  4DJH A;  2ZBK B;  139L A;  1P3N A;  2F4V M;  1C6F A;  3GUI A;  1P3Q Q;  3L26 A;  1L49 A;  1VAT A;  3HDE A;  1L09 A;  252L A;  3IJV A;  4NSG A;  1L52 A;  2QP9 X;  217L A;  4LYZ A;  1YIK A;  3T6P A;  4PJ2 C;  4WM1 A;  1LSB A;  1JHL A;  1XGT C;  2OE4 X;  1PJQ A;  2O7A A;  5F16 A;  4KOD A;  1LLH A;  1YE9 A;  3BBZ A;  3DN3 A;  2HEE A;  190L A;  4GIT A;  5IZ7 D;  4XBO A;  1QZM A;  4QEQ A;  1UUZ C;  3GUJ A;  1OUE A;  169L A;  1T97 A;  1IY0 A;  3A96 A;  1GFA A;  2DI0 A;  1C45 A;  1AZF A;  4H9C A;  2KRU A;  2CHV A;  1QTD A;  1D0M A;  2FE8 A;  4HPE A;  3KAM A;  137L A;  1DGG A;  2RGH A;  5D5C A;  4ZIX A;  1N78 A;  2Z8Y M;  1EL1 A;  1VAU A;  5KXO A;  1GEZ A;  1GE2 A;  1I6S A;  4HL4 A;  3AL0 C;  4HV1 A;  4M9S A;  3K8Z A;  1OVH A;  2BQN A;  4DQ5 A;  2MRO B;  1CUK A;  1B7S A;  1OYU A;  3RFW A;  1LPY A;  230L A;  4FDY A;  4NGV A;  5KXP A;  3VW7 A;  1L35 A;  1SXJ B;  3A46 A;  1DV0 A;  1G71 A;  1HNL A;  5EP3 A;  2L4F A;  5EBH A;  1JWR A;  1IX0 A;  4GMQ A;  2RRU A;  4E3U A;  3GLI B;  1LSA A;  4OWC A;  1C6P A;  4W53 A;  3D4S A;  3WL2 A;  1KS3 A;  3TXI A;  4O34 A;  3AZ6 A;  1PQJ A;  205L A;  3I01 M;  1GBW A;  4WM2 A;  1B5U A;  2ZQ4 A;  1OQY A;  1IFY A;  1L64 A;  5E6J A;  2OE9 X;  2XTH A;  4I0C A;  4OOT A;  1GE4 A;  2K6B A;  1N36 M;  1LGU A;  3FD9 A;  3T38 A;  1Q02 A;  2C98 A;  1CVK A;  5BR8 M;  2DAM A;  197L A;  2R46 A;  2DAE A;  1XEI A;  4FVM A;  4I7L A;  1HEN A;  1BQL Y;  1GBX A;  3QY4 A;  2DXI A;  1XHB A;  2XH9 A;  1XSF A;  1N34 M;  4JI5 M;  1XGR C;  192L A;  1GO5 A;  232L A;  1YAO A;  4OU7 A;  4AW4 A;  1IP5 A;  1CV0 A;  1CKH A;  2W1Y A;  5KY1 A;  3K92 A;  1L83 A;  1QUS A;  103L A;  1L45 A;  4L78 A;  3GRU A;  2RBP A;  262L A;  1L84 A;  1MEL L;  5DM9 A;  1D2N A;  4QHT A;  1GBY A;  4IBJ A;  1WQO A;  3AOE C;  3GLF B;  1LZ4 A;  259L A;  4JI1 M;  4WO9 A;  1REY A;  1ORY B;  1LMP A;  3JAM S;  3LW5 F;  4MGK E;  1HNW M;  115L A;  1LYE A;  4N5R A;  5IEL A;  3W6E A;  5LYZ A;  4FWG A;  4KO8 A;  4D81 A;  2LZM A;  1BVS A;  2LWX A;  1L86 A;  5F81 A;  1GF3 A;  3DNA A;  3BOS A;  4YY3 M;  4ETC A;  4UN2 B;  1C68 A;  3EIE A;  3HWL A;  1WIV A;  4YXC A;  2FOI C;  1LSF A;  4OOO A;  3TXB A;  248L A;  1GB3 A;  4ZEE A;  3GLG B;  2FBD A;  111L A;  2BQE A;  140L A;  3FTD A;  2EIZ C;  3QAK A;  2D4J A;  4ARL A;  4PK0 A;  3U5Z B;  2HEC A;  4II8 A;  3U6M A;  2B6W A;  2F2N A;  4CIZ A;  4L6V 6;  134L A;  3Q8X A;  4JV5 M;  1QT8 A;  4NL4 H;  1L06 A;  4AI6 A;  3A45 A;  5B1G A;  3DN6 A;  1JKD A;  4P2E A;  5II3 A;  4LF9 M;  1ZUR A;  4RW1 A;  1GF6 A;  4FWD A;  1LYS A;  1V7T A;  3ATN A;  3L25 A;  3R8F A;  1IWZ A;  5FEL A;  1VDP A;  3LCU A;  2DQC Y;  1NDG C;  2CUU A;  1OFH A;  1CUP A;  2G3Q A;  4NHQ A;  4ETE A;  1BB4 A;  1YIL A;  4IBI A;  1W5T A;  102L A;  2DQF C;  1Y8G A;  3AGH A;  1REX A;  1GL6 A;  3AZ7 A;  1SLY A;  1IWV A;  2F5O A;  1RCM A;  1R2Z A;  3HTD A;  3U61 A;  4DR3 M;  1XB2 B;  2DNA A;  1IY4 A;  1XGU C;  208L A;  231L A;  1XEP A;  4ET8 A;  3LYM A;  1HHL A;  4N1E I;  2XJW A;  4IBG A;  3RT5 X;  4P17 A;  1LHK A;  1XEJ A;  2LVQ D;  3CGW A;  4XYY A;  5KXW A;  1LHM A;  3THG A;  2QB0 B;  4NSJ A;  3AKZ A;  153L A;  135L A;  2XEP A;  3CSQ A;  3TXH A;  3VDU A;  2EA0 A;  5LVI A;  109L A;  3NWL A;  2GV0 A;  2W1M A;  1L19 A;  2BAA A;  2XBS A;  2JUJ A;  2JY6 B;  1B0D A;  4H1P A;  1C61 A;  4DC4 A;  3B9P A;  2D4K A;  1BVX A;  1L01 A;  3TXG A;  3WHL A;  5KXK A;  2JP7 A;  1ZV1 A;  3ULR A;  2DHY A;  1GJS A;  1D3N A;  1CJ6 A;  3DMV A;  2F47 A;  4CJ6 A;  4NGZ A;  1C64 A;  1LJI A;  1OUD A;  5L3I A;  1DYE A;  2N5Z A;  4JN6 A;  4DD3 A;  3HU1 A;  5DNY A;  1PZY A;  4HTN A;  3SN6 R;  4DD1 A;  2HKJ A;  3CTW B;  4XK8 F;  1GAY A;  130L A;  1DZB X;  112L A;  1L07 A;  1PQK A;  1JSE A;  2Z2F A;  4JI2 M;  2JWS A;  1VQ1 A;  4WLT A;  1IXZ A;  1LYH A;  1F4I A;  5KXT A;  1D0K A;  1YL1 X;  1IN6 A;  1T3P A;  3P66 A;  1AT6 A;  4J1A A;  1HQC A;  2CV0 A;  2OTZ X;  1L8Q A;  3J7A S;  1VDT A;  2CUZ A;  1CJ7 A;  4JI8 M;  1L14 A;  4W5W A;  3WVX A;  4NXN M;  4GCE A;  3CF0 A;  1UIA A;  3ZEK A;  4DWX A;  1J09 A;  1D3M A;  2OU9 A;  4E97 A;  1UC0 A;  1C1K A;  3HKP A;  1N4F A;  2DQE Y;  201L A;  3U6C A;  1L82 A;  164L A;  4GH9 A;  4DR4 M;  4NHS A;  3KVW A;  1C69 A;  3A3R X;  2BQL A;  154L A;  3LVV A;  4AZF A;  4NHT A;  5FTL A;  4IJE A;  3TWM A;  4GC5 A;  2J7N A;  4DBG B;  2D91 A;  4WG7 A;  3SMP A;  1LTM A;  5KXY A;  2KA6 B;  3N9C A;  1DYF A;  1IY3 A;  4GN5 C;  1WVV A;  2EJS A;  1A5T A;  4G6Z A;  2C9C A;  4YOP A;  5ITY A;  2ZTC A;  4EXM A;  1B7M A;  2C9O A;  3P64 A;  4MB7 A;  1G3I A;  2RH1 A;  4HV2 A;  1WTN A;  1JTN A;  1ZVY B;  3RE8 A;  2A7D A;  1JTT L;  1LMQ A;  1FLY A;  1HEL A;  2VQF M;  3FA0 A;  1TH4 A;  1DKJ A;  3SHG B;  3F9L A;  1UBZ A;  2BWB A;  4YEN A;  3EO5 A;  1D3J A;  1QTE A;  1NNJ A;  1IOS A;  1XC8 A;  177L A;  1RJC B;  1JIT A;  2DAK A;  5DLA A;  5A3Z A;  4XN6 A;  4PJZ A;  1L08 A;  246L A;  1XXH B;  4K5Y A;  2IGC A;  1BB3 A;  151L A;  1MN3 A;  1AT5 A;  5M1Y A;  1L85 A;  3SAU A;  1YAQ A;  2HEB A;  4M0D A;  4BBA A;  1P2R A;  3LZ2 A;  1LSY A;  2RBQ A;  1L38 A;  2ZNX Y;  3AOE A;  3HY5 A;  1L74 A;  1ZMV A;  1GB9 A;  4W57 A;  1IWW A;  1FLU A;  1GF0 A;  1FKQ A;  4GN3 A;  4EKS A;  1QZE A;  2RB2 X;  1HEO A;  1H6U A;  1I1Z A;  1LZC A;  1KXY A;  249L A;  3CSR A;  1IC5 Y;  4DDB A;  3GXR A;  1GFG A;  3HU8 A;  1EQE A;  2ZM6 M;  4QHS A;  3V76 A;  2F32 A;  4ETD A;  3CDV A;  3EML A;  4IBF A;  4WOA A;  3G3A B;  4R3D A;  2F4A A;  4Z6Y A;  157L A;  1J1X Y;  4HPI A;  3CDQ A;  104L A;  2LYM A;  3PBL A;  3HBE X;  2NQ8 C;  3N9E A;  4WP2 A;  2EKF A;  3KSJ A;  2CJL A;  3T1Y M;  251L A;  2FBB A;  2LYZ A;  1EIJ A;  1EQ5 A;  1QSA A;  1L0J A;  2Z39 A;  1GHL A;  4FJR A;  3FUV A;  1D9W A;  1OUI A;  2BQF A;  3HJQ A;  1C6J A;  1ZQ9 A;  1YQV Y;  1L1Z A;  4LFA M;  7CAT A;  1HEQ A;  3FUT A;  2O4W A;  2I7N A;  2LH0 A;  4BAD A;  2RB0 X;  1R6B X;  4LZT A;  1Z5C A;  5J7C A;  4EKP A;  4G3O A;  2VF8 A;  1IBM M;  2DWL A;  2QBY A;  2NTH A;  3HH4 A;  4WLD A;  2AUB A;  1IM2 A;  3IWR A;  2EKK A;  3D8L A;  1T8A A;  4W52 A;  2LZ2 A;  2XLJ A;  1CX7 A;  2HAK A;  3C58 A;  2LVA A;  1KIR C;  3HBD A;  3K2R A;  4NEB A;  1C6M A;  1GF7 A;  1FNN A;  4HJV A;  3DA1 A;  4JI4 M;  1HT1 E;  5KXX A;  1LSG A;  1CUQ A;  3UZU A;  1L11 A;  4S0W A;  4GKK M;  4K0K M;  4NGJ A;  1IP2 A;  1UIH A;  2RBS A;  5LMU M;  1L89 A;  1P6Y A;  4IJF A;  1LAA A;  2Z4R A;  2JZ0 A;  1L13 A;  1IBL M;  4WUR A;  4HJY A;  4HTQ A;  5FEK A;  5KXM A;  2R44 A;  2C8P A;  4I7J A;  4DV5 M;  3SBB C;  4YHH M;  1L41 A;  1D6P A;  3AZ4 A;  3SBA A;  4MCK A;  1L21 A;  1TF0 B;  158L A;  199L A;  247L A;  4UWU A;  2G4P A;  5FLX S;  1E9S A;  4DUZ M;  1L59 A;  4RLM A;  3KS8 A;  2M5Z A;  2X0A A;  4CHT B;  4FCW A;  4BAF A;  3KW6 A;  142L A;  3DN1 A;  1L97 A;  1L70 A;  4WM4 A;  2YBJ A;  4RDS A;  1L57 A;  1C6D A;  4GKJ M;  1GFH A;  3L29 A;  1ZWN A;  1LZT A;  2JY7 A;  1L30 A;  2XFS A;  4G4N A;  3NBX X;  1B5Y A;  1T8G A;  122L A;  5B07 A;  5BPV A;  4Z98 A;  1EPY A;  3J2P B;  3LHM A;  1WVU A;  2I6Z A;  4I8S A;  4EPI A;  4DV6 M;  1MX0 A;  1QDT A;  2O79 A;  4PRU A;  3TE6 A;  4OWE A;  1B7N A;  1JTP L;  186L A;  4H91 A;  3GRY A;  5IRE B;  1L80 A;  2LXE A;  3KOY E;  3KOZ E;  3FKE A;  1KY1 A;  1DI3 A;  5EJC A;  5KXN A;  1P5C A;  167L A;  1VEK A;  1L28 A;  5ITQ A;  2VQE M;  1GF9 A;  1GL7 A;  1L15 A;  8LYZ A;  4B1A A;  2Y20 A;  3U60 A;  3RZ4 A;  1N33 M;  4G9S A;  1PJS A;  5EXP A;  1DGH A;  149L A;  2QQ8 A;  1B7R A;  3SYL A;  2BQH A;  1C6H A;  2G5G X;  1E9R A;  2UUA M;  4NOO B;  1OUC A;  4HTK A;  1QYR A;  141L A;  1OAO C;  1C63 A;  5DN4 A;  2FNA A;  3RNX A;  1KW7 A;  3A94 A;  2L7H A;  2DQI Y;  4AXT A;  3OE0 A;  1C6G A;  1OWZ A;  2BQA A;  2HUB A;  4N0J A;  1LZ5 A;  3HT7 A;  1XEK A;  2PC2 A;  3AV0 A;  1IWU A;  2OOB A;  240L A;  215L A;  2I25 L;  4L8R C;  