1QDRA

2.1 a resolution structure of escherichia coli lytic transglycosylase slt35
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Binding of calcium in the EF-hand of Escherichia coli lytic transglycosylase Slt35 is important for stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qdrA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qdrA02
3A6CY 3A94A 4LYMA 4RW2A 1DKJA 3FI7A 1FLQA 3AZ7A 3A3RX 2BQOA 3B0KA 4NHIA 2ZYCA 1D6QA 4WM2A 5F81A 4NSJA 8LYZA 5HNCA 1G7JC 4ETAA 4NGKA 1CJ7A 4XJFA 1LSFA 1LZDA 2CJLA 2I26L 5HNLA 5A3ZA 1LHHA 2FYDA 2YSSC 4DDAA 1PZYA 1GF0A 2I6ZA 3LYMA 1YROA 3B0IA 4H1PA 4DD7A 5KXOA 1JTOL 1REXA 1NHEA 4LYZA 4N1CC 1HENA 1LSNA 5KXMA 2BQIA 3A93A 4NHTA 5LVJA 4PGJB 4IATA 1TCYA 1VDQA 2LYMA 1LZ9A 1GF4A 4H8XA 4NHQA 3WUMA 2MEEA 1E8LA 5C6LA 4KL7A 5DN4A 3HBEX 1GF3A 3LYZA 1JISA 1LHIA 2LZTA 5LXWA 2ZQ4A 4XJDA 4ETCA 1LZEA 3TXFA 1H6MA 4ZIXA 2HEBA 4CJ2A 1LHMA 4R0FA 4IASA 2W1YA 4DYGA 1JKAA 4XJBA 2DQHY 1YIKA 2F30A 4PRUA 1BB3A 1UIAA 1LSMA 4QGZA 4HJVA 4XYYA 1BB6A 1JHLA 3A3QA 5LVHA 1FBIX 4J0LA 3W6FA 4N5RA 2H5ZA 1B0DA 1C46A 1LZCA 4LT3A 3TMUA 1UIDA 3RW8A 3RZ4A 1LZ5A 3WH1A 3WPJA 1XSFA 1WVVA 5KXSA 2HEFA 4WM1A 1LZ8A 1QDRA 4NGLA 1B7LA 1WTMA 1H87A 3SP3A 3WXTA 3A90A 1QDTA 1HFYA 2BQGA 207LA 1DQJC 154LA 1SQ2L 1CJ6A 1IWTA 1GFGA 4LYBA 5KKIA 1GBSA 2N5ZA 2H9JA 3WMKA 1C10A 1UC0A 5F16A 1IP3A 1P2CC 1WQPA 1JTPL 1IIZA 1IOQA 4B4JA 1B5XA 4PHIA 1WVUA 5I54A 1NBZC 5L3IA 4EMNA 4DD1A 2HTXA 4KPMA 193LA 1JKBA 3N9CA 1FKQA 4G4CA 2DQEY 1F10A 3OK0A 1IOTA 1DI3A 5I4YA 2F4AA 2YBMA 4NGZA 5FSTA 1UIHA 4GN3A 5KKJA 2G4QA 5B1FA 3TXIA 1NWGA 3W6AA 1VDPA 4WO6A 1JTTL 1CJ9A 4OWHA 5HMJA 2DBTA 2FBDA 1FN5A 4N8ZA 5C6JA 2XTHA 1EQ5A 2GV0A 2Z37A 3BKHA 1AM7A 4Z41A 1GWDA 1LCNA 1OQMA 2WARA 1DPXA 1GBZA 4G49A 4LT1A 4KXIA 1XGPC 3WVYA 4WM3A 2EKSC 4LT2A 3ZEKA 1GB0A 4GCFA 5FHWA 3QY4A 4H9IA 1F6SA 3FE0A 1JPOA 1LMPA 1IY3A 1D6PA 3WYHA 3TXKA 1HC0A 4LYTA 1MELL 1GB5A 2F2NA 2Z18A 5J7CA 1OUBA 2XBSA 2BQCA 1RFPA 5D5CA 4U3XB 1UA6Y 1W08A 1LOZA 1YAPA 4NWEA 5KXRA 4GN5C 2HEAA 2IHLA 1O23A 1LZBA 1JITA 1OUEA 4HPEA 4I8SA 6LYTA 1HSWA 4N0JA 1WQOA 4QDNA 5F9XA 4HSFA 1GE4A 1T6VL 1IC4Y 1GBXA 1LZ4A 1SLYA 3TMWA 2YBHA 1REYA 1KXYA 1B5WA 1IP2A 1GE2A 4WG1A 1GXXA 5E4PA 1MLCE 3LZ2A 4MR1A 1GF6A 2EQLA 1GB6A 1LMQA 4BADA 4N1EI 1LMOA 1IY4A 1GF7A 3TXGA 4NHPA 1OP9B 2MEBA 3BKVA 1LMCA 2D6BA 2DQCY 3A6BY 1CKGA 2DQAA 1B7SA 2ZILA 3VWOA 1UICA 3G3BB 3CT1A 3AW7A 4QEQA 1GEVA 2MEGA 2Z19A 1DPWA 5KXKA 4M6DA 4DDBA 1XEJA 2YVBA 4NGYA 3IJVA 5LVKA 3LZTA 1A4VA 2W1MA 1KIPC 1LMNA 1WQMA 2ZWBA 3MGWA 3WW5A 2Z39A 5LIOA 3B6LA 4GCBA 4H9AA 3WU7A 1JJ0A 2FBBA 2DQJY 1HEPA 9LYZA 1GB3A 4HV1A 1AT5A 1LYZA 3WVXA 4BAFA 3ATNA 1AZFA 4NGWA 3RNXA 3TMXA 4AXTA 4LYOA 4J7VA 4WMGA 1J1OY 3WL2A 4BAPA 3P65A 1TDYA 2RSCA 3TXBA 1JSFA 2BLYA 1HEQA 1B7OA 1LYSA 4XJIA 1GFKA 1YAOA 4C5FA 1VATA 5HQ1A 2PC2A 2BQFA 2HEDA 4XADA 1GXV2 1NF5A 5LYMA 1LZYA 1NQIA 1F0WA 4IJ4A 3P68A 5LVGA 1D0KA 1HEOA 4H93A 5HLLA 1LSYA 4WLTA 2DQGY 4GCDA 3HBDA 5IDDA 1CKCA 1UUZC 2DQIY 2BLXA 4H9HA 5DM9A 3J4GA 1IOCA 1BWIA 5KXNA 1B5UA 4KT3A 1RJCB 3CT0A 3EXDA 1GE1A 1XGTC 2D4IA 3AGGG 3LYOA 1GEZA 1IWZA 4HTNA 4OOOA 4XJHA 3W6BA 1GF9A 7LYZA 2XJWA 1LYOA 1GFEA 3N9AA 2BQDA 1BB7A 1GB7A 1NBYC 3TXJA 1LAAA 2D4JA 3EO5A 1NKHA 2W1LA 1BVKC 1HERA 5ILFA 1LKSA 1XFPL 2DQFC 1FLYA 4CFOA 1KXWA 2LYOA 4ZFPA 3ULRA 1C7PA 3T6UA 1D9UA 4FJRA 1FDLY 4W94A 4XENA 5B05A 5I4WA 4NGIA 3T36A 1TBYA 1A2YC 5EBHA 5D5FA 1IWVA 1LHLA 1IO5A 3IWRA 1QSAA 4HJZA 3TXHA 4OWEA 2ZYPA 1HEWA 4NGOA 1T3PA 1GBWA 4H9BA 1YILA 1HMLA 153LA 4Z98A 1TEWA 4GLVA 1Z55A 3K3TA 5L3HA 5LINA 2VB1A 2DKVA 194LA 1G7HC 1LJJA 4W96A 4YEOA 1V7SA 1YAQA 1GAYA 2XBRA 3AZ6A 1IC5Y 1LSAA 1TAYA 3EMSA 4M4OA 2Y8PA 4L41A 4H9FA 1GDWA 5FELA 4NGVA 1B7QA 2BAAA 3A91A 1BHZA 4LZTA 2B5ZA 1LJFA 5KY1A 4NGJA 2MEHA 4XN6A 3AW6A 4WM4A 1GB8A 1QTEA 4OWAA 4ML7A 2CGIA 3J6KA 4MCKA 3OJPA 1YANA 1D0MA 3RT5X 1EQEA 3CSQA 1LJEA 135LA 1VFBC 5K7OA 132LA 4H91A 1GB9A 3HBHA 4WO9A 1EL1A 1YKZX 1B7NA 3CQLA 208LA 4GCCA 1IP4A 4DD9A 4DD2A 1OUHA 1GPQC 1WQRA 1LTMA 3E3DA 1UCOA 2BQAA 1IORA 1LJ4A 1OUDA 2Z2FA 1LZ1A 4EOFA 1BWHA 1YL1X 2G4PA 1WQNA 5T3FA 2ZNWY 2C8OA 3ZVQB 4WM6A 1DI4A 1G7LC 3A95A 4WL7A 1IEEA 4H8YA 1LMTA 3A67Y 1HFXA 5B07A 1ZVHL 4ETEA 1JUGA 5JENB 4II8A 4B1AA 4NFVA 5LAFA 4DC4A 4UWVA 2BQKA 3AGIA 3AB6A 3A34A 1JIYA 3QNGA 1YL0X 4CHXA 2D91A 5APDA 5IELA 2YBIA 4TSCA 5HMVA 4TWSA 1JKCA 5LAGA 1GFRA 4CFPA 1C45A 1JJ1A 2HEEA 1GF8A 1LHKA 3F6ZA 4QY9A 2AUBA 1W6ZA 1IR9A 1IP1A 1IX0A 4NG1A 4NG8A 5F9UA 3AJNA 2ZIJA 4HP0A 1VDSA 1ZMYL 1QQYA 4ZEEA 1F6RA 1BWJA 5KXPA 2CWIA 4PRQA 1GF5A 4H92A 2A7FA 1IR7A 1ALCA 1B5ZA 4P2EA 5DLAA 3W3EA 1LJKA 2H9KA 3A96A 4NWHA 1GB2A 2BQNA 3ZVQA 4DDCA 1YAMA 4UWNA 1I20A 1V7TA 1C43A 1IP6A 1CJ8A 2BQJA 2DQDY 5DL9A 4GN4A 1GBYA 4A7DA 5I53A 4PPOA 4NSHA 1FLWA 1YQVY 1GHLA 4HTKA 5C6IA 1IC7Y 3M18B 3WUNA 4DT3A 3TXDA 5B59A 5KXTA 4LFXA 3WU8A 1NMMA 1JSEA 4G4HA 1UACY 3GXKA 3GXRA 3LN2A 1GFUA 4MSTA 4ET9A 1YKYX 1OUGA 1LSPA 1XEKA 2ZQ3A 2Z38A 2BPUA 4HJYA 4YENA 3WU9A 1DKKA 4B4IA 1LSZA 1VAUA 1OUCA 3D3DA 2D4KA 3WULA 4LGKA 3W6EA 1GE0A 1GBOA 4H9CA 1BGIA 2MEIA 4YM8A 5KXXA 3TXEA 5LYTA 3CSZA 1LJGA 4H90A 3RU5A 5AMYA 4J1AA 2FYCA 5II3A 3A92A 5IHGA 1KIQC 1REMA 2Z12A 1OUJA 4DD0A 2ZNXY 1J1PY 2YBJA 4B0DA 4YEMA 1DZBX 2Z2EA 1GFTA 4I0CA 4UWUA 4WM5A 1FLUA 1G7IC 1HELA 4TUNA 5APFA 3TMVA 1HHLA 3CT5A 4GLAA 5I4XA 1IVMA 1GD6A 2F4GA 1DI5A 1AT6A 1QUSA 1PS5A 3CB7A 5APEA 1LYYA 1B5YA 1IWUA 2G4NA 5I5QA 1CKFA 4AGAA 3WXUA 4C3WA 3HFMY 1UIFA 1LZTA 1DXJA 1BQLY 5FCPA 2EPEA 5F14A 4B49A 2YBNA 4NIJA 2Q0MX 1WQQA 3AYQA 1ZV5L 3B72A 1B7RA 4B4EA 3WW6A 3KAMA 1LJ3A 4H9EA 134LA 1BB4A 1JWRA 3AZ5A 1LZAA 4WL6A 1RI8B 1JJ3A 5LYZA 4R6CA 1B7PA 1B5VA 2MEFA 2BQMA 3QE8A 1BVXA 4LT0A 4XJGA 2W1XA 2X0AA 4O34A 2NWDX 1GFAA 5KXWA 3ATOA 5ILCA 1LJIA 2YBLA 1HNLA 4TSBA 4TTDA 4WOAA 5LA8A 1CKHA 133LA 1IWYA 1LSGA 1LZNA 1KIRC 1OUFA 1JEFA 3A8ZA 1REZA 3CSRA 1LZRA 1GFHA 2IFFY 4HTQA 1HF4A 2BQEA 2LZ2A 1GE3A 4GCEA 1NDGC 1YKXX 1RCMA 4ETDA 2YDGA 1LSCA 1UIBA 1IR8A 1XGUC 1AKIA 5FEKA 2HU1A 3AGHA 1LJHA 3P4ZA 2MEAA 5DN5A 1G7MC 4ET8A 5B1GA 2I25L 1QUTA 2LYZA 3EBAB 3WPLA 1IWXA 3IJUA 1LJNA 2LHMA 1GDXA 1VEDA 2A7DA 1GAZA 5APCA 1QIOA 3AZ4A 4OWCA 4RDSA 4J1BA 1EQ4A 4OW1A 1HMKA 4D9ZA 4Z3MA 5A3EA 5KXLA 5M1YA 1XGRC 1LSBA 1CKDA 4OOTA 4ANRA 3W6DA 3P64A 4E3UA 6LYZA 1NDMC 1CNSA 1UIGA 3B0OA 2C8PA 1OUIA 1QSWA 1IWWA 4WLDA 2ZIKA 1B7MA 1GFJA 1LKRA 2MEDA 2HUBA 1LMAA 5KXYA 5KXZA 1I1ZA 4NHSA 4H94A 3W6CA 1GFVA 4LFPA 1ZVYB 2EIZC 1LHJA 4OWBA 1N4FA 5E9RA 4YF2A 1UBZA 3N9EA 1J1XY 3P66A 4NEBA 3M3UA 4NSGA 4RLMA 1JKDA 1HSXA 4YOPA 4HPIA 4DD3A 4RLNA 4ETBA 2HECA 5LVIA 4CGEA 4FDYA 1XGQC 1I56A 1B2KA 1IP5A 1LZSA 1B9OA 1C08C 1HEMA 2BQBA 1LPIA 2BQHA 1LZGA 1D0LA 2HU3A 1LZ6A 1RE2A 4WLXA 1HFZA 5L9JA 4PJ2C 4RW1A 4TX7A 2BQLA 2CDSA 3G3AB 3WPKA 1QTKA 1IP7A 4H8ZA 4LYCA 5KJ9A 1INUA 1FKVA 3LHMA 1IOSA 4DWXA 5FDJA 4NY5A 4NSIA 4WG7A 1XEIA 3D9AC 5LA5A 4N9RA 4BS7A 1VDTA 1KXXA 1LSEA 1UIEA 1WTNA 4WLYA 1OUAA 5B06A 4Z46A 1LSDA 4HV2A 1BB5A 4X3BA 3LYTA 3WUAA 4G9SA 4G4BA 2MECA
chains in the Genus database with same CATH superfamily
1QTZA 1IN7A 2CEAA 3VFDA 2RGHA 1DKJA 4IBFA 1FLQA 241LA 3UJNA 3B0KA 3DN0A 8LYZA 5BR8M 1CU6A 1G7JC 1L63A 1TDZA 4NGKA 3C3EA 4XJFA 3SB8A 1TDHA 5A3ZA 2YSSC 3UONA 1PZYA 1GF0A 5KXOA 4CJ6A 1YROA 3B0IA 1VQ1A 3SMPA 1NHEA 1C6IA 1J5EM 1HENA 2C9OA 3A93A 3J80S 233LA 3QAUA 3HUAA 1GF4A 2IGCA 4H8XA 1E8LA 3GQ4A 2R6FA 2DAKA 1L34A 1C7YA 2QSFX 5BPVA 4B3MM 3FADA 4I8OA 5FLXS 1TLAA 2JY5A 1GL7A 2HEBA 2B6YA 2DAIA 2W1YA 3HKPA 2DI0A 2GQFA 1L80A 1JHLA 261LA 5GKNA 2F4VM 1FBIX 2H5ZA 1CUKA 2KZUA 4M9ZA 1V34A 3U6DA 4LT3A 2RBRA 1L19A 1UIDA 4NOOB 2KA6B 3U60A 1XSFA 1LZ8A 1T8AA 3QWLA 155LA 3GUIA 3WXTA 5E26A 4LRTA 4R3DA 4KT0F 4NL4H 207LA 1SQ2L 3GP1A 2XSZD 1IWTA 2N5ZA 1UC0A 211LA 3KOYE 4B08A 2F5SA 1JTPL 144LA 4JI7M 4X64M 3HTFA 1JKBA 4ZPXA 3DMZA 1OFHA 2F32A 1WIVA 5B1FA 1VDPA 1CJ9A 229LA 4L16A 1FN5A 1L02A 2XTHA 3BKHA 1ZWNA 1LCNA 4YHHM 1OQMA 1GBZA 2X8AA 4LF7M 4R71A 4LT1A 149LA 4JV5M 2LNHC 3HT8A 3QY4A 1CU0A 1JPOA 5E6JA 3AOEA 1T3TA 2F2NA 1HNXM 1L16A 1OUBA 2XBSA 1RFPA 1W08A 3GPYA 1LOZA 1YAPA 4IJFA 3DN4A 4GN5C 1O23A 2B75A 1OUEA 3F92A 4N0JA 1WQOA 1L35A 1GE4A 240LA 1GBXA 4AW4A 3LVWA 1B5WA 1GE2A 1GXXA 3LZ2A 1N77A 4MR1A 1GB6A 3SB9A 1LMQA 3K8ZA 4N1EI 2RKOA 2CV1A 4MH0E 1OP9B 1L10A 3D4SA 3B9PA 1P46A 1B7SA 1L36A 1GEVA 2EO2A 2F5PA 1L38A 2Z19A 1DPWA 243LA 5KXKA 5DYGA 126LA 2HKJA 1P64A 4MM3B 4M6DA 4P17A 4K5YA 2VDBB 3HT7A 2OQ4A 5LVKA 3LZTA 1A4VA 1LMNA 2DKLA 2G5GX 3WW5A 4GCBA 4H9AA 3WU7A 3RGSA 2FBBA 2OTZX 4HV1A 4M9XA 1LYZA 1L82A 3GQ5A 3AKZA 1AZFA 1Z5BA 1SWYA 3DNAA 4LYOA 4AZFA 3WL2A 1PQDA 4IBCA 3UGJA 1IQPA 2RSCA 3HTGA 1JSFA 2BLYA 1B7OA 5EXTA 1GFKA 5HQ1A 3PVSA 3FUUA 184LA 2HEDA 5ITXA 213LA 2VQFM 2X4AA 1D0KA 4M0DA 4ARQB 1N34M 2OE4X 1UUZC 2BLXA 3J4GA 1I94M 107LA 3HHWA 3V2WA 1L87A 2M5ZA 3VW7A 4LJ4A 4HTNA 2LXEA 1LYHA 2XJWA 4AQNA 1L42A 4R7GA 1L69A 1RU3A 3LVVA 4LJ9A 3TXJA 3EO5A 1NKHA 5ILFA 1L8QA 1LKSA 1XFPL 2DQFC 3ULRA 3T6UA 1D9UA 4FJRA 4LDEA 4XENA 3CF6E 2Z8YM 3E4RA 1G0MA 2ANXA 5D5FA 1LHLA 1JR3E 1QSAA 3M6AA 244LA 3TXHA 4OWEA 1L70A 3TQSA 1QTHA 1QVRA 4LGMA 4K0KM 2OU8A 1N36M 1L66A 4I81A 1LYIA 2VB1A 2YR0A 4NC6A 3JAMS 3AFHA 1TGUA 2LH0A 3GPXA 4BB9A 1LJJA 4W96A 1LI2A 3THGA 2XBRA 1IY1A 2Y8PA 3GRRA 1L2CA 4H9FA 4I7MA 3A91A 2B5ZA 4MGKE 3GUNA 4XN6A 1R6BX 1B6IA 1OTRA 3I04M 1V92A 4ML7A 2QBYA 3J6KA 3OJPA 2F5NA 1TR8A 3HU8A 135LA 1IXSA 3UZUA 3TPZA 4JI3M 3PBLA 1OUHA 3LQQA 1UCOA 4EOFA 3LMMA 1LJ4A 2Z2FA 1OQYA 1CX7A 4AG5A 147LA 1LMTA 3GLIB 3A67Y 1HFXA 3HDFA 1VEGA 1JUGA 4II8A 1K82A 4DC4A 114LA 4QHSA 3AGIA 2VQEM 2DNAA 4CHXA 2MJ5B 1L50A 1LGUA 4TWSA 5LAGA 1GFRA 3AOEC 2DAEA 2HEEA 1R2ZA 192LA 1IR9A 1IP1A 1IX0A 3LCVB 3V2YA 1VDSA 1ZMYL 2RB2X 1F6RA 1IN8A 4I7LA 5KXPA 4PRQA 1GF5A 2CV0A 1B5ZA 4P2EA 1QT3A 1LJKA 191LA 4NWHA 3AV0A 2BQNA 1SXJD 146LA 3ZVQA 1YAMA 3I4VA 197LA 1IP6A 2BQJA 3LCUA 4PPOA 4NSHA 1TH2A 2OE7X 3TXDA 3WU8A 1JSEA 4ET9A 1GFUA 4AKHA 1OUGA 1YKYX 3C7ZA 2ZQ3A 5KKJA 1IBMM 1DKKA 1OUCA 1LLHA 4JI1M 2XZFA 3K1JA 2P5TA 5KJ9A 3GUKA 1QZMA 1BGIA 5KXXA 4IBBA 5EXXA 1QS5A 3CSZA 3OE9A 4H90A 5LYTA 5AMYA 3GLGB 4AKGA 5II3A 3KSXA 1I4WA 3A92A 2WSCF 4LJ7A 1K3XA 1VEJA 3DA1A 1C6HA 1DZBX 1L76A 2Z2EA 4UWUA 4Z41A 4L78A 196LA 1XWIA 1DI5A 5APEA 1CKFA 3WXUA 2KZSA 1UIFA 4E97A 4L15A 1XNQM 2L7HA 4B49A 1N32M 2R44A 1WQQA 4PDGA 4LDOA 4DV2M 1LPYA 1OWZA 3SARA 1C60A 2XZUA 1LZAA 1C6FA 4NXMM 1LYJA 4DR3M 2MEFA 2JWSA 3QE8A 1C6EA 3GULA 2XH9A 1L22A 1SG9A 5EP3A 5KXWA 5ILCA 1LJIA 2XFSA 2HCBA 133LA 1IWYA 1L79A 1LSGA 141LA 3A8ZA 1T97A 3CSRA 4GC9A 1GFHA 2IFFY 4HTQA 1HF4A 177LA 2LHGA 4GCEA 2QP9X 157LA 1RCMA 4NRWA 4ETDA 1P5CA 1UIBA 1IR8A 1PQJA 5ITXE 1AKIA 5FEKA 1LJHA 262LA 1C6DA 2MEAA 2BJVA 4GHLA 160LA 5DN5A 5B1GA 3GPUA 3SATA 2I25L 1QUTA 