2XEPA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
428
structure length
419
Chain Sequence
SVPTPAEAALAAQTALAADDSPMGDAARWAMGLLTRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 135
structure length 419
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xepA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xepA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xepA02
2H5SA 2V1ZA 2DCFA 3OCNA 1W79A 3IHAA 4GD6A 3TG9A 1L2SA 5AQ9A 2X71A 4EBLA 3IF6B 1KDSA 1GHPA 3M2JA 5CTMA 5I94A 1NRFA 3ZG8B 5CTNA 4Y0OA 5EECA 3DWKA 1YLWA 3OPHA 4GOGA 4BQMA 1FOFA 3N8SA 3NIAA 4OONA 2WGVA 2J9PA 1XXMA 2ZMAA 3G32A 3ITBA 2X01A 4DKIA 3Q7ZA 3TSGA 1CK3A 2WKEA 3S22A 4KQRA 5GHYA 3PBNA 1ERQA 2HPBA 2QPNA 2WAEA 4UAAA 3IH8A 3P98A 4U0XA 2EX9A 2XDMA 2Y2GA 4XUZA 3ZHHA 4E3NA 2B5RA 5CHMA 2J9OA 3UDXA 4E3MA 4GN2A 4K0WA 3HVFA 4WM9A 3MXSA 4IBRA 4ZJ3A 5CEDA 3LEZA 4OOMA 5GLCA 3OPPA 4KQOA 4RA7A 3MKFA 2Q9NA 3ZG9B 5FDHA 1TDLA 2Y2IA 1NJ4A 3GQZA 5HFOA 4JF4A 4E6WA 4OQHA 4F94A 3UDFA 4LCMA 3RXXA 3ZG7B 2E8IA 3IXHA 5DTTA 4OOLA 2Z2LB 4OP5A 1K6SA 3HLFA 3BFDA 5D3OA 3IXGA 5A91A 3W4QA 4UHUA 2JCHA 3Q81A 4WZ4A 4PM5A 2HDUA 3AGFA 1KDWA 1MWSA 1H5XA 3M6BA 5HARA 3MZDA 1ESIA 2WADA 1MWTA 3PTEA 1PI4A 4FD8A 1PI5A 4ZJ2A 4N1HA 1S6RA 1LLBA 1YMXA 3D4FA 3WS5A 5KMWA 3ZDJA 4QB8A 4HEFA 5FAOA 3G30A 4E6XA 1EI5A 3Q7VA 4KZAA 1VM1A 5FI6A 4C3QA 2ZD8A 3BYDA 2XFSA 3TOIA 3C7VA 3N6IA 1E25A 2JC7A 1JWPA 4P0MA 2R9WA 4C75A 4S2LA 2ZQ9A 1RP5A 4N9KA 4U0TA 5FI7A 1WE4A 1HVBA 3PBSA 5FA7A 4NETA 2EXAA 2WK0A 2WUQA 4UA9A 1DJBA 4EUZA 5F1FA 1IYQA 1SHVA 1PIOA 5U47A 3WS2A 1PWDA 3WRTA 5DF9A 4MLLA 5F82A 4DE2A 4WMCD 1PYYA 3GSGA 1DJAA 3BEBA 1KGGA 2CC1A 5FQIA 4N9LA 3LY3A 3QHYA 4S2OA 1LL5A 3NCKA 4LV1A 4MBFA 1MWRA 2OSUA 3VP0A 5E2HA 4RVAA 3WRZA 5CRFA 3FZCA 4JXVA 4WEKA 2Y2PA 1JWVA 1JWZA 2Y2KA 3GTCA 4RX2A 4R0QA 1ERMA 1MPLA 1PWCA 2WAFA 3S1YA 4ZJ1A 1ES2A 3P09A 2G2UA 2JBFA 5AQ7A 3VP4A 4OQ0A 4X55A 3WS0A 3NI9A 2GDNA 1MY8A 4RYEA 4UA6A 4X6TA 4LV3A 4P6BA 4S2MA 4BD1A 1SDNA 3HREA 3WS4A 4KENB 2EFUA 1FSWA 3MZEA 4IBXA 3Q82A 3HLBA 5FQJA 5FSRA 1YLZA 5FAQA 5EOEA 3UN7A 2X02A 3PBTA 5E2EA 3A3DA 1MXOA 5KSCA 5DF7A 1JVJA 4WZ5C 3PAEA 5BOHA 1L0EA 1K6RA 2Y2OA 3MBZA 4XXRA 4WBGA 2Y2LA 3W4OA 1PW8A 4N1XA 4N92A 1IYOA 4FH4A 5CEBA 1M40A 3C4OA 4EBPA 4U3TA 5GLDA 4X56A 1JTGA 5CERA 1I5QA 5F1GA 1GA0A 3NY4A 4OKPA 3AGDA 1ZG4A 4GD8A 4WELA 2XF3A 3FWLA 3QNBA 2IWBA 3IWIA 4CPKA 3HBRA 3O87A 5FAPA 1FQGA 4KZ3A 3UE3A 4BLMA 2ZC5B 2ZM2A 3V50A 1H8ZA 3LY4A 1HTZA 2XR0A 5CGXA 3SS5A 1TVFA 4E3IA 1TEMA 4K0XA 1GHMA 2A49A 3AGEA 4X69A 3HLCA 2H10A 4LENA 2WGWB 5FATA 5EVID 4GKUA 4WMCA 1BLPA 5DF8A 1E3UA 1I2WA 1S0WA 1YT4A 1Z6FA 3FKVA 2Y4AA 3G2YA 4GDBA 4DE3A 4KG2A 4GZBA 4MNRA 2XFTA 1IKIA 3LCEA 3UNWA 1CI9A 2C5WB 4OH0A 1DJCA 3HUOA 2HP6A 4FH2A 2Q9MA 3IWQA 1I2SA 3GRJA 1RCJA 1XGIA 2H0TA 3OZHA 5A90A 1Y54A 3EQUA 1PW1A 2R9XA 4EQIA 3MKEA 4DDYA 3GVBA 4DXBA 2I72A 2WZXA 3IT9A 3BFEA 2P74A 3W4PA 4QY5A 1E4DA 2HDRA 2PU2A 2EX2A 3HUMA 4OQGA 4JBFA 1ESUA 4JPMA 4K91A 4XUXA 3ZGAB 4DXCA 3A3JA 3OCLA 3SH8A 5CGSA 2DRWA 1BUEA 5M18A 3BECA 4B4XA 1BULA 4M3KA 1K4EA 1CEFA 1ONGA 2FFYA 2G2WA 4S2IA 1ES4A 4E3KA 5EVIA 2V20A 4E3OA 4PM7A 3UDIA 1ES3A 3G4PA 5KSHA 5DTKA 4Y0UA 3HLEA 3UPPA 1MBLA 5FQMA 4QD4A 2OV5A 4ZTKA 4OP8A 3IQAA 2VGKA 5HX9A 1BLCA 2EFXA 4OLDA 5TR7A 1KVLA 5G18A 5GHZA 1ZKJA 1IKGA 1KE4A 1FR6A 4KQQA 3BFGA 5HAIA 1YMSA 5TGFA 1N4OA 3UPOA 1Q2PA 1U60A 3JYIA 2XGNA 5HAQA 1BSGA 1K56A 3BM6A 3N4IA 1YQSA 1EWZA 2J8YA 3WS1A 1FCNA 4R3JA 1EROA 2XEPA 2XLNA 1ZC2A 2UWXA 1HZOA 4GNUA 5EOOA 4KZBA 1PWGA 3ZCZA 4KZ4A 1K54C 2Y55A 3O86A 3ITAA 3LO7A 1C3BA 3VSLA 1LHYA 3BFCA 2ZC7A 3E2KA 2BG1A 3SH7A 4KG5A 5CECA 3PBQA 2ZQAA 4ZAMA 1O07A 3UPNA 5HAPA 3N7WA 1K25A 4KZ7A 2EX6A 2C6WB 3IF5A 3O88A 1MKIA 4FCFA 2ZJ9A 4BJPA 3V5MA 4P85A 3CMZA 5GHXA 5E2FA 1K55C 4DF6A 5CGWA 3N8LA 2ZQ8A 2OLUA 2ZM8A 3HLGA 2HP9A 5F83A 3VOZA 3V3RA 3SOIA 1VQQA 1BLHA 2RL3A 1K38A 1M6KA 1ONHA 3C7UA 1BTLA 3CG5A 4HBTA 4QHCA 1NYMA 4PMAA 4R1GA 3ZG5A 4S2KA 1XX2A 1PZPA 4S2NA 1L0DA 4WYYA 3NDEA 4Y7PA 5JYPA 1AXBA 4OPYA 4ZDXA 4B88A 3ISGA 5EUAA 5TFQA 5HW3A 1YM1A 3G34A 3V39A 1DY6A 3ZG0A 4LV2A 2PU4A 3M2KA 3IXDA 3OPRA 3VP3A 4C6YA 3GR2A 2ZQDA 1L0FA 5E43A 3Q07A 2QMIA 4YFMA 1K4FA 3UO9A 5DVAA 4PM6A 3VFFA 1WYBA 5IHVA 1BLSA 3CZDA 3NDGA 5FQKA 4JKTA 3UY6A 4DE1A 1IELA 1NYYA 5EPHA 1QMEA 2H0YA 1K57C 4KZ8A 3VP2A 1W7FA 1XA7A 4KG6A 1YLPA 4RX3A 3BLMA 4X53A 3GMWA 5A92A 3Q7VB 5GLBA 4QU3A 2ZC6B 2XD1A 3IF6C 4CJNA 4R3BA 3N8RA 3MZFA 5AQAA 1BZAA 4EV4A 3RJUA 1NXYA 1E3UD 4GB7A 4IVIA 4X68A 3S4XA 4D2OA 1LI0A 4PM9A 1YLJA 3SH9A 4L0LA 4DE0A 5AQBA 3C5AA 1SKFA 2FFFB 1FCMA 1XP4A 4UA7A 2DNSA 3FKWA 1MWUA 3CJMA 3HLWA 4OPRA 4R4RA 2ZQCA 3BFFA 4DRTA 1XPBA 1IEMA 1PZOA 2XD5A 3HLDA 3G35A 4JXWA 3W8KA 1OMEA 4NK3A 3HUNA 1FSYA 3BLSA 3DWZA 3QNCA 2EXBA 4QY6A 3PBOA 4JF5A 3RXWA 4OOYA 2Y2NA 2WKHA 4OPQA 2Y2JA 2WZZA 4P87A 2WGIA 2Y2MA 4OLGA 1CEGA 1G68A 1BT5A 1H8YA 2A3UA 4O7DA 2ZLYA 5CHJA 5E2GA 1K57A 5FQQA 4EWFA 4PPRA 3ZFZA 1JTDA 3FV7A 4ID4A 2ZC3B 4Q8IA 3B3XA 2RCXA 2QZ6A 3ZVTA 4E3LA 