3M3U A;  2MH8 A;  1JQU A;  2WSF F;  3T1H M;  257L A;  1S3S A;  2R45 A;  3SAS A;  3SYK A;  3AOG A;  3OE6 A;  4X64 M;  3FYD A;  3H4M A;  3TWL A;  2HTX A;  1L33 A;  1VEG A;  1N32 M;  5I4X A;  2DKV A;  3E3D A;  2ERC A;  4G4R A;  212L A;  2HUM A;  4DD2 A;  3FUX A;  223L A;  1JJ3 A;  2BLX A;  4I5S A;  3WU7 A;  5KPR A;  1CKG A;  1L48 A;  1YAN A;  4DAJ A;  4DUY M;  2JA2 A;  1L67 A;  4M4O A;  3LYO A;  1QUD A;  1P56 A;  1JTM A;  131L A;  4YXA C;  3V2Y A;  1L93 A;  1LZB A;  4TWS A;  3SB9 A;  1QT3 A;  2X8A A;  4DR5 M;  1NBZ C;  2JXN A;  3AGG G;  1L72 A;  254L A;  218L A;  3WXU A;  1UIF A;  129L A;  3U6D A;  1PS5 A;  3FRH A;  1B6I A;  4NSO B;  5C6I A;  1P64 A;  2KNZ A;  4LZM A;  2B6X A;  1CJ8 A;  1G41 A;  1KY0 A;  2R0I A;  1JJ0 A;  196L A;  2MEH A;  4HP0 A;  9LYZ A;  3UGJ A;  1GBS A;  244L A;  1R2Y A;  4GC9 A;  5HMJ A;  8CAT A;  3TXF A;  1W6Z A;  1XNR M;  258L A;  5EP2 A;  2UUB M;  1NV8 A;  2F30 A;  3B72 A;  2ANV A;  221L A;  132L A;  3I04 M;  4Y28 F;  1OUB A;  3TMW A;  3ZVQ A;  3WXT A;  3D3D A;  3OE8 A;  4KPM A;  120L A;  5I4W A;  4JI7 M;  1I56 A;  3TMU A;  1J1O Y;  5DN5 A;  3DMX A;  1L61 A;  4W54 A;  4IBC A;  1KIP C;  2LHG A;  3AGI A;  1KYI A;  2X49 A;  1C43 A;  1BGI A;  2B5Z A;  1CJ9 A;  1B7L A;  1Q39 A;  4ARM A;  1C6E A;  1LYG A;  4EIW A;  1D3F A;  1QTB A;  3PNY A;  1Z5B A;  1L53 A;  1IWX A;  3QAU A;  1OIZ A;  4NGY A;  2CGI A;  1K3W A;  1G59 A;  3A3Q A;  1MJG M;  3B0I A;  3GPX A;  4ARQ B;  1NV9 A;  213L A;  3B7Z A;  2CWI A;  1L54 A;  4GHA A;  1LHH A;  1L81 A;  2RKO A;  1QAM A;  1NHW C;  2LVN C;  1OKS A;  1K82 A;  1C66 A;  4B4J A;  5LVJ A;  1IR8 A;  1CX6 A;  1IOC A;  5LIO A;  185L A;  5L8R F;  3HHY A;  4F1I A;  4F2L A;  3U6S A;  1JUG A;  1VED A;  2QAR C;  1L55 A;  4XGI A;  3A92 A;  2A7F A;  4H92 A;  4I7Q A;  3U6L A;  3V2W A;  1LMA A;  3HHX A;  1SSW A;  3HH5 A;  3E21 A;  4NGL A;  1QUG A;  3WH1 A;  3A98 B;  5JI2 E;  1GF4 A;  1LPI A;  3SAR A;  1H87 A;  2Z6B A;  4LZJ A;  4AQN A;  4C3W A;  1IXR C;  1HJP A;  1H6M A;  3GLI E;  1L05 A;  3CF2 A;  1GF8 A;  4X65 M;  1DXJ A;  4I4L A;  1LKS A;  3U6Q A;  1VDQ A;  1WGN A;  2H1R A;  2DQG Y;  4GRI A;  1TH2 A;  3BKV A;  2Y0T A;  1IXS B;  229L A;  3W6A A;  2V1U A;  4LRS A;  6LZM A;  3BKH A;  1LSE A;  2BQO A;  4LGK A;  2L2D A;  2Z7J A;  3HT6 A;  143L A;  4M9X A;  2RAY X;  3B0O A;  4I8O A;  2MEI A;  5FST A;  1QAO A;  4LF4 M;  176L A;  4W51 A;  4ARJ A;  222L A;  239L A;  4EOF A;  4MGH A;  1L32 A;  3CSZ A;  1RE2 A;  3HUA A;  1L99 A;  1HSW A;  1L50 A;  4WLX A;  3PNV A;  1YKZ X;  5F9U A;  1LWG A;  1L22 A;  3GUP A;  3HJ8 A;  4B49 A;  1KSF X;  4XJD A;  4W59 A;  1FJG M;  1K28 A;  4IBK A;  3GLH A;  4LJA A;  2RAZ X;  4ETA A;  5L3H A;  4A3V B;  1FLW A;  3IG8 A;  1PRB A;  2YR0 A;  2B72 A;  3W67 A;  3C8S A;  150L A;  3I4V A;  1NQI A;  4DD7 A;  4DQJ A;  4NWH A;  4IBB A;  4NGI A;  4PGJ B;  4G4O A;  1HFY A;  4LDE A;  4YEO A;  4LF6 M;  2D4I A;  3TXE A;  3GQ5 A;  2DWM A;  2QHO B;  1GB8 A;  2Y8P A;  7LYZ A;  4H9F A;  1SXJ C;  1KFV A;  2MEB A;  1OQM A;  1HFZ A;  4DR2 M;  2E5L M;  1WQQ A;  3NY9 A;  4MM3 B;  3DOA A;  5LZM A;  4GIP A;  2AHM A;  4B4I A;  2C99 A;  2DBT A;  3FTC A;  4QY9 A;  1BB5 A;  1JEF A;  1CU0 A;  5ITU A;  1CV3 A;  3UMM A;  2RB1 X;  3GQ4 A;  1LSM A;  2ZAO A;  3U6O A;  1T6H A;  1QTC A;  1HFX A;  3GUN A;  4QNR A;  3J80 S;  1QSQ A;  1C65 A;  4AGA A;  1WGL A;  4I7M A;  2GQF A;  2CE7 A;  1EFU B;  3TXK A;  1SQ2 L;  2B75 A;  3GPP A;  1BVK C;  4PCZ A;  2H9K A;  1IC7 Y;  4OW1 A;  113L A;  206L A;  5FTJ A;  4OO9 A;  4LGM A;  3J7B A;  1IP4 A;  1YKX X;  2YFQ A;  3KSX A;  4IBD A;  1YSY A;  1GF5 A;  2WZJ A;  3J6K A;  4AG5 A;  1IEE A;  3A6C Y;  1QSW A;  1D2Y A;  1QTV A;  5B06 A;  1ZMW A;  1TR8 A;  1GB7 A;  1L18 A;  1UIG A;  4I7P A;  2FYC A;  2ZAN A;  4B7F A;  2Z38 A;  3U6P A;  3VK8 A;  1TDZ A;  3SAV A;  3D8B A;  1B5V A;  2HHH M;  3JR5 A;  1GB2 A;  3TPZ A;  1GDX A;  1L2B