3EBAB 186LA 1IWXA 2LHMA 1GDXA 5FELA 3KFUG 3AZ4A 4RDSA 2WZJA 1HMKA 3U61B 3W6DA 4OOTA 4NRVA 1NDMC 1HQYE 2C8PA 2K47A 3C8SA 164LA 2JP7A 1B7MA 1GFJA 5KXYA 1ORYB 2L2DA 4DKLA 223LA 195LA 1IFYA 3CDTA 1KY0A 4OWBA 1L75A 2Z4RA 4RLMA 1HSXA 2DWMA 4JI4M 3C3DA 4RLNA 1ZAEA 5LVIA 4ETBA 2QENA 2XSZA 4CIZA 3UK6A 1KFVA 4B3TM 1XGQC 4QOZC 2Y21A 1QT6A 1LPIA 2D7GA 1D0LA 4GRIA 2MROB 1CV0A 1RE2A 4RF1A 3AL0C 3U6SA 200LA 1L83A 2BQLA 1IP7A 4LYCA 3A42A 3LHMA 3GLIA 1QT8A 4DWXA 1L11A 1XEIA 5LA5A 4CHTB 5B06A 1LWKA 1NJFA 2BJWA 1L2BA 5EP4A 1W5SA 3SYLA 3AZ7A 3H4JA 3HHXA 1XMQM 1C6KA 3A3RX 3B7NA 1D6QA 4F1IA 1C6PA 1XNRM 3SBJA 2MR9A 1C64A 2APLA 2CJLA 4DDAA 2R18A 4DD7A 2FNAA 3I51A 1G0KA 4LYZA 2J5YA 1DYEA 4NHTA 5LVJA 4PT5A 1L57A 4IATA 3BXWA 2LYMA 1VDQA 3DMVA 1LZ9A 4W53A 2B72A 2H5XA 3D8BA 1L62A 5LXWA 4XJDA 2L7IA 1LZEA 3TXFA 169LA 1XHBA 1G1WA 2MH8A 4F2LA 2JXNA 1L92A 2DXIA 4IASA 1G8PA 1JKAA 4XJBA 1YIKA 1C6NA 1L85A 1UIAA 2RBOA 3LZMA 1C6BA 4HJVA 1BB6A 1GJTA 3AJIB 4J0LA 3W6FA 4N5RA 4OU7A 2K0BX 1D3JA 1B0DA 1C46A 1LZCA 2N35A 3PNYA 4EPFA 3SN6R 2CRUA 5KXSA 1C6QA 4YX7C 1T43A 4NGLA 1P3NA 1HFYA 3NBXX 1DQJC 1WJ7A 1GFGA 2W82A 1ZV1A 5F16A 2O25A 1OVKA 172LA 3KS4A 4MGYE 1G07A 4B4JA 1B5XA 4PHIA 3FUTA 1WVUA 1DYBA 3HUKA 2JY6B 3HHYA 1E32A 3KOWE 2V1CA 4HEOA 1L51A 1IOTA 5I4YA 2F4AA 4NGZA 5FSTA 3JR4A 217LA 4GN3A 1WTHA 1NWGA 4DR4M 3W6AA 4WO6A 4X66M 2FBDA 2DENA 3GLHA 1EQ5A 1C6CA 1L41A 3SB5A 1GWDA 2Y20A 3RE8A 4PDIA 4KXIA 3OE8A 4WM3A 3ZEKA 1GB0A 137LA 3WHKA 1F6SA 4IBGA 1LMPA 2XLJA 219LA 1OAIA 1HT1E 5J7CA 1WHCA 151LA 4W52A 3E46A 5D5CA 2C96A 4LY6A 142LA 2K9DA 3DMXA 6LYTA 2OU0X 1HSWA 4QDNA 3CF0A 5F9XA 1CU2A 3M0EA 1LYEA 1T6VL 1GJSA 3C80A 1REYA 4WG1A 1MLCE 1L39A 2L4FA 1VG5A 2KHHA 2L78A 3U5ZA 1IY4A 1GF7A 3VK8A 3BKVA 3K92A 1L05A 3A6BY 1CKGA 3VWOA 2H1RA 150LA 3G3BB 3CT1A 4QEQA 2O79A 2MEGA 1DGGA 3HDEA 1EPYA 4NGYA 3IJVA 1KIPC 1Z5AA 1YLAA 2NQ8C 1DGFA 3W68A 5FTLA 1QUOA 3HX3A 1AT5A 3ATNA 3RNXA 4J7VA 1J1OY 5EXSA 1TDYA 3TXBA 1QSBA 1L53A 4C5FA 4XJIA 1G4AE 4ARJA 2CFOA 1CU5A 4XADA 1GXV2 156LA 1NV8A 5LYMA 1LZYA 1MX0A 1F0WA 4EKPA 131LA 5HLLA 1LSYA 3FUVA 2DQGY 4GCDA 3HBDA 3DN2A 227LA 4H9HA 1IOCA 1BWIA 2XQOA 5KXNA 4LFBM 1QYRA 1DYDA 1RJCB 4I7RA 3IECA 2UXBM 2OPFA 3UMMA 3EXDA 1L54A 3AGGG 3MK6A 4OOOA 2QCUA 1L93A 4Z6YA 159LA 4I7OA 209LA 175LA 2BQDA 1BB7A 1GB7A 3L2XA 2EA0A 1DO0A 1SXJA 3GLIE 4I7NA 1LV7A 1BVKC 1YSYA 4YXCA 1WXQA 127LA 2XFTA 3U6MA 2QBYB 1FDLY 5EQTA 1IN6A 2F5QA 1IXSB 4L6V6 1LYFA 4D80A 3ZH9B 4HJZA 2ZYPA 4NGOA 4H9BA 4S12A 153LA 4Z98A 5L3HA 1Z55A 3K3TA 2XF3A 4IIWA 3L26A 1P37A 1G7HC 5H37D 4YEOA 4LZZA 1GAYA 3AZ6A 2CV2A 3T15A 4M4OA 4L41A 1L98A 4NGVA 1B7QA 1L59A 1NHBA 4XBOA 1LJFA 1XXHE 2RRUA 1D0MA 3GRUA 3G3XA 158LA 1QT5A 3DKEX 4MGIE 132LA 3FRHA 4A3VB 1B7NA 1YE9A 4TUWA 5ITYA 2HUKA 1OV7A 1VDDA 2BQAA 2G4PA 1WQNA 3GUPA 3ZVQB 2DHRA 4WM6A 1DI4A 218LA 3GLGE 2R46A 4ETEA 2YFQA 3FKEA 4B1AA 1KW5A 1PM5A 4NFVA 178LA 4DV5M 199LA 4UWVA 1WGNA 3A34A 1JIYA 3KS8A 5IELA 2YBIA 5HMVA 254LA 1L06A 2I7PA 1L71A 1C45A 1JJ1A 4CFPA 1C68A 1GF8A 1LHKA 3F6ZA 1T6HA 2CWBA 1QT4A 2UXCM 4IJEA 2V1UA 2RBNA 3AJNA 4HP0A 5F9UA 2FOIC 5DYIA 2OOAA 1FJGM 2CWIA 2A7FA 3W3EA 4DDCA 1WR1B 1ZURA 4UWNA 238LA 1V7TA 5IZ7D 2DQDY 4A7DA 5I53A 3U6CA 1YQVY 1GHLA 4HTKA 3WUNA 2C99A 109LA 4MSTA 5L9JA 225LA 2Z38A 4X65M 3WULA 1L30A 4OVZA 3W6EA 2MEIA 4H9CA 4XGIA 1LJGA 4J1AA 3HWLA 4AG6A 1REMA 2Z12A 1OUJA 1L37A 1PJIA 2C98A 4B0DA 7CATA 3HT6A 5APFA 5EXPA 1FLUA 3TMVA 4LJ8A 1W5TA 3H4MA 1HHLA 1IVMA 4GLAA 5I4XA 4MB7A 1GD6A 1AT6A 1XMOM 3CB7A 3U6LA 3HH5A 1LYYA 2CUZA 2G4NA 1PJSA 3EMLA 5I5QA 4C3WA 2DAGA 3HT9A 1DXJA 5FCPA 2EPEA 1SSYA 4I7KA 4REZA 4NIJA 3ZCBB 3DN3A 3ODUA 1AIPC 4W56A 260LA 3J7AS 4H9EA 3VKHA 3DN8A 3U6QA 1BB4A 1DGHA 1JWRA 1OWYA 1QQWA 4I7SA 1JJ3A 1C61A 210LA 3FD9A 4R6CA 1XB2B 1B7PA 1SXJC 2BQMA 3C8RA 4FCVA 5LMNM 2DWLA 1L72A 2X0AA 4O34A 2NWDX 1GFAA 1HQCA 1LI6A 3ZC7B 4TTDA 5LA8A 3U6EA 2Q9DA 4LF4M 3QYEA 4DJHA 1LZNA 1Q3BA 1REZA 1LZRA 1QT7A 3HU9A 3Q8GA 3C83A 4FCWA 2BQEA 4L4UA 1L03A 139LA 1YKXX 3NWLA 119LA 1KSFX 2KNAA 1I6SA 1XGUC 2I7NA 2G3QA 2QPAA 3AGHA 4ET8A 4DV3M 3WPLA 4KLNA 3FRIA 3IJUA 4Q7JA 1GAZA 4Z3MA 4OW1A 5A3EA 2O7AA 1QS9A 4ANRA 4E3UA 6LYZA 4PCZA 4EXMA 1UIGA 2XGNA 3CDOA 1CTWA 3U6PA 1JR3D 1L14A 2J7OA 1LKRA 3TWLA 4NHSA 2OO9A 1V33A 2EIZC 5F3WA 1C6JA 170LA 4YF2A 3LQRA 1IM2A 1EIJA 4LF5M 1L32A 1IN5A 1K28A 4YOPA 4M9SA 220LA 103LA 4FDYA 5ITTA 1IP5A 4QNRA 3RZEA 1LZSA 1B9OA 1C08C 1HEMA 2BQBA 2BQHA 1L96A 5A2QS 2B6XA 4PJ2C 1R5LA 3G3WA 3GUOA 1G71A 3CF2A 4II7A 2HWJA 1L73A 3G3AB 2EKKA 1Q39A 1L13A 1INUA 1L49A 245LA 2FS1A 257LA 2X49A 5FDJA 1L67A 4M0WA 2VF7A 3KVWA 1PQIA 1VDTA 1LSEA 1Z5CA 3E21A 1R7RA 4Z46A 4HV2A 4X3BA 4G4BA 2Y0TA 122LA 2HL7A 2BQOA 4NHIA 4HL4A 2LCBA 4NSJA 3HTBA 2FFJA 3A46A 3SB6A 5HNLA 1LSFA 187LA 2D7EA 1LZDA 2I26L 5JENB 3LYMA 2I6ZA 2F47A 4H1PA 2J7NA 2G8LA 5KXMA 7LZMA 1LSNA 1L52A 3AOGA 1L89A 1GVNA 102LA 4FD2A 4KL7A 3PNVA 5I14A 5DN4A 2B73A 3HBEX 1GF3A 1QTDA 3CDQA 3LYZA 1LHIA 2HULA 2LZTA 1L77A 3OE6A 1ZYTA 2KRUA 4ZIXA 3L29A 1L84A 4JN6A 1LHMA 4GIPA 2DZOB 3RGPA 1L99A 3KXEC 4PRUA 1GKIA 4QGZA 1UM8A 2O01F 4BBAA 4W55A 4XYYA 3SYKA 232LA 3A3QA 5LVHA 2KRKA 1CV1A 1OFIA 4W54A 2QZ4A 3TMUA 4JI6M 3RW8A 252LA 3GLHB 4AI6A 1LZ5A 3RZ4A 1L12A 3CTWB 118LA 4WM1A 4NSOB 1QDRA 1B7LA 1WTMA 1PRBA 3SP3A 3A90A 1QDTA 2BQGA 2LVQD 1D3MA 1CJ6A 1GBSA 2H9JA 251LA 2RAZX 2Z6BA 4KODA 1P2CC 1L2DA 2R4JA 1IIZA 1IOQA 3HJQA 2FE8A 201LA 1NBZC 4EMNA 4UN2B 2HTXA 4KPMA 3C7YA 4G3OA 3GQ3A 2DQEY 3OK0A 1DI3A 2JZ1A 5KQDA 1UIHA 167LA 2G4QA 4B3SM 4OWHA 2OOBA 5LMUM 1G41A 2GV0A 2KXEA 5JI2E 1AM7A 2WARA 1DPXA 4G49A 4EIWA 3U5ZB 1XGPC 205LA 3WVYA 2EKSC 4LT2A 1G59A 5FTMA 4GCFA 2UXDM 2ERCA 3C82A 1C6MA 1KNIA 3L2AA 4Y28F 3DOAA 1D6PA 2R45A 4EKSA 1HC0A 3BOSA 1GB5A 2Z18A 1L40A 1C67A 1LWGA 4LF9M 2KEBA 4U3XB 4NWEA 2HEAA 3KW6A 1NV9A 1LZBA 4HPEA 1L31A 1QUGA 2KNZA 2V6ZM 5JI3E 3TWMA 2L09A 4JI2M 1LZ4A 4Z8XA 4DQ5A 3TMWA 1PGYA 1L56A 1Z59A 1C6LA 1L00A 3R9XB 1L60A 1GO5A 1GF6A 2EQLA 2LVAA 3DFZA 4BADA 2MEBA 2D6BA 2VF8A 2DQCY 2DQAA 2Z3XA 3NYAA 5KO3A 4GKJM 2ZILA 3AW7A 4LF6M 4ARMA 1L25A 1XEJA 1TF0B 1LW9A 3CDVA 2YVBA 4G4RA 3MGWA 2W1MA 162LA 1IN4A 1JJ0A 228LA 1HEPA 2B7XA 3C8QA 2QHOB 3D8LA 9LYZA 256LA 4BAFA 4NGWA 4AXTA 1SXJB 4WMGA 4BAPA 3P65A 4KO8A 1P7SA 1G1VA 3HH4A 1N75A 5C1BA 1VATA 3HJ8A 2BQFA 3RUNA 1XC8A 2DZNB 3L64A 181LA 2OEAX 5IWAM 4LZJA 4IJ4A 138LA 1S3SA 4CGYB 4DV4M 2MGWA 1CKCA 2BWEA 1L33A 5DM9A 1OV5A 249LA 152LA 1B5UA 2A5YB 2LHCA 3L27A 3GRYA 1GE1A 2D4IA 1GEZA 1E94E 198LA 4LCBA 1GF9A 1LYOA 1GFEA 1HT2E 3CDRA 1NBYC 1LAAA 1L0KA 111LA 2D4JA 3FTEA 2W1LA 189LA 1FLYA 1D2YA 3IG5A 1C7PA 5DNYA 4W94A 4B7GA 3PFIA 5B05A 1D2WA 1P2RA 1TBYA 4DR5M 3DN1A 4ZPUA 1IO5A 1ZMVA 1L15A 5C18A 3JR5A 1J09A 1HEWA 1T3PA 3FYCA 1GBWA 1L43A 1YILA 1HMLA 4GLVA 4B7HA 1EE8A 5LINA 2DVWB 1G0QA 194LA 3C58A 1V7SA 3NY9A 1IC5Y 1LSAA 1TAYA 1GDWA 1J7KA 2L6OA 3J2PB 3GUJA 3B7ZA 4FW9A 4DR1M 3A45A 1BHZA 3R8FA 4LZTA 5KY1A 2Y0QA 4NGJA 1HNWM 4JI5M 2O5RA 4OWAA 2CGIA 4IBJA 1EQEA 3CSQA 1LJEA 1VFBC 1DV0A 5K7OA 4H91A 4WO9A 2LVPC 1EL1A 3LW5F 1YKZX 4GCCA 1IP4A 4DD9A 1R2YA 1LTMA 3E3DA 1IORA 1LZ1A 5T3FA 2ZNWY 1DYFA 2C8OA 163LA 1G7LC 3I4YA 1IEEA 4OO9A 1CV3A 1L45A 5LAFA 2CHQA 1L20A 2BQKA 4GKKM 3VK7A 1NJGA 2D91A 222LA 1JKCA 2HHHM 3C81A 4QY9A 2AUBA 1W6ZA 4I5SA 4OVZB 4NG1A 145LA 4NG8A 1L0JA 1BWJA 1TTEA 6LZMA 3HU2A 4DV1M 1ALCA 1IR7A 5DLAA 2C9CA 4DR7M 3W0FA 4I7JA 1GB2A 1JQUA 1I20A 3CGWA 2UUCM 1C43A 3HWSA 5DL9A 1CJ8A 4GN4A 4ITQA 4GH9A 259LA 2ZTDA 3MHVC 1D3NA 2ANVA 1FLWA 2LZMA 180LA 1IC7Y 4DT3A 5B59A 1L74A 1SX7A 5KXTA 4LFXA 4G6ZA 1NMMA 4DUYM 4G4HA 2UUBM 1UACY 3DZDA 4HJYA 1LSPA 3GLFB 4YENA 4B4IA 1IBKM 2BPUA 4DQJA 1E9SA 3WU9A 4OX9M 1JR3A 2O4WA 1VAUA 1D9WA 4PD2A 1G0LA 4W57A 4LGKA 1L97A 2DZLA 1DGHB 1C63A 2FYCA 1C6AA 5IHGA 4DV6M 1KIQC 1FNNA 148LE 1IBLM 1QUHA 165LA 1NHWC 1J1PY 2YBJA 3B89A 3F9LA 4I0CA 3HZJA 3C7WA 3CT5A 237LA 4OW0A 1QUSA 4FVMA 1B5YA 1NVMA 4AGAA 3HFMY 2NTHA 4DR6M 1LZTA 3U6OA 3SBAA 1P2LA 1KYIA 2YBNA 2GNOA 3F8VA 3AYQA 3V76A 1ZV5L 3B72A 4LG2A 3EIHA 3KAMA 1LJ3A 4GRVA 2B70A 134LA 1ZMWA 1L68A 3GPPA 2Q9EA 3AZ5A 1RI8B 1NO1A 5LYZA 3HU3A 1BVXA 4XJGA 3HHZA 128LA 2YBLA 1CKHA 5ITUA 4YY3M 1OUFA 1KIRC 253LA 1E9RA 1OIPA 1L91A 2R62A 1NY6A 4LJAA 3TWKA 1GE3A 2L4EA 3FUWA 1LSCA 1P36A 2JY7A 4LFCM 1P3QQ 1G7MC 258LA 2LYZA 2XEPA 1VEDA 216LA 3MMPA 1SWZA 4J1BA 5M1YA 1XGRC 206LA 1QANA 3P64A 1R4GA 1L08A 1K3WA 4FWHA 1CNSA 3B0OA 1OUIA 1P6YA 1QSWA 4QOSA 1IWWA 2RAYX 3HJSA 1LMAA 5KXZA 4S0WA 1QTCA 3W6CA 1GFVA 4JXJA 4LFPA 1ZVYB 1DYCA 2LC9A 1WGLA 1LHJA 2YNMD 1L28A 2B3TA 3RFWA 1J1XY 3Q8XA 5FSWA 4DQ7A 4NEBA 3M3UA 2OTYX 4NSGA 4QNMA 1ZMUA 4HPIA 2OU9A 4CGEA 5KQ8A 1L04A 2Q2EB 1HJPA 5KPZA 1B2KA 1C6GA 1I56A 1LZGA 1PQMA 1JB0F 2LWXA 2HU3A 1AUAA 1HFZA 2B6WA 8CATA 4TX7A 2CDSA 1QTKA 182LA 2EKFA 4IBDA 129LA 2WSEF 1D3FA 3PXGA 1FKVA 3WHLA 130LA 1IOSA 183LA 3HH3A 4NY5A 4WG7A 4N9RA 3GLHE 1KXXA 1WTNA 4WLYA 1OUAA 4WP2A 3SMSA 1BB5A 3LYTA 3T1YM 3IG8A 171LA 2MECA 3A6CY 3A94A 4LYMA 4RW2A 4GHAA 3T38A 5IREB 3FI7A 2FH0A 4LDLA 1VEKA 4WM2A 2ZYCA 2ZAOA 3NY8A 5F81A 1QSQA 2OE9X 5HNCA 3T6PA 3J7BA 4ETAA 3OE0A 1F4IA 3HU1A 1CJ7A 3K2RA 1LHHA 2FYDA 5FTKA 4W59A 3HUQA 1PQOA 3J81S 3SASA 2R4EA 1H6UA 1YUBA 3GO8A 1JTOL 1REXA 1C6TA 4N1CC 3SBBC 2QQ8A 1L65A 2BQIA 4PGJB 1TH3A 1TCYA 3WUMA 125LA 4NHQA 1QAOA 2MEEA 1JTMA 1N33M 3W67A 1NNUC 5C6LA 3VDUA 2JNHA 1C62A 1JQJC 1IXZA 1JISA 2EJSA 1QTBA 2ZQ4A 112LA 214LA 4ETCA 168LA 3GLFA 1L95A 1Z6TA 1H6MA 4CJ2A 4I4LA 4R0FA 4DYGA 4GC5A 1ZQ9A 2ZAMA 2DQHY 2F30A 3BBZA 1BB3A 1LSMA 226LA 2QB0B 1L21A 5ITQA 5EP1A 4FWDA 2K6BA 1L58A 3WH1A 3WPJA 4RKUF 1WVVA 2HEFA 2RB1X 2RB0X 1DO2A 1OVJA 5L3IA 1H87A 154LA 1CU3A 3HGIA 1QAQA 3FTCA 1MU5A 1C65A 4RF0A 3GRVA 3ZQJA 2E5LM 4LYBA 5KKIA 3WMKA 1C10A 1IP3A 1EFUB 4LJ5A 1WQPA 2JA2A 3OTOM 4MGZE 5I54A 4IBEA 2B74A 3SAWA 4DD1A 5L8RF 193LA 1NNJA 3N9CA 1FKQA 2QARC 4G4CA 4FCTA 1F10A 215LA 1G3IA 2YBMA 1KS3A 3TXIA 5LZMA 1JTTL 5HMJA 3KSJA 3L25A 212LA 2DBTA 5C6JA 4N8ZA 2RGOA 2Z37A 110LA 1L81A 2M60A 231LA 1CVKA 2RBQA 1SXJE 4P16A 3SFZA 5FHWA 4H9IA 1L55A 1GL6A 3FE0A 4GITA 1IY3A 234LA 3WYHA 3TXKA 1Y8GA 1L01A 4LYTA 1MELL 4ARMB 1OIZA 2BQCA 2HUMA 4LZMA 1UA6Y 5KXRA 4W51A 1G06A 2IHLA 1G0JA 1JITA 4I8SA 1KW7A 1CX6A 3K9PA 4HSFA 1IC4Y 4LJ6A 1SLYA 4LRSA 2ZBKB 2YBHA 4W58A 1KXYA 1IP2A 5E4PA 3T1HM 1LI3A 1LMOA 2AHMA 3TXGA 4NHPA 1XEPA 166LA 3A98B 4NXNM 1LMCA 1CV6A 1UICA 3TE6A 2ZTCA 3FUXA 1N78A 3FTDA 248LA 3KDSE 1PJQA 4DDBA 2A4TA 2ZWBA 1WQMA 1L47A 1L1ZA 2Z39A 5LIOA 3B6LA 2DQJY 1PJTA 4AKIA 1GB3A 2CUUA 3WVXA 1OAOC 2BWBA 1XXHB 3TMXA 1NHGC 176LA 3K2LA 2D7HA 2KNVA 4QHTA 3SHFA 1HEQA 3KOXE 1LYSA 5ITRA 2UUAM 1YAOA 2PC2A 1PQKA 2DAMA 161LA 4MGHA 1C66A 1NF5A 4XK8F 1C69A 3HTDA 1NQIA 3PDSA 3P68A 1DGBA 5LVGA 1L17A 