4MEZA 2V2FF 5CHUA 1FCOA 3UE0A 3ZNYA 5M19A 1IYSA 1RGYA 1GA9A 1XGJA 4OQIA 3VP1A 3C4PA 5JYOA 1O7EA 1L0GA 1J9MA 1XA1A 3WWXA 3OPLA 3PBRA 4LCLA 4LV0A 1RGZA 2J7VA 4BD0A 2EX8A 3G2ZA 5HL1A 2ZC4B 4KZ6A 5EE8A 3M6HA 1W8QA 2P9VA 4GDNA 2XH9A 1WYCA 1KE3A 1G6AA 2Y59A 4OPZA 2Y91A 5DTSA 2WKIA 2Y2HA 4KZ9A 4FSFA 4R23A 1XKZA 3A3FA 3BRMA 4BL3A 3GV9A 4E3JA 1LL9A 2HP5A 5EVLA 1KGFA 1KE0A 1FR1A 4EBNA 4JLFA 1K54A 2IWCA 4PM8A 2P9VB 4MBKA 4OVDA 3IH9A 4ZBEA 3UE1A 1NZOA 5EVIB 5CXWA 3SS3A 3IXBA 1SCWA 4IEDA 4R4SA 4YINA 3MFDA 4MBHA 2IWDA 1W5DA 4Z9QA 3Q1FA 3DTMA 5GLAA 2ZM0A 1YLYA 5FQ9A 1YLTA 2Z2MB 3MXRA 4JXGA 1IYPA 2BLSA 3G31A 2PBYA 5A93A 2XQZA 5FASA 5J8XA 5GL9A 3V3SA 2JE5A 1SDEA 1LI9A 4HBUA 2OLVA 1Q2QA 2HDQA 3NC8A 2VGJA 4DDSA 5L2FA 1GHIA 3PAGA 3VFHA 4S2JA 3VSKA 3O3VA 4JF6A 3IWOA 3DW0A 4IVKA 1ALQA 1QMFA 4Y0TA 3OC2A 1K56D 1HD8A 1W8YA 5M1AA 3SS4A 5KZHA 3ZNTA 4B4ZA 4HESA 3IHBA 1ZG6A 3E2LA 1K55A 2XK1A 1KVMA 3FYZA 1N9BA 1TDGA 1CI8A 4BENA 4BL2A 5EVIC 1KGEA 4S2PA 3ZVWA 2ZQ7A 4JXSA 4A5RA 3A3EA 4S2NC 4QJGA 2WGWA 4WZ5A 4H8RA 3VOYA 1ES5A 3HL9A 4WEJA 5FI2A 1NZUA 3EQVA 2WYXA 3NBLA 3IF6A 1NY0A 3VMAA 2Y2QA 3A3IA 3I7JA 2HDSA 1GCEA 4KZ5A
chains in the Genus database with same CATH superfamily
4Y2FA 2CRUA 4Q0JA 2VDBB 4AI6A 2OQ4A 3IHAA 3K92A 1KDSA 1GHPA 4MB7A 1OAIA 2GX5A 4Y17A 1NRFA 2CHGA 4MH0E 3F7SA 3MG1A 4JGRA 1G3IA 1IQYA 1Z09A 3NIAA 3NQYA 2J9PA 5ITXA 1JBTA 1OTBA 5I5LA 2JN7A 1UW1A 2R4IA 4DKIA 4G4NA 3ITBA 5EXPA 2H0GA 1CK3A 3U2AA 2JKRM 3NBRA 3S22A 4KQRA 1BVSA 2UUAM 1IXSB 3PNYA 4B7HA 3JPUA 1XFQA 2WAEA 1RSNA 3E98A 3VE3A 4U0XA 4E3NA 2B5RA 5CHMA 3IX3A 3H9WA 2V9AA 4CISA 1X1XA 1CQAA 1LL8A 4E3MA 3HVFA 4NRWA 1BNFA 2STDA 5CEDA 4ZJ3A 3GZXB 1BNEA 4XDVA 4BTXA 1G59A 2MROB 3C3DA 3OPPA 4LG2A 1V9ZA 1IV7A 3MKFA 3U6CA 5HD3A 4RNYA 3ZG9B 1RGEA 1C7YA 1TS6A 2UXBM 4IBIA 1G02A 1Q40A 3SEDA 2Y2IA 3UMEA 3HIIA 4E6WA 3DAVA 1BNJA 3LT9A 3DTKA 4LCMA 4OQHA 3ZG7B 1RTUA 1K41A 3PYJA 3LQQA 3JUOA 3GDIA 2LVOC 5D3OA 2FGTA 2K54A 5A91A 4Z8XA 4DJ2A 1JV2B 2K31A 1I2GA 3UNLA 1VB6A 4UHUA 5HSQA 4Y15A 2JY7A 2WGOA 2A24B 3K3CA 4PM5A 1F2KA 4HAAA 1MWSA 3OTOM 4HOHA 5F69A 3C8CA 1ESIA 3MZDA 3QP4A 3BNDA 2V1BA 1PI4A 3M0EA 3LTAA 2ACGA 4ZJ2A 2VGLS 1WGLA 1XHBA 3HHYA 1XWIA 1O7MB 4RNAA 4FWDA 5AYSC 4QB8A 3WS5A 1GSWA 4HEFA 5FAOA 3ZDJA 4NXMM 3DUKA 3Q7VA 2B95A 4XBTA 4RF0A 3BYDA 3NWLA 4HH3A 2XFSA 3N6IA 1J5EM 4HBRA 1ORYB 2GBXB 3LTCA 1UGHI 4FMCA 2JC7A 2M5ZA 2NQ8C 1JWPA 4HOIA 2CW9A 1TH3A 3GLFB 1XXHA 1OHOA 2UGIA 2R41A 3FTCA 2KAAA 4EETB 1BVIA 2EXAA 2ZAOA 3F8HA 5ITUA 1NHGC 5AIFA 2M7VA 4EUZA 2YR0A 1IYQA 3TL4X 5F6AA 1T1AA 4DE2A 4R4KA 2CC1A 3LY3A 1AY7A 4PD2A 2INXA 4WHAA 2VQFM 3NCKA 4LV1A 4FCZA 2GXFA 3W2ZA 4PDGA 5HL6A 1QDRA 1I70A 2BMRB 3S7OA 2Y2PA 1TH2A 1JR3D 1LQMB 1N8QA 1SPUA 1ULIB 1ERMA 2WAFA 4GHAA 1ES2A 2W3DA 4EEPA 4BTWA 1NWZA 2B1XB 3TJZC 1CYVA 4OQ0A 5TJJA 2FNAA 3K5TA 5AVEA 3NI9A 4JF8A 4X6TA 5CX7A 4FR9A 1SZVA 4P6BA 1PYLA 3GRYA 4BD1A 3HREA 2OOBA 4KENB 3AJIB 3U60A 2EFUA 3E4QA 3OXAA 1ZV1A 1YLZA 3A0VA 2CEAA 3QP6A 5FAQA 1IFYA 1Z59A 5EOEA 4QOZC 1YSQA 2DKLA 1F9IA 3UN7A 2LTUA 5KSCA 1W63Q 3HIGA 4BLCA 1VQP3 1YSPA 4GCZA 2Y2OA 1FGQA 4XXRA 4LSOA 2KZSA 4N92A 4DR1M 4FH4A 1ZS7A 1QALA 1M40A 5GLDA 5AIHA 4X56A 1W6CA 1ZX2A 4GD8A 4M0WA 1WMNA 3SXXA 1Q814 4MN6A 1PNEA 1DGGA 2IWBA 5EP4A 2C4BA 3O87A 4MGHA 4BLMA 4NSOB 4IBCA 3GRDA 2ZC5B 5IWAM 1MN3A 3V50A 1H8ZA 4BWIA 4LRXC 3B7ZA 4AW4A 3AGEA 3AOEC 2WGWB 2G3QA 5FATA 4MMZB 4GKUA 3DBAA 2CHQA 3G2YA 3SW1A 1PRQA 1IBKM 5IG0A 1O7HB 4GZBA 5IS1A 1EIJA 1SXJD 1HKXA 4HJ4A 1IKIA 1I3IA 2IUJA 1CI9A 4HZBB 1UCJA 4HJ3A 3UNWA 2C5WB 5BR8M 1BUQA 1DYUA 1DJCA 1YIT3 2HP6A 3K0ZA 2Q9MA 2L4FA 4DR7M 4O8GA 3WHLA 5IW9A 3GRJA 4PHTA 3PS8A 1RCJA 5L09A 3OZHA 4F1IA 3Q8GA 3KP1E 4HL4A 3VOLA 2K9DA 3IS2A 3IT9A 4DV1M 4DXBA 2P74A 2GEXA 1E4DA 1IK3A 4DR3M 2EX2A 3F1OA 1NNUC 1IV9A 4XUXA 4DXCA 1JJ22 5IREB 3A0RA 1RNTA 3CCV3 3KSJA 2X49A 3GPYA 4F3LB 4B4XA 1LQGC 4HM4B 3T4JA 4MEZA 3Q3FA 4HNBA 4R3DA 1CEFA 2XLJA 1LVNA 1ONGA 4I3IA 1JNQA 4S2IA 2JY5A 1ES4A 2LH0A 1ES3A 1DVCA 1QAMA 4DV3M 4LEHA 1VQ53 4N6MA 8CATA 3UPPA 4ETXA 3GLIB 4DN0A 4Y5FA 3IQAA 5HX9A 1DMQA 5G18A 5GHZA 2K2NA 1ZKJA 1DP8A 2KDKA 4M9ZA 1IYYA 4B7GA 3BQ8A 3MFXA 1O7PB 1YNVX 1V33A 3U6DA 2XGNA 1K56A 1XXHB 2J8YA 2CFGA 4R3JA 3B7QA 5ITRA 1ZC2A 2Z7AA 5EOOA 4KZ4A 4RKUF 4PT5A 4EV5A 3K3DA 4LRSA 2BG1A 3MQOA 3SH7A 5CECA 3VK8A 1JNUA 3FRHA 5IG4A 1S5AA 3LT8A 4KZ7A 2EX6A 5KPZA 6RNTA 2C6WB 3O88A 2OAP1 3NXJA 2ZJ9A 4EQ1A 2PNCA 1HJPA 1OAOC 3SOAA 3LYXA 5GHXA 1K55C 2LHGA 3VDUA 4DF6A 1BSBA 3HLGA 2ZM8A 2HP9A 2RGOA 1VQQA 2OO9A 1M6KA 3QK9A 1W02A 4HBTA 1UI8A 5CK6A 4WFOA 5FTJA 1GSVA 4S2NA 2WSCF 4FMBA 4I81A 4UN2B 3L27A 3EN8A 5JYPA 3JUQA 1KD14 3NOUC 4OPYA 3UMDA 4B88A 3A5EA 5EUAA 5EP3A 1YM1A 4OW0A 4IBKA 2ML6A 3GLGE 4BIRA 1I8VA 1DY6A 1N9NA 4YHHM 3IXDA 4GITA 3CF6E 3L29A 1RCKA 3CUEC 2ZQDA 1L0FA 2GZAA 2C11A 3Q07A 2JNHA 2JWSA 3F8XA 4EW7A 2QMIA 3GQ3A 5DVAA 5EVHA 2CKFB 4IIAA 2SBLA 1WYBA 5IHVA 3HX8A 3CZDA 4AKHA 3NDGA 5FQKA 5F5YA 1GSPA 3TWLA 2Z6DA 2M60A 3SASA 4CLCB 2LVQD 3CCQ3 3ECFA 1BUJA 