A;  3GUO A;  4J1B A;  4TTD A;  2JZ1 A;  3R9X B;  5ILF A;  3PFI A;  3UJN A;  1GAZ A;  3OTO M;  4NG1 A;  2OPF A;  4H8Z A;  1L77 A;  1LJ3 A;  4WMG A;  238L A;  1OUA A;  5DFL A;  3HT8 A;  1JR3 E;  4MST A;  3FAD A;  1IO5 A;  3DKE X;  2EO2 A;  4B08 A;  2CV1 A;  2VII A;  3MJ5 A;  1LZ9 A;  1NMM A;  4GHL A;  1VDS A;  2MEE A;  1DO2 A;  4OVZ B;  5APC A;  4WLY A;  1BHZ A;  1QUO A;  107L A;  2ZIL A;  1L24 A;  3C7Y A;  3K3T A;  3M6A A;  1GEV A;  3HWS A;  127L A;  1L63 A;  2BQK A;  2HWJ A;  3HT9 A;  2Q2E B;  2L4E A;  2CWB A;  1N77 A;  4J0L A;  163L A;  1AIP C;  1L46 A;  5LA8 A;  250L A;  5FTN A;  1C60 A;  4NHI A;  4WL7 A;  1JPO A;  1LMC A;  3MK6 A;  1DYA A;  3LYZ A;  2UXD M;  2A4T A;  3GUL A;  1GD6 A;  2Z18 A;  3GUM A;  3F92 A;  2LZT A;  2KNV A;  1L03 A;  1G0P A;  2VDB B;  3OE9 A;  1OAI A;  1GXX A;  1LMO A;  3T6U A;  4CGY B;  1JIS A;  1L98 A;  256L A;  1HSX A;  2V6Z M;  3W3E A;  3H4J A;  1PJJ A;  1C7Y A;  2R4J A;  3GRR A;  4GEW A;  2O25 A;  5EXS A;  5JI3 E;  1SXJ D;  3W6C A;  3KFU G;  4B3S M;  4LFP A;  4NSH A;  1NO1 A;  1YRO A;  2VF7 A;  1F6R A;  2QCU A;  110L A;  1LHL A;  2OU0 X;  2UU9 M;  3SB8 A;  4LJ7 A;  1LZA A;  2DEN A;  1JTO L;  4LFC M;  2LCB A;  3F6Z A;  1IR9 A;  1FKV A;  3IJU A;  1DYB A;  2HU1 A;  1MU5 A;  1TCY A;  3A34 A;  1G7L C;  6LYT A;  2XF3 A;  4FD2 A;  1C7P A;  1QUT A;  234L A;  2CDS A;  5KO3 A;  4Z41 A;  3L28 A;  5A3E A;  1L94 A;  1B7Q A;  4I7T A;  4NHP A;  1IVM A;  2BJV A;  3M7G A;  1NKH A;  3ZC7 B;  2K0B X;  2HUL A;  2IHL A;  3HTB A;  4HEO A;  3SBJ A;  3KP0 E;  3GPU A;  2FS1 A;  1XJT A;  2X4A A;  2DVW B;  4LJ5 A;  4JYA M;  3VKH A;  3B89 A;  4DV3 M;  1ZV5 L;  4PHI A;  2OQ4 A;  1QT6 A;  3QNG A;  3RZE A;  3A95 A;  4NWE A;  2MEA A;  4I7N A;  3HGI A;  2Z3X A;  1LSN A;  3KDS E;  5I5Q A;  1IC4 Y;  3WMK A;  1LI3 A;  3SB6 A;  1YLA A;  4BS7 A;  4NSI A;  3HUQ A;  1ZMU A;  2ZYC A;  128L A;  4KL7 A;  2VB1 A;  5KQ8 A;  2Y21 A;  4PDI A;  1QS5 A;  2MEF A;  5HLL A;  3QYB A;  3TMV A;  4MR1 A;  4CJ2 A;  2OO9 A;  1PQM A;  1Z6T A;  1CNS A;  1F6S A;  5C6L A;  2YQZ A;  3JR6 A;  4XEN A;  4H9B A;  147L A;  1IQP A;  3GRV A;  3DN8 A;  3B6L A;  2N35 A;  2C96 A;  3G3B B;  1K3X A;  3HHW A;  3A91 A;  3GPY A;  1T6V L;  4WW0 A;  1BWJ A;  165L A;  3L2X A;  3FUU A;  1QTZ A;  1L60 A;  3C3D A;  5H37 D;  4DDA A;  3DN2 A;  3RGP A;  4LDO A;  4R71 A;  4L41 A;  1L90 A;  1LZG A;  1LYZ A;  2ZIK A;  1GXV 2;  4RNA A;  1L26 A;  3IHP A;  1SXJ A;  5L9J A;  2ZAM A;  5IWA M;  1HNX M;  2Z4S A;  3C9P A;  1LZY A;  1R4G A;  1XMO M;  1LYO A;  210L A;  4H9A A;  1T43 A;  2CRU A;  4NGO A;  4LJ8 A;  4G4B A;  3TMX A;  1C6B A;  1L65 A;  1J7K A;  188L A;  1GB6 A;  4NRV A;  1SSY A;  1T8F A;  2MR9 A;  3GLI A;  4DR6 M;  5LAG A;  5LVG A;  1HEW A;  1GBZ A;  3WYH A;  1L29 A;  1LJ4 A;  1B5X A;  3TWK A;  2R6F A;  2MEG A;  4TUW A;  3WUM A;  1G4A E;  219L A;  1L34 A;  3CT0 A;  1UCO A;  4W56 A;  1LSZ A;  3EIH A;  1L1T A;  1C10 A;  4I7R A;  1OFI A;  3I51 A;  4H94 A;  1PQD A;  193L A;  3GLH E;  2DAI A;  3AYQ A;  1HQY E;  1QTH A;  1IIZ A;  3QE8 A;  4IAP A;  4LCB A;  1OV7 A;  3CT5 A;  3PDS A;  4LF5 M;  4II7 A;  1DI4 A;  5IHG A;  3U61 B;  4W94 A;  2UXB M;  1JKB A;  4OX9 M;  4XJI A;  155L A;  5I54 A;  3J81 S;  1G1V A;  2DQH Y;  4FW9 A;  1QIO A;  3KOX E;  2G4N A;  4R0F A;  160L A;  3WW6 A;  2EKS C;  1CV1 A;  4DD0 A;  1UIE A;  1Q3B A;  1AUA A;  3GLF A;  5E26 A;  1LZ1 A;  1FDL Y;  1L88 A;  4TSB A;  1LKR A;  4LT2 A;  5ITT A;  4LT1 A;  1GFV A;  1QVR A;  3FI7 A;  3C7W A;  3ZQJ A;  4LYM A;  1HEM A;  4OWB A;  2XSZ D;  1JR3 D;  3ILK A;  4GLA A;  2DKL A;  3WPK A;  1AM7 A;  4IAS A;  2D7E A;  2Q0M X;  1C6K A;  5LYM A;  1JJ1 A;  1W5S A;  3FUW A;  1IWT A;  2Z37 A;  3GLG A;  1L27 A;  1L40 A;  4LT0 A;  1HC0 A;  174L A;  3P65 A; 
#chains in the Genus database with same CATH homology