1Q02A 1HEOA 4H93A 4WLTA 4EPIA 4G4QA 5IDDA 4DR2M 2DQIY 1CV5A 4GEWA 1P56A 4KT3A 3CT0A 4DV0M 4LF8M 2LVNC 1XGTC 3W6BA 4XJHA 3LYOA 1IWZA 2WSFF 4I7TA 7LYZA 3QAKA 3N9AA 5FTJA 1L27A 246LA 113LA 4D81A 3HY5A 143LA 1HERA 4PJZA 4CFOA 1KXWA 2LYOA 4ZFPA 3EIEA 4B7FA 1KY1A 4LGYA 115LA 1L46A 5I4WA 4NGIA 2JY8A 3T36A 4W5WA 4JYAM 1A2YC 2Z7JA 5EBHA 3VLFB 1IY2A 1IWVA 1L44A 3IWRA 2NTGA 4G4OA 4ARQA 3SAVA 1TH4A 1TEWA 1OYUA 255LA 221LA 1GLNA 2DKVA 1A5TA 2DWNA 4ARLA 1YAQA 3EMSA 1L64A 1MN3A 2DWZB 2RBPA 1LGWA 3VKGA 1LYDA 2BAAA 3JR6A 4WURA 2MEHA 3AW6A 4WM4A 3VDPA 2YQZA 1GB8A 1QTEA 4DV7M 4MCKA 1YANA 3RT5X 4GMQA 2C5RA 1L1TA 3GLFE 1GB9A 3HBHA 3CQLA 1L90A 208LA 4ARPA 4DD2A 1GPQC 1WQRA 4PK0A 4X62M 1OUDA 1SX2A 1BWHA 1YL1X 4IAPA 3A95A 4WL7A 3FYDA 2DHYA 3FE3A 1BVSA 4H8YA 3KP0E 1PJJA 185LA 5B07A 2JUJA 1ZVHL 1XJUA 3M7GA 1GABA 5IT9S 3J27B 1X37A 2QNJA 3AB6A 3QNGA 1YL0X 1DYAA 5APDA 1QAMA 2CHVA 4TSCA 108LA 3I01M 173LA 2B6ZA 2R65A 4JI0M 4I7QA 2R0IA 188LA 3HH6A 2ZIJA 3NBIA 1QQYA 1C1KA 4ZEEA 4AQYM 104LA 4H92A 3B7QA 1OJLA 3K9OA 2H9KA 3A96A 2F5OA 2UU9M 3GUMA 5FTNA 3FTFA 1GBYA 4RNAA 4LFAM 1L24A 4DAJA 3E9SA 120LA 2B6TA 3G3VA 5C6IA 3L28A 3M18B 3W0LB 1T6OA 1L48A 3GXKA 3GXRA 3LN2A 4FWGA 5F14A 1XEKA 4G4NA 3SB7A 1LSZA 3ILKA 4HLQA 3FA0A 3D3DA 4IBKA 1CV4A 5DFLA 2D4KA 190LA 4YM8A 2CP8A 1GBOA 1GE0A 3MJ5A 3TXEA 1L23A 3RU5A 5EJCA 2F2QA 2VIIA 5EP2A 2RBSA 1L86A 4DD0A 2ZNXY 2JZ0A 5KPRA 3U60B 4YEMA 1GFTA 4WM5A 1G7IC 1HELA 1D2NA 4TUNA 1VDLA 2F4GA 1PS5A 3SHGB 1IWUA 1XXHA 4CISA 1HNZM 1L18A 1Q3CA 1G0PA 174LA 1BQLY 242LA 4GBRB 1L29A 2Q0MX 1LYGA 1QZEA 1B7RA 4B4EA 3SAUA 3WW6A 1IY0A 1IXRC 3GLGA 3KP1E 4WL6A 3IHPA 4YXAC 239LA 1B5VA 1HR0M 4BLCA 250LA 4LT0A 2W1XA 3ATOA 4WW0A 1HNLA 4TSBA 4WOAA 224LA 4D82A 1UFZA 1L09A 1JEFA 4EKRA 2LZ2A 3SC3A 1NDGC 1OKSA 1L88A 2ZM6M 2YDGA 2CHGA 2HU1A 3P4ZA 4L8RC 4EKQA 4NSRA 1LGXA 1LJNA 2LVOC 1G0GA 2A7DA 5APCA 5KPTA 1QIOA 4OWCA 5KXLA 1XJTA 1EQ4A 4D9ZA 1MJGM 1LSBA 1CKDA 1T8GA 236LA 4EJ4A 4I7PA 3KOZE 230LA 1OVHA 1NSFA 235LA 4WLDA 2CE7A 4B3RM 4KHPM 2ZIKA 3FI5A 2MEDA 2HUBA 1I1ZA 4JI8M 4H94A 2LBCA 3C9PA 1JTNA 1N4FA 5E9RA 1QTVA 1UBZA 3N9EA 3P66A 3DN6A 2EUCA 1JKDA 2BNKA 4DD3A 2HAKA 3B74A 2HECA 123LA 4IBIA 1L61A 1QUDA 1DYGA 2RH1A 1LZ6A 4DBGB 2ZANA 3U61A 2KDLA 1L26A 4WLXA 1SSWA 3TL4X 4RW1A 247LA 3WPKA 1CUQA 4H8ZA 3QYBA 2Z4SA 4NSIA 2LTUA 1NY5A 3D9AC 4BS7A 4DUZM 1UIEA 140LA 1CUPA 1T8FA 1L94A 1LSDA 3WUAA 4G9SA 2KW0A 1L07A
chains in the Genus database with same CATH topology
1QTZA 1DKJA 1FLQA 241LA 3B0KA 3DN0A 8LYZA 1CU6A 1G7JC 1L63A 4NGKA 4XJFA 5A3ZA 3SB8A 2YSSC 3UONA 1PZYA 1GF0A 5KXOA 1YROA 3B0IA 1NHEA 1C6IA 1HENA 3A93A 233LA 3HUAA 1GF4A 2IGCA 4H8XA 1E8LA 1L34A 3FADA 1TLAA 2HEBA 2B6YA 2W1YA 1L80A 1JHLA 261LA 1FBIX 2H5ZA 4LT3A 2RBRA 1L19A 1UIDA 1XSFA 1LZ8A 1T8AA 155LA 3GUIA 3WXTA 207LA 1SQ2L 1IWTA 2N5ZA 1UC0A 211LA 1JTPL 144LA 3HTFA 1JKBA 3DMZA 2F32A 5B1FA 1VDPA 1CJ9A 229LA 1FN5A 1L02A 2XTHA 3BKHA 1ZWNA 1LCNA 1OQMA 1GBZA 4LT1A 149LA 3HT8A 3QY4A 1CU0A 1JPOA 2F2NA 1L16A 1OUBA 2XBSA 1RFPA 1W08A 1LOZA 1YAPA 3DN4A 4GN5C 1O23A 2B75A 1OUEA 4N0JA 1WQOA 1L35A 1GE4A 240LA 1GBXA 1B5WA 1GE2A 1GXXA 3LZ2A 4MR1A 1GB6A 3SB9A 1LMQA 4N1EI 1OP9B 1L10A 3D4SA 1P46A 1B7SA 1L36A 1GEVA 1L38A 2Z19A 1DPWA 243LA 5KXKA 126LA 1P64A 4M6DA 4K5YA 3HT7A 5LVKA 3LZTA 1A4VA 1LMNA 3WW5A 4GCBA 4H9AA 3WU7A 2FBBA 2OTZX 4HV1A 1LYZA 1L82A 1AZFA 1SWYA 4LYOA 3DNAA 3WL2A 1PQDA 2RSCA 3HTGA 1JSFA 2BLYA 1B7OA 1GFKA 5HQ1A 184LA 2HEDA 213LA 1D0KA 4ARQB 2OE4X 1UUZC 2BLXA 3J4GA 107LA 3V2WA 1L87A 3VW7A 4HTNA 1LYHA 2XJWA 4AQNA 1L42A 1L69A 3TXJA 3EO5A 1NKHA 5ILFA 1LKSA 1XFPL 2DQFC 3ULRA 3T6UA 1D9UA 4FJRA 4LDEA 4XENA 1G0MA 2ANXA 5D5FA 1LHLA 1QSAA 244LA 3TXHA 4OWEA 1L70A 1QTHA 2OU8A 1L66A 1LYIA 2VB1A 1LJJA 4W96A 1LI2A 2XBRA 2Y8PA 4H9FA 4I7MA 3A91A 2B5ZA 3GUNA 4XN6A 1B6IA 4ML7A 3J6KA 3OJPA 3HU8A 135LA 3PBLA 1OUHA 1UCOA 4EOFA 1LJ4A 2Z2FA 1CX7A 147LA 1LMTA 3A67Y 1HFXA 3HDFA 1JUGA 4II8A 4DC4A 114LA 3AGIA 4CHXA 1L50A 1LGUA 4TWSA 5LAGA 1GFRA 2HEEA 192LA 1IR9A 1IP1A 1IX0A 3V2YA 1VDSA 1ZMYL 2RB2X 1F6RA 4I7LA 5KXPA 4PRQA 1GF5A 1B5ZA 4P2EA 1QT3A 1LJKA 191LA 4NWHA 2BQNA 3ZVQA 146LA 1YAMA 197LA 1IP6A 2BQJA 4PPOA 4NSHA 2OE7X 3TXDA 3WU8A 1JSEA 4ET9A 1GFUA 1YKYX 1OUGA 5KKJA 3C7ZA 2ZQ3A 1DKKA 1OUCA 1LLHA 3GUKA 1BGIA 5KXXA 5LYTA 1QS5A 3CSZA 3OE9A 4H90A 5AMYA 5II3A 3A92A 1C6HA 1DZBX 1L76A 2Z2EA 4UWUA 4Z41A 196LA 1DI5A 5APEA 1CKFA 3WXUA 1UIFA 4E97A 4B49A 1WQQA 4LDOA 1LPYA 1OWZA 1C60A 1LZAA 1C6FA 1LYJA 2MEFA 3QE8A 1C6EA 3GULA 1L22A 5KXWA 5ILCA 1LJIA 133LA 1IWYA 1L79A 1LSGA 141LA 3A8ZA 1T97A 3CSRA 1GFHA 2IFFY 4HTQA 1HF4A 177LA 4GCEA 157LA 1RCMA 4ETDA 1P5CA 1UIBA 1IR8A 1PQJA 1AKIA 5FEKA 1LJHA 262LA 1C6DA 2MEAA 5DN5A 160LA 5B1GA 2I25L 1QUTA 3EBAB 186LA 1IWXA 2LHMA 1GDXA 5FELA 3AZ4A 4RDSA 1HMKA 3W6DA 4OOTA 1NDMC 2C8PA 3C8SA 164LA 1B7MA 1GFJA 5KXYA 4DKLA 223LA 195LA 3CDTA 1KY0A 4OWBA 1L75A 4RLMA 1HSXA 4RLNA 4ETBA 5LVIA 1XGQC 1QT6A 1LPIA 1D0LA 1CV0A 1RE2A 200LA 1L83A 2BQLA 1IP7A 4LYCA 3LHMA 4DWXA 1QT8A 1L11A 1XEIA 5LA5A 5B06A 1LWKA 3AZ7A 1C6KA 3A3RX 1D6QA 1C6PA 1C64A 2CJLA 4DDAA 4DD7A 1G0KA 4LYZA 1DYEA 4NHTA 5LVJA 1L57A 4IATA 2LYMA 1VDQA 3DMVA 1LZ9A 4W53A 2B72A 1L62A 5LXWA 4XJDA 1LZEA 3TXFA 169LA 1G1WA 1L92A 4IASA 1JKAA 4XJBA 1YIKA 1C6NA 1L85A 3LZMA 1UIAA 2RBOA 1C6BA 4HJVA 1BB6A 4J0LA 3W6FA 4N5RA 1D3JA 1B0DA 1C46A 1LZCA 4EPFA 3SN6R 5KXSA 1C6QA 4YX7C 4NGLA 1P3NA 1HFYA 1DQJC 1GFGA 5F16A 1OVKA 172LA 1G07A 4B4JA 1B5XA 4PHIA 1WVUA 1DYBA 3HUKA 1L51A 1IOTA 5I4YA 2F4AA 4NGZA 5FSTA 217LA 4GN3A 1WTHA 1NWGA 3W6AA 4WO6A 2FBDA 1EQ5A 1C6CA 1L41A 3SB5A 1GWDA 4KXIA 3OE8A 4WM3A 3ZEKA 1GB0A 137LA 1F6SA 1LMPA 219LA 5J7CA 151LA 4W52A 5D5CA 142LA 3DMXA 6LYTA 2OU0X 1HSWA 4QDNA 5F9XA 1CU2A 1LYEA 1T6VL 3C80A 1REYA 4WG1A 1MLCE 1L39A 2L78A 1IY4A 1GF7A 3BKVA 3A6BY 1L05A 1CKGA 3VWOA 150LA 3G3BB 3CT1A 4QEQA 2O79A 2MEGA 3HDEA 1EPYA 4NGYA 3IJVA 1KIPC 1QUOA 1AT5A 3ATNA 3RNXA 4J7VA 1J1OY 1TDYA 3TXBA 1QSBA 1L53A 4C5FA 4XJIA 4ARJA 1CU5A 4XADA 1GXV2 156LA 5LYMA 1LZYA 1F0WA 4EKPA 131LA 5HLLA 1LSYA 2DQGY 4GCDA 3HBDA 3DN2A 227LA 4H9HA 1IOCA 1BWIA 2XQOA 5KXNA 1DYDA 4I7RA 1RJCB 3EXDA 1L54A 3AGGG 4OOOA 1L93A 159LA 4I7OA 209LA 175LA 2BQDA 1BB7A 1GB7A 3L2XA 4I7NA 1BVKC 4YXCA 127LA 1FDLY 1LYFA 4HJZA 2ZYPA 4NGOA 4H9BA 153LA 4Z98A 5L3HA 1Z55A 3K3TA 1P37A 1G7HC 4YEOA 1GAYA 3AZ6A 4M4OA 4L41A 1L98A 4NGVA 1B7QA 1L59A 1NHBA 1LJFA 3G3XA 1D0MA 158LA 1QT5A 3DKEX 132LA 1B7NA 2HUKA 1OV7A 2BQAA 2G4PA 1WQNA 3GUPA 3ZVQB 4WM6A 1DI4A 218LA 4ETEA 4B1AA 1KW5A 4NFVA 178LA 199LA 4UWVA 3A34A 1JIYA 5IELA 2YBIA 5HMVA 254LA 1L06A 1L71A 4CFPA 1C45A 1JJ1A 1C68A 1GF8A 1LHKA 3F6ZA 1T6HA 1QT4A 2RBNA 3AJNA 4HP0A 5F9UA 2CWIA 2A7FA 3W3EA 4DDCA 1ZURA 4UWNA 238LA 1V7TA 2DQDY 4A7DA 5I53A 1YQVY 3WUNA 1GHLA 4HTKA 109LA 4MSTA 5L9JA 225LA 2Z38A 3WULA 1L30A 3W6EA 2MEIA 4H9CA 1LJGA 4J1AA 3HWLA 1REMA 2Z12A 1OUJA 1L37A 4B0DA 3HT6A 5APFA 1FLUA 3TMVA 1HHLA 1IVMA 4GLAA 5I4XA 1GD6A 1AT6A 3CB7A 3HH5A 1LYYA 2G4NA 3EMLA 5I5QA 4C3WA 3HT9A 1DXJA 5FCPA 2EPEA 1SSYA 4I7KA 4NIJA 3DN3A 3ODUA 4W56A 260LA 4H9EA 3DN8A 1BB4A 1JWRA 1OWYA 4I7SA 1JJ3A 1C61A 210LA 4R6CA 1B7PA 2BQMA 3C8RA 1L72A 2X0AA 4O34A 2NWDX 1GFAA 1LI6A 4TTDA 5LA8A 2Q9DA 4DJHA 1LZNA 1REZA 1LZRA 1QT7A 3HU9A 3C83A 2BQEA 1L03A 139LA 1YKXX 1I6SA 119LA 1XGUC 3AGHA 4ET8A 3WPLA 3IJUA 1GAZA 4Z3MA 4OW1A 5A3EA 2O7AA 1QS9A 4ANRA 4E3UA 6LYZA 4EXMA 1UIGA 3CDOA 1CTWA 1L14A 1LKRA 4NHSA 2EIZC 1C6JA 170LA 4YF2A 1L32A 1K28A 4YOPA 220LA 103LA 4FDYA 1IP5A 3RZEA 1LZSA 2BQHA 1B9OA 1C08C 1HEMA 2BQBA 1L96A 2B6XA 4PJ2C 3G3WA 3GUOA 1L73A 3G3AB 1L13A 1INUA 1L49A 245LA 257LA 5FDJA 1L67A 1PQIA 1VDTA 1LSEA 4Z46A 4HV2A 4X3BA 4G4BA 122LA 2BQOA 4NHIA 2LCBA 4NSJA 3HTBA 3SB6A 5HNLA 1LSFA 187LA 1LZDA 2I26L 5JENB 3LYMA 2I6ZA 2F47A 4H1PA 5KXMA 7LZMA 1LSNA 1L52A 1L89A 102LA 4KL7A 5I14A 5DN4A 2B73A 3HBEX 1GF3A 1QTDA 3CDQA 3LYZA 1LHIA 2HULA 2LZTA 1L77A 3OE6A 1ZYTA 4ZIXA 1L84A 1LHMA 1L99A 4PRUA 4QGZA 4W55A 4XYYA 232LA 3A3QA 5LVHA 1CV1A 4W54A 3TMUA 3RW8A 252LA 3RZ4A 1LZ5A 1L12A 118LA 4WM1A 1QDRA 1B7LA 1WTMA 3SP3A 3A90A 1QDTA 2BQGA 1D3MA 1CJ6A 1GBSA 2H9JA 251LA 2RAZX 2Z6BA 1P2CC 1IIZA 1IOQA 201LA 1NBZC 4EMNA 2HTXA 4KPMA 3C7YA 2DQEY 3OK0A 1DI3A 1UIHA 167LA 2G4QA 4OWHA 2GV0A 1AM7A 2WARA 1DPXA 4G49A 1XGPC 205LA 3WVYA 2EKSC 4LT2A 4GCFA 3C82A 1C6MA 1KNIA 1D6PA 4EKSA 1HC0A 1GB5A 2Z18A 1L40A 1C67A 1LWGA 4U3XB 4NWEA 2HEAA 1LZBA 4HPEA 1L31A 1QUGA 1LZ4A 4DQ5A 3TMWA 1L56A 1C6LA 1L00A 1L60A 1GF6A 2EQLA 4BADA 2MEBA 2D6BA 2DQCY 2DQAA 3NYAA 2ZILA 3AW7A 4ARMA 1L25A 1XEJA 3CDVA 1LW9A 2YVBA 3MGWA 2W1MA 162LA 1JJ0A 228LA 1HEPA 2B7XA 3C8QA 9LYZA 256LA 4BAFA 4NGWA 4AXTA 4WMGA 4BAPA 3P65A 1P7SA 1G1VA 3HH4A 1VATA 2BQFA 3RUNA 3L64A 181LA 2OEAX 4IJ4A 138LA 1CKCA 1L33A 5DM9A 1OV5A 249LA 152LA 1B5UA 1GE1A 2D4IA 1GEZA 198LA 1GF9A 1LYOA 1GFEA 3CDRA 1NBYC 1LAAA 1L0KA 111LA 2D4JA 2W1LA 189LA 1FLYA 1D2YA 1C7PA 4W94A 5B05A 1D2WA 1P2RA 1TBYA 3DN1A 4ZPUA 1IO5A 1L15A 1HEWA 1T3PA 1L43A 1GBWA 1YILA 1HMLA 4GLVA 5LINA 1G0QA 194LA 1V7SA 3NY9A 1IC5Y 1LSAA 1TAYA 1GDWA 3GUJA 1BHZA 4LZTA 5KY1A 4NGJA 4OWAA 2CGIA 1EQEA 3CSQA 1LJEA 1VFBC 5K7OA 4H91A 4WO9A 1EL1A 1YKZX 4GCCA 1IP4A 4DD9A 1LTMA 3E3DA 1IORA 1LZ1A 5T3FA 2ZNWY 1DYFA 2C8OA 163LA 1G7LC 1IEEA 4OO9A 1CV3A 1L45A 5LAFA 1L20A 2BQKA 2D91A 222LA 1JKCA 3C81A 4QY9A 2AUBA 1W6ZA 4NG1A 145LA 4NG8A 1L0JA 1BWJA 6LZMA 1IR7A 1ALCA 5DLAA 4I7JA 1GB2A 1JQUA 1I20A 1C43A 5DL9A 1CJ8A 4GN4A 259LA 1D3NA 2ANVA 1FLWA 2LZMA 180LA 1IC7Y 4DT3A 5B59A 1L74A 1SX7A 5KXTA 4LFXA 1NMMA 4G4HA 1UACY 4HJYA 1LSPA 4YENA 4B4IA 2BPUA 4DQJA 3WU9A 2O4WA 1VAUA 1D9WA 1G0LA 4W57A 4LGKA 1L97A 1C63A 2FYCA 1C6AA 5IHGA 1QUHA 1KIQC 148LE 165LA 1J1PY 2YBJA 3F9LA 4I0CA 3C7WA 3CT5A 237LA 1QUSA 1B5YA 4AGAA 3HFMY 2NTHA 1LZTA 3SBAA 1P2LA 2YBNA 3F8VA 3AYQA 1ZV5L 3B72A 3KAMA 1LJ3A 4GRVA 2B70A 134LA 1L68A 2Q9EA 3AZ5A 1RI8B 5LYZA 1BVXA 4XJGA 128LA 2YBLA 1CKHA 1OUFA 1KIRC 253LA 1L91A 1GE3A 1LSCA 1P36A 1G7MC 258LA 2LYZA 1VEDA 216LA 1SWZA 4J1BA 5M1YA 1XGRC 206LA 3P64A 1L08A 1CNSA 3B0OA 1OUIA 1P6YA 1QSWA 1IWWA 2RAYX 1LMAA 5KXZA 4S0WA 1QTCA 3W6CA 1GFVA 4LFPA 1ZVYB 1DYCA 2LC9A 1LHJA 1L28A 1J1XY 4DQ7A 4NEBA 3M3UA 2OTYX 4NSGA 4HPIA 2OU9A 4CGEA 1L04A 1I56A 1B2KA 1C6GA 1LZGA 1PQMA 2HU3A 1HFZA 2B6WA 4TX7A 2CDSA 1QTKA 182LA 5KJ9A 129LA 1D3FA 1FKVA 130LA 1IOSA 183LA 3HH3A 4NY5A 4WG7A 4N9RA 1KXXA 1WTNA 4WLYA 1OUAA 1BB5A 3LYTA 2MECA 171LA 3A6CY 3A94A 4LYMA 4RW2A 3FI7A 4LDLA 4WM2A 2ZYCA 3NY8A 5F81A 1QSQA 2OE9X 5HNCA 4ETAA 3OE0A 1CJ7A 3K2RA 1LHHA 2FYDA 4W59A 3HUQA 1PQOA 1JTOL 1REXA 3SBBC 1C6TA 4N1CC 2BQIA 1L65A 4PGJB 1TCYA 3WUMA 125LA 4NHQA 2MEEA 1JTMA 5C6LA 1C62A 1JISA 1QTBA 2ZQ4A 112LA 214LA 4ETCA 168LA 1L95A 1H6MA 4CJ2A 4R0FA 