4LF6M 5IU1A 3EIHA 1G6OA 1IBLM 3VP2A 2GJ3A 4NKPA 4KG6A 3UJMA 3GMWA 2XROA 3SYLA 5BIRA 1Z1SA 1RCLA 2CIUA 1QZEA 5EQTA 4JI2M 1BU4A 3KN4A 3RNTA 3F7XA 4W5WA 4L8RC 1NY5A 4WYKA 1C54A 2OOAA 1HLUP 2UV0E 3BLZA 5EJCA 1LI0A 1S4RA 3SATA 3MMHA 4L0LA 2QEX3 4DE0A 4UQIS 3S67A 5AQBA 5LBRA 4CIZA 1FCMA 1OPXA 3U6EA 3CNMA 3FKWA 3CD63 1GMPA 3HLWA 4GS9A 4OPRA 1B20A 2P09A 1T43A 2XD5A 3H4MA 3G35A 4JXWA 3W8KA 1TRQA 3BLSA 4EIWA 3DWZA 1EQKA 2EXBA 3QNCA 2LWXA 4QY6A 5C1BA 2JA2A 4EW5A 3G0KA 2C9OA 2DAGA 4JN6A 4DV0M 4MMXB 2Z6BA 4OPQA 4DE1A 1G8PA 4G1MB 4OLGA 1HQCA 1H8YA 2A3UA 4LF5M 4AG5A 5STDA 1LXEA 2ZLYA 1N9LA 5D82A 2HAKA 4HM1B 4N6TA 4BU4A 1YE9A 2QENA 2RCXA 2QZ6A 3ZVTA 4KO8A 1KOUA 5CHUA 2BNGA 3UE0A 4FCTA 3KSGA 4MM3B 4BBUA 1BRSA 1JN5A 5M19A 1NY6A 1XGJA 1TR8A 1O7WB 3T1QB 1MNLA 4K1VA 2NUPC 4NXFA 2W0NA 2P5TA 4LCLA 4FWHA 1RGZA 2J7VA 2VZWA 4BD0A 4Y13A 3G2ZA 2DWNA 1GS3A 5HL1A 3B89A 2W03A 1XXHE 4KZ6A 1W8QA 4KFDA 5ITTA 1KE3A 2DVWB 2VV6A 1YKDA 3HU3A 2DWZB 1B27A 3H4JA 3P01A 2UXCM 4REZA 4KZ9A 2F5SA 1XKZA 3UB5P 1BSDA 3GV9A 3ICYA 2FNQA 4KUOA 3L26A 4LGYA 4EC6A 4AKZA 5EVLA 1KGFA 1K54A 4FW9A 1GJTA 4ZBEA 3JVCA 3SS3A 1A90A 2K0MA 3G713 4YINA 2HOHA 1V34A 4MBHA 1NNJA 1N9JA 5IEPA 3CF0A 3DTMA 4BBTA 4CHTB 4X2HA 5GLAA 4OU7A 2ZM0A 1S1YA 4KQDA 2K0BX 2ZA4A 1YLYA 5FQ9A 2BMQB 3DGMA 1L2CA 5HOHA 4O01A 2Z2MB 1RGLA 1UWPX 3LR4A 5FASA 1OF5A 5J8XA 4R70A 1IXRC 5L07A 3LVVA 2JE5A 4XBYA 2D7HA 3UGJA 3MPHA 2HDQA 3C38A 1UFZA 2VGJA 3NHXA 1IFQA 4DDSA 5L2FA 1VQL3 1RN4A 3PAGA 3VFHA 5L8RF 3VSKA 5AJGA 3NBXX 3O3VA 2R78A 3DW0A 2IA2A 5IEOA 1ALQA 4PDIA 4Y0TA 4CJ6A 3Q2PA 5M1AA 1HD8A 2J3TC 2O0YA 3J2PB 3G6OA 5KZHA 1SG9A 3H82A 1SJWA 1M9GA 3IHBA 2L4EA 3AHWA 4HM2B 1E3VA 1MGWA 3E2LA 1CUKA 4QNMA 3SLUA 1QVF2 1CI8A 1D0KA 5EVIC 4S2PA 1QVRA 2ZQ7A 1IVWA 2GQFA 3TE6A 1P97A 2CWBA 1C7HA 1SARA 6STDA 2KW0A 1R4YA 3HL9A 4WEJA 3CLOA 1B2XA 2VIIA 1OIZA 2GSPA 2VEAA 3NQZA 2WYXA 7RNTA 4KODA 3VMAA 2X8AA 3K1JA 3FKAA 1PU4A 3I7JA 3F92A 4L9EA 5HWVA 2HCBA 1LOYA 1BRIA 2H5SA 3L9KA 1UI7A 1W79A 3QRDA 4GD6A 2PD8A 4EBLA 4XBOA 1OTDA 2W1TB 3KOZE 2KF6A 1W5TA 4HJLB 3HX3A 4WP2A 4Y0OA 2CV1A 1FOFA 3HJIA 4AKGA 3FZWA 1L1ZA 4G3VA 1M1K4 1FW7A 1QZMA 4CCVA 1TUHA 5HDDA 3TSGA 2O9CA 1D6YA 2WKEA 5CF2A 3DTEA 3CC23 2HPBA 2QPNA 2ERCA 2F5QA 3GLGB 5JPUA 3N9HA 1K9M4 2VLGA 3UDXA 1G71A 4FMAA 4LMIA 1TU5A 4GN2A 2KX6A 3MXSA 3FUUA 2MC8A 2C9CA 3BIRA 1T5YA 2LB9A 4OOMA 5GLCA 4KQOA 2C98A 2QJ5A 5LC7A 1SXJC 3LIDA 2Q9NA 2E2VA 3PR6A 4KUKA 2BO9B 1YVBI 5FDHA 3GQZA 5HFOA 3I51A 3A42A 3KOYE 1QMAA 1WMPA 4GIPA 3SOYA 3FUWA 3RXXA 4F94A 3IX8A 3KYEA 2E8IA 4I3JA 4HVNA 1IBMM 4K0KM 3E4PA 4L8PA 2Z2LB 1Q40B 3LGOA 5KPRA 1DGHA 4FWGA 2JKTI 3BFDA 4M0DA 2Y74A 3IXGA 3PXMA 1JBSA 5C18A 3W4QA 3NUVA 3FTFA 3HGIA 3Q81A 4WZ4A 1D0LA 2O9UX 3AGFA 4X1LA 1H5XA 5HARA 1Q9EA 5L10A 2WADA 2PR5A 5C5KA 1RLSA 4FD8A 2QBYB 4LZZA 1YMXA 4G4RA 2MR9A 5HWWA 2W56B 1WR1B 1E9SA 5FI6A 3SC3A 2ZD8A 3MHVC 3T6PA 1UGIA 3TOIA 4XBXA 2CWVA 3FF2A 2PDRA 4HY8A 3C30A 4KFFA 4GKKM 2R9WA 3GLIE 2ZQ9A 3E4OA 3T1HM 3LIBA 2ZOIA 2IUKA 4L9GA 1DO2A 3WOEB 1VEJA 1ZGXA 3K8ZA 1HVBA 3PBSA 5FA7A 4QHSA 4R9LA 1LT0A 4M4XA 1IVVA 3CU3A 1HYFA 1DJBA 4UA9A 1W5SA 4LGQA 1PIOA 4GLQA 4MLLA 1PFPA 1PYYA 4JXJA 3GZRA 1QYRA 3T8UA 3BEBA 3AL0C 5FQIA 9RNTA 1IN7A 3J7AS 1LL5A 2O5RA 4MBFA 4IJFA 2ZANA 3SVAA 3CCU3 1BOXA 3FZCA 4JXVA 4WEKA 1JWZA 6GSPA 3GTCA 1HR0M 4R0QA 3S1YA 1ZMWA 2KEBA 3GLFE 2FS1A 2F5PA 3B4OA 2L4VA 1VETB 3R9XB 5K5BA 3CITA 4WP5A 1LOXA 3SX1A 5KQ8A 1MY8A 4S2MA 3ZQJA 3A45A 3RTYA 2DWLA 2HF6A 3STDA 2WZJA 2VJWA 1L5GB 2OQEA 1JB4A 2VF8A 3KSXA 3LVWA 4LF4M 2P05A 1LSXA 2AHMA 4BBAA 5ITQA 5G1KA 4IUKA 2X02A 3PBTA 1L1TA 2QKPA 1XJ6A 5E2EA 3PZWA 4WZ5C 1OTAA 1L0EA 1JKGA 3VSYA 2VQEM 2I9VA 1HNWM 1TP6A 1T19A 2Y2LA 1PW8A 1LOVA 1BNGA 2E8JA 1T3BA 4AEQA 2VA0A 5CEBA 3C4OA 4JI4M 1D6ZA 2BWEA 5CERA 3K63A 4FD2A 1OGZA 4ANRA 1ZG4A 3AGDA 3FWLA 3LOYA 2XA7M 1RDSA 2H1RA 1CEWI 2QP9X 1HT1E 1GLNA 2ZM2A 1VQM3 3LY4A 2I9WA 2DMWA 5ITYA 1ROAA 1TVFA 1B2MA 4B3MM 2CH9A 1Q7Y4 2A49A 3S27A 3KSIA 4ZPXA 2OWPA 3HLCA 2R46A 3RGAA 1GL7A 4MGIE 2KF5A 3U6OA 1XJ4A 4WMCA 1YT4A 3KIIA 3FKVA 2Y4AA 4DE3A 4JI3M 4MNRA 2XFTA 2PAVP 5FDSA 3EBTA 4YOFA 1QAFA 2MJ6A 3QP1A 2DAIA 3C58A 2RSXA 3LTBA 4X64M 4OH0A 4DV7M 1ZTUA 2J3TD 1FA3A 4HYZA 3IWQA 2EO2A 1Y4OA 2SARA 1RN7A 1GMRA 1OCVA 2W6JH 1VDDA 4XK8F 1M1XB 2H0TA 3RFWA 4JV5M 4MJDA 4DV6M 3EQUA 3MK6A 2K3DA 2OOVA 2GBWB 5KO3A 3FKEA 3CUEA 3W4PA 4QY5A 2MJ5B 4X66M 4PKYA 3ZGAB 3HUMA 4OQGA 1RMSA 1OF5B 5RNTA 4GMQA 1IN5A 4HLQA 2ZL8A 5LMUM 3T12B 2DRWA 3J80S 5M18A 3NJAA 4M3KA 5DKLA 3MJ5A 1A0KA 3H3HA 1RGGA 1WXQA 1UM8A 1IY0A 4GH9A 3T8NA 2FFYA 2G2WA 3B42A 5EVIA 2XSZA 2V20A 4PM7A 5FTNA 4DBGB 5DYIA 3DZLA 4CLCA 1ULJB 4O8SA 3TDGA 2JY8A 2Z76A 1BLCA 5TR7A 2RNTA 1KVLA 1NRJA 1IKGA 1BSCA 1FR6A 3LCUA 3BFGA 4KQQA 4Z6YA 3I563 1VQ83 1YMSA 4EEUA 2LVNC 1KC84 1Q2PA 4CDLA 2WOHA 3JYIA 1BSGA 4FCMA 3BM6A 3N4IA 1WIVA 1FCNA 4LJAA 1EROA 1VHMA 2XEPA 4GNUA 3BB9A 1H6UA 5A2QS 5J7EA 3ITAA 3LO7A 2YX9A 3VSLA 3E2KA 2ZC7A 3CI6A 1WQLB 1BGSA 5EXTA 2D1WA 4WL9A 3UPNA 3GRVA 3AHSA 5FL3A 