 1OVK A;  1G7M C;  2YBL A;  1L43 A;  3CDO A;  4QDN A;  3HTF A;  148L E;  1CKC A;  2LC9 A;  172L A;  2HU3 A;  4W96 A;  1CV4 A;  1GE0 A;  114L A;  3A90 A;  1B9O A;  1GE3 A;  1IR7 A;  2ZNW Y;  5LA5 A;  4W58 A;  1LGX A;  1TBY A;  1L91 A;  125L A;  3ATO A;  1QSB A;  1IWY A;  1L0K A;  3N9A A;  1L96 A;  3A93 A;  1EQ4 A;  1LJK A;  2ANX A;  1QDR A;  4N8Z A;  1OUG A;  3CDT A;  4YM8 A;  1QTK A;  2B6T A;  1TDY A;  1J1P Y;  5B59 A;  1L73 A;  1IOQ A;  211L A;  2OE7 X;  2OU8 A;  1ZVH L;  2XBR A;  4CFO A;  161L A;  4TSC A;  5I53 A;  5E4P A;  3WUN A;  1L10 A;  4GCD A;  4LYB A;  3M18 B;  2HEF A;  1SWY A;  1TEW A;  1I20 A;  3HUK A;  198L A;  2RSC A;  1FLQ A;  3HH3 A;  1Z55 A;  3WUA A;  2OEA X;  1D0L A;  1C6T A;  2EPE A;  3HBH A;  3WVY A;  184L A;  2YSS C;  1ALC A;  138L A;  1KIQ C;  4PRQ A;  2BQI A;  4RW2 A;  3AW6 A;  1WQN A;  2BLY A;  1DQJ C;  4ZPU A;  4LFX A;  1L36 A;  2ZWB A;  1B7P A;  2EQL A;  4CHX A;  1B5Z A;  2LYO A;  1F10 A;  3W6D A;  4ZFP A;  1PQI A;  3C8Q A;  1IP1 A;  4C5F A;  1G0Q A;  3GXK A;  1HER A;  1GWD A;  1L92 A;  4DQ7 A;  4XJH A;  1LOZ A;  3T36 A;  1L56 A;  3DN0 A;  173L A;  3CT1 A;  3EBA B;  1L00 A;  1XJU A;  1G7I C;  1HEP A;  227L A;  1L37 A;  209L A;  4G4H A;  220L A;  2IFF Y;  1LI6 A;  5F14 A;  1DYG A;  3HDF A;  4ANR A;  1YAP A;  2HEA A;  1CU2 A;  1CV5 A;  166L A;  178L A;  3CQL A;  1LSD A;  2MEC A;  242L A;  1L23 A;  233L A;  3OK0 A;  1OUF A;  4IAT A;  180L A;  1REZ A;  4EKQ A;  4CGE A;  2YBI A;  3WPL A;  2XQO A;  1FBI X;  3AB6 A;  226L A;  3EMS A;  4NFV A;  5I4Y A;  3TXJ A;  2H9J A;  1LZ6 A;  260L A;  2BQJ A;  3TXD A;  1L12 A;  1RFP A;  253L A;  4LDL A;  3CB7 A;  1NF5 A;  1LCN A;  2DQD Y;  1MLC E;  2W1X A;  3LZT A;  200L A;  1GFT A;  1XGQ C;  1C08 C;  2NTG A;  4GCB A;  4EKR A;  1LYI A;  1L25 A;  1NHB A;  1CU5 A;  4N9R A;  2Z2E A;  1WQR A;  1IOT A;  5ILC A;  2BPU A;  1IP3 A;  1C62 A;  1HF4 A;  1L75 A;  4H9E A;  4H8Y A;  1C6N A;  1P36 A;  1L16 A;  2ZYP A;  1LI2 A;  3WU9 A;  1WTH A;  119L A;  2RBN A;  3ODU A;  1LJG A;  3G3X A;  236L A;  3AJN A;  3VWO A;  4TX7 A;  5LAF A;  4NGK A;  3W6F A;  4WL6 A;  1L68 A;  1GDW A;  4LYO A;  1CKD A;  4B4E A;  3F8V A;  3SB5 A;  3C8R A;  2WAR A;  4U3X B;  1PQO A;  1KNI A;  2B6Y A;  1BWH A;  1LJE A;  1LMN A;  1D9U A;  3G3V A;  1UA6 Y;  4M6D A;  1LYY A;  4ARP A;  1LJN A;  1G7H C;  1GE1 A;  2B7X A;  1NWG A;  1LZD A;  3C83 A;  4I7K A;  1G1W A;  187L A;  1L39 A;  1L87 A;  1P37 A;  1L02 A;  126L A;  2FYD A;  1OWY A;  1XFP L;  4W55 A;  4H9I A;  1P2C C;  1YL0 X;  2YBH A;  1DYD A;  4YEM A;  146L A;  1OV5 A;  191L A;  1QT7 A;  3P68 A;  5E9R A;  4EMN A;  4KXI A;  3GUK A;  1GFK A;  3CDR A;  237L A;  1VFB C;  1C6L A;  5I14 A;  1QT5 A;  1IOR A;  194L A;  1B7O A;  4G4C A;  1SX7 A;  2NWD X;  1LJJ A;  1F0W A;  189L A;  3SB7 A;  1LHJ A;  168L A;  1GB0 A;  1L42 A;  1LJF A;  1UIB A;  4WM5 A;  118L A;  4N1C C;  245L A;  2YBM A;  5K7O A;  5APD A;  3RUN A;  1GFR A;  1DKK A;  1JKA A;  2F4G A;  5B05 A;  2D6B A;  5LVK A;  1ZYT A;  2MED A;  4Z46 A;  3C82 A;  4NIJ A;  1V7S A;  1DPX A;  1L17 A;  1L51 A;  4Z3M A;  1P7S A;  3DN4 A;  1C6I A;  3FI5 A;  5FCP A;  241L A;  1P2L A;  123L A;  1G0M A;  1BB6 A;  5B1F A;  1W08 A;  4A7D A;  1REM A;  1G0K A;  2W1L A;  145L A;  3HH6 A;  5APF A;  2B6Z A;  1B5W A;  2L78 A;  2C8O A;  1LYF A;  3A6B Y;  4YF2 A;  1B2K A;  2B73 A;  2Z19 A;  182L A;  1CKF A;  6LYZ A;  4I7O A;  3ZVQ B;  4DDC A;  1GPQ C;  1KXW A;  2I26 L;  4H8X A;  1LYD A;  1QUH A;  3RU5 A;  2BQB A;  1D2W A;  4HJZ A;  1DI5 A;  4NY5 A;  108L A;  3G3W A;  3LYT A;  2BQC A;  1KW5 A;  5KXZ A;  5KKJ A;  1P46 A;  1G06 A;  171L A;  1NBY C;  3HU9 A;  1D6Q A;  4TUN A;  5APE A;  4ARM B;  2RBR A;  2HED A;  1CTW A;  1OUJ A;  2LHM A;  1LJH A;  4R6C A;  4H9H A;  4GLV A;  3MGW A;  1CU6 A;  1L44 A;  2DQA A;  1CU3 A;  1GFE A;  4XJF A;  2Z12 A;  152L A;  2B74 A;  1L95 A;  4DD9 A;  1L04 A;  1O23 A;  3C80 A;  4DT3 A;  1L66 A;  3WU8 A;  1OUH A;  3FE0 A;  4DYG A;  5FHW A;  4XJB A;  