4DYGA 2DQHY 2F30A 1BB3A 1LSMA 226LA 2QB0B 1L21A 1L58A 3WH1A 3WPJA 1WVVA 2HEFA 2RB1X 2RB0X 1OVJA 5L3IA 1H87A 154LA 1CU3A 1C65A 4LYBA 5KKIA 3WMKA 1C10A 1IP3A 1WQPA 5I54A 2B74A 4DD1A 193LA 3N9CA 1FKQA 2QARC 4G4CA 1F10A 215LA 2YBMA 1KS3A 3TXIA 5LZMA 1JTTL 5HMJA 2DBTA 212LA 5C6JA 4N8ZA 2Z37A 110LA 1L81A 231LA 1CVKA 2RBQA 5FHWA 4H9IA 1L55A 3FE0A 1IY3A 234LA 3WYHA 3TXKA 1L01A 4LYTA 1MELL 4ARMB 2BQCA 2HUMA 4LZMA 1UA6Y 5KXRA 4W51A 1G06A 2IHLA 1G0JA 1JITA 4I8SA 1KW7A 1CX6A 4HSFA 1IC4Y 1SLYA 4W58A 2YBHA 1KXYA 1IP2A 5E4PA 1LI3A 1LMOA 3TXGA 4NHPA 1XEPA 166LA 1LMCA 1CV6A 1UICA 248LA 4DDBA 2A4TA 2ZWBA 1WQMA 1L47A 2Z39A 5LIOA 3B6LA 2DQJY 1GB3A 2CUUA 3WVXA 3TMXA 176LA 1HEQA 1LYSA 1YAOA 2PC2A 1PQKA 161LA 1C66A 1NF5A 3HTDA 1C69A 1NQIA 3PDSA 3P68A 5LVGA 1L17A 1HEOA 4H93A 4WLTA 4EPIA 5IDDA 2DQIY 1CV5A 1P56A 4KT3A 3CT0A 1XGTC 3W6BA 4XJHA 3LYOA 1IWZA 4I7TA 7LYZA 3QAKA 3N9AA 1L27A 246LA 113LA 143LA 1HERA 4PJZA 4CFOA 1KXWA 2LYOA 4ZFPA 1KY1A 115LA 1L46A 5I4WA 4NGIA 3T36A 1A2YC 5EBHA 1IWVA 1L44A 3IWRA 2NTGA 4ARQA 1TEWA 1OYUA 255LA 221LA 2DKVA 4ARLA 1YAQA 3EMSA 1L64A 2RBPA 1LGWA 1LYDA 2BAAA 3JR6A 2MEHA 3AW6A 4WM4A 1GB8A 1QTEA 4MCKA 1YANA 3RT5X 1GB9A 3HBHA 3CQLA 1L90A 208LA 4ARPA 4DD2A 1GPQC 1WQRA 4PK0A 1OUDA 1SX2A 1BWHA 1YL1X 4IAPA 3A95A 4WL7A 4H8YA 185LA 5B07A 1ZVHL 1XJUA 3AB6A 3QNGA 1YL0X 1DYAA 5APDA 4TSCA 108LA 173LA 2B6ZA 4I7QA 188LA 3HH6A 2ZIJA 1QQYA 4ZEEA 104LA 4H92A 2H9KA 3A96A 3GUMA 1GBYA 1L24A 4DAJA 120LA 2B6TA 3G3VA 5C6IA 3M18B 1L48A 3GXKA 3GXRA 3LN2A 5F14A 1XEKA 3SB7A 1LSZA 3FA0A 3D3DA 1CV4A 2D4KA 190LA 4YM8A 1GE0A 1GBOA 3TXEA 1L23A 3RU5A 2F2QA 2RBSA 1L86A 4DD0A 2ZNXY 4YEMA 1GFTA 4WM5A 1G7IC 1HELA 4TUNA 2F4GA 1PS5A 1IWUA 1L18A 1G0PA 174LA 1BQLY 242LA 4GBRB 1L29A 2Q0MX 1LYGA 1B7RA 4B4EA 3WW6A 4WL6A 4YXAC 239LA 1B5VA 250LA 4LT0A 2W1XA 3ATOA 1HNLA 4TSBA 4WOAA 224LA 1L09A 1JEFA 4EKRA 2LZ2A 1NDGC 1L88A 2YDGA 2HU1A 3P4ZA 4EKQA 1LGXA 1LJNA 1G0GA 2A7DA 5APCA 1QIOA 4OWCA 5KXLA 1XJTA 1EQ4A 4D9ZA 1LSBA 1CKDA 1T8GA 236LA 4EJ4A 4I7PA 230LA 1OVHA 235LA 4WLDA 2ZIKA 3FI5A 2MEDA 2HUBA 1I1ZA 4H94A 1JTNA 1N4FA 5E9RA 1QTVA 1UBZA 3N9EA 3P66A 3DN6A 1JKDA 4DD3A 2HECA 123LA 1L61A 1QUDA 1DYGA 2RH1A 1LZ6A 4WLXA 1L26A 1SSWA 4RW1A 247LA 3WPKA 1CUQA 4H8ZA 4NSIA 3D9AC 4BS7A 1UIEA 140LA 1CUPA 1T8FA 1L94A 1LSDA 3WUAA 4G9SA 1L07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6C Y;  3A94 A;  4LYM A;  4RW2 A;  1DKJ A;  3FI7 A;  1FLQ A;  3AZ7 A;  3A3R X;  2BQO A;  3B0K A;  4NHI A;  2ZYC A;  1D6Q A;  4WM2 A;  5F81 A;  4NSJ A;  8LYZ A;  5HNC A;  1G7J C;  4ETA A;  4NGK A;  1CJ7 A;  4XJF A;  1LSF A;  1LZD A;  2CJL A;  2I26 L;  5HNL A;  5A3Z A;  1LHH A;  2FYD A;  2YSS C;  4DDA A;  1PZY A;  1GF0 A;  2I6Z A;  3LYM A;  1YRO A;  3B0I A;  4H1P A;  4DD7 A;  5KXO A;  1JTO L;  1REX A;  1NHE A;  4LYZ A;  4N1C C;  1HEN A;  1LSN A;  5KXM A;  2BQI A;  3A93 A;  4NHT A;  5LVJ A;  4PGJ B;  4IAT A;  1TCY A;  1VDQ A;  2LYM A;  1LZ9 A;  1GF4 A;  4H8X A;  4NHQ A;  3WUM A;  2MEE A;  1E8L A;  5C6L A;  4KL7 A;  5DN4 A;  3HBE X;  1GF3 A;  3LYZ A;  1JIS A;  1LHI A;  2LZT A;  5LXW A;  2ZQ4 A;  4XJD A;  4ETC A;  1LZE A;  3TXF A;  1H6M A;  4ZIX A;  2HEB A;  4CJ2 A;  1LHM A;  4R0F A;  4IAS A;  2W1Y A;  4DYG A;  1JKA A;  4XJB A;  2DQH Y;  1YIK A;  2F30 A;  4PRU A;  1BB3 A;  1UIA A;  1LSM A;  4QGZ A;  4HJV A;  4XYY A;  1BB6 A;  1JHL A;  3A3Q A;  5LVH A;  1FBI X;  4J0L A;  3W6F A;  4N5R A;  2H5Z A;  1B0D A;  1C46 A;  1LZC A;  4LT3 A;  3TMU A;  1UID A;  3RW8 A;  3RZ4 A;  1LZ5 A;  3WH1 A;  3WPJ A;  1XSF A;  1WVV A;  5KXS A;  2HEF A;  4WM1 A;  1LZ8 A;  1QDR A;  4NGL A;  1B7L A;  1WTM A;  1H87 A;  3SP3 A;  3WXT A;  3A90 A;  1QDT A;  1HFY A;  2BQG A;  207L A;  1DQJ C;  154L A;  1SQ2 L;  1CJ6 A;  1IWT A;  1GFG A;  4LYB A;  5KKI A;  1GBS A;  2N5Z A;  2H9J A;  3WMK A;  1C10 A;  1UC0 A;  5F16 A;  1IP3 A;  1P2C C;  1WQP A;  1JTP L;  1IIZ A;  1IOQ A;  4B4J A;  1B5X A;  4PHI A;  1WVU A;  5I54 A;  1NBZ C;  5L3I A;  4EMN A;  4DD1 A;  2HTX A;  4KPM A;  193L A;  1JKB A;  3N9C A;  1FKQ A;  4G4C A;  2DQE Y;  1F10 A;  3OK0 A;  1IOT A;  1DI3 A;  5I4Y A;  2F4A A;  2YBM A;  4NGZ A;  5FST A;  1UIH A;  4GN3 A;  5KKJ A;  2G4Q A;  5B1F A;  3TXI A;  1NWG A;  3W6A A;  1VDP A;  4WO6 A;  1JTT L;  1CJ9 A;  4OWH A;  5HMJ A;  2DBT A;  2FBD A;  1FN5 A;  4N8Z A;  5C6J A;  2XTH A;  1EQ5 A;  2GV0 A;  2Z37 A;  3BKH A;  1AM7 A;  4Z41 A;  1GWD A;  1LCN A;  1OQM A;  2WAR A;  1DPX A;  1GBZ A;  4G49 A;  4LT1 A;  4KXI A;  1XGP C;  3WVY A;  4WM3 A;  2EKS C;  4LT2 A;  3ZEK A;  1GB0 A;  4GCF A;  5FHW A;  3QY4 A;  4H9I A;  1F6S A;  3FE0 A;  1JPO A;  1LMP A;  1IY3 A;  1D6P A;  3WYH A;  3TXK A;  1HC0 A;  4LYT A;  1MEL L;  1GB5 A;  2F2N A;  2Z18 A;  5J7C A;  1OUB A;  2XBS A;  2BQC A;  1RFP A;  5D5C A;  4U3X B;  1UA6 Y;  1W08 A;  1LOZ A;  1YAP A;  4NWE A;  5KXR A;  4GN5 C;  2HEA A;  2IHL A;  1O23 A;  1LZB A;  1JIT A;  1OUE A;  4HPE A;  4I8S A;  6LYT A;  1HSW A;  4N0J A;  1WQO A;  4QDN A;  5F9X A;  4HSF A;  1GE4 A;  1T6V L;  1IC4 Y;  1GBX A;  1LZ4 A;  1SLY A;  3TMW A;  2YBH A;  1REY A;  1KXY A;  1B5W A;  1IP2 A;  1GE2 A;  4WG1 A;  1GXX A;  5E4P A;  1MLC E;  3LZ2 A;  4MR1 A;  1GF6 A;  2EQL A;  1GB6 A;  1LMQ A;  4BAD A;  4N1E I;  1LMO A;  1IY4 A;  1GF7 A;  3TXG A;  4NHP A;  1OP9 B;  2MEB A;  3BKV A;  1LMC A;  2D6B A;  2DQC Y;  3A6B Y;  1CKG A;  2DQA A;  1B7S A;  2ZIL A;  3VWO A;  1UIC A;  3G3B B;  3CT1 A;  3AW7 A;  4QEQ A;  1GEV A;  2MEG A;  2Z19 A;  1DPW A;  5KXK A;  4M6D A;  4DDB A;  1XEJ A;  2YVB A;  4NGY A;  3IJV A;  5LVK A;  3LZT A;  1A4V A;  2W1M A;  1KIP C;  1LMN A;  1WQM A;  2ZWB A;  3MGW A;  3WW5 A;  2Z39 A;  5LIO A;  3B6L A;  4GCB A;  4H9A A;  3WU7 A;  1JJ0 A;  2FBB A;  2DQJ Y;  1HEP A;  9LYZ A;  1GB3 A;  4HV1 A;  1AT5 A;  1LYZ A;  3WVX A;  4BAF A;  3ATN A;  1AZF A;  4NGW A;  3RNX A;  3TMX A;  4AXT A;  4LYO A;  4J7V A;  4WMG A;  1J1O Y;  3WL2 A;  4BAP A;  3P65 A;  1TDY A;  2RSC A;  3TXB A;  1JSF A;  2BLY A;  1HEQ A;  1B7O A;  1LYS A;  4XJI A;  1GFK A;  1YAO A;  4C5F A;  1VAT A;  5HQ1 A;  2PC2 A;  2BQF A;  2HED A;  4XAD A;  1GXV 2;  1NF5 A;  5LYM A;  1LZY A;  1NQI A;  1F0W A;  4IJ4 A;  3P68 A;  5LVG A;  1D0K A;  1HEO A;  4H93 A;  5HLL A;  1LSY A;  4WLT A;  2DQG Y;  4GCD A;  3HBD A;  5IDD A;  1CKC A;  1UUZ C;  2DQI Y;  2BLX A;  4H9H A;  5DM9 A;  3J4G A;  1IOC A;  1BWI A;  5KXN A;  1B5U A;  4KT3 A;  1RJC B;  3CT0 A;  3EXD A;  1GE1 A;  1XGT C;  2D4I A;  3AGG G;  3LYO A;  1GEZ A;  1IWZ A;  4HTN A;  4OOO A;  4XJH A;  3W6B A;  1GF9 A;  7LYZ A;  2XJW A;  1LYO A;  1GFE A;  3N9A A;  2BQD A;  1BB7 A;  1GB7 A;  1NBY C;  3TXJ A;  1LAA A;  2D4J A;  3EO5 A;  1NKH A;  2W1L A;  1BVK C;  1HER A;  5ILF A;  1LKS A;  1XFP L;  2DQF C;  1FLY A;  4CFO A;  1KXW A;  2LYO A;  4ZFP A;  3ULR A;  1C7P A;  3T6U A;  1D9U A;  4FJR A;  1FDL Y;  4W94 A;  4XEN A;  5B05 A;  5I4W A;  4NGI A;  3T36 A;  1TBY A;  1A2Y C;  5EBH A;  5D5F A;  1IWV A;  1LHL A;  1IO5 A;  3IWR A;  1QSA A;  4HJZ A;  3TXH A;  4OWE A;  2ZYP A;  1HEW A;  4NGO A;  1T3P A;  1GBW A;  4H9B A;  1YIL A;  1HML A;  153L A;  4Z98 A;  1TEW A;  4GLV A;  1Z55 A;  3K3T A;  5L3H A;  5LIN A;  2VB1 A;  2DKV A;  194L A;  1G7H C;  1LJJ A;  4W96 A;  4YEO A;  1V7S A;  1YAQ A;  1GAY A;  2XBR A;  3AZ6 A;  1IC5 Y;  1LSA A;  1TAY A;  3EMS A;  4M4O A;  2Y8P A;  4L41 A;  4H9F A;  1GDW A;  5FEL A;  4NGV A;  1B7Q A;  2BAA A;  3A91 A;  1BHZ A;  4LZT A;  2B5Z A;  1LJF A;  5KY1 A;  4NGJ A;  2MEH A;  4XN6 A;  3AW6 A;  4WM4 A;  1GB8 A;  1QTE A;  4OWA A;  4ML7 A;  2CGI A;  3J6K A;  4MCK A;  3OJP A;  1YAN A;  1D0M A;  3RT5 X;  1EQE A;  3CSQ A;  1LJE A;  135L A;  1VFB C;  5K7O A;  132L A;  4H91 A;  1GB9 A;  3HBH A;  4WO9 A;  1EL1 A;  1YKZ X;  1B7N A;  3CQL A;  208L A;  4GCC A;  1IP4 A;  4DD9 A;  4DD2 A;  1OUH A;  1GPQ C;  1WQR A;  1LTM A;  3E3D A;  1UCO A;  2BQA A;  1IOR A;  1LJ4 A;  1OUD A;  2Z2F A;  1LZ1 A;  4EOF A;  1BWH A;  1YL1 X;  2G4P A;  1WQN A;  5T3F A;  2ZNW Y;  2C8O A;  3ZVQ B;  4WM6 A;  1DI4 A;  1G7L C;  3A95 A;  4WL7 A;  1IEE A;  4H8Y A;  1LMT A;  3A67 Y;  1HFX A;  5B07 A;  1ZVH L;  4ETE A;  1JUG A;  5JEN B;  4II8 A;  4B1A A;  4NFV A;  5LAF A;  4DC4 A;  4UWV A;  2BQK A;  3AGI A;  3AB6 A;  3A34 A;  1JIY A;  3QNG A;  1YL0 X;  4CHX A;  2D91 A;  5APD A;  5IEL A;  2YBI A;  4TSC A;  5HMV A;  4TWS A;  1JKC A;  5LAG A;  1GFR A;  4CFP A;  1C45 A;  1JJ1 A;  2HEE A;  1GF8 A;  1LHK A;  3F6Z A;  4QY9 A;  2AUB A;  1W6Z A;  1IR9 A;  1IP1 A;  1IX0 A;  4NG1 A;  4NG8 A;  5F9U A;  3AJN A;  2ZIJ A;  4HP0 A;  1VDS A;  1ZMY L;  1QQY A;  4ZEE A;  1F6R A;  1BWJ A;  5KXP A;  2CWI A;  4PRQ A;  1GF5 A;  4H92 A;  2A7F A;  1IR7 A;  1ALC A;  1B5Z A;  4P2E A;  5DLA A;  3W3E A;  1LJK A;  2H9K A;  3A96 A;  4NWH A;  1GB2 A;  2BQN A;  3ZVQ A;  4DDC A;  1YAM A;  4UWN A;  1I20 A;  1V7T A;  1C43 A;  1IP6 A;  1CJ8 A;  2BQJ A;  2DQD Y;  5DL9 A;  4GN4 A;  1GBY A;  4A7D A;  5I53 A;  4PPO A;  4NSH A;  1FLW A;  1YQV Y;  1GHL A;  4HTK A;  5C6I A;  1IC7 Y;  3M18 B;  3WUN A;  4DT3 A;  3TXD A;  5B59 A;  5KXT A;  4LFX A;  3WU8 A;  1NMM A;  1JSE A;  4G4H A;  1UAC Y;  3GXK A;  3GXR A;  3LN2 A;  1GFU A;  4MST A;  4ET9 A;  1YKY X;  1OUG A;  1LSP A;  1XEK A;  2ZQ3 A;  2Z38 A;  2BPU A;  4HJY A;  4YEN A;  3WU9 A;  1DKK A;  4B4I A;  1LSZ A;  1VAU A;  1OUC A;  3D3D A;  2D4K A;  3WUL A;  4LGK A;  3W6E A;  1GE0 A;  1GBO A;  4H9C A;  1BGI A;  2MEI A;  4YM8 A;  5KXX A;  3TXE A;  5LYT A;  3CSZ A;  1LJG A;  4H90 A;  3RU5 A;  5AMY A;  4J1A A;  2FYC A;  5II3 A;  3A92 A;  5IHG A;  1KIQ C;  1REM A;  2Z12 A;  1OUJ A;  4DD0 A;  2ZNX Y;  1J1P Y;  2YBJ A;  4B0D A;  4YEM A;  1DZB X;  2Z2E A;  1GFT A;  4I0C A;  4UWU A;  4WM5 A;  1FLU A;  1G7I C;  1HEL A;  4TUN A;  5APF A;  3TMV A;  1HHL A;  3CT5 A;  4GLA A;  5I4X A;  1IVM A;  1GD6 A;  2F4G A;  1DI5 A;  1AT6 A;  1QUS A;  1PS5 A;  3CB7 A;  5APE A;  1LYY A;  1B5Y A;  1IWU A;  2G4N A;  5I5Q A;  1CKF A;  4AGA A;  3WXU A;  4C3W A;  3HFM Y;  1UIF A;  1LZT A;  1DXJ A;  1BQL Y;  5FCP A;  2EPE A;  5F14 A;  4B49 A;  2YBN A;  4NIJ A;  2Q0M X;  1WQQ A;  3AYQ A;  1ZV5 L;  3B72 A;  1B7R A;  4B4E A;  3WW6 A;  3KAM A;  1LJ3 A;  4H9E A;  134L A;  1BB4 A;  1JWR A;  3AZ5 A;  1LZA A;  4WL6 A;  1RI8 B;  1JJ3 A;  5LYZ A;  4R6C A;  1B7P A;  1B5V A;  2MEF A;  2BQM A;  3QE8 A;  1BVX A;  4LT0 A;  4XJG A;  2W1X A;  2X0A A;  4O34 A;  2NWD X;  1GFA A;  5KXW A;  3ATO A;  5ILC A;  1LJI A;  2YBL A;  1HNL A;  4TSB A;  4TTD A;  4WOA A;  5LA8 A;  1CKH A;  133L A;  1IWY A;  1LSG A;  1LZN A;  1KIR C;  1OUF A;  1JEF A;  3A8Z A;  1REZ A;  3CSR A;  1LZR A;  1GFH A;  2IFF Y;  4HTQ A;  1HF4 A;  2BQE A;  2LZ2 A;  1GE3 