1JZDA 3GZYB 5H37D 4R80A 5EV0A 3GQ5A 4BJPA 1TJDA 2J3WA 4P85A 3CMZA 4XDWA 3WDGB 4LFUA 5CGWA 3DM8A 1JZOA 1YPRA 2C5RA 1FJGM 3VOZA 1GL6A 3BWLA 2R62A 1N77A 4EV2A 1MGRA 1Z5BA 3LR5A 3SOIA 1VQO3 4HJ6A 3CG5A 4QHCA 3PHYA 4PMAA 4R1GA 4S2KA 2L09A 2LQVA 1L0DA 4WYYA 3EB8A 3M8CA 4AFIA 3CHWP 1NU3A 2KNAA 3A76A 2FZ0A 2KA6B 4ZDXA 4IBBA 2A15A 3GZBA 2IY2A 1BRGA 3Q8XA 3CPW2 3KOWE 2CP8A 5DRVA 3WMDA 3G34A 4LV2A 3UB8A 3W67A 4J8TA 4QWTA 4II7A 2O25A 3SYKA 3JAMS 3OPRA 2FOIC 1R6BX 2VKSA 3GR2A 3F1PA 3V76A 2W1TA 3KP0E 3FC7A 1HQYE 3SHFA 3UO9A 2H28A 1Q3BA 5DFYA 1BLSA 5HZHA 3JVVA 2HMLB 3LICA 4JKTA 3PXGA 4LF9M 1NYYA 1PM5A 5AEUB 7CATA 1OQYA 3CPTB 4KZ8A 5DYGA 2E2TA 2KF4A 3F9SA 1BRJA 1XA7A 1VEUB 1YLPA 4X53A 5A92A 3Q7VB 3EBYA 3EHCA 3KZTA 3IF6C 3R7WB 2Z7JA 3LTDA 2K47A 2LVPC 1V74A 3MZFA 1LOWA 3N8RA 5DJUA 1NJGA 1MKMA 3VV4A 3S4XA 4D2OA 3F1OB 2CX0A 4AG6A 1TFKA 1N8R4 1C1KA 2CC3A 3LI9A 3C5AA 2HMKB 1BNRA 4NPBA 3TRCA 1DMNA 2FFFB 2PZVA 4L6V6 1MWUA 2DAKA 4EUVA 2ZQCA 2JKFA 1IEMA 1TDZA 1TFOA 5AIIA 2QWSA 1PGYA 4PCZA 3HJQA 3KCHA 4B9OA 1BYWA 4NK3A 3E0YA 3HUNA 1FSYA 1E94E 2W2CA 3PBOA 3HKPA 2Y2NA 2L1SA 1IY1A 2WKHA 1RJOA 2ZBKB 4P87A 2W3HA 5GKNA 1JR3E 3B74A 4WF0A 2WSEF 4N6LA 3J7Yd 1CEGA 5E2GA 3A46A 4N6V0 5CHJA 4EWFA 3U6SA 3LMLA 4PPRA 3AMOA 4ID4A 3I01M 2ZC3B 1NVMA 2ZDJA 3B3XA 1WJ7A 4LY6A 1DVDA 2QGUA 1P0ZA 3P7NA 4E3LA 1FCOA 1LSWA 3HHWA 4IBFA 4NXGA 1GA9A 3VP1A 4WLAA 4NXNM 1L0GA 4G3KA 3LMMA 3HU1A 3FGYA 1KQS2 1J9MA 1NLZA 4Y3IA 1T2IA 3KE7A 3L2AA 4K1UA 4GEWA 1DMMA 3RGSA 3PBRA 4LV0A 1IM2A 3MG2A 3UMMA 3RGRA 1VQK3 4BTYA 5FLXS 4JGOA 2R44A 1DP9A 1NJFA 2P9VA 2XH9A 1WYCA 3ULFA 3T50A 1YHQ3 3FG3A 4OPZA 4NOOB 3H51A 5DTSA 3FUXA 1WGNA 1W5ZA 4FSFA 4R23A 5FW5A 5LMNM 4K90B 3DFZA 4DV5M 3H7WA 2QNJA 1KE0A 3OBFA 2JP7A 1FGMA 2IWCA 4PAUA 1QAOA 3B4PA 3NULA 2JY6B 1OT6A 2KRUA 2O01F 4OVZA 3IH9A 4OVDA 2CFDA 1Y8GA 1NZOA 3QP2A 5CXWA 3UE1A 2BASA 3BBZA 2LXEA 3KFUG 1X1UA 4Z9QA 3Q1FA 2UXDM 4B7FA 4I4KA 4I8OA 1EG9B 1E32A 1K82A 3VE4A 3UK6A 5BVBA 2LHCA 2BJVA 1N36M 5D83A 2W3FA 2L1MA 2GU1A 3NV0A 3V3SA 1KFVA 2N35A 4YY3M 4HBUA 2W9QA 2Z4SA 1Q2QA 1BANA 2XR8B 4HQAA 1GYBA 1LV7A 2Y0QA 4S2JA 3IG8A 2YFJB 4Q0IA 2PBDP 1QMFA 2BHMA 4I38A 3L25A 4O02B 4HM0B 1W2B2 3SYUA 4X1MA 2XSHB 4HESA 1ZG6A 1G4AE 3EGDC 3HJ8A 3CXC2 1K55A 2XK1A 1KVMA 5J4EA 1N9BA 2J7OA 3ILKA 3QYEA 2XRXB 1P9RA 3HCYA 1Q3CA 4JI6M 1G0TA 2HKJA 5TGNA 4N6NB 4QJGA 1JB0F 4P17A 3IBJA 2MGWA 5EFWA 3UB1A 2JKGA 4LFBM 3EQVA 4MGKE 3ZYTA 3NBLA 4EU0A 1NV9A 3VDPA 4Q7JA 2Y2QA 2HDSA 2D42A 1LRAA 2EWWA 3HJKA 4KFEA 2DCFA 3OCNA 2B3TA 5AQ9A 2X71A 5HGRA 2BTFP 3IF6B 3M2JA 4NXBA 5I94A 2BMOB 2VGLM 5CTNA 5EECA 1NV8A 2CK3H 4QHTA 3DWKA 2CFKA 1S67L 1H0MA 1YLWA 3GRUA 3OPHA 4GOGA 4GHOA 4XT2A 3G16A 3N8SA 5TBMA 4BQMA 1OTRA 1GY5A 3LZAA 4TX4A 1V58A 2G8LA 3HI7A 3OWSA 1M904 3KKGA 2WGVA 2W3GA 3EQQB 3HK4A 2ZMAA 4EXRA 3G32A 2X01A 3Q7ZA 2EKFA 1BAOA 3GSPA 3PBNA 4NEED 3SAVA 2V1AA 3IH8A 3P98A 3KO6A 2EX9A 2XDMA 2Y2GA 4O3VA 3ZHHA 4CLCD 2YNMD 2DI0A 3FG1A 1L2DA 1NLYA 3LEZA 2FE8A 3GO8A 2P0XA 2LB5A 2DZOB 4GJ4A 2QIYA 4D80A 3HZPA 2YQZA 4JF4A 3UDFA 3EEAA 1IOUA 3IXHA 5DTTA 4OOLA 1K6SA 4RZMA 4LF7M 2KRKA 1GSXA 1X1YA 3KSHA 3RGPA 2WOFA 3EX9A 2ZTCA 3MF0A 3T0UA 1GMQA 2HDUA 1QAKA 4STDA 2D7GA 4R7GA 2HGVA 2ZBBA 4P6ZM 4JRFA 1LLBA 2KNVA 3KX0X 5KMWA 1VEKA 3UZUA 3G30A 4J9AA 1VM1A 4C3QA 1PFLA 4B3SM 2INWA 3I04M 1JB2A 2EA9A 2ZL1A 1E25A 3D3LA 1T2HA 5EXXA 1D0MA 3FUTA 1XNQM 3Q90A 3CPTA 3LIEA 4C75A 3DTIA 2XRNA 4N9KA 1OUNA 5A0OB 3CME3 1WE4A 1SXJE 2FH0A 2XA7S 2WK0A 2VV7A 2QJ7A 2ZOHA 5U47A 3WS2A 3WRTA 3DOAA 1F98A 5F82A 4IJGA 2VF7A 2HJ9C 4DUZM 1DJAA 2RCDA 1KGGA 3F1PB 3U6MA 4LGMA 3MYTA 2OWJA 5HDSA 1XMOM 1MWRA 2HJEA 2OSUA 5E2HA 4RVAA 1TTEA 3U5ZA 4RNZA 5CRFA 2O9AA 4LLOB 1RGCA 1JWVA 3DY5A 4NG2A 2JKTM 4RX2A 4ZJ1A 1XB2B 3M6AA 1GKIA 4L4UA 1A5TA 2UU9M 2G2UA 3P09A 1R4GA 3ROBA 1KSFX 3H82B 2AADA 4UQIM 3IJEB 5AQ7A 1YJN3 3VP4A 2YKFA 5D81A 4EESA 4X55A 2ML5A 3WS0A 4RYEA 4UA6A 1PJTA 4LV3A 1R2ZA 3HWSA 1ODVA 3WOFB 3KS4A 3WS4A 3UL6A 1E9RA 3MZEA 4IBXA 5HPIA 3B9PA 5AEWB 3X42A 3HLBA 3Q82A 5FSRA 3NX0A 3MQQA 1OHPA 2DZNB 4CLCC 1PJQA 3SAUA 3V98A 1W4NA 1MXOA 3A3DA 1Q7HA 4GHIB 3U61B 4FVMA 1JVJA 5BOHA 3S5CA 2QHOB 3PAEA 3IHPA 1V92A 1VEGA 2W9PA 4LFCM 1PY3A 3T15A 1K6RA 3BW6A 4WBGA 2L0WA 5CF1A 3GPPA 2UUCM 3W4OA 3GQ4A 3T4LA 3U6QA 1I0XA 3GLHE 2B18A 1UCIA 4U3TA 4CGYB 2VV8A 2LVAA 5JBSA 3HY5A 1GA0A 1I5QA 1W63M 3NY4A 1QVG2 4HM7B 3THGA 4OVMA 3T1XA 1HNZM 2KLIA 4HP4A 1VQ43 3IWIA 5FAPA 1FQGA 3VK7A 1A67A 1CYUA 4XB5A 2Y79A 4LGWA 1QUSA 4QOSA 2QBYA 1HTZA 2XR0A 4OK0A 1PJJA 2CE7A 1GO5A 3SS5A 4E3IA 1TEMA 2CV2A 4K0XA 1GHMA 1UUGB 4X69A 1WMOA 4RNTA 1BSEA 3LI8A 2H10A 4LENA 2DHRA 3S7PA 3F1NB 5EVID 3FF0A 5DF8A 1E3UA 1I2WA 1S0WA 4QWOA 1T6OA 1Z6FA 3A98B 1BIRA 3BY9A 3SHGB 3IPTA 4J5GA 1OTEA 1FGOA 1LSVA 3LCEA 4BB9A 5CXOA 3KSFA 4EXOA 2Z4RA 1K8A4 3E46A 5EP2A 2F86B 3CCL3 3SZTA 4R1KA 4DR2M 1I2SA 3LEQA 4AQYM 1KSIA 3TW8A 2F99A 1XGIA 5A90A 2DZLA 5KP4A 3LQRA 2R9XA 4JI5M 2J5YA 3BFEA 3OWYA 3RDEA 2HDRA 2K6BA 4IUHA 1ESUA 4JPMA 4K91A 1QDTA 4NSRA 2XGLA 5IENA 