4HSF A;  1LMT A;  1UID A;  4LT3 A;  1AKI A;  4XJG A;  162L A;  1G0L A;  1C67 A;  3J4G A;  2B70 A;  4RLN A;  3HTG A;  5HNL A;  1A4V A;  3AW7 A;  3A8Z A;  1LGW A;  1DYC A;  4DKL A;  4H90 A;  4XAD A;  2RBO A;  7LZM A;  4UWN A;  1OVJ A;  4IJ4 A;  1QT4 A;  4GRV A;  156L A;  159L A;  5HNC A;  3OJP A;  2Q9E A;  2ZIJ A;  4WM6 A;  1JKC A;  1LYJ A;  1QQY A;  3C7Z A;  1LWK A;  3EXD A;  3WW5 A;  1XGP C;  207L A;  1UAC Y;  1GFU A;  4BAP A;  4D9Z A;  1G0J A;  1YKY X;  2ZQ3 A;  4GCF A;  1NHE A;  4ET9 A;  255L A;  235L A;  1L47 A;  3D9A C;  1L31 A;  1LSP A;  5KXR A;  1E8L A;  4I7S A;  4J7V A;  4ARQ A;  1FN5 A;  1L20 A;  5LXW A;  183L A;  1KXX A;  1TLA A;  4B0D A;  5C6J A;  4KT3 A;  5LYT A;  2Q9D A;  4WG1 A;  1L69 A;  5F9X A;  1C6C A;  1GFJ A;  1A2Y C;  1WQP A;  1NDM C;  1LW9 A;  4QGZ A;  1LZR A;  3RW8 A;  195L A;  4EJ4 A;  5HMV A;  1LZE A;  2HUK A;  1WTM A;  4LYT A;  216L A;  2BQD A;  1ZMY L;  3NY8 A;  5FDJ A;  1UIC A;  1LSC A;  1LZN A;  1LHI A;  4WO6 A;  2H5Z A;  1DPW A;  5KJ9 A;  4ML7 A;  1LZ8 A;  1GBO A;  1L71 A;  3C81 A;  2YBN A;  4WM3 A;  3UON A;  2G4Q A;  5KXS A;  1BWI A;  1JSF A;  1QS9 A;  1WQM A;  1IP6 A;  2F2Q A;  175L A;  1L62 A;  2OTY X;  5AMY A;  5LIN A;  4NGW A;  2BQG A;  1G7J C;  1L76 A;  3LZM A;  1SWZ A;  4G49 A;  2BQM A;  5IDD A;  181L A;  5T3F A;  3A67 Y;  1JIY A;  1SX2 A;  4YX7 C;  1HMK A;  1G07 A;  3P4Z A;  2YVB A;  1C6Q A;  5DL9 A;  5LVH A;  3DMZ A;  4ETB A;  243L A;  3SP3 A;  4OWH A;  4GCC A;  225L A;  1HML A;  133L A;  1IP7 A;  3HFM Y;  5HQ1 A;  3WPJ A;  3NYA A;  228L A;  1YAM A;  5D5F A;  144L A;  4UWV A;  1INU A;  1LZS A;  4CFP A;  1C46 A;  4X3B A;  1TAY A;  1G0G A;  224L A;  3L64 A;  170L A;  4OWA A;  4GN4 A;  4EPF A;  214L A;  1L79 A;  1OP9 B;  3LN2 A;  1BB7 A;  1RI8 B;  2YDG A;  261L A;  4H93 A;  5KKI A;  2DQJ Y;  4NG8 A;  3AZ5 A;  1CV6 A;  3WUL A;  1L58 A;  4PPO A;  4LYC A;  1C6A A;  3W6B A;  4GBR B;  3B0K A;  1GB5 A;  5JEN B;  5KXL A;  4DJH A;  139L A;  1P3N A;  1C6F A;  3GUI A;  1VAT A;  1L49 A;  3HDE A;  3IJV A;  1L09 A;  252L A;  4NSG A;  1L52 A;  217L A;  4LYZ A;  1YIK A;  4PJ2 C;  4WM1 A;  1LSB A;  2OE4 X;  1JHL A;  1XGT C;  2O7A A;  5F16 A;  1LLH A;  3DN3 A;  2HEE A;  190L A;  4QEQ A;  1UUZ C;  3GUJ A;  1OUE A;  169L A;  1T97 A;  3A96 A;  1GFA A;  1C45 A;  1AZF A;  4H9C A;  1QTD A;  1D0M A;  4HPE A;  3KAM A;  137L A;  5D5C A;  4ZIX A;  1EL1 A;  1VAU A;  5KXO A;  1GEZ A;  1GE2 A;  1I6S A;  4HV1 A;  1OVH A;  2BQN A;  4DQ5 A;  4FDY A;  1B7S A;  1OYU A;  1LPY A;  230L A;  4NGV A;  5KXP A;  3VW7 A;  1L35 A;  1HNL A;  5EBH A;  1JWR A;  1IX0 A;  4E3U A;  1LSA A;  4OWC A;  1C6P A;  4W53 A;  3D4S A;  3WL2 A;  1KS3 A;  3TXI A;  4O34 A;  3AZ6 A;  1PQJ A;  205L A;  1GBW A;  4WM2 A;  1B5U A;  2ZQ4 A;  1L64 A;  2OE9 X;  2XTH A;  4I0C A;  4OOT A;  1GE4 A;  1LGU A;  1CVK A;  197L A;  1XEI A;  4I7L A;  1HEN A;  1BQL Y;  1GBX A;  3QY4 A;  1XSF A;  1XGR C;  192L A;  232L A;  1YAO A;  1IP5 A;  1CV0 A;  1CKH A;  2W1Y A;  5KY1 A;  1L83 A;  1QUS A;  103L A;  1L45 A;  2RBP A;  262L A;  1L84 A;  1MEL L;  5DM9 A;  1GBY A;  1WQO A;  1LZ4 A;  259L A;  4WO9 A;  1REY A;  1LMP A;  115L A;  4N5R A;  1LYE A;  5IEL A;  3W6E A;  5LYZ A;  2LZM A;  1L86 A;  5F81 A;  1GF3 A;  3DNA A;  4ETC A;  1C68 A;  3HWL A;  4YXC A;  1LSF A;  4OOO A;  3TXB A;  248L A;  1GB3 A;  4ZEE A;  2FBD A;  111L A;  2BQE A;  140L A;  2EIZ C;  3QAK A;  2D4J A;  4ARL A;  4PK0 A;  2HEC A;  4II8 A;  2B6W A;  2F2N A;  134L A;  1QT8 A;  1L06 A;  5B1G A;  3DN6 A;  1JKD A;  4P2E A;  5II3 A;  1ZUR A;  4RW1 A;  1GF6 A;  1LYS A;  1V7T A;  3ATN A;  1IWZ A;  5FEL A;  1VDP A;  2DQC Y;  1NDG C;  2CUU A;  1CUP A;  4NHQ A;  4ETE A;  1BB4 A;  1YIL A;  102L A;  2DQF C;  3AGH A;  1REX A;  3AZ7 A;  1SLY A;  1IWV A;  1RCM A;  3HTD A;  1IY4 A;  1XGU C;  208L A;  231L A;  1XEP A;  4ET8 A;  3LYM A;  1HHL A;  4N1E I;  2XJW A;  3RT5 X;  1LHK