A;  4GCE A;  1NDG C;  1YKX X;  1RCM A;  4ETD A;  2YDG A;  1LSC A;  1UIB A;  1IR8 A;  1XGU C;  1AKI A;  5FEK A;  2HU1 A;  3AGH A;  1LJH A;  3P4Z A;  2MEA A;  5DN5 A;  1G7M C;  4ET8 A;  5B1G A;  2I25 L;  1QUT A;  2LYZ A;  3EBA B;  3WPL A;  1IWX A;  3IJU A;  1LJN A;  2LHM A;  1GDX A;  1VED A;  2A7D A;  1GAZ A;  5APC A;  1QIO A;  3AZ4 A;  4OWC A;  4RDS A;  4J1B A;  1EQ4 A;  4OW1 A;  1HMK A;  4D9Z A;  4Z3M A;  5A3E A;  5KXL A;  5M1Y A;  1XGR C;  1LSB A;  1CKD A;  4OOT A;  4ANR A;  3W6D A;  3P64 A;  4E3U A;  6LYZ A;  1NDM C;  1CNS A;  1UIG A;  3B0O A;  2C8P A;  1OUI A;  1QSW A;  1IWW A;  4WLD A;  2ZIK A;  1B7M A;  1GFJ A;  1LKR A;  2MED A;  2HUB A;  1LMA A;  5KXY A;  5KXZ A;  1I1Z A;  4NHS A;  4H94 A;  3W6C A;  1GFV A;  4LFP A;  1ZVY B;  2EIZ C;  1LHJ A;  4OWB A;  1N4F A;  5E9R A;  4YF2 A;  1UBZ A;  3N9E A;  1J1X Y;  3P66 A;  4NEB A;  3M3U A;  4NSG A;  4RLM A;  1JKD A;  1HSX A;  4YOP A;  4HPI A;  4DD3 A;  4RLN A;  4ETB A;  2HEC A;  5LVI A;  4CGE A;  4FDY A;  1XGQ C;  1I56 A;  1B2K A;  1IP5 A;  1LZS A;  1B9O A;  1C08 C;  1HEM A;  2BQB A;  1LPI A;  2BQH A;  1LZG A;  1D0L A;  2HU3 A;  1LZ6 A;  1RE2 A;  4WLX A;  1HFZ A;  5L9J A;  4PJ2 C;  4RW1 A;  4TX7 A;  2BQL A;  2CDS A;  3G3A B;  3WPK A;  1QTK A;  1IP7 A;  4H8Z A;  4LYC A;  5KJ9 A;  1INU A;  1FKV A;  3LHM A;  1IOS A;  4DWX A;  5FDJ A;  4NY5 A;  4NSI A;  4WG7 A;  1XEI A;  3D9A C;  5LA5 A;  4N9R A;  4BS7 A;  1VDT A;  1KXX A;  1LSE A;  1UIE A;  1WTN A;  4WLY A;  1OUA A;  5B06 A;  4Z46 A;  1LSD A;  4HV2 A;  1BB5 A;  4X3B A;  3LYT A;  3WUA A;  4G9S A;  4G4B A;  2MEC A; 
#chains in the Genus database with same CATH topology
 1QTZ A;  1IN7 A;  2CEA A;  3VFD A;  2RGH A;  1DKJ A;  4IBF A;  1FLQ A;  241L A;  3UJN A;  3B0K A;  3DN0 A;  8LYZ A;  5BR8 M;  1CU6 A;  1G7J C;  1L63 A;  1TDZ A;  4NGK A;  3C3E A;  4XJF A;  3SB8 A;  1TDH A;  5A3Z A;  2YSS C;  3UON A;  1PZY A;  1GF0 A;  5KXO A;  4CJ6 A;  1YRO A;  3B0I A;  1VQ1 A;  3SMP A;  1NHE A;  1C6I A;  1J5E M;  1HEN A;  2C9O A;  3A93 A;  3J80 S;  233L A;  3QAU A;  3HUA A;  1GF4 A;  2IGC A;  4H8X A;  1E8L A;  3GQ4 A;  2R6F A;  2DAK A;  1L34 A;  1C7Y A;  2QSF X;  5BPV A;  4B3M M;  3FAD A;  4I8O A;  5FLX S;  1TLA A;  2JY5 A;  1GL7 A;  2HEB A;  2B6Y A;  2DAI A;  2W1Y A;  3HKP A;  2DI0 A;  2GQF A;  1L80 A;  1JHL A;  261L A;  5GKN A;  2F4V M;  1FBI X;  2H5Z A;  1CUK A;  2KZU A;  4M9Z A;  1V34 A;  3U6D A;  4LT3 A;  2RBR A;  1L19 A;  1UID A;  4NOO B;  2KA6 B;  3U60 A;  1XSF A;  1LZ8 A;  1T8A A;  3QWL A;  155L A;  3GUI A;  3WXT A;  5E26 A;  4LRT A;  4R3D A;  4KT0 F;  4NL4 H;  207L A;  1SQ2 L;  3GP1 A;  2XSZ D;  1IWT A;  2N5Z A;  1UC0 A;  211L A;  3KOY E;  4B08 A;  2F5S A;  1JTP L;  144L A;  4JI7 M;  4X64 M;  3HTF A;  1JKB A;  4ZPX A;  3DMZ A;  1OFH A;  2F32 A;  1WIV A;  5B1F A;  1VDP A;  1CJ9 A;  229L A;  4L16 A;  1FN5 A;  1L02 A;  2XTH A;  3BKH A;  1ZWN A;  1LCN A;  4YHH M;  1OQM A;  1GBZ A;  2X8A A;  4LF7 M;  4R71 A;  4LT1 A;  149L A;  4JV5 M;  2LNH C;  3HT8 A;  3QY4 A;  1CU0 A;  1JPO A;  5E6J A;  3AOE A;  1T3T A;  2F2N A;  1HNX M;  1L16 A;  1OUB A;  2XBS A;  1RFP A;  1W08 A;  3GPY A;  1LOZ A;  1YAP A;  4IJF A;  3DN4 A;  4GN5 C;  1O23 A;  2B75 A;  1OUE A;  3F92 A;  4N0J A;  1WQO A;  1L35 A;  1GE4 A;  240L A;  1GBX A;  4AW4 A;  3LVW A;  1B5W A;  1GE2 A;  1GXX A;  3LZ2 A;  1N77 A;  4MR1 A;  1GB6 A;  3SB9 A;  1LMQ A;  3K8Z A;  4N1E I;  2RKO A;  2CV1 A;  4MH0 E;  1OP9 B;  1L10 A;  3D4S A;  3B9P A;  1P46 A;  1B7S A;  1L36 A;  1GEV A;  2EO2 A;  2F5P A;  1L38 A;  2Z19 A;  1DPW A;  243L A;  5KXK A;  5DYG A;  126L A;  2HKJ A;  1P64 A;  4MM3 B;  4M6D A;  4P17 A;  4K5Y A;  2VDB B;  3HT7 A;  2OQ4 A;  5LVK A;  3LZT A;  1A4V A;  1LMN A;  2DKL A;  2G5G X;  3WW5 A;  4GCB A;  4H9A A;  3WU7 A;  3RGS A;  2FBB A;  2OTZ X;  4HV1 A;  4M9X A;  1LYZ A;  1L82 A;  3GQ5 A;  3AKZ A;  1AZF A;  1Z5B A;  1SWY A;  3DNA A;  4LYO A;  4AZF A;  3WL2 A;  1PQD A;  4IBC A;  3UGJ A;  1IQP A;  2RSC A;  3HTG A;  1JSF A;  2BLY A;  1B7O A;  5EXT A;  1GFK A;  5HQ1 A;  3PVS A;  3FUU A;  184L A;  2HED A;  5ITX A;  213L A;  2VQF M;  2X4A A;  1D0K A;  4M0D A;  4ARQ B;  1N34 M;  2OE4 X;  1UUZ C;  2BLX A;  3J4G A;  1I94 M;  107L A;  3HHW A;  3V2W A;  1L87 A;  2M5Z A;  3VW7 A;  4LJ4 A;  4HTN A;  2LXE A;  1LYH A;  2XJW A;  4AQN A;  1L42 A;  4R7G A;  1L69 A;  1RU3 A;  3LVV A;  4LJ9 A;  3TXJ A;  3EO5 A;  1NKH A;  5ILF A;  1L8Q A;  1LKS A;  1XFP L;  2DQF C;  3ULR A;  3T6U A;  1D9U A;  4FJR A;  4LDE A;  4XEN A;  3CF6 E;  2Z8Y M;  3E4R A;  1G0M A;  2ANX A;  5D5F A;  1LHL A;  1JR3 E;  1QSA A;  3M6A A;  244L A;  3TXH A;  4OWE A;  1L70 A;  3TQS A;  1QTH A;  1QVR A;  4LGM A;  4K0K M;  2OU8 A;  1N36 M;  1L66 A;  4I81 A;  1LYI A;  2VB1 A;  2YR0 A;  4NC6 A;  3JAM S;  3AFH A;  1TGU A;  2LH0 A;  3GPX A;  4BB9 A;  1LJJ A;  4W96 A;  1LI2 A;  3THG A;  2XBR A;  1IY1 A;  2Y8P A;  3GRR A;  1L2C A;  4H9F A;  4I7M A;  3A91 A;  2B5Z A;  4MGK E;  3GUN A;  4XN6 A;  1R6B X;  1B6I A;  1OTR A;  3I04 M;  1V92 A;  4ML7 A;  2QBY A;  3J6K A;  3OJP A;  2F5N A;  1TR8 A;  3HU8 A;  135L A;  1IXS A;  3UZU A;  3TPZ A;  4JI3 M;  3PBL A;  1OUH A;  3LQQ A;  1UCO A;  4EOF A;  3LMM A;  1LJ4 A;  2Z2F A;  1OQY A;  1CX7 A;  4AG5 A;  147L A;  1LMT A;  3GLI B;  3A67 Y;  1HFX A;  3HDF A;  1VEG A;  1JUG A;  4II8 A;  1K82 A;  4DC4 A;  114L A;  4QHS A;  3AGI A;  2VQE M;  2DNA A;  4CHX A;  2MJ5 B;  1L50 A;  1LGU A;  4TWS A;  5LAG A;  1GFR A;  3AOE C;  2DAE A;  2HEE A;  1R2Z A;  192L A;  1IR9 A;  1IP1 A;  1IX0 A;  3LCV B;  3V2Y A;  1VDS A;  1ZMY L;  2RB2 X;  1F6R A;  1IN8 A;  4I7L A;  5KXP A;  4PRQ A;  1GF5 A;  2CV0 A;  1B5Z A;  4P2E A;  1QT3 A;  1LJK A;  191L A;  4NWH A;  3AV0 A;  2BQN A;  1SXJ D;  146L A;  3ZVQ A;  1YAM A;  3I4V A;  197L A;  1IP6 A;  2BQJ A;  3LCU A;  4PPO A;  4NSH A;  1TH2 A;  2OE7 X;  3TXD A;  3WU8 A;  1JSE A;  4ET9 A;  1GFU A;  4AKH A;  1OUG A;  1YKY X;  3C7Z A;  2ZQ3 A;  5KKJ A;  1IBM M;  1DKK A;  1OUC A;  1LLH A;  4JI1 M;  2XZF A;  3K1J A;  2P5T A;  5KJ9 A;  3GUK A;  1QZM A;  1BGI A;  5KXX A;  4IBB A;  5EXX A;  1QS5 A;  3CSZ A;  3OE9 A;  4H90 A;  5LYT A;  5AMY A;  3GLG B;  4AKG A;  5II3 A;  3KSX A;  1I4W A;  3A92 A;  2WSC F;  4LJ7 A;  1K3X A;  1VEJ A;  3DA1 A;  1C6H A;  1DZB X;  1L76 A;  2Z2E A;  4UWU A;  4Z41 A;  4L78 A;  196L A;  1XWI A;  1DI5 A;  5APE A;  1CKF A;  3WXU A;  2KZS A;  1UIF A;  4E97 A;  4L15 A;  1XNQ M;  2L7H A;  4B49 A;  1N32 M;  2R44 A;  1WQQ A;  4PDG A;  4LDO A;  4DV2 M;  1LPY A;  1OWZ A;  3SAR A;  1C60 A;  2XZU A;  1LZA A;  1C6F A;  4NXM M;  1LYJ A;  4DR3 M;  2MEF A;  2JWS A;  3QE8 A;  1C6E A;  3GUL A;  2XH9 A;  1L22 A;  1SG9 A;  5EP3 A;  5KXW A;  5ILC A;  1LJI A;  2XFS A;  2HCB A;  133L A;  1IWY A;  1L79 A;  1LSG A;  141L A;  3A8Z A;  1T97 A;  3CSR A;  4GC9 A;  1GFH A;  2IFF Y;  4HTQ A;  1HF4 A;  177L A;  2LHG A;  4GCE A;  2QP9 X;  157L A;  1RCM A;  4NRW A;  4ETD A;  1P5C A;  1UIB A;  1IR8 A;  1PQJ A;  5ITX E;  1AKI A;  5FEK A;  1LJH A;  262L A;  1C6D A;  2MEA A;  2BJV A;  4GHL A;  160L A;  5DN5 A;  5B1G A;  3GPU A;  3SAT A;  2I25 L;  1QUT A;  3EBA B;  186L A;  1IWX A;  2LHM A;  1GDX A;  5FEL A;  3KFU G;  3AZ4 A;  4RDS A;  2WZJ A;  1HMK A;  3U61 B;  3W6D A;  4OOT A;  4NRV A;  1NDM C;  1HQY E;  2C8P A;  2K47 A;  3C8S A;  164L A;  2JP7 A;  1B7M A;  1GFJ A;  5KXY A;  1ORY B;  2L2D A;  4DKL A;  223L A;  195L A;  1IFY A;  3CDT A;  1KY0 A;  4OWB A;  1L75 A;  2Z4R A;  4RLM A;  1HSX A;  2DWM A;  4JI4 M;  3C3D A;  4RLN A;  1ZAE A;  5LVI A;  4ETB A;  2QEN A;  2XSZ A;  4CIZ A;  3UK6 A;  1KFV A;  4B3T M;  1XGQ C;  4QOZ C;  2Y21 A;  1QT6 A;  1LPI A;  2D7G A;  1D0L A;  4GRI A;  2MRO B;  1CV0 A;  1RE2 A;  4RF1 A;  3AL0 C;  3U6S A;  200L A;  1L83 A;  2BQL A;  1IP7 A;  4LYC A;  3A42 A;  3LHM A;  3GLI A;  1QT8 A;  4DWX A;  1L11 A;  1XEI A;  5LA5 A;  4CHT B;  5B06 A;  1LWK A;  1NJF A;  2BJW A;  1L2B A;  5EP4 A;  1W5S A;  3SYL A;  3AZ7 A;  3H4J A;  3HHX A;  1XMQ M;  1C6K A;  3A3R X;  3B7N A;  1D6Q A;  4F1I A;  1C6P A;  1XNR M;  3SBJ A;  2MR9 A;  1C64 A;  2APL A;  2CJL A;  4DDA A;  2R18 A;  4DD7 A;  2FNA A;  3I51 A;  1G0K A;  4LYZ A;  2J5Y A;  1DYE A;  4NHT A;  5LVJ A;  4PT5 A;  1L57 A;  4IAT A;  3BXW A;  2LYM A;  1VDQ A;  3DMV A;  1LZ9 A;  4W53 A;  2B72 A;  2H5X A;  3D8B A;  1L62 A;  5LXW A;  4XJD A;  2L7I A;  1LZE A;  3TXF A;  169L A;  1XHB A;  1G1W A;  2MH8 A;  4F2L A;  2JXN A;  1L92 A;  2DXI A;  4IAS A;  1G8P A;  1JKA A;  4XJB A;  1YIK A;  1C6N A;  1L85 A;  1UIA A;  2RBO A;  3LZM A;  1C6B A;  4HJV A;  1BB6 A;  1GJT A;  3AJI B;  4J0L A;  3W6F A;  4N5R A;  4OU7 A;  2K0B X;  1D3J A;  1B0D A;  1C46 A;  1LZC A;  2N35 A;  3PNY A;  4EPF A;  3SN6 R;  2CRU A;  5KXS A;  1C6Q A;  4YX7 C;  1T43 A;  4NGL A;  1P3N A;  1HFY A;  3NBX X;  1DQJ C;  1WJ7 A;  1GFG A;  2W82 A;  1ZV1 A;  5F16 A;  2O25 A;  1OVK A;  172L A;  3KS4 A;  4MGY E;  1G07 A;  4B4J A;  1B5X A;  4PHI A;  3FUT A;  1WVU A;  1DYB A;  3HUK A;  2JY6 B;  3HHY A;  1E32 A;  3KOW E;  2V1C A;  4HEO A;  1L51 A;  1IOT A;  5I4Y A;  2F4A A;  4NGZ A;  5FST A;  3JR4 A;  217L A;  4GN3 A;  1WTH A;  1NWG A;  4DR4 M;  3W6A A;  4WO6 A;  4X66 M;  2FBD A;  2DEN A;  3GLH A;  1EQ5 A;  1C6C A;  1L41 A;  3SB5 A;  1GWD A;  2Y20 A;  3RE8 A;  4PDI A;  4KXI A;  3OE8 A;  4WM3 A;  3ZEK A;  1GB0 A;  137L A;  3WHK A;  1F6S A;  4IBG A;  1LMP A;  2XLJ A;  219L A;  1OAI A;  1HT1 E;  5J7C A;  1WHC A;  151L A;  4W52 A;  3E46 A;  5D5C A;  2C96 A;  4LY6 A;  142L A;  2K9D A;  3DMX A;  6LYT A;  2OU0 X;  1HSW A;  4QDN A;  3CF0 A;  5F9X A;  1CU2 A;  3M0E A;  1LYE A;  1T6V L;  1GJS A;  3C80 A;  1REY A;  4WG1 A;  1MLC E;  1L39 A;  2L4F A;  1VG5 A;  2KHH A;  2L78 A;  3U5Z A;  1IY4 A;  1GF7 A;  3VK8 A;  3BKV A;  3K92 A;  1L05 A;  3A6B Y;  1CKG A;  3VWO A;  2H1R A;  150L A;  3G3B B;  3CT1 A;  4QEQ A;  2O79 A;  2MEG A;  1DGG A;  3HDE A;  1EPY A;  4NGY A;  3IJV A;  1KIP C;  1Z5A A;  1YLA A;  2NQ8 C;  1DGF A;  3W68 A;  5FTL A;  1QUO A;  3HX3 A;  1AT5 A;  3ATN A;  3RNX A;  4J7V A;  1J1O Y;  5EXS A;  1TDY A;  3TXB A;  1QSB A;  1L53 A;  4C5F A;  4XJI A;  1G4A E;  4ARJ A;  2CFO A;  1CU5 A;  4XAD A;  1GXV 2;  156L A;  1NV8 A;  5LYM A;  1LZY A;  1MX0 A;  1F0W A;  4EKP A;  131L A;  5HLL A;  1LSY A;  3FUV A;  2DQG Y;  4GCD A;  3HBD A;  3DN2 A;  227L A;  4H9H A;  1IOC A;  1BWI A;  2XQO A;  5KXN A;  4LFB M;  1QYR A;  1DYD A;  1RJC B;  4I7R A;  3IEC A;  2UXB M;  2OPF A;  3UMM A;  3EXD A;  1L54 A;  3AGG G;  3MK6 A;  4OOO A;  2QCU A;  1L93 A;  4Z6Y A;  159L A;  4I7O A;  209L A;  175L A;  2BQD A;  1BB7 A;  1GB7 A;  3L2X A;  2EA0 A;  1DO0 A;  1SXJ A;  3GLI E;  4I7N