1AQZA 3CC73 5CGSA 4NL4H 3TPZA 2OPFA 3KFQC 2DNAA 1BUEA 2OAQ1 3BY8A 3R7WA 3WHKA 2J8XB 2EWVA 1BULA 1VEUA 1JBRA 4OX9M 5G4YA 3U5ZB 4DV2M 1OACA 3D8LA 3IG5A 3GLFA 3FYCA 1PJIA 4ARZA 5KPTA 4E3OA 4JGPA 5I97A 3G4PA 3DA1A 3JVUA 3UDIA 2C99A 1MBLA 4QD4A 4WYKB 1T1BA 2C96A 4ZTKA 1JB5A 4OP8A 1WHCA 3NBJA 2GNXA 3QYBA 4OLDA 3AKZA 1KE4A 5EVEA 5HAIA 5TGFA 3UPOA 3T4KA 5HAQA 2V6ZM 1CH0A 2W3EA 2J7NA 4X65M 2Y21A 4PEJA 2EUCA 4KZBA 1PWGA 1K54C 2A24A 2OTL3 1TH4A 2A2LA 1C3BA 1LHYA 2YKHA 5A8BA 4KG5A 4B3TM 4NHFA 3D8BA 4ZAMA 1TF0B 3FPWA 2F4VM 5HAPA 1DO0A 1J09A 4LJ8A 1K25A 3JR5A 3IF5A 1MKIA 4J5KA 2V1UA 3DXOA 4WW0A 1E97A 2ZMVA 4O2HA 1DRMA 3VFDA 1MOLA 3N8LA 2M1CA 3X3ZA 3LR0A 1Z6TA 1W00A 3MWZA 3R8FA 2OLUA 3OX9A 3MKIA 1OIPA 4D82A 2QPAA 1BLHA 1FILA 1K38A 2RL3A 2ZM6M 3LXUX 3KSED 3C7UA 1AR0A 1PZPA 4ITQA 1VETA 2A5YB 1OGXA 3X3YA 2Z6CA 4FUWA 4R6LA 4L78A 1BRNL 1OJLA 2Z8YM 3KSPA 1WNHA 3UB6A 1OH0A 1RNBA 3T4QA 3V39A 1W6GA 3NOPC 5TBMB 3VF1A 1S3SA 3C2WA 4FTXA 3VP3A 4C6YA 2Y0TA 3UL5A 4LJ9A 3D9YA 4L9FA 4YFMA 2YFLB 3U1WA 1FUWA 1IQXA 2UUGC 3VFFA 4OUQA 1AVLA 4HM8B 8CHOA 3KW6A 3ZC7B 4IJEA 2KRTA 2QQ8A 1OFHA 2CHVA 1BNIA 1FYSA 2PYPA 4X25A 4X62M 1IDPA 3T4TA 1IELA 3E21A 5EPHA 2H0YA 3FD9A 1JQJC 2CWTA 2BU4A 3EN1B 3I0YA 2CV0A 1N9EA 1Q864 3FRIA 1SIHA 4O0PA 4RX3A 4ESPA 1BNSA 3F14A 5GLBA 2W04A 2IMJA 4H6JA 3CWFA 3AOEA 4LJ6A 5AQAA 3D9RA 1ACFA 4RF1A 2PD7A 4GHIA 4GRIA 4EV4A 3GLIA 1NXYA 1SKOB 2L7HA 4X68A 1AUAA 5LC6A 3SH9A 4WUJA 5DFLA 5EQLA 2P38A 1VZZA 3C3EA 1MX0A 2KCDA 1SKFA 2DXIA 4HHDA 2XZUA 2D7EA 3NBBA 3OW22 4KVHA 1XP4A 4G4QA 2W1RA 2DNSA 1VDLA 1K0KA 3CJMA 3SFZA 1ZO2A 2R0IA 3K7CA 2X4AA 1DE3A 3BFFA 4R4RA 1XPBA 1DGHB 4DRTA 1J7KA 3HLDA 2G5GX 1N5HA 1AV4A 1N33M 1W6YA 4LZIA 2JZ1A 2R4EA 1RGHA 3RXWA 7GSPA 4HM5B 4LRTA 2O9BA 4GS9B 2Y2JA 3IX4A 3KYQA 3DGOA 2WZZA 4YNRA 1UCKA 4QNRA 1QJGA 3NM2A 5IT9S 1G68A 1STFI 2R45A 1YGWA 1BT5A 4I3AA 1K57A 4FOFA 3ZFZA 1W01A 2Q0OA 1H8MA 1RHLA 2V2FF 1ZQ9A 3FE3A 1P9WA 3KYZA 1IYSA 1RGYA 8RNTA 4HH2A 4OQIA 1U8CB 3C4PA 4MN5A 4LCBA 5JYOA 1O7EA 1O7GB 5ELJA 1ZHHB 2JQ5A 3WWXA 3ZH9B 2QSFX 2Y20A 3OPLA 4MMYB 1D1JA 4GB5A 2EX8A 3KS8A 2F5MA 2ZC4B 2RKOA 1IU7A 3UE6A 5EE8A 4DUYM 2HMNB 1Q39A 1QAQA 1WTHA 2WKPA 2HHHM 3K9MC 1G6AA 2Y59A 2Y91A 4ETZA 1G41A 2WKIA 2JKRI 3H7WB 1S4SA 1JKGB 3LW5F 5HPFA 3A3FA 4BL3A 1RRLA 2F5WA 1L8QA 2LNHC 1LL9A 4E3JA 1UCLA 4B93A 4EBNA 1NSFA 4B08A 1FR1A 3K2NA 1V57A 2P9VB 1JRQA 1ISKA 3FPVA 4MBKA 3W0LB 5G1LA 1NJI4 2L4RA 2DHYA 5EVIB 4GSPA 3HOHA 2WKQA 2GNOA 2O3OA 1D06A 4IEDA 3MFDA 1W5DA 1UDII 5EM0A 1QQWA 3CCJ3 1FGTA 3FG8A 5JI2E 3D3OA 2CUZA 3O8YA 2GU3A 2WKRA 4DR6M 5HD5A 4HZ9B 3PGBA 1YLTA 3D5IA 3NOTC 4R38A 3MXRA 4JXGA 3GP1A 1TS7A 1XNRM 3G31A 2HV1A 2PBYA 2XQZA 3V92A 3AGOA 3U6PA 5GL9A 1H3QA 4EERA 4MCWA 2R4JA 2H0IA 1UGUA 1SDEA 4R71A 2OLVA 1DETA 3U60B 1GHIA 5IF6A 2W0QA 2HL7A 4AKYA 5DFXA 3CPOA 1ZAEA 2F56A 1TS0A 2OWHA 4IVKA 1ASKA 1KWIA 3B47A 3SS4A 3L0RA 2Q2EB 2HMMB 5IT5A 1IXSA 5BPVA 3K9OA 1DGFA 4KHPM 3FYZA 1RGKA 1I4WA 1B2UA 1EFUB 1KGEA 2XSSA 3ZVWA 5KQDA 2AVXA 2JUJA 3V67A 3FTDA 1XFNA 3PYPA 1EEJA 1GD3A 4WZ5A 3VOYA 1RU3A 1RRHA 1DGBA 2WGQA 3PFIA 3IF6A 2G7UA 4N3VA 2CX1A 1MZUA 5AYRB 1GVNA 2HMJB 3LIFA 1SXJB 4KZ5A 2V1ZA 4DJ3A 3TG9A 1K734 1L2SA 2FXTA 4GHLA 4ORLA 1JR3A 1TRPA 4Q0HA 1FNNA 5CTMA 1WA9A 3ZG8B 1TF1A 1YJ93 2F5OA 3BQAA 1IVUA 1G96A 1IQ8A 1NWWA 3N54B 2DAMA 4MN7A 1SQWA 1J3WA 1FIKA 1OJGA 1RN1A 4IBDA 2V8CA 1XXMA 2RFRA 5FTKA 2Z3XA 1BRHA 1B21A 5GHYA 4GC9A 2R18A 2KZUA 1ERQA 2I7PA 4UAAA 1PRBA 3I4VA 4LRZE 2MF7A 2WO0A 4XUZA 4GKJM 1S66L 4KZ1A 4ZRRA 4FCJA 2EKKA 3FYDA 2J9OA 3IS2B 2P08A 4IIWA 2BWBA 4IBGA 2C10A 4K0WA 4WM9A 5MC7A 3HHXA 4IBRA 1OT9A 4RA7A 2JXNA 3KVWA 3CTWB 5AVFA 4H3UA 1TDLA 1TDHA 1NJ4A 1Q824 4EYCA 3SBJA 3L28A 3NV0B 2BJWA 2ZAMA 3GLGA 3V99A 2QA43 3DGLA 2I7NA 3D4AA 4HM3B 4OP5A 4FCWA 3S7QA 4I5SA 5IG3A 3HLFA 4BBVA 1HZ1A 3QP8A 2Q07A 1GY7A 3VLFB 1G5UA 1RKYA 3E9SA 1LTMA 2UX0A 2JCHA 2YFIB 3UB7A 2BT3A 4IHQA 1I2EA 3FG4A 3I4YA 1KDWA 3PCRA 3M6BA 4S12A 1YI23 4P6ZS 4M9SA 1MWTA 3MG3A 3PTEA 3GLHB 1PI5A 1IVXA 4R3AA 1YGEA 4N1HA 1P3QQ 1S6RA 3D4FA 3X3XA 5EM1A 3B33A 3JR4A 3MR0A 4KT3B 1T1CA 3B7CA 3KOXE 4H6JB 3FUVA 4I5QA 4E6XA 1EI5A 4KZAA 1N75A 3C7VA 1NB3I 5BXQA 2W27A 2QCUA 3VGNA 1F4IA 5FTLA 4P0MA 2CWUA 1ROVA 4S2LA 4JI8M 1RP5A 1A2KA 2OTJ3 4LRYC 4I39A 4G4OA 1G28A 5EEOA 4U0TA 1XJ2A 5FI7A 4NETA 2W56A 3D5GA 2WUQA 3CCS3 4GC5A 3GPXA 4EBGA 3SAWA 3IBRA 1SHVA 5F1FA 4WWUC 1PWDA 5DF9A 2CG1A 2V1LA 1J2BA 4WMCD 3GSGA 1GOUA 3OLOA 3URPA 1TS8A 4N9LA 3QHYA 1FUSA 4S2OA 2V0UA 1GOVA 2ZHXB 1BSAA 3J81S 3TE8A 1NHWC 2Y73A 4NREA 3VP0A 3E4RA 3WRZA 2W82A 1R4CA 3EF8A 2Y2KA 3EC9A 4LPZA 3MMPA 1MPLA 3G6E3 1PWCA 4LJ7A 3PVSA 2F4YA 1E3RA 4AKIA 2JZ0A 2JBFA 2XZFA 2J80A 3WR2A 4BMWA 1QUTA 3KXEC 2GDNA 1HNXM 1GJSA 3AGNA 1Y28A 1YUBA 2GEYA 1SDNA 5FTMA 4HM6B 1B2SA 2K7SA 3PNVA 1FSWA 5ELUA 2LBCA 5FQJA 3CNXA 1MC0A 2CFLA 3A0SA 4HEOA 2DAEA 3LCVB 3W0FA 4JI1M 1B3SA 1D2NA 3BNBA 5DF7A 2XSOB 4ME4A 3BOSA 4DMZA 3MBZA 5DKKA 4F2LA 3CCR3 4JI0M 1YJW3 4LJ4A 2ZMFA 3JUNA 1R7RA 4QPRA 1XMQM 4N1XA 1IYOA 