A;  1XEJ A;  4XYY A;  5KXW A;  1LHM A;  2QB0 B;  4NSJ A;  153L A;  135L A;  3CSQ A;  3TXH A;  5LVI A;  109L A;  2GV0 A;  2W1M A;  1L19 A;  2BAA A;  2XBS A;  1B0D A;  4H1P A;  1C61 A;  4DC4 A;  2D4K A;  1BVX A;  1L01 A;  3TXG A;  5KXK A;  3ULR A;  1D3N A;  1CJ6 A;  3DMV A;  2F47 A;  4NGZ A;  1C64 A;  1LJI A;  1OUD A;  5L3I A;  1DYE A;  2N5Z A;  4DD3 A;  1PZY A;  4HTN A;  3SN6 R;  4DD1 A;  1GAY A;  2Z2F A;  130L A;  1DZB X;  112L A;  1L07 A;  1PQK A;  1JSE A;  4WLT A;  1LYH A;  5KXT A;  1D0K A;  1YL1 X;  1T3P A;  3P66 A;  1AT6 A;  4J1A A;  2OTZ X;  1VDT A;  1CJ7 A;  1L14 A;  3WVX A;  4GCE A;  1UIA A;  3ZEK A;  4DWX A;  1D3M A;  2OU9 A;  4E97 A;  1UC0 A;  1N4F A;  2DQE Y;  201L A;  1L82 A;  164L A;  4NHS A;  1C69 A;  3A3R X;  2BQL A;  154L A;  4NHT A;  2D91 A;  4WG7 A;  1LTM A;  5KXY A;  3N9C A;  1DYF A;  1IY3 A;  4GN5 C;  1WVV A;  4YOP A;  4EXM A;  1B7M A;  3P64 A;  4HV2 A;  2RH1 A;  1WTN A;  1JTN A;  1ZVY B;  2A7D A;  1JTT L;  1LMQ A;  1FLY A;  1HEL A;  3FA0 A;  1DKJ A;  3F9L A;  1UBZ A;  4YEN A;  3EO5 A;  1D3J A;  1QTE A;  1IOS A;  177L A;  1RJC B;  1JIT A;  5DLA A;  5A3Z A;  4XN6 A;  4PJZ A;  1L08 A;  246L A;  4K5Y A;  2IGC A;  1BB3 A;  151L A;  1AT5 A;  5M1Y A;  1L85 A;  1YAQ A;  2HEB A;  1P2R A;  3LZ2 A;  1LSY A;  2RBQ A;  1L38 A;  2ZNX Y;  1L74 A;  1GB9 A;  4W57 A;  1IWW A;  1FLU A;  1GF0 A;  1FKQ A;  4GN3 A;  4EKS A;  2RB2 X;  1HEO A;  1LZC A;  1I1Z A;  1KXY A;  249L A;  3CSR A;  1IC5 Y;  4DDB A;  3GXR A;  1GFG A;  3HU8 A;  1EQE A;  2F32 A;  4ETD A;  3CDV A;  3EML A;  4WOA A;  3G3A B;  2F4A A;  157L A;  1J1X Y;  4HPI A;  3CDQ A;  104L A;  2LYM A;  3PBL A;  3HBE X;  3N9E A;  2CJL A;  251L A;  2FBB A;  2LYZ A;  1EQ5 A;  1QSA A;  1L0J A;  2Z39 A;  1GHL A;  4FJR A;  1D9W A;  1OUI A;  2BQF A;  1C6J A;  1YQV Y;  1HEQ A;  2O4W A;  4BAD A;  2RB0 X;  4LZT A;  5J7C A;  4EKP A;  3HH4 A;  2NTH A;  4WLD A;  2AUB A;  3IWR A;  1T8A A;  4W52 A;  2LZ2 A;  1CX7 A;  1KIR C;  3HBD A;  3K2R A;  4NEB A;  1C6M A;  1GF7 A;  4HJV A;  5KXX A;  1LSG A;  1CUQ A;  1L11 A;  4S0W A;  4NGJ A;  1IP2 A;  1UIH A;  2RBS A;  1L89 A;  1P6Y A;  1LAA A;  1L13 A;  4HJY A;  4HTQ A;  5FEK A;  5KXM A;  2C8P A;  4I7J A;  3SBB C;  1L41 A;  1D6P A;  3AZ4 A;  3SBA A;  4MCK A;  1L21 A;  158L A;  199L A;  247L A;  4UWU A;  2G4P A;  1L59 A;  4RLM A;  2X0A A;  4BAF A;  142L A;  3DN1 A;  1L97 A;  1L70 A;  4WM4 A;  2YBJ A;  4RDS A;  1L57 A;  1C6D A;  1GFH A;  1ZWN A;  1LZT A;  1L30 A;  1B5Y A;  1T8G A;  5B07 A;  122L A;  4Z98 A;  1EPY A;  3LHM A;  1WVU A;  2I6Z A;  4I8S A;  4EPI A;  1QDT A;  2O79 A;  4PRU A;  4OWE A;  1B7N A;  1JTP L;  186L A;  4H91 A;  1L80 A;  1KY1 A;  1DI3 A;  5KXN A;  1P5C A;  167L A;  1L28 A;  1GF9 A;  1L15 A;  8LYZ A;  4B1A A;  3RZ4 A;  4G9S A;  149L A;  1B7R A;  2BQH A;  1C6H A;  1OUC A;  4HTK A;  141L A;  1C63 A;  5DN4 A;  3RNX A;  1KW7 A;  3A94 A;  2DQI Y;  4AXT A;  3OE0 A;  1C6G A;  1OWZ A;  2BQA A;  2HUB A;  4N0J A;  1LZ5 A;  3HT7 A;  1XEK A;  2PC2 A;  1IWU A;  240L A;  215L A;  2I25 L;  3M3U A;  1JQU A;  257L A;  3OE6 A;  2HTX A;  1L33 A;  5I4X A;  2DKV A;  3E3D A;  212L A;  2HUM A;  4DD2 A;  223L A;  1JJ3 A;  2BLX A;  3WU7 A;  1CKG A;  1L48 A;  1YAN A;  4DAJ A;  1L67 A;  4M4O A;  3LYO A;  1QUD A;  1P56 A;  1JTM A;  131L A;  4YXA C;  3V2Y A;  1L93 A;  1LZB A;  4TWS A;  3SB9 A;  1QT3 A;  1NBZ C;  3AGG G;  1L72 A;  254L A;  218L A;  3WXU A;  1UIF A;  129L A;  1PS5 A;  1B6I A;  5C6I A;  1P64 A;  4LZM A;  2B6X A;  1CJ8 A;  1KY0 A;  1JJ0 A;  196L A;  2MEH A;  4HP0 A;  9LYZ A;  1GBS A;  244L A;  5HMJ A;  3TXF A;  1W6Z A;  258L A;  2F30 A;  3B72 A;  2ANV A;  221L A;  132L A;  1OUB A;  3TMW A;  3ZVQ A;  3WXT A;  3D3D A;  3OE8 A;  4KPM A;  120L A;  5I4W A;  1I56 A;  3TMU A;  1J1O Y;  5DN5 A;  3DMX A;  1L61 A;  4W54 A;  1KIP C;  3AGI A;  1C43 A;  1BGI A;  2B5Z A;  1CJ9 A;  1B7L A;  4ARM A;  1C6E A;  