A;  1LV7 A;  1BVK C;  1YSY A;  4YXC A;  1WXQ A;  127L A;  2XFT A;  3U6M A;  2QBY B;  1FDL Y;  5EQT A;  1IN6 A;  2F5Q A;  1IXS B;  4L6V 6;  1LYF A;  4D80 A;  3ZH9 B;  4HJZ A;  2ZYP A;  4NGO A;  4H9B A;  4S12 A;  153L A;  4Z98 A;  5L3H A;  1Z55 A;  3K3T A;  2XF3 A;  4IIW A;  3L26 A;  1P37 A;  1G7H C;  5H37 D;  4YEO A;  4LZZ A;  1GAY A;  3AZ6 A;  2CV2 A;  3T15 A;  4M4O A;  4L41 A;  1L98 A;  4NGV A;  1B7Q A;  1L59 A;  1NHB A;  4XBO A;  1LJF A;  1XXH E;  2RRU A;  1D0M A;  3GRU A;  3G3X A;  158L A;  1QT5 A;  3DKE X;  4MGI E;  132L A;  3FRH A;  4A3V B;  1B7N A;  1YE9 A;  4TUW A;  5ITY A;  2HUK A;  1OV7 A;  1VDD A;  2BQA A;  2G4P A;  1WQN A;  3GUP A;  3ZVQ B;  2DHR A;  4WM6 A;  1DI4 A;  218L A;  3GLG E;  2R46 A;  4ETE A;  2YFQ A;  3FKE A;  4B1A A;  1KW5 A;  1PM5 A;  4NFV A;  178L A;  4DV5 M;  199L A;  4UWV A;  1WGN A;  3A34 A;  1JIY A;  3KS8 A;  5IEL A;  2YBI A;  5HMV A;  254L A;  1L06 A;  2I7P A;  1L71 A;  1C45 A;  1JJ1 A;  4CFP A;  1C68 A;  1GF8 A;  1LHK A;  3F6Z A;  1T6H A;  2CWB A;  1QT4 A;  2UXC M;  4IJE A;  2V1U A;  2RBN A;  3AJN A;  4HP0 A;  5F9U A;  2FOI C;  5DYI A;  2OOA A;  1FJG M;  2CWI A;  2A7F A;  3W3E A;  4DDC A;  1WR1 B;  1ZUR A;  4UWN A;  238L A;  1V7T A;  5IZ7 D;  2DQD Y;  4A7D A;  5I53 A;  3U6C A;  1YQV Y;  1GHL A;  4HTK A;  3WUN A;  2C99 A;  109L A;  4MST A;  5L9J A;  225L A;  2Z38 A;  4X65 M;  3WUL A;  1L30 A;  4OVZ A;  3W6E A;  2MEI A;  4H9C A;  4XGI A;  1LJG A;  4J1A A;  3HWL A;  4AG6 A;  1REM A;  2Z12 A;  1OUJ A;  1L37 A;  1PJI A;  2C98 A;  4B0D A;  7CAT A;  3HT6 A;  5APF A;  5EXP A;  1FLU A;  3TMV A;  4LJ8 A;  1W5T A;  3H4M A;  1HHL A;  1IVM A;  4GLA A;  5I4X A;  4MB7 A;  1GD6 A;  1AT6 A;  1XMO M;  3CB7 A;  3U6L A;  3HH5 A;  1LYY A;  2CUZ A;  2G4N A;  1PJS A;  3EML A;  5I5Q A;  4C3W A;  2DAG A;  3HT9 A;  1DXJ A;  5FCP A;  2EPE A;  1SSY A;  4I7K A;  4REZ A;  4NIJ A;  3ZCB B;  3DN3 A;  3ODU A;  1AIP C;  4W56 A;  260L A;  3J7A S;  4H9E A;  3VKH A;  3DN8 A;  3U6Q A;  1BB4 A;  1DGH A;  1JWR A;  1OWY A;  1QQW A;  4I7S A;  1JJ3 A;  1C61 A;  210L A;  3FD9 A;  4R6C A;  1XB2 B;  1B7P A;  1SXJ C;  2BQM A;  3C8R A;  4FCV A;  5LMN M;  2DWL A;  1L72 A;  2X0A A;  4O34 A;  2NWD X;  1GFA A;  1HQC A;  1LI6 A;  3ZC7 B;  4TTD A;  5LA8 A;  3U6E A;  2Q9D A;  4LF4 M;  3QYE A;  4DJH A;  1LZN A;  1Q3B A;  1REZ A;  1LZR A;  1QT7 A;  3HU9 A;  3Q8G A;  3C83 A;  4FCW A;  2BQE A;  4L4U A;  1L03 A;  139L A;  1YKX X;  3NWL A;  119L A;  1KSF X;  2KNA A;  1I6S A;  1XGU C;  2I7N A;  2G3Q A;  2QPA A;  3AGH A;  4ET8 A;  4DV3 M;  3WPL A;  4KLN A;  3FRI A;  3IJU A;  4Q7J A;  1GAZ A;  4Z3M A;  4OW1 A;  5A3E A;  2O7A A;  1QS9 A;  4ANR A;  4E3U A;  6LYZ A;  4PCZ A;  4EXM A;  1UIG A;  2XGN A;  3CDO A;  1CTW A;  3U6P A;  1JR3 D;  1L14 A;  2J7O A;  1LKR A;  3TWL A;  4NHS A;  2OO9 A;  1V33 A;  2EIZ C;  5F3W A;  1C6J A;  170L A;  4YF2 A;  3LQR A;  1IM2 A;  1EIJ A;  4LF5 M;  1L32 A;  1IN5 A;  1K28 A;  4YOP A;  4M9S A;  220L A;  103L A;  4FDY A;  5ITT A;  1IP5 A;  4QNR A;  3RZE A;  1LZS A;  1B9O A;  1C08 C;  1HEM A;  2BQB A;  2BQH A;  1L96 A;  5A2Q S;  2B6X A;  4PJ2 C;  1R5L A;  3G3W A;  3GUO A;  1G71 A;  3CF2 A;  4II7 A;  2HWJ A;  1L73 A;  3G3A B;  2EKK A;  1Q39 A;  1L13 A;  1INU A;  1L49 A;  245L A;  2FS1 A;  257L A;  2X49 A;  5FDJ A;  1L67 A;  4M0W A;  2VF7 A;  3KVW A;  1PQI A;  1VDT A;  1LSE A;  1Z5C A;  3E21 A;  1R7R A;  4Z46 A;  4HV2 A;  4X3B A;  4G4B A;  2Y0T A;  122L A;  2HL7 A;  2BQO A;  4NHI A;  4HL4 A;  2LCB A;  4NSJ A;  3HTB A;  2FFJ A;  3A46 A;  3SB6 A;  5HNL A;  1LSF A;  187L A;  2D7E A;  1LZD A;  2I26 L;  5JEN B;  3LYM A;  2I6Z A;  2F47 A;  4H1P A;  2J7N A;  2G8L A;  5KXM A;  7LZM A;  1LSN A;  1L52 A;  3AOG A;  1L89 A;  1GVN A;  102L A;  4FD2 A;  4KL7 A;  3PNV A;  5I14 A;  5DN4 A;  2B73 A;  3HBE X;  1GF3 A;  1QTD A;  3CDQ A;  3LYZ A;  1LHI A;  2HUL A;  2LZT A;  1L77 A;  3OE6 A;  1ZYT A;  2KRU A;  4ZIX A;  3L29 A;  1L84 A;  4JN6 A;  1LHM A;  4GIP A;  2DZO B;  3RGP A;  1L99 A;  3KXE C;  4PRU A;  1GKI A;  4QGZ A;  1UM8 A;  2O01 F;  4BBA A;  4W55 A;  4XYY A;  3SYK A;  232L A;  3A3Q A;  5LVH A;  2KRK A;  1CV1 A;  1OFI A;  4W54 A;  2QZ4 A;  3TMU A;  4JI6 M;  3RW8 A;  252L A;  3GLH B;  4AI6 A;  1LZ5 A;  3RZ4 A;  1L12 A;  3CTW B;  118L A;  4WM1 A;  4NSO B;  1QDR A;  1B7L A;  1WTM A;  1PRB A;  3SP3 A;  3A90 A;  1QDT A;  2BQG A;  2LVQ D;  1D3M A;  1CJ6 A;  1GBS A;  2H9J A;  251L A;  2RAZ X;  2Z6B A;  4KOD A;  1P2C C;  1L2D A;  2R4J A;  1IIZ A;  1IOQ A;  3HJQ A;  2FE8 A;  201L A;  1NBZ C;  4EMN A;  4UN2 B;  2HTX A;  4KPM A;  3C7Y A;  4G3O A;  3GQ3 A;  2DQE Y;  3OK0 A;  1DI3 A;  2JZ1 A;  5KQD A;  1UIH A;  167L A;  2G4Q A;  4B3S M;  4OWH A;  2OOB A;  5LMU M;  1G41 A;  2GV0 A;  2KXE A;  5JI2 E;  1AM7 A;  2WAR A;  1DPX A;  4G49 A;  4EIW A;  3U5Z B;  1XGP C;  205L A;  3WVY A;  2EKS C;  4LT2 A;  1G59 A;  5FTM A;  4GCF A;  2UXD M;  2ERC A;  3C82 A;  1C6M A;  1KNI A;  3L2A A;  4Y28 F;  3DOA A;  1D6P A;  2R45 A;  4EKS A;  1HC0 A;  3BOS A;  1GB5 A;  2Z18 A;  1L40 A;  1C67 A;  1LWG A;  4LF9 M;  2KEB A;  4U3X B;  4NWE A;  2HEA A;  3KW6 A;  1NV9 A;  1LZB A;  4HPE A;  1L31 A;  1QUG A;  2KNZ A;  2V6Z M;  5JI3 E;  3TWM A;  2L09 A;  4JI2 M;  1LZ4 A;  4Z8X A;  4DQ5 A;  3TMW A;  1PGY A;  1L56 A;  1Z59 A;  1C6L A;  1L00 A;  3R9X B;  1L60 A;  1GO5 A;  1GF6 A;  2EQL A;  2LVA A;  3DFZ A;  4BAD A;  2MEB A;  2D6B A;  2VF8 A;  2DQC Y;  2DQA A;  2Z3X A;  3NYA A;  5KO3 A;  4GKJ M;  2ZIL A;  3AW7 A;  4LF6 M;  4ARM A;  1L25 A;  1XEJ A;  1TF0 B;  1LW9 A;  3CDV A;  2YVB A;  4G4R A;  3MGW A;  2W1M A;  162L A;  1IN4 A;  1JJ0 A;  228L A;  1HEP A;  2B7X A;  3C8Q A;  2QHO B;  3D8L A;  9LYZ A;  256L A;  4BAF A;  4NGW A;  4AXT A;  1SXJ B;  4WMG A;  4BAP A;  3P65 A;  4KO8 A;  1P7S A;  1G1V A;  3HH4 A;  1N75 A;  5C1B A;  1VAT A;  3HJ8 A;  2BQF A;  3RUN A;  1XC8 A;  2DZN B;  3L64 A;  181L A;  2OEA X;  5IWA M;  4LZJ A;  4IJ4 A;  138L A;  1S3S A;  4CGY B;  4DV4 M;  2MGW A;  1CKC A;  2BWE A;  1L33 A;  5DM9 A;  1OV5 A;  249L A;  152L A;  1B5U A;  2A5Y B;  2LHC A;  3L27 A;  3GRY A;  1GE1 A;  2D4I A;  1GEZ A;  1E94 E;  198L A;  4LCB A;  1GF9 A;  1LYO A;  1GFE A;  1HT2 E;  3CDR A;  1NBY C;  1LAA A;  1L0K A;  111L A;  2D4J A;  3FTE A;  2W1L A;  189L A;  1FLY A;  1D2Y A;  3IG5 A;  1C7P A;  5DNY A;  4W94 A;  4B7G A;  3PFI A;  5B05 A;  1D2W A;  1P2R A;  1TBY A;  4DR5 M;  3DN1 A;  4ZPU A;  1IO5 A;  1ZMV A;  1L15 A;  5C18 A;  3JR5 A;  1J09 A;  1HEW A;  1T3P A;  3FYC A;  1GBW A;  1L43 A;  1YIL A;  1HML A;  4GLV A;  4B7H A;  1EE8 A;  5LIN A;  2DVW B;  1G0Q A;  194L A;  3C58 A;  1V7S A;  3NY9 A;  1IC5 Y;  1LSA A;  1TAY A;  1GDW A;  1J7K A;  2L6O A;  3J2P B;  3GUJ A;  3B7Z A;  4FW9 A;  4DR1 M;  3A45 A;  1BHZ A;  3R8F A;  4LZT A;  5KY1 A;  2Y0Q A;  4NGJ A;  1HNW M;  4JI5 M;  2O5R A;  4OWA A;  2CGI A;  4IBJ A;  1EQE A;  3CSQ A;  1LJE A;  1VFB C;  1DV0 A;  5K7O A;  4H91 A;  4WO9 A;  2LVP C;  1EL1 A;  3LW5 F;  1YKZ X;  4GCC A;  1IP4 A;  4DD9 A;  1R2Y A;  1LTM A;  3E3D A;  1IOR A;  1LZ1 A;  5T3F A;  2ZNW Y;  1DYF A;  2C8O A;  163L A;  1G7L C;  3I4Y A;  1IEE A;  4OO9 A;  1CV3 A;  1L45 A;  5LAF A;  2CHQ A;  1L20 A;  2BQK A;  4GKK M;  3VK7 A;  1NJG A;  2D91 A;  222L A;  1JKC A;  2HHH M;  3C81 A;  4QY9 A;  2AUB A;  1W6Z A;  4I5S A;  4OVZ B;  4NG1 A;  145L A;  4NG8 A;  1L0J A;  1BWJ A;  1TTE A;  6LZM A;  3HU2 A;  4DV1 M;  1ALC A;  1IR7 A;  5DLA A;  2C9C A;  4DR7 M;  3W0F A;  4I7J A;  1GB2 A;  1JQU A;  1I20 A;  3CGW A;  2UUC M;  1C43 A;  3HWS A;  5DL9 A;  1CJ8 A;  4GN4 A;  4ITQ A;  4GH9 A;  259L A;  2ZTD A;  3MHV C;  1D3N A;  2ANV A;  1FLW A;  2LZM A;  180L A;  1IC7 Y;  4DT3 A;  5B59 A;  1L74 A;  1SX7 A;  5KXT A;  4LFX A;  4G6Z A;  1NMM A;  4DUY M;  4G4H A;  2UUB M;  1UAC Y;  3DZD A;  4HJY A;  1LSP A;  3GLF B;  4YEN A;  4B4I A;  1IBK M;  2BPU A;  4DQJ A;  1E9S A;  3WU9 A;  4OX9 M;  1JR3 A;  2O4W A;  1VAU A;  1D9W A;  4PD2 A;  1G0L A;  4W57 A;  4LGK A;  1L97 A;  2DZL A;  1DGH B;  1C63 A;  2FYC A;  1C6A A;  5IHG A;  4DV6 M;  1KIQ C;  1FNN A;  148L E;  1IBL M;  1QUH A;  165L A;  1NHW C;  1J1P Y;  2YBJ A;  3B89 A;  3F9L A;  4I0C A;  3HZJ A;  3C7W A;  3CT5 A;  237L A;  4OW0 A;  1QUS A;  4FVM A;  1B5Y A;  1NVM A;  4AGA A;  3HFM Y;  2NTH A;  4DR6 M;  1LZT A;  3U6O A;  3SBA A;  1P2L A;  1KYI A;  2YBN A;  2GNO A;  3F8V A;  3AYQ A;  3V76 A;  1ZV5 L;  3B72 A;  4LG2 A;  3EIH A;  3KAM A;  1LJ3 A;  4GRV A;  2B70 A;  134L A;  1ZMW A;  1L68 A;  3GPP A;  2Q9E A;  3AZ5 A;  1RI8 B;  1NO1 A;  5LYZ A;  3HU3 A;  1BVX A;  4XJG A;  3HHZ A;  128L A;  2YBL A;  1CKH A;  5ITU A;  4YY3 M;  1OUF A;  1KIR C;  253L A;  1E9R A;  1OIP A;  1L91 A;  2R62 A;  1NY6 A;  4LJA A;  3TWK A;  1GE3 A;  2L4E A;  3FUW A;  1LSC A;  1P36 A;  2JY7 A;  4LFC M;  1P3Q Q;  1G7M C;  258L A;  2LYZ A;  2XEP A;  1VED A;  216L A;  3MMP A;  1SWZ A;  4J1B A;  5M1Y A;  1XGR C;  206L A;  1QAN A;  3P64 A;  1R4G A;  1L08 A;  1K3W A;  4FWH A;  1CNS A;  3B0O A;  1OUI A;  1P6Y A;  1QSW A;  4QOS A;  1IWW A;  2RAY X;  3HJS A;  1LMA A;  5KXZ A;  4S0W A;  1QTC A;  3W6C A;  1GFV A;  4JXJ A;  4LFP A;  1ZVY B;  1DYC A;  2LC9 A;  1WGL A;  1LHJ A;  2YNM D;  1L28 A;  2B3T A;  3RFW A;  1J1X Y;  3Q8X A;  5FSW A;  4DQ7 A;  4NEB A;  3M3U A;  2OTY X;  4NSG A;  4QNM A;  1ZMU A;  4HPI A;  2OU9 A;  4CGE A;  5KQ8 A;  1L04 A;  2Q2E B;  1HJP A;  5KPZ A;  1B2K A;  1C6G A;  1I56 A;  1LZG A;  1PQM A;  1JB0 F;  2LWX A;  2HU3 A;  1AUA A;  1HFZ A;  2B6W A;  8CAT A;  4TX7 A;  2CDS A;  1QTK A;  182L A;  2EKF A;  4IBD A;  129L A;  2WSE F;  1D3F A;  3PXG A;  1FKV A;  3WHL A;  130L A;  1IOS A;  183L A;  3HH3 A;  4NY5 A;  4WG7 A;  4N9R A;  3GLH E;  1KXX A;  1WTN A;  4WLY A;  1OUA A;  4WP2 A;  3SMS A;  1BB5 A;  3LYT A;  3T1Y M;  3IG8 A;  171L A;  2MEC A;  3A6C Y;  3A94 A;  4LYM A;  4RW2 A;  4GHA A;  3T38 A;  5IRE B;  3FI7 A;  2FH0 A;  4LDL A;  1VEK A;  4WM2 A;  2ZYC A;  2ZAO A;  3NY8 A;  5F81 A;  1QSQ A;  2OE9 X;  5HNC A;  3T6P A;  3J7B A;  4ETA A;  3OE0 A;  1F4I A;  3HU1 A;  1CJ7 A;  3K2R A;  1LHH A;  2FYD A;  5FTK A;  4W59 A;  3HUQ A;  1PQO A;  3J81 S;  3SAS A;  2R4E A;  1H6U A;  1YUB A;  3GO8 A;  1JTO L;  1REX A;  1C6T A;  4N1C C;  3SBB C;  2QQ8 A;  1L65 A;  2BQI A;  4PGJ B;  1TH3 A;  1TCY A;  3WUM A;  125L A;  4NHQ A;  1QAO A;  2MEE A;  1JTM A;  1N33 M;  3W67 A;  1NNU C;  5C6L A;  3VDU A;  2JNH A;  1C62 A;  1JQJ C;  1IXZ A;  1JIS A;  2EJS A;  1QTB A;  2ZQ4 A;  112L A;  214L A;  4ETC A;  168L A;  3GLF A;  1L95 A;  1Z6T A;  1H6M A;  4CJ2 A;  4I4L A;  4R0F A;  4DYG A;  4GC5 A;  1ZQ9 A;  2ZAM A;  2DQH Y;  2F30 A;  3BBZ A;  1BB3 A;  1LSM