1OFIA 3T4OA 2EJSA 3S29A 4EBPA 3FLJA 2CFWA 1CQSA 1JTGA 4B3RM 5L8MA 4PKYG 5F1GA 2ZL1B 4OKPA 4MDZA 4WELA 2XF3A 3CGWA 5E6JA 3BXWA 3QNBA 1DV0A 3FH1A 3M7GA 3D79A 4CPKA 3HBRA 1Q02A 4RQ9A 1FUTA 4KZ3A 3UE3A 3EOIA 1TIJA 2L6OA 3U6LA 1PJSA 1I0VA 1XJ3A 3DZDA 2PHYA 5CGXA 3S7NA 1HU9A 4ARZB 3NECA 3GRRA 1F5MA 4L7KA 5AI1A 1K28A 3DMCA 1BLPA 4GDBA 1TD5A 3QAUA 1K3XA 3LYGA 4KG2A 2D01A 3X41A 4Y28F 3N8BA 1GY6A 3GWRA 2HMOB 3IECA 4TUWA 1GD4A 3WHOA 3EE1A 3HUOA 3AMOB 2JHEA 4FH2A 4LZJA 3LH4A 4JI7M 3NHQA 2WSFF 3FSDA 3SMSA 5F3WA 2CHCA 3X40A 1Y54A 5FEGA 1FZUA 1PW1A 3UB9A 4EQIA 3MKEA 5ITXE 3GVBA 1CF0A 4DDYA 3HU2A 2I72A 2WZXA 5GSPA 1MJGM 2DWMA 1O7NB 2PU2A 3CCE3 5E26A 3CC43 4JBFA 3EJVA 3NM7A 1SKOA 1MU5A 3A3JA 3OCLA 3VKGA 3SH8A 3T1SA 3CCM3 4WN5A 4CQHA 3B8LA 3BECA 4LJ5A 1RGAA 3DGYA 4HIAA 1EW0A 2OCTA 1VQ63 1K4EA 1EUIC 1OKSA 5FSWA 2MH8A 3WA3A 4UEYA 1OTIA 1YIJ3 3FCSB 3S28A 4E3KA 5JI3E 5KSHA 5DTKA 1TGUA 4Y0UA 3HLEA 3SARA 5FQMA 2F5NA 2OV5A 3EIEA 3LFVA 2VGKA 2EFXA 2KNZA 5JPPA 4LYLB 2OOVC 4HKVB 1NO1A 1N4OA 1U60A 5FEFA 4MGYE 2DENA 1OHSA 1EWZA 1GABA 1YQSA 3WS1A 1IXZA 3ALAA 1Z5CA 2YFQA 3SMPA 4AZFA 1R2YA 2QYBA 3CF2A 2XLNA 5AIGA 5IG5A 1IQPA 1HZOA 2UWXA 4Z1WA 3ZCZA 2Y55A 3W68A 3O86A 2RGHA 4FCVA 2E2UA 2V1CA 1A2VA 3BFCA 1FGRA 1N32M 2AAEA 1IT8A 3U61A 1UUVB 3PBQA 2ZQAA 3D72A 1O07A 3N7WA 1US1A 5J3WA 4L15A 1ZMUA 3LIAA 3B7NA 1LNIA 1W7CA 1I3FA 1YVSA 4FCFA 3V5MA 3L7HA 2H0HA 4X2OA 3I553 5E2FA 2PRFA 4WURA 5HWTA 4KLNA 4L16A 5IERA 4U13A 1CJFA 2ZQ8A 5F83A 3QP5A 3GECA 3KDSE 4OONA 1VQ73 3V3RA 1N78A 1UWNX 1HT2E 4LF8M 3BU4A 5DREA 4I4LA 1L3LA 4NRVA 4H61A 4N6OB 1ONHA 3GAXA 1B2ZA 1IN6A 1BTLA 2NUTC 3MQ0A 5KIZA 1NYMA 3ZG5A 1AWIA 1OJ5A 1XX2A 2KXGA 3EWKA 4G6ZA 3NDEA 4Y7PA 3CAXA 1D7EA 1AXBA 3ZQ5A 1L2BA 3T1RA 3ISGA 2R65A 5KP1A 5TFQA 5HW3A 4DR5M 3ZG0A 1T18A 2PU4A 3M2KA 2RRUA 1IY2A 3JUPA 1I2FA 4XGIA 4JYAM 3G4S3 2FH5A 2VK3A 5E43A 2EA0A 1T3TA 2BNKA 5EXSA 1K4FA 3RE8A 2H5XA 4PM6A 4IBJA 4KT0F 3HHZA 3UY6A 3LUQA 2KDLA 2JDIH 2KF3A 1YSYA 1QMEA 2PR6A 3UJNA 1K57C 3GPUA 3QWLA 1V9YA 2M7OA 3ZCBB 2V0WA 3T1YM 1K3WA 3O5YA 1TTOA 1W7FA 1R5LA 2P0MA 5CLKA 3BLMA 4QU3A 2ZC6B 1X1WA 4CJNA 1SXJA 2CG0A 2XD1A 4FMDA 1X37A 4NC6A 3EEHA 3NBIA 4R3BA 1IT7A 1BZAA 3ER7A 3OWUA 5G2GA 1VQ1A 1VG5A 1E3UD 4GB7A 3RJUA 2P7JA 4IVIA 3MXQA 2OOLA 5KP3A 1STZA 4PM9A 1YLJA 3K9PA 2RGQA 4MGZE 2HWJA 3T38A 2Z77A 4UA7A 4YWZA 2IYJA 4MEIA 3MJQA 4XM4A 3J27B 2ZTDA 4Q53A 2L2DA 1X0OA 4DR4M 1PZOA 2D02A 2M7UA 1Q42A 1VQN3 1OMEA 3WODG 1N5PA 3LR3A 1EE8A 3WA2X 4JF5A 4OOYA 1BRKA 2B24B 3BNCA 2L7IA 2KHHA 4DV4M 2WGIA 2Y2MA 4ILFA 1NDOB 2VX8A 4O7DA 5FQQA 4G3WA 2KXEA 2QZ4A 1JTDA 3FV7A 3OOVA 4GW9A 1U5OA 5BU4A 4Q8IA 2APLA 1Y4KA 3F40A 3Q1CA 3HJSA 4P16A 3OV4A 1UUWB 4K61A 3G8ZA 2QHKA 3BJNA 1AVKA 3ZNYA 1NO3A 2E5LM 4HP9A 1ZMVA 4JGQA 3AOGA 5FGOA 3IMAB 3VKHA 1XA1A 3CMA3 5HDCA 1KYIA 1OPYA 1VQ93 1YAXA 4G3OA 4XT2B 1STDA 1DP6A 3TWMA 5G4ZA 2XSZD 1W2ZA 3EGXC 3K2LA 1S723 3M6HA 4GDNA 1N34M 3TWKA 4R9KA 2PYRA 3AV0A 1RGFA 3MSOA 5DJTA 2Y2HA 3T4SA 3MHEA 4E04A 3BRMA 5EP1A 3U4LP 1JN5B 1AIPC 2HP5A 4M9XA 4JLFA 4IPBA 1IN8A 2HZ5A 3GLHA 1LNHA 2RBIA 4PM8A 3FTEA 2FFJA 2BIRA 1N9OA 2CMNA 1S1ZA 4D60A 1Z5AA 3IXBA 3DGNA 1SCWA 1I94M 2CFOA 4IT7A 4R4SA 1GOYA 2IWDA 4IBEA 1SIIA 3HZJA 1QANA 3TQSA 5DNYA 1NB5I 2PT7A 3BNEA 2OQEC 4K08A 4F3LA 3AFHA 1IYPA 2BLSA 3MS6A 5A93A 2R6FA 3JUMA 4ZM8A 3U97A 1EA2A 3RH8B 2F98A 1LI9A 3E99A 3NC8A 4HI4A 2O99A 7STDA 1YLAA 1A2PA 2B02A 4N6UA 2Y8HA 4JF6A 3IWOA 3MSHA 4A3VB 2UUBM 5F68A 3DH2A 1K56D 3OC2A 1W8YA 4NXEA 4L8OA 3PCSA 3ZNTA 4B4ZA 2LYXA 1IN4A 1D6UA 1NNVA 1TDGA 4BL2A 2KOIA 4BENA 4D81A 4JXSA 1F8NA 4A5RA 3A3EA 4S2NC 3F1NA 4GL6A 3C9PA 2P04A 2WGWA 4RBNA 1EKMA 1XC8A 4H8RA 4LFAM 1ES5A 3PXPA 4CLCE 5FI2A 5IZ7D 4OVZB 1NZUA 3J7BA 1NY0A 2IA7A 3RFBA 2V8FA 3A3IA 3R4KA 1GCEA 4MMNA
chains in the Genus database with same CATH topology
4AI6A 2OQ4A 3IHAA 3K92A 1KDSA 1GHPA 4MB7A 1NRFA 2CHGA 4MH0E 3F7SA 3MG1A 1G3IA 1IQYA 3NIAA 3NQYA 2J9PA 5ITXA 3ITBA 1UW1A 2R4IA 4DKIA 4G4NA 5EXPA 1CK3A 3S22A 3NBRA 4KQRA 2UUAM 1IXSB 3PNYA 4B7HA 2WAEA 4U0XA 4E3NA 2B5RA 5CHMA 4CISA 4E3MA 3HVFA 4NRWA 2STDA 5CEDA 4ZJ3A 3GZXB 4XDVA 4BTXA 1G59A 3OPPA 4LG2A 1IV7A 3MKFA 3U6CA 4RNYA 3ZG9B 2Y2IA 2UXBM 4IBIA 1Q40A 3SEDA 3HIIA 4E6WA 4OQHA 3LT9A 4LCMA 3ZG7B 1K41A 3PYJA 3LQQA 3JUOA 5D3OA 2FGTA 2K54A 5A91A 4Z8XA 1JV2B 4UHUA 3UNLA 2WGOA 4PM5A 1MWSA 3OTOM 3MZDA 1ESIA 3BNDA 1PI4A 3M0EA 3LTAA 4ZJ2A 1XHBA 3HHYA 1XWIA 1O7MB 4RNAA 4FWDA 5AYSC 4QB8A 3WS5A 4HEFA 3ZDJA 5FAOA 4NXMM 3DUKA 3Q7VA 4XBTA 4RF0A 3BYDA 3NWLA 2XFSA 3N6IA 1J5EM 4HBRA 1ORYB 2GBXB 3LTCA 4FMCA 2JC7A 2M5ZA 2NQ8C 1JWPA 2CW9A 1TH3A 3GLFB 1XXHA 1OHOA 3FTCA 2EXAA 2ZAOA 3F8HA 5ITUA 1NHGC 5AIFA 4EUZA 2YR0A 1IYQA 3TL4X 4DE2A 4R4KA 2CC1A 3LY3A 2INXA 4PD2A 4WHAA 2VQFM 3NCKA 4LV1A 4FCZA 2GXFA 4PDGA 2BMRB 2Y2PA 1TH2A 1JR3D 1ERMA 1N8QA 1SPUA 1ULIB 2WAFA 4GHAA 1ES2A 4BTWA 2B1XB 1CYVA 4OQ0A 2FNAA 3K5TA 3NI9A 4JF8A 4X6TA 4FR9A 4P6BA 3GRYA 4BD1A 3HREA 4KENB 3AJIB 3U60A 2EFUA 3OXAA 1YLZA 2CEAA 5FAQA 1Z59A 5EOEA 4QOZC 3UN7A 