1LYG A;  1D3F A;  1QTB A;  1L53 A;  1IWX A;  4NGY A;  2CGI A;  3A3Q A;  3B0I A;  4ARQ B;  213L A;  2CWI A;  1L54 A;  1LHH A;  1L81 A;  1C66 A;  4B4J A;  5LVJ A;  1IR8 A;  1CX6 A;  1IOC A;  5LIO A;  185L A;  1VED A;  2QAR C;  1JUG A;  1L55 A;  3A92 A;  2A7F A;  4H92 A;  4I7Q A;  3V2W A;  1LMA A;  1SSW A;  3HH5 A;  4NGL A;  1QUG A;  3WH1 A;  4AQN A;  1GF4 A;  1LPI A;  4C3W A;  1H87 A;  2Z6B A;  1H6M A;  1L05 A;  1GF8 A;  1DXJ A;  1LKS A;  1VDQ A;  2DQG Y;  3BKV A;  3W6A A;  229L A;  6LZM A;  3BKH A;  1LSE A;  2BQO A;  4LGK A;  3HT6 A;  143L A;  3B0O A;  2RAY X;  2MEI A;  5FST A;  4W51 A;  176L A;  4ARJ A;  222L A;  239L A;  4EOF A;  3CSZ A;  1L32 A;  1RE2 A;  3HUA A;  1L99 A;  1HSW A;  1L50 A;  4WLX A;  1YKZ X;  5F9U A;  1LWG A;  1L22 A;  3GUP A;  4B49 A;  4XJD A;  4W59 A;  1K28 A;  2RAZ X;  4ETA A;  5L3H A;  1FLW A;  2B72 A;  3C8S A;  150L A;  4DD7 A;  1NQI A;  4DQJ A;  4NWH A;  4NGI A;  4PGJ B;  1HFY A;  4LDE A;  4YEO A;  2D4I A;  3TXE A;  2Y8P A;  7LYZ A;  1GB8 A;  4H9F A;  2MEB A;  1OQM A;  1HFZ A;  1WQQ A;  3NY9 A;  5LZM A;  4B4I A;  2DBT A;  4QY9 A;  1BB5 A;  1JEF A;  1CU0 A;  1CV3 A;  2RB1 X;  1LSM A;  1T6H A;  1QTC A;  1HFX A;  3GUN A;  1QSQ A;  1C65 A;  4AGA A;  4I7M A;  3TXK A;  1SQ2 L;  2B75 A;  1BVK C;  2H9K A;  1IC7 Y;  4OW1 A;  113L A;  206L A;  4OO9 A;  1IP4 A;  1YKX X;  1GF5 A;  3J6K A;  1IEE A;  3A6C Y;  1QSW A;  1D2Y A;  1QTV A;  5B06 A;  1GB7 A;  1L18 A;  1UIG A;  4I7P A;  2FYC A;  2Z38 A;  1B5V A;  1GB2 A;  1GDX A;  3GUO A;  4J1B A;  4TTD A;  5ILF A;  1GAZ A;  4NG1 A;  4H8Z A;  1L77 A;  1LJ3 A;  4WMG A;  238L A;  1OUA A;  3HT8 A;  4MST A;  3FAD A;  1IO5 A;  3DKE X;  1LZ9 A;  1NMM A;  1VDS A;  2MEE A;  5APC A;  4WLY A;  1BHZ A;  1QUO A;  107L A;  2ZIL A;  1L24 A;  3C7Y A;  3K3T A;  1GEV A;  127L A;  1L63 A;  2BQK A;  3HT9 A;  4J0L A;  5LA8 A;  163L A;  1L46 A;  250L A;  1C60 A;  4NHI A;  4WL7 A;  1JPO A;  1LMC A;  1DYA A;  3LYZ A;  2A4T A;  3GUL A;  1GD6 A;  2Z18 A;  3GUM A;  2LZT A;  1L03 A;  1G0P A;  3OE9 A;  1GXX A;  1LMO A;  3T6U A;  1JIS A;  1L98 A;  256L A;  1HSX A;  3W3E A;  3W6C A;  4LFP A;  4NSH A;  1YRO A;  1F6R A;  110L A;  1LHL A;  2OU0 X;  3SB8 A;  1LZA A;  1JTO L;  3F6Z A;  2LCB A;  1IR9 A;  1FKV A;  3IJU A;  1DYB A;  2HU1 A;  1TCY A;  3A34 A;  1G7L C;  6LYT A;  1C7P A;  1QUT A;  234L A;  2CDS A;  4Z41 A;  5A3E A;  1L94 A;  1B7Q A;  4I7T A;  4NHP A;  1IVM A;  1NKH A;  2HUL A;  2IHL A;  3HTB A;  1XJT A;  1ZV5 L;  4PHI A;  1QT6 A;  3QNG A;  3RZE A;  3A95 A;  4NWE A;  2MEA A;  4I7N A;  1LSN A;  5I5Q A;  1IC4 Y;  3WMK A;  1LI3 A;  3SB6 A;  4BS7 A;  4NSI A;  3HUQ A;  2ZYC A;  128L A;  4KL7 A;  2VB1 A;  1QS5 A;  2MEF A;  5HLL A;  3TMV A;  4MR1 A;  4CJ2 A;  1PQM A;  5C6L A;  1CNS A;  1F6S A;  3JR6 A;  4XEN A;  4H9B A;  147L A;  3DN8 A;  3B6L A;  3G3B B;  3A91 A;  1T6V L;  1BWJ A;  165L A;  3L2X A;  1QTZ A;  1L60 A;  4DDA A;  3DN2 A;  4LDO A;  4L41 A;  1L90 A;  1LZG A;  1LYZ A;  2ZIK A;  1GXV 2;  1L26 A;  5L9J A;  1LZY A;  1LYO A;  210L A;  4H9A A;  4NGO A;  4G4B A;  3TMX A;  1C6B A;  1L65 A;  1T8F A;  188L A;  1GB6 A;  1SSY A;  5LAG A;  5LVG A;  1HEW A;  1GBZ A;  3WYH A;  1L29 A;  1LJ4 A;  1B5X A;  2MEG A;  3WUM A;  219L A;  1L34 A;  3CT0 A;  1UCO A;  4W56 A;  1LSZ A;  1C10 A;  4I7R A;  4H94 A;  1PQD A;  193L A;  3AYQ A;  1QTH A;  1IIZ A;  3QE8 A;  4IAP A;  1OV7 A;  3CT5 A;  3PDS A;  1DI4 A;  5IHG A;  4W94 A;  1JKB A;  4XJI A;  155L A;  5I54 A;  1G1V A;  2DQH Y;  2G4N A;  1QIO A;  4R0F A;  160L A;  3WW6 A;  2EKS C;  1CV1 A;  4DD0 A;  1UIE A;  1LZ1 A;  1FDL Y;  1L88 A;  4TSB A;  1LKR A;  4LT2 A;  4LT1 A;  1GFV A;  3FI7 A;  3C7W A;  4LYM A;  1HEM A;  4OWB A;  4GLA A;  3WPK A;  1AM7 A;  4IAS A;  2Q0M X;  1C6K A;  5LYM A;  1JJ1 A;  1IWT A;  2Z37 A;  1HC0 A;  1L27 A;  1L40 A;  4LT0 A;  174L A;  3P65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...