A;  226L A;  2QB0 B;  1L21 A;  5ITQ A;  5EP1 A;  4FWD A;  2K6B A;  1L58 A;  3WH1 A;  3WPJ A;  4RKU F;  1WVV A;  2HEF A;  2RB1 X;  2RB0 X;  1DO2 A;  1OVJ A;  5L3I A;  1H87 A;  154L A;  1CU3 A;  3HGI A;  1QAQ A;  3FTC A;  1MU5 A;  1C65 A;  4RF0 A;  3GRV A;  3ZQJ A;  2E5L M;  4LYB A;  5KKI A;  3WMK A;  1C10 A;  1IP3 A;  1EFU B;  4LJ5 A;  1WQP A;  2JA2 A;  3OTO M;  4MGZ E;  5I54 A;  4IBE A;  2B74 A;  3SAW A;  4DD1 A;  5L8R F;  193L A;  1NNJ A;  3N9C A;  1FKQ A;  2QAR C;  4G4C A;  4FCT A;  1F10 A;  215L A;  1G3I A;  2YBM A;  1KS3 A;  3TXI A;  5LZM A;  1JTT L;  5HMJ A;  3KSJ A;  3L25 A;  212L A;  2DBT A;  5C6J A;  4N8Z A;  2RGO A;  2Z37 A;  110L A;  1L81 A;  2M60 A;  231L A;  1CVK A;  2RBQ A;  1SXJ E;  4P16 A;  3SFZ A;  5FHW A;  4H9I A;  1L55 A;  1GL6 A;  3FE0 A;  4GIT A;  1IY3 A;  234L A;  3WYH A;  3TXK A;  1Y8G A;  1L01 A;  4LYT A;  1MEL L;  4ARM B;  1OIZ A;  2BQC A;  2HUM A;  4LZM A;  1UA6 Y;  5KXR A;  4W51 A;  1G06 A;  2IHL A;  1G0J A;  1JIT A;  4I8S A;  1KW7 A;  1CX6 A;  3K9P A;  4HSF A;  1IC4 Y;  4LJ6 A;  1SLY A;  4LRS A;  2ZBK B;  2YBH A;  4W58 A;  1KXY A;  1IP2 A;  5E4P A;  3T1H M;  1LI3 A;  1LMO A;  2AHM A;  3TXG A;  4NHP A;  1XEP A;  166L A;  3A98 B;  4NXN M;  1LMC A;  1CV6 A;  1UIC A;  3TE6 A;  2ZTC A;  3FUX A;  1N78 A;  3FTD A;  248L A;  3KDS E;  1PJQ A;  4DDB A;  2A4T A;  2ZWB A;  1WQM A;  1L47 A;  1L1Z A;  2Z39 A;  5LIO A;  3B6L A;  2DQJ Y;  1PJT A;  4AKI A;  1GB3 A;  2CUU A;  3WVX A;  1OAO C;  2BWB A;  1XXH B;  3TMX A;  1NHG C;  176L A;  3K2L A;  2D7H A;  2KNV A;  4QHT A;  3SHF A;  1HEQ A;  3KOX E;  1LYS A;  5ITR A;  2UUA M;  1YAO A;  2PC2 A;  1PQK A;  2DAM A;  161L A;  4MGH A;  1C66 A;  1NF5 A;  4XK8 F;  1C69 A;  3HTD A;  1NQI A;  3PDS A;  3P68 A;  1DGB A;  5LVG A;  1L17 A;  1Q02 A;  1HEO A;  4H93 A;  4WLT A;  4EPI A;  4G4Q A;  5IDD A;  4DR2 M;  2DQI Y;  1CV5 A;  4GEW A;  1P56 A;  4KT3 A;  3CT0 A;  4DV0 M;  4LF8 M;  2LVN C;  1XGT C;  3W6B A;  4XJH A;  3LYO A;  1IWZ A;  2WSF F;  4I7T A;  7LYZ A;  3QAK A;  3N9A A;  5FTJ A;  1L27 A;  246L A;  113L A;  4D81 A;  3HY5 A;  143L A;  1HER A;  4PJZ A;  4CFO A;  1KXW A;  2LYO A;  4ZFP A;  3EIE A;  4B7F A;  1KY1 A;  4LGY A;  115L A;  1L46 A;  5I4W A;  4NGI A;  2JY8 A;  3T36 A;  4W5W A;  4JYA M;  1A2Y C;  2Z7J A;  5EBH A;  3VLF B;  1IY2 A;  1IWV A;  1L44 A;  3IWR A;  2NTG A;  4G4O A;  4ARQ A;  3SAV A;  1TH4 A;  1TEW A;  1OYU A;  255L A;  221L A;  1GLN A;  2DKV A;  1A5T A;  2DWN A;  4ARL A;  1YAQ A;  3EMS A;  1L64 A;  1MN3 A;  2DWZ B;  2RBP A;  1LGW A;  3VKG A;  1LYD A;  2BAA A;  3JR6 A;  4WUR A;  2MEH A;  3AW6 A;  4WM4 A;  3VDP A;  2YQZ A;  1GB8 A;  1QTE A;  4DV7 M;  4MCK A;  1YAN A;  3RT5 X;  4GMQ A;  2C5R A;  1L1T A;  3GLF E;  1GB9 A;  3HBH A;  3CQL A;  1L90 A;  208L A;  4ARP A;  4DD2 A;  1GPQ C;  1WQR A;  4PK0 A;  4X62 M;  1OUD A;  1SX2 A;  1BWH A;  1YL1 X;  4IAP A;  3A95 A;  4WL7 A;  3FYD A;  2DHY A;  3FE3 A;  1BVS A;  4H8Y A;  3KP0 E;  1PJJ A;  185L A;  5B07 A;  2JUJ A;  1ZVH L;  1XJU A;  3M7G A;  1GAB A;  5IT9 S;  3J27 B;  1X37 A;  2QNJ A;  3AB6 A;  3QNG A;  1YL0 X;  1DYA A;  5APD A;  1QAM A;  2CHV A;  4TSC A;  108L A;  3I01 M;  173L A;  2B6Z A;  2R65 A;  4JI0 M;  4I7Q A;  2R0I A;  188L A;  3HH6 A;  2ZIJ A;  3NBI A;  1QQY A;  1C1K A;  4ZEE A;  4AQY M;  104L A;  4H92 A;  3B7Q A;  1OJL A;  3K9O A;  2H9K A;  3A96 A;  2F5O A;  2UU9 M;  3GUM A;  5FTN A;  3FTF A;  1GBY A;  4RNA A;  4LFA M;  1L24 A;  4DAJ A;  3E9S A;  120L A;  2B6T A;  3G3V A;  5C6I A;  3L28 A;  3M18 B;  3W0L B;  1T6O A;  1L48 A;  3GXK A;  3GXR A;  3LN2 A;  4FWG A;  5F14 A;  1XEK A;  4G4N A;  3SB7 A;  1LSZ A;  3ILK A;  4HLQ A;  3FA0 A;  3D3D A;  4IBK A;  1CV4 A;  5DFL A;  2D4K A;  190L A;  4YM8 A;  2CP8 A;  1GBO A;  1GE0 A;  3MJ5 A;  3TXE A;  1L23 A;  3RU5 A;  5EJC A;  2F2Q A;  2VII A;  5EP2 A;  2RBS A;  1L86 A;  4DD0 A;  2ZNX Y;  2JZ0 A;  5KPR A;  3U60 B;  4YEM A;  1GFT A;  4WM5 A;  1G7I C;  1HEL A;  1D2N A;  4TUN A;  1VDL A;  2F4G A;  1PS5 A;  3SHG B;  1IWU A;  1XXH A;  4CIS A;  1HNZ M;  1L18 A;  1Q3C A;  1G0P A;  174L A;  1BQL Y;  242L A;  4GBR B;  1L29 A;  2Q0M X;  1LYG A;  1QZE A;  1B7R A;  4B4E A;  3SAU A;  3WW6 A;  1IY0 A;  1IXR C;  3GLG A;  3KP1 E;  4WL6 A;  3IHP A;  4YXA C;  239L A;  1B5V A;  1HR0 M;  4BLC A;  250L A;  4LT0 A;  2W1X A;  3ATO A;  4WW0 A;  1HNL A;  4TSB A;  4WOA A;  224L A;  4D82 A;  1UFZ A;  1L09 A;  1JEF A;  4EKR A;  2LZ2 A;  3SC3 A;  1NDG C;  1OKS A;  1L88 A;  2ZM6 M;  2YDG A;  2CHG A;  2HU1 A;  3P4Z A;  4L8R C;  4EKQ A;  4NSR A;  1LGX A;  1LJN A;  2LVO C;  1G0G A;  2A7D A;  5APC A;  5KPT A;  1QIO A;  4OWC A;  5KXL A;  1XJT A;  1EQ4 A;  4D9Z A;  1MJG M;  1LSB A;  1CKD A;  1T8G A;  236L A;  4EJ4 A;  4I7P A;  3KOZ E;  230L A;  1OVH A;  1NSF A;  235L A;  4WLD A;  2CE7 A;  4B3R M;  4KHP M;  2ZIK A;  3FI5 A;  2MED A;  2HUB A;  1I1Z A;  4JI8 M;  4H94 A;  2LBC A;  3C9P A;  1JTN A;  1N4F A;  5E9R A;  1QTV A;  1UBZ A;  3N9E A;  3P66 A;  3DN6 A;  2EUC A;  1JKD A;  2BNK A;  4DD3 A;  2HAK A;  3B74 A;  2HEC A;  123L A;  4IBI A;  1L61 A;  1QUD A;  1DYG A;  2RH1 A;  1LZ6 A;  4DBG B;  2ZAN A;  3U61 A;  2KDL A;  1L26 A;  4WLX A;  1SSW A;  3TL4 X;  4RW1 A;  247L A;  3WPK A;  1CUQ A;  4H8Z A;  3QYB A;  2Z4S A;  4NSI A;  2LTU A;  1NY5 A;  3D9A C;  4BS7 A;  4DUZ M;  1UIE A;  140L A;  1CUP A;  1T8F A;  1L94 A;  1LSD A;  3WUA A;  4G9S A;  2KW0 A;  1L07 A; 
#chains in the Genus database with same CATH homology
 1QTZ A;  1DKJ A;  1FLQ A;  241L A;  3B0K A;  3DN0 A;  8LYZ A;  1CU6 A;  1G7J C;  1L63 A;  4NGK A;  4XJF A;  5A3Z A;  3SB8 A;  2YSS C;  3UON A;  1PZY A;  1GF0 A;  5KXO A;  1YRO A;  3B0I A;  1NHE A;  1C6I A;  1HEN A;  3A93 A;  233L A;  3HUA A;  1GF4 A;  2IGC A;  4H8X A;  1E8L A;  1L34 A;  3FAD A;  1TLA A;  2HEB A;  2B6Y A;  2W1Y A;  1L80 A;  1JHL A;  261L A;  1FBI X;  2H5Z A;  4LT3 A;  2RBR A;  1L19 A;  1UID A;  1XSF A;  1LZ8 A;  1T8A A;  155L A;  3GUI A;  3WXT A;  207L A;  1SQ2 L;  1IWT A;  2N5Z A;  1UC0 A;  211L A;  1JTP L;  144L A;  3HTF A;  1JKB A;  3DMZ A;  2F32 A;  5B1F A;  1VDP A;  1CJ9 A;  229L A;  1FN5 A;  1L02 A;  2XTH A;  3BKH A;  1ZWN A;  1LCN A;  1OQM A;  1GBZ A;  4LT1 A;  149L A;  3HT8 A;  3QY4 A;  1CU0 A;  1JPO A;  2F2N A;  1L16 A;  1OUB A;  2XBS A;  1RFP A;  1W08 A;  1LOZ A;  1YAP A;  3DN4 A;  4GN5 C;  1O23 A;  2B75 A;  1OUE A;  4N0J A;  1WQO A;  1L35 A;  1GE4 A;  240L A;  1GBX A;  1B5W A;  1GE2 A;  1GXX A;  3LZ2 A;  4MR1 A;  1GB6 A;  3SB9 A;  1LMQ A;  4N1E I;  1OP9 B;  1L10 A;  3D4S A;  1P46 A;  1B7S A;  1L36 A;  1GEV A;  1L38 A;  2Z19 A;  1DPW A;  243L A;  5KXK A;  126L A;  1P64 A;  4M6D A;  4K5Y A;  3HT7 A;  5LVK A;  3LZT A;  1A4V A;  1LMN A;  3WW5 A;  4GCB A;  4H9A A;  3WU7 A;  2FBB A;  2OTZ X;  4HV1 A;  1LYZ A;  1L82 A;  1AZF A;  1SWY A;  4LYO A;  3DNA A;  3WL2 A;  1PQD A;  2RSC A;  3HTG A;  1JSF A;  2BLY A;  1B7O A;  1GFK A;  5HQ1 A;  184L A;  2HED A;  213L A;  1D0K A;  4ARQ B;  2OE4 X;  1UUZ C;  2BLX A;  3J4G A;  107L A;  3V2W A;  1L87 A;  3VW7 A;  4HTN A;  1LYH A;  2XJW A;  4AQN A;  1L42 A;  1L69 A;  3TXJ A;  3EO5 A;  1NKH A;  5ILF A;  1LKS A;  1XFP L;  2DQF C;  3ULR A;  3T6U A;  1D9U A;  4FJR A;  4LDE A;  4XEN A;  1G0M A;  2ANX A;  5D5F A;  1LHL A;  1QSA A;  244L A;  3TXH A;  4OWE A;  1L70 A;  1QTH A;  2OU8 A;  1L66 A;  1LYI A;  2VB1 A;  1LJJ A;  4W96 A;  1LI2 A;  2XBR A;  2Y8P A;  4H9F A;  4I7M A;  3A91 A;  2B5Z A;  3GUN A;  4XN6 A;  1B6I A;  4ML7 A;  3J6K A;  3OJP A;  3HU8 A;  135L A;  3PBL A;  1OUH A;  1UCO A;  4EOF A;  1LJ4 A;  2Z2F A;  1CX7 A;  147L A;  1LMT A;  3A67 Y;  1HFX A;  3HDF A;  1JUG A;  4II8 A;  4DC4 A;  114L A;  3AGI A;  4CHX A;  1L50 A;  1LGU A;  4TWS A;  5LAG A;  1GFR A;  2HEE A;  192L A;  1IR9 A;  1IP1 A;  1IX0 A;  3V2Y A;  1VDS A;  1ZMY L;  2RB2 X;  1F6R A;  4I7L A;  5KXP A;  4PRQ A;  1GF5 A;  1B5Z A;  4P2E A;  1QT3 A;  1LJK A;  191L A;  4NWH A;  2BQN A;  3ZVQ A;  146L A;  1YAM A;  197L A;  1IP6 A;  2BQJ A;  4PPO A;  4NSH A;  2OE7 X;  3TXD A;  3WU8 A;  1JSE A;  4ET9 A;  1GFU A;  1YKY X;  1OUG A;  5KKJ A;  3C7Z A;  2ZQ3 A;  1DKK A;  1OUC A;  1LLH A;  3GUK A;  1BGI A;  5KXX A;  5LYT A;  1QS5 A;  3CSZ A;  3OE9 A;  4H90 A;  5AMY A;  5II3 A;  3A92 A;  1C6H A;  1DZB X;  1L76 A;  2Z2E A;  4UWU A;  4Z41 A;  196L A;  1DI5 A;  5APE A;  1CKF A;  3WXU A;  1UIF A;  4E97 A;  4B49 A;  1WQQ A;  4LDO A;  1LPY A;  1OWZ A;  1C60 A;  1LZA A;  1C6F A;  1LYJ A;  2MEF A;  3QE8 A;  1C6E A;  3GUL A;  1L22 A;  5KXW A;  5ILC A;  1LJI A;  133L A;  1IWY A;  1L79 A;  1LSG A;  141L A;  3A8Z A;  1T97 A;  3CSR A;  1GFH A;  2IFF Y;  4HTQ A;  1HF4 A;  177L A;  4GCE A;  157L A;  1RCM A;  4ETD A;  1P5C A;  1UIB A;  1IR8 A;  1PQJ A;  1AKI A;  5FEK A;  1LJH A;  262L A;  1C6D A;  2MEA A;  5DN5 A;  160L A;  5B1G A;  2I25 L;  1QUT A;  3EBA B;  186L A;  1IWX A;  2LHM A;  1GDX A;  5FEL A;  3AZ4 A;  4RDS A;  1HMK A;  3W6D A;  4OOT A;  1NDM C;  2C8P A;  3C8S A;  164L A;  1B7M A;  1GFJ A;  5KXY A;  4DKL A;  223L A;  195L A;  3CDT A;  1KY0 A;  4OWB A;  1L75 A;  4RLM A;  1HSX A;  4RLN A;  4ETB A;  5LVI A;  1XGQ C;  1QT6 A;  1LPI A;  1D0L A;  1CV0 A;  1RE2 A;  200L A;  1L83 A;  2BQL A;  1IP7 A;  4LYC A;  3LHM A;  4DWX A;  1QT8 A;  1L11 A;  1XEI A;  5LA5 A;  5B06 A;  1LWK A;  3AZ7 A;  1C6K A;  3A3R X;  1D6Q A;  1C6P A;  1C64 A;  2CJL A;  4DDA A;  4DD7 A;  1G0K A;  4LYZ A;  1DYE A;  4NHT A;  5LVJ A;  1L57 A;  4IAT A;  2LYM A;  1VDQ A;  3DMV A;  1LZ9 A;  4W53 A;  2B72 A;  1L62 A;  5LXW A;  4XJD A;  1LZE A;  3TXF A;  169L A;  1G1W A;  1L92 A;  4IAS A;  1JKA A;  4XJB A;  1YIK A;  1C6N A;  1L85 A;  3LZM A;  1UIA A;  2RBO A;  1C6B A;  4HJV A;  1BB6 A;  4J0L A;  3W6F A;  4N5R A;  1D3J A;  1B0D A;  1C46 A;  1LZC A;  4EPF A;  3SN6 R;  5KXS A;  1C6Q A;  4YX7 C;  4NGL A;  1P3N A;  1HFY A;  1DQJ C;  1GFG A;  5F16 A;  1OVK A;  172L A;  1G07 A;  4B4J A;  1B5X A;  4PHI A;  1WVU A;  1DYB A;  3HUK A;  1L51 A;  1IOT A;  5I4Y A;  2F4A A;  4NGZ A;  5FST A;  217L A;  4GN3 A;  1WTH A;  1NWG A;  3W6A A;  4WO6 A;  2FBD A;  1EQ5 A;  1C6C A;  1L41 A;  3SB5 A;  1GWD A;  4KXI A;  3OE8 A;  4WM3 A;  3ZEK A;  1GB0 A;  137L A;  1F6S A;  1LMP A;  219L A;  5J7C A;  151L A;  4W52 A;  5D5C A;  142L A;  3DMX A;  6LYT A;  2OU0 X;  1HSW A;  4QDN A;  5F9X A;  1CU2 A;  1LYE A;  1T6V L;  3C80 A;  1REY A;  4WG1 A;  1MLC E;  1L39 A;  2L78 A;  1IY4 A;  1GF7 A;  3BKV A;  3A6B Y;  1L05 A;  1CKG A;  3VWO A;  150L A;  3G3B B;  3CT1 A;  4QEQ A;  2O79 A;  2MEG A;  3HDE A;  1EPY A;  4NGY A;  3IJV A;  1KIP C;  1QUO A;  1AT5 A;  3ATN A;  3RNX A;  4J7V A;  1J1O Y;  1TDY A;  3TXB