5KSCA 3HIGA 4BLCA 1VQP3 2Y2OA 1FGQA 4XXRA 4LSOA 2KZSA 4N92A 4DR1M 4FH4A 1M40A 1QALA 5GLDA 5AIHA 4X56A 1W6CA 1ZX2A 4GD8A 4M0WA 1WMNA 3SXXA 1Q814 1DGGA 2IWBA 5EP4A 3O87A 4BLMA 4MGHA 4NSOB 4IBCA 3GRDA 2ZC5B 5IWAM 3V50A 1H8ZA 4AW4A 3AGEA 3AOEC 2WGWB 5FATA 4MMZB 4GKUA 2CHQA 3G2YA 1IBKM 5IG0A 1O7HB 4GZBA 1SXJD 1HKXA 1IKIA 3UNWA 2IUJA 1CI9A 4HZBB 2C5WB 5BR8M 1BUQA 1DYUA 1DJCA 1YIT3 2HP6A 3K0ZA 2Q9MA 4DR7M 3WHLA 5IW9A 3GRJA 3PS8A 1RCJA 3OZHA 3KP1E 4HL4A 4DXBA 3IT9A 4DV1M 2P74A 2GEXA 1E4DA 1IK3A 4DR3M 2EX2A 1NNUC 1IV9A 4XUXA 4DXCA 1JJ22 5IREB 3CCV3 3KSJA 2X49A 3GPYA 4B4XA 4HM4B 4R3DA 1CEFA 2XLJA 1LVNA 1ONGA 1JNQA 4S2IA 1ES4A 2LH0A 1ES3A 1DVCA 1QAMA 4DV3M 4LEHA 1VQ53 4N6MA 8CATA 3UPPA 3GLIB 3IQAA 5HX9A 1DMQA 5G18A 5GHZA 1ZKJA 4M9ZA 4B7GA 1O7PB 3U6DA 2XGNA 1K56A 1XXHB 2J8YA 2CFGA 4R3JA 5ITRA 1ZC2A 2Z7AA 5EOOA 4KZ4A 4PT5A 4EV5A 4LRSA 2BG1A 3SH7A 5CECA 3VK8A 5IG4A 1S5AA 3LT8A 4KZ7A 2EX6A 5KPZA 2C6WB 3O88A 3NXJA 2ZJ9A 2PNCA 3SOAA 5GHXA 1K55C 3VDUA 4DF6A 3HLGA 2ZM8A 2HP9A 2RGOA 1VQQA 1M6KA 3QK9A 1W02A 4HBTA 1UI8A 5CK6A 4WFOA 5FTJA 4S2NA 4FMBA 4I81A 3L27A 3EN8A 5JYPA 3JUQA 1KD14 4OPYA 4B88A 5EUAA 5EP3A 1YM1A 4OW0A 4IBKA 2ML6A 1DY6A 4YHHM 3IXDA 4GITA 3CF6E 3L29A 2ZQDA 1L0FA 2C11A 3Q07A 3F8XA 2QMIA 3GQ3A 5DVAA 5EVHA 2CKFB 4IIAA 2SBLA 1WYBA 5IHVA 3HX8A 3CZDA 4AKHA 3NDGA 5FQKA 3TWLA 2M60A 3SASA 3CCQ3 3ECFA 4LF6M 3EIHA 1IBLM 3VP2A 4KG6A 3UJMA 3GMWA 3SYLA 1Z1SA 2CIUA 5EQTA 4JI2M 3KN4A 3F7XA 4W5WA 4L8RC 1NY5A 4WYKA 3BLZA 5EJCA 1LI0A 3SATA 4L0LA 2QEX3 4DE0A 3S67A 5AQBA 1FCMA 3U6EA 3CNMA 3FKWA 3CD63 3HLWA 4OPRA 2P09A 2XD5A 3H4MA 3G35A 4JXWA 3W8KA 3BLSA 4EIWA 3DWZA 1EQKA 2EXBA 3QNCA 2LWXA 4QY6A 5C1BA 2JA2A 3G0KA 2C9OA 4JN6A 4DV0M 4MMXB 2Z6BA 4OPQA 1G8PA 4G1MB 4OLGA 1HQCA 1H8YA 2A3UA 4LF5M 4AG5A 5STDA 1LXEA 2ZLYA 5D82A 4HM1B 4N6TA 1YE9A 2QENA 2RCXA 2QZ6A 3ZVTA 4KO8A 5CHUA 2BNGA 3UE0A 4FCTA 4MM3B 1JN5A 5M19A 1NY6A 1XGJA 1O7WB 1MNLA 4K1VA 2P5TA 4LCLA 4FWHA 1RGZA 2J7VA 4BD0A 3G2ZA 2DWNA 1GS3A 5HL1A 2W03A 4KZ6A 1W8QA 4KFDA 5ITTA 1KE3A 2DVWB 3HU3A 2DWZB 2UXCM 4REZA 4KZ9A 2F5SA 1XKZA 3GV9A 2FNQA 3L26A 4LGYA 4EC6A 4AKZA 5EVLA 1KGFA 1K54A 4FW9A 4ZBEA 3JVCA 3SS3A 1A90A 2K0MA 3G713 4YINA 4MBHA 1NNJA 1N9JA 5IEPA 3CF0A 3DTMA 4CHTB 4X2HA 5GLAA 4OU7A 2ZM0A 1YLYA 5FQ9A 2BMQB 3DGMA 1L2CA 2Z2MB 5FASA 1OF5A 5J8XA 1IXRC 3LVVA 2JE5A 4XBYA 2D7HA 3UGJA 3MPHA 2HDQA 2VGJA 4DDSA 3NHXA 5L2FA 1VQL3 3PAGA 3VFHA 3VSKA 3O3VA 3DW0A 5IEOA 1ALQA 4PDIA 4Y0TA 5M1AA 3Q2PA 1HD8A 3J2PB 5KZHA 1SJWA 1M9GA 3IHBA 4HM2B 1E3VA 3E2LA 4QNMA 3SLUA 1QVF2 1CI8A 5EVIC 4S2PA 1QVRA 2ZQ7A 1IVWA 3TE6A 1C7HA 6STDA 2KW0A 3HL9A 4WEJA 2VIIA 3NQZA 2WYXA 4KODA 3VMAA 2X8AA 3K1JA 3FKAA 1PU4A 3I7JA 2HCBA 2H5SA 1UI7A 1W79A 3QRDA 4GD6A 4EBLA 4XBOA 3KOZE 1W5TA 4HJLB 4Y0OA 2CV1A 1FOFA 4AKGA 3FZWA 1L1ZA 1M1K4 1QZMA 4CCVA 1TUHA 3TSGA 1D6YA 2WKEA 5CF2A 3CC23 2HPBA 2QPNA 2ERCA 2F5QA 3GLGB 5JPUA 3N9HA 1K9M4 3UDXA 4GN2A 4FMAA 4LMIA 1TU5A 3MXSA 3FUUA 2MC8A 2C9CA 1T5YA 4OOMA 5GLCA 4KQOA 2C98A 5LC7A 1SXJC 2Q9NA 2E2VA 2BO9B 1YVBI 5FDHA 3GQZA 5HFOA 3I51A 3A42A 3KOYE 1QMAA 1WMPA 4GIPA 3SOYA 3FUWA 3RXXA 4F94A 2E8IA 4HVNA 1IBMM 4K0KM 4L8PA 2Z2LB 1Q40B 5KPRA 1DGHA 4FWGA 3BFDA 4M0DA 2Y74A 3IXGA 3PXMA 5C18A 3W4QA 3NUVA 3FTFA 3HGIA 3Q81A 4WZ4A 2O9UX 3AGFA 1H5XA 5HARA 2WADA 4FD8A 2QBYB 4LZZA 1YMXA 4G4RA 2W56B 1E9SA 5FI6A 3SC3A 2ZD8A 3MHVC 3TOIA 4XBXA 2CWVA 3FF2A 4KFFA 4GKKM 2R9WA 2ZQ9A 3T1HM 2IUKA 1DO2A 3WOEB 3K8ZA 1HVBA 3PBSA 5FA7A 4QHSA 4R9LA 4UA9A 1IVVA 3CU3A 1DJBA 1W5SA 4LGQA 1PIOA 4MLLA 1PFPA 1PYYA 4JXJA 3GZRA 1QYRA 3T8UA 3BEBA 3AL0C 5FQIA 1IN7A 3J7AS 1LL5A 2O5RA 4MBFA 4IJFA 2ZANA 3SVAA 3CCU3 3FZCA 4JXVA 4WEKA 1JWZA 3GTCA 1HR0M 4R0QA 3S1YA 2KEBA 2F5PA 3B4OA 2L4VA 3R9XB 4WP5A 1LOXA 3SX1A 5KQ8A 1MY8A 4S2MA 3A45A 2DWLA 3STDA 1L5GB 2OQEA 1JB4A 3KSXA 3LVWA 4LF4M 2P05A 2AHMA 4BBAA 5ITQA 2X02A 3PBTA 1L1TA 5E2EA 3PZWA 4WZ5C 1L0EA 1JKGA 3VSYA 2VQEM 1HNWM 1TP6A 2Y2LA 1PW8A 4AEQA 5CEBA 3C4OA 4JI4M 1D6ZA 5CERA 3K63A 4FD2A 1OGZA 3AGDA 1ZG4A 3FWLA 3LOYA 2H1RA 1CEWI 2QP9X 1HT1E 1GLNA 2ZM2A 1VQM3 3LY4A 2I9WA 5ITYA 1ROAA 1TVFA 4B3MM 2CH9A 1Q7Y4 2A49A 3S27A 4ZPXA 2OWPA 3HLCA 2R46A 3RGAA 1GL7A 4MGIE 3U6OA 4WMCA 1YT4A 3KIIA 3FKVA 2Y4AA 4DE3A 4JI3M 4MNRA 2XFTA 3EBTA 1QAFA 3C58A 2RSXA 3LTBA 4X64M 4OH0A 4DV7M 1FA3A 4HYZA 3IWQA 2EO2A 1RN7A 1OCVA 2W6JH 1VDDA 1M1XB 2H0TA 3RFWA 4JV5M 4MJDA 4DV6M 3EQUA 3MK6A 2OOVA 2GBWB 5KO3A 3FKEA 3W4PA 4QY5A 4X66M 3ZGAB 3HUMA 4OQGA 1OF5B 4GMQA 1IN5A 4HLQA 2ZL8A 5LMUM 2DRWA 3J80S 5M18A 4M3KA 3MJ5A 3H3HA 1WXQA 1UM8A 1IY0A 4GH9A 3T8NA 2FFYA 2G2WA 5EVIA 2XSZA 2V20A 4PM7A 5FTNA 5DYIA 3DZLA 1ULJB 4O8SA 3TDGA 2Z76A 1BLCA 5TR7A 1KVLA 1IKGA 1FR6A 4KQQA 3BFGA 4Z6YA 3I563 1VQ83 1YMSA 1KC84 1Q2PA 4CDLA 2WOHA 3JYIA 1BSGA 4FCMA 3BM6A 3N4IA 1FCNA 4LJAA 1EROA 2XEPA 4GNUA 3BB9A 1H6UA 5A2QS 3ITAA 3LO7A 2YX9A 3VSLA 3E2KA 2ZC7A 1WQLB 5EXTA 2D1WA 3UPNA 3GRVA 3GZYB 5H37D 4R80A 3GQ5A 4BJPA 4P85A 3CMZA 4XDWA 3WDGB 5CGWA 3DM8A 2C5RA 1FJGM 3VOZA 1GL6A 2R62A 1N77A 4EV2A 