A;  1QSB A;  1L53 A;  4C5F A;  4XJI A;  4ARJ A;  1CU5 A;  4XAD A;  1GXV 2;  156L A;  5LYM A;  1LZY A;  1F0W A;  4EKP A;  131L A;  5HLL A;  1LSY A;  2DQG Y;  4GCD A;  3HBD A;  3DN2 A;  227L A;  4H9H A;  1IOC A;  1BWI A;  2XQO A;  5KXN A;  1DYD A;  4I7R A;  1RJC B;  3EXD A;  1L54 A;  3AGG G;  4OOO A;  1L93 A;  159L A;  4I7O A;  209L A;  175L A;  2BQD A;  1BB7 A;  1GB7 A;  3L2X A;  4I7N A;  1BVK C;  4YXC A;  127L A;  1FDL Y;  1LYF A;  4HJZ A;  2ZYP A;  4NGO A;  4H9B A;  153L A;  4Z98 A;  5L3H A;  1Z55 A;  3K3T A;  1P37 A;  1G7H C;  4YEO A;  1GAY A;  3AZ6 A;  4M4O A;  4L41 A;  1L98 A;  4NGV A;  1B7Q A;  1L59 A;  1NHB A;  1LJF A;  3G3X A;  1D0M A;  158L A;  1QT5 A;  3DKE X;  132L A;  1B7N A;  2HUK A;  1OV7 A;  2BQA A;  2G4P A;  1WQN A;  3GUP A;  3ZVQ B;  4WM6 A;  1DI4 A;  218L A;  4ETE A;  4B1A A;  1KW5 A;  4NFV A;  178L A;  199L A;  4UWV A;  3A34 A;  1JIY A;  5IEL A;  2YBI A;  5HMV A;  254L A;  1L06 A;  1L71 A;  4CFP A;  1C45 A;  1JJ1 A;  1C68 A;  1GF8 A;  1LHK A;  3F6Z A;  1T6H A;  1QT4 A;  2RBN A;  3AJN A;  4HP0 A;  5F9U A;  2CWI A;  2A7F A;  3W3E A;  4DDC A;  1ZUR A;  4UWN A;  238L A;  1V7T A;  2DQD Y;  4A7D A;  5I53 A;  1YQV Y;  3WUN A;  1GHL A;  4HTK A;  109L A;  4MST A;  5L9J A;  225L A;  2Z38 A;  3WUL A;  1L30 A;  3W6E A;  2MEI A;  4H9C A;  1LJG A;  4J1A A;  3HWL A;  1REM A;  2Z12 A;  1OUJ A;  1L37 A;  4B0D A;  3HT6 A;  5APF A;  1FLU A;  3TMV A;  1HHL A;  1IVM A;  4GLA A;  5I4X A;  1GD6 A;  1AT6 A;  3CB7 A;  3HH5 A;  1LYY A;  2G4N A;  3EML A;  5I5Q A;  4C3W A;  3HT9 A;  1DXJ A;  5FCP A;  2EPE A;  1SSY A;  4I7K A;  4NIJ A;  3DN3 A;  3ODU A;  4W56 A;  260L A;  4H9E A;  3DN8 A;  1BB4 A;  1JWR A;  1OWY A;  4I7S A;  1JJ3 A;  1C61 A;  210L A;  4R6C A;  1B7P A;  2BQM A;  3C8R A;  1L72 A;  2X0A A;  4O34 A;  2NWD X;  1GFA A;  1LI6 A;  4TTD A;  5LA8 A;  2Q9D A;  4DJH A;  1LZN A;  1REZ A;  1LZR A;  1QT7 A;  3HU9 A;  3C83 A;  2BQE A;  1L03 A;  139L A;  1YKX X;  1I6S A;  119L A;  1XGU C;  3AGH A;  4ET8 A;  3WPL A;  3IJU A;  1GAZ A;  4Z3M A;  4OW1 A;  5A3E A;  2O7A A;  1QS9 A;  4ANR A;  4E3U A;  6LYZ A;  4EXM A;  1UIG A;  3CDO A;  1CTW A;  1L14 A;  1LKR A;  4NHS A;  2EIZ C;  1C6J A;  170L A;  4YF2 A;  1L32 A;  1K28 A;  4YOP A;  220L A;  103L A;  4FDY A;  1IP5 A;  3RZE A;  1LZS A;  2BQH A;  1B9O A;  1C08 C;  1HEM A;  2BQB A;  1L96 A;  2B6X A;  4PJ2 C;  3G3W A;  3GUO A;  1L73 A;  3G3A B;  1L13 A;  1INU A;  1L49 A;  245L A;  257L A;  5FDJ A;  1L67 A;  1PQI A;  1VDT A;  1LSE A;  4Z46 A;  4HV2 A;  4X3B A;  4G4B A;  122L A;  2BQO A;  4NHI A;  2LCB A;  4NSJ A;  3HTB A;  3SB6 A;  5HNL A;  1LSF A;  187L A;  1LZD A;  2I26 L;  5JEN B;  3LYM A;  2I6Z A;  2F47 A;  4H1P A;  5KXM A;  7LZM A;  1LSN A;  1L52 A;  1L89 A;  102L A;  4KL7 A;  5I14 A;  5DN4 A;  2B73 A;  3HBE X;  1GF3 A;  1QTD A;  3CDQ A;  3LYZ A;  1LHI A;  2HUL A;  2LZT A;  1L77 A;  3OE6 A;  1ZYT A;  4ZIX A;  1L84 A;  1LHM A;  1L99 A;  4PRU A;  4QGZ A;  4W55 A;  4XYY A;  232L A;  3A3Q A;  5LVH A;  1CV1 A;  4W54 A;  3TMU A;  3RW8 A;  252L A;  3RZ4 A;  1LZ5 A;  1L12 A;  118L A;  4WM1 A;  1QDR A;  1B7L A;  1WTM A;  3SP3 A;  3A90 A;  1QDT A;  2BQG A;  1D3M A;  1CJ6 A;  1GBS A;  2H9J A;  251L A;  2RAZ X;  2Z6B A;  1P2C C;  1IIZ A;  1IOQ A;  201L A;  1NBZ C;  4EMN A;  2HTX A;  4KPM A;  3C7Y A;  2DQE Y;  3OK0 A;  1DI3 A;  1UIH A;  167L A;  2G4Q A;  4OWH A;  2GV0 A;  1AM7 A;  2WAR A;  1DPX A;  4G49 A;  1XGP C;  205L A;  3WVY A;  2EKS C;  4LT2 A;  4GCF A;  3C82 A;  1C6M A;  1KNI A;  1D6P A;  4EKS A;  1HC0 A;  1GB5 A;  2Z18 A;  1L40 A;  1C67 A;  1LWG A;  4U3X B;  4NWE A;  2HEA A;  1LZB A;  4HPE A;  1L31 A;  1QUG A;  1LZ4 A;  4DQ5 A;  3TMW A;  1L56 A;  1C6L A;  1L00 A;  1L60 A;  1GF6 A;  2EQL A;  4BAD A;  2MEB A;  2D6B A;  2DQC Y;  2DQA A;  3NYA A;  2ZIL A;  3AW7 A;  4ARM A;  1L25 A;  1XEJ A;  3CDV A;  1LW9 A;  2YVB A;  3MGW A;  2W1M A;  162L A;  1JJ0 A;  228L A;  1HEP A;  2B7X A;  3C8Q A;  9LYZ A;  256L A;  4BAF A;  4NGW A;  4AXT A;  4WMG A;  4BAP A;  3P65 A;  1P7S A;  1G1V A;  3HH4 A;  1VAT A;  2BQF A;  3RUN A;  3L64 A;  181L A;  2OEA X;  4IJ4 A;  138L A;  1CKC A;  1L33 A;  5DM9 A;  1OV5 A;  249L A;  152L A;  1B5U A;  1GE1 A;  2D4I A;  1GEZ A;  198L A;  1GF9 A;  1LYO A;  1GFE A;  3CDR A;  1NBY C;  1LAA A;  1L0K A;  111L A;  2D4J A;  2W1L A;  189L A;  1FLY A;  1D2Y A;  1C7P A;  4W94 A;  5B05 A;  1D2W A;  1P2R A;  1TBY A;  3DN1 A;  4ZPU A;  1IO5 A;  1L15 A;  1HEW A;  1T3P A;  1L43 A;  1GBW A;  1YIL A;  1HML A;  4GLV A;  5LIN A;  1G0Q A;  194L A;  1V7S A;  3NY9 A;  1IC5 Y;  1LSA A;  1TAY A;  1GDW A;  3GUJ A;  1BHZ A;  4LZT A;  5KY1 A;  4NGJ A;  4OWA A;  2CGI A;  1EQE A;  3CSQ A;  1LJE A;  1VFB C;  5K7O A;  4H91 A;  4WO9 A;  1EL1 A;  1YKZ X;  4GCC A;  1IP4 A;  4DD9 A;  1LTM A;  3E3D A;  1IOR A;  1LZ1 A;  5T3F A;  2ZNW Y;  1DYF A;  2C8O A;  163L A;  1G7L C;  1IEE A;  4OO9 A;  1CV3 A;  1L45 A;  5LAF A;  1L20 A;  2BQK A;  2D91 A;  222L A;  1JKC A;  3C81 A;  4QY9 A;  2AUB A;  1W6Z A;  4NG1 A;  145L A;  4NG8 A;  1L0J A;  1BWJ A;  6LZM A;  1IR7 A;  1ALC A;  5DLA A;  4I7J A;  1GB2 A;  1JQU A;  1I20 A;  1C43 A;  5DL9 A;  1CJ8 A;  4GN4 A;  259L A;  1D3N A;  2ANV A;  1FLW A;  2LZM A;  180L A;  1IC7 Y;  4DT3 A;  5B59 A;  1L74 A;  1SX7 A;  5KXT A;  4LFX A;  1NMM A;  4G4H A;  1UAC Y;  4HJY A;  1LSP A;  4YEN A;  4B4I A;  2BPU A;  4DQJ A;  3WU9 A;  2O4W A;  1VAU A;  1D9W A;  1G0L A;  4W57 A;  4LGK A;  1L97 A;  1C63 A;  2FYC A;  1C6A A;  5IHG A;  1QUH A;  1KIQ C;  148L E;  165L A;  1J1P Y;  2YBJ A;  3F9L A;  4I0C A;  3C7W A;  3CT5 A;  237L A;  1QUS A;  1B5Y A;  4AGA A;  3HFM Y;  2NTH A;  1LZT A;  3SBA A;  1P2L A;  2YBN A;  3F8V A;  3AYQ A;  1ZV5 L;  3B72 A;  3KAM A;  1LJ3 A;  4GRV A;  2B70 A;  134L A;  1L68 A;  2Q9E A;  3AZ5 A;  1RI8 B;  5LYZ A;  1BVX A;  4XJG A;  128L A;  2YBL A;  1CKH A;  1OUF A;  1KIR C;  253L A;  1L91 A;  1GE3 A;  1LSC A;  1P36 A;  1G7M C;  258L A;  2LYZ A;  1VED A;  216L A;  1SWZ A;  4J1B A;  5M1Y A;  1XGR C;  206L A;  3P64 A;  1L08 A;  1CNS A;  3B0O A;  1OUI A;  1P6Y A;  1QSW A;  1IWW A;  2RAY X;  1LMA A;  5KXZ A;  4S0W A;  1QTC A;  3W6C A;  1GFV A;  4LFP A;  1ZVY B;  1DYC A;  2LC9 A;  1LHJ A;  1L28 A;  1J1X Y;  4DQ7 A;  4NEB A;  3M3U A;  2OTY X;  4NSG A;  4HPI A;  2OU9 A;  4CGE A;  1L04 A;  1I56 A;  1B2K A;  1C6G A;  1LZG A;  1PQM A;  2HU3 A;  1HFZ A;  2B6W A;  4TX7 A;  2CDS A;  1QTK A;  182L A;  5KJ9 A;  129L A;  1D3F A;  1FKV A;  130L A;  1IOS A;  183L A;  3HH3 A;  4NY5 A;  4WG7 A;  4N9R A;  1KXX A;  1WTN A;  4WLY A;  1OUA A;  1BB5 A;  3LYT A;  2MEC A;  171L A;  3A6C Y;  3A94 A;  4LYM A;  4RW2 A;  3FI7 A;  4LDL A;  4WM2 A;  2ZYC A;  3NY8 A;  5F81 A;  1QSQ A;  2OE9 X;  5HNC A;  4ETA A;  3OE0 A;  1CJ7 A;  3K2R A;  1LHH A;  2FYD A;  4W59 A;  3HUQ A;  1PQO A;  1JTO L;  1REX A;  3SBB C;  1C6T A;  4N1C C;  2BQI A;  1L65 A;  4PGJ B;  1TCY A;  3WUM A;  125L A;  4NHQ A;  2MEE A;  1JTM A;  5C6L A;  1C62 A;  1JIS A;  1QTB A;  2ZQ4 A;  112L A;  214L A;  4ETC A;  168L A;  1L95 A;  1H6M A;  4CJ2 A;  4R0F A;  4DYG A;  2DQH Y;  2F30 A;  1BB3 A;  1LSM A;  226L A;  2QB0 B;  1L21 A;  1L58 A;  3WH1 A;  3WPJ A;  1WVV A;  2HEF A;  2RB1 X;  2RB0 X;  1OVJ A;  5L3I A;  1H87 A;  154L A;  1CU3 A;  1C65 A;  4LYB A;  5KKI A;  3WMK A;  1C10 A;  1IP3 A;  1WQP A;  5I54 A;  2B74 A;  4DD1 A;  193L A;  3N9C A;  1FKQ A;  2QAR C;  4G4C A;  1F10 A;  215L A;  2YBM A;  1KS3 A;  3TXI A;  5LZM A;  1JTT L;  5HMJ A;  2DBT A;  212L A;  5C6J A;  4N8Z A;  2Z37 A;  110L A;  1L81 A;  231L A;  1CVK A;  2RBQ A;  5FHW A;  4H9I A;  1L55 A;  3FE0 A;  1IY3 A;  234L A;  3WYH A;  3TXK A;  1L01 A;  4LYT A;  1MEL L;  4ARM B;  2BQC A;  2HUM A;  4LZM A;  1UA6 Y;  5KXR A;  4W51 A;  1G06 A;  2IHL A;  1G0J A;  1JIT A;  4I8S A;  1KW7 A;  1CX6 A;  4HSF A;  1IC4 Y;  1SLY A;  4W58 A;  2YBH A;  1KXY A;  1IP2 A;  5E4P A;  1LI3 A;  1LMO A;  3TXG A;  4NHP A;  1XEP A;  166L A;  1LMC A;  1CV6 A;  1UIC A;  248L A;  4DDB A;  2A4T A;  2ZWB A;  1WQM A;  1L47 A;  2Z39 A;  5LIO A;  3B6L A;  2DQJ Y;  1GB3 A;  2CUU A;  3WVX A;  3TMX A;  176L A;  1HEQ A;  1LYS A;  1YAO A;  2PC2 A;  1PQK A;  161L A;  1C66 A;  1NF5 A;  3HTD A;  1C69 A;  1NQI A;  3PDS A;  3P68 A;  5LVG A;  1L17 A;  1HEO A;  4H93 A;  4WLT A;  4EPI A;  5IDD A;  2DQI Y;  1CV5 A;  1P56 A;  4KT3 A;  3CT0 A;  1XGT C;  3W6B A;  4XJH A;  3LYO A;  1IWZ A;  4I7T A;  7LYZ A;  3QAK A;  3N9A A;  1L27 A;  246L A;  113L A;  143L A;  1HER A;  4PJZ A;  4CFO A;  1KXW A;  2LYO A;  4ZFP A;  1KY1 A;  115L A;  1L46 A;  5I4W A;  4NGI A;  3T36 A;  1A2Y C;  5EBH A;  1IWV A;  1L44 A;  3IWR A;  2NTG A;  4ARQ A;  1TEW A;  1OYU A;  255L A;  221L A;  2DKV A;  4ARL A;  1YAQ A;  3EMS A;  1L64 A;  2RBP A;  1LGW A;  1LYD A;  2BAA A;  3JR6 A;  2MEH A;  3AW6 A;  4WM4 A;  1GB8 A;  1QTE A;  4MCK A;  1YAN A;  3RT5 X;  1GB9 A;  3HBH A;  3CQL A;  1L90 A;  208L A;  4ARP A;  4DD2 A;  1GPQ C;  1WQR A;  4PK0 A;  1OUD A;  1SX2 A;  1BWH A;  1YL1 X;  4IAP A;  3A95 A;  4WL7 A;  4H8Y A;  185L A;  5B07 A;  1ZVH L;  1XJU A;  3AB6 A;  3QNG A;  1YL0 X;  1DYA A;  5APD A;  4TSC A;  108L A;  173L A;  2B6Z A;  4I7Q A;  188L A;  3HH6 A;  2ZIJ A;  1QQY A;  4ZEE A;  104L A;  4H92 A;  2H9K A;  3A96 A;  3GUM A;  1GBY A;  1L24 A;  4DAJ A;  120L A;  2B6T A;  3G3V A;  5C6I A;  3M18 B;  1L48 A;  3GXK A;  3GXR A;  3LN2 A;  5F14 A;  1XEK A;  3SB7 A;  1LSZ A;  3FA0 A;  3D3D A;  1CV4 A;  2D4K A;  190L A;  4YM8 A;  1GE0 A;  1GBO A;  3TXE A;  1L23 A;  3RU5 A;  2F2Q A;  2RBS A;  1L86 A;  4DD0 A;  2ZNX Y;  4YEM A;  1GFT A;  4WM5 A;  1G7I C;  1HEL A;  4TUN A;  2F4G A;  1PS5 A;  1IWU A;  1L18 A;  1G0P A;  174L A;  1BQL Y;  242L A;  4GBR B;  1L29 A;  2Q0M X;  1LYG A;  1B7R A;  4B4E A;  3WW6 A;  4WL6 A;  4YXA C;  239L A;  1B5V A;  250L A;  4LT0 A;  2W1X A;  3ATO A;  1HNL A;  4TSB A;  4WOA A;  224L A;  1L09 A;  1JEF A;  4EKR A;  2LZ2 A;  1NDG C;  1L88 A;  2YDG A;  2HU1 A;  3P4Z A;  4EKQ A;  1LGX A;  1LJN A;  1G0G A;  2A7D A;  5APC A;  1QIO A;  4OWC A;  5KXL A;  1XJT A;  1EQ4 A;  4D9Z A;  1LSB A;  1CKD A;  1T8G A;  236L A;  4EJ4 A;  4I7P A;  230L A;  1OVH A;  235L A;  4WLD A;  2ZIK A;  3FI5 A;  2MED A;  2HUB A;  1I1Z A;  4H94 A;  1JTN A;  1N4F A;  5E9R A;  1QTV A;  1UBZ A;  3N9E A;  3P66 A;  3DN6 A;  1JKD A;  4DD3 A;  2HEC A;  123L A;  1L61 A;  1QUD A;  1DYG A;  2RH1 A;  1LZ6 A;  4WLX A;  1L26 A;  1SSW A;  4RW1 A;  247L A;  3WPK A;  1CUQ A;  4H8Z A;  4NSI A;  3D9A C;  4BS7 A;  1UIE A;  140L A;  1CUP A;  1T8F A;  1L94 A;  1LSD A;  3WUA A;  4G9S A;  1L07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...