1Z5BA 3SOIA 1VQO3 3CG5A 4QHCA 4PMAA 4R1GA 4S2KA 2L09A 2LQVA 1L0DA 4WYYA 3EB8A 3M8CA 1NU3A 3A76A 2KA6B 4ZDXA 4IBBA 2A15A 3GZBA 3Q8XA 3CPW2 3KOWE 5DRVA 3WMDA 3G34A 4LV2A 4J8TA 4QWTA 4II7A 3OPRA 3SYKA 3JAMS 2FOIC 1R6BX 3GR2A 3KP0E 1HQYE 3SHFA 3UO9A 1Q3BA 1BLSA 2HMLB 4JKTA 3PXGA 4LF9M 1NYYA 1PM5A 5AEUB 7CATA 4KZ8A 5DYGA 2E2TA 3F9SA 1XA7A 1YLPA 4X53A 5A92A 3Q7VB 3EBYA 3EHCA 3KZTA 3IF6C 2Z7JA 3LTDA 2K47A 3N8RA 1V74A 3MZFA 1NJGA 3S4XA 4D2OA 4AG6A 1TFKA 1N8R4 1C1KA 2CC3A 3C5AA 2HMKB 1DMNA 2FFFB 2PZVA 1MWUA 2ZQCA 1IEMA 1TDZA 1TFOA 5AIIA 4PCZA 3HJQA 4NK3A 3HUNA 1FSYA 1E94E 2W2CA 3PBOA 3HKPA 2Y2NA 1IY1A 2WKHA 1RJOA 2ZBKB 4P87A 5GKNA 4N6LA 3J7Yd 1CEGA 5E2GA 3A46A 4N6V0 5CHJA 4EWFA 3U6SA 3LMLA 4PPRA 3AMOA 4ID4A 2ZC3B 1NVMA 2ZDJA 3B3XA 4LY6A 1DVDA 4E3LA 2QGUA 1FCOA 3HHWA 4IBFA 1GA9A 3VP1A 4NXNM 1L0GA 3LMMA 3HU1A 3FGYA 1KQS2 1J9MA 3KE7A 4K1UA 3L2AA 3PBRA 4LV0A 1DMMA 3RGSA 3MG2A 3RGRA 1IM2A 3UMMA 1VQK3 4BTYA 5FLXS 2P9VA 1NJFA 2XH9A 1WYCA 1YHQ3 3FG3A 4OPZA 4NOOB 3H51A 5DTSA 3FUXA 1W5ZA 4FSFA 4R23A 5FW5A 5LMNM 4K90B 3DFZA 4DV5M 1KE0A 1FGMA 2IWCA 1QAOA 3B4PA 2KRUA 4OVZA 3IH9A 4OVDA 3UE1A 2CFDA 1NZOA 5CXWA 2LXEA 3KFUG 4Z9QA 3Q1FA 2UXDM 4B7FA 4I4KA 4I8OA 1EG9B 1E32A 1K82A 3UK6A 5BVBA 2BJVA 1N36M 5D83A 3V3SA 2GU1A 3NV0A 1KFVA 4YY3M 4HBUA 2W9QA 2Z4SA 1Q2QA 2XR8B 1GYBA 1LV7A 2Y0QA 4S2JA 3IG8A 2YFJB 1QMFA 2BHMA 3L25A 4O02B 4HM0B 1W2B2 2XSHB 4HESA 1ZG6A 1G4AE 3HJ8A 3CXC2 1K55A 2XK1A 1KVMA 1N9BA 2J7OA 3ILKA 2XRXB 1Q3CA 4JI6M 5TGNA 2HKJA 4QJGA 4N6NB 3UB1A 4LFBM 3EQVA 4MGKE 3NBLA 3VDPA 2Y2QA 2HDSA 2D42A 4KFEA 2DCFA 3OCNA 5AQ9A 2X71A 5HGRA 3IF6B 3M2JA 5I94A 2BMOB 5CTNA 5EECA 2CK3H 4QHTA 3DWKA 2CFKA 1YLWA 3GRUA 3OPHA 4GOGA 4BQMA 3G16A 3N8SA 3LZAA 1GY5A 2WGVA 4TX4A 4OONA 2G8LA 3HI7A 3OWSA 1M904 3KKGA 3EQQB 3HK4A 2ZMAA 4EXRA 3G32A 2X01A 3Q7ZA 3PBNA 3SAVA 3IH8A 3P98A 2EX9A 2XDMA 2Y2GA 4O3VA 3ZHHA 2YNMD 3FG1A 1L2DA 3LEZA 2FE8A 3GO8A 2P0XA 2DZOB 3HZPA 4D80A 2QIYA 2YQZA 4JF4A 3UDFA 3IXHA 5DTTA 4OOLA 1K6SA 4RZMA 4LF7M 2KRKA 3RGPA 2WOFA 3EX9A 3T0UA 2HDUA 1QAKA 4STDA 2D7GA 4R7GA 4JRFA 1LLBA 5KMWA 3UZUA 3G30A 4J9AA 1VM1A 4C3QA 4B3SM 1JB2A 1E25A 3D3LA 5EXXA 3FUTA 1XNQM 3Q90A 4C75A 4N9KA 1OUNA 5A0OB 3CME3 1WE4A 1SXJE 2WK0A 5U47A 3WS2A 3WRTA 3DOAA 5F82A 4DUZM 1DJAA 2RCDA 1KGGA 3U6MA 4LGMA 3MYTA 1XMOM 1MWRA 2OSUA 5E2HA 4RVAA 3U5ZA 4RNZA 5CRFA 1JWVA 3DY5A 4RX2A 4ZJ1A 3M6AA 1GKIA 4L4UA 2UU9M 3P09A 2G2UA 3ROBA 1KSFX 3IJEB 5AQ7A 1YJN3 3VP4A 5D81A 4X55A 2ML5A 3WS0A 4RYEA 4UA6A 4LV3A 1R2ZA 3HWSA 3WOFB 3KS4A 3WS4A 3UL6A 1E9RA 3MZEA 4IBXA 3B9PA 5AEWB 3X42A 3HLBA 3Q82A 5FSRA 3NX0A 1OHPA 2DZNB 3SAUA 3V98A 1W4NA 1MXOA 3A3DA 3U61B 4FVMA 1JVJA 5BOHA 3S5CA 3PAEA 2W9PA 4LFCM 1K6RA 3T15A 4WBGA 5CF1A 3GPPA 2UUCM 3W4OA 3GQ4A 3U6QA 4U3TA 4CGYB 5JBSA 1I5QA 1GA0A 3NY4A 1QVG2 4HM7B 3THGA 4OVMA 1HNZM 1VQ43 3IWIA 5FAPA 1FQGA 3VK7A 1A67A 1CYUA 4XB5A 4QOSA 2QBYA 1HTZA 2XR0A 4OK0A 1PJJA 2CE7A 3SS5A 4E3IA 1TEMA 2CV2A 4K0XA 1GHMA 4X69A 1WMOA 2H10A 4LENA 2DHRA 5EVID 3FF0A 5DF8A 1E3UA 1I2WA 1S0WA 1Z6FA 3A98B 3SHGB 3IPTA 1FGOA 3LCEA 4BB9A 5CXOA 2Z4RA 1K8A4 5EP2A 2F86B 3CCL3 4R1KA 4DR2M 1I2SA 4AQYM 1KSIA 2F99A 1XGIA 5A90A 5KP4A 3LQRA 2R9XA 4JI5M 3BFEA 3OWYA 3RDEA 2HDRA 1ESUA 4JPMA 4K91A 4NSRA 2XGLA 5IENA 5CGSA 3CC73 4NL4H 3TPZA 2OPFA 3KFQC 1BUEA 3WHKA 1BULA 4OX9M 3U5ZB 4DV2M 1OACA 3D8LA 3IG5A 3GLFA 3FYCA 1PJIA 5KPTA 4E3OA 3UDIA 5I97A 3G4PA 3DA1A 2C99A 1MBLA 4QD4A 4WYKB 2C96A 4ZTKA 1JB5A 4OP8A 3NBJA 4OLDA 3AKZA 1KE4A 5HAIA 5TGFA 3UPOA 5HAQA 2V6ZM 2J7NA 4X65M 2Y21A 4PEJA 2EUCA 4KZBA 1PWGA 1K54C 2OTL3 1TH4A 1C3BA 1LHYA 4KG5A 4B3TM 4NHFA 3D8BA 4ZAMA 2F4VM 5HAPA 1DO0A 1J09A 4LJ8A 1K25A 3JR5A 3IF5A 1MKIA 2V1UA 3DXOA 4WW0A 1E97A 4O2HA 3VFDA 1MOLA 3N8LA 3X3ZA 1Z6TA 1W00A 3MWZA 3R8FA 2OLUA 3OX9A 3MKIA 4D82A 2QPAA 1BLHA 2RL3A 1K38A 3C7UA 2ZM6M 3LXUX 3KSED 1AR0A 1PZPA 4ITQA 2A5YB 1OGXA 3X3YA 4L78A 1OJLA 3KSPA 1WNHA 3V39A 1OH0A 1W6GA 3VF1A 1S3SA 3VP3A 4C6YA 2Y0TA 3UL5A 4LJ9A 4YFMA 2YFLB 3U1WA 1FUWA 1IQXA 3VFFA 4OUQA 1AVLA 4HM8B 8CHOA 3KW6A 3ZC7B 4IJEA 2KRTA 4DE1A 1OFHA 2CHVA 4X62M 1IDPA 1IELA 5EPHA 2H0YA 3FD9A 1JQJC 2CWTA 3EN1B 3I0YA 2CV0A 1N9EA 1Q864 1SIHA 4RX3A 3F14A 5GLBA 2W04A 2IMJA 3AOEA 4LJ6A 5AQAA 3D9RA 4RF1A 4GRIA 4EV4A 3GLIA 1NXYA 2L7HA 4X68A 5LC6A 3SH9A 5EQLA 2P38A 1VZZA 1MX0A 2KCDA 1SKFA 2DXIA 2XZUA 2D7EA 3NBBA 3OW22 4KVHA 1XP4A 4G4QA 2DNSA 3CJMA 3SFZA 1ZO2A 3K7CA 4R4RA 2X4AA 3BFFA 4DRTA 1XPBA 1DGHB 1J7KA 3HLDA 2G5GX 1N5HA 1AV4A 1N33M 1W6YA 4LZIA 2R4EA 3RXWA 4HM5B 4LRTA 2Y2JA 3DGOA 2WZZA 4QNRA 1QJGA 3NM2A 5IT9S 1G68A 1STFI 2R45A 1BT5A 1K57A 3ZFZA 1W01A 2V2FF 1ZQ9A 1IYSA 1RGYA 4OQIA 1U8CB 3C4PA 5JYOA 4LCBA 1O7EA 1O7GB 5ELJA 2JQ5A 3WWXA 3ZH9B 2Y20A 3OPLA 4MMYB 4GB5A 2EX8A 3KS8A 2ZC4B 2RKOA 1IU7A 5EE8A 4DUYM 2HMNB 1Q39A 1QAQA 1WTHA 2HHHM 3K9MC 1G6AA 2Y59A 2Y91A 1G41A 2WKIA 1JKGB 3A3FA 4BL3A 1RRLA 1L8QA 2LNHC 1LL9A 4E3JA 4EBNA 1NSFA 4B08A 1FR1A 2P9VB 1JRQA 1ISKA 4MBKA 3W0LB 1NJI4 5EVIB 2O3OA 4IEDA 3MFDA 1W5DA 1QQWA 3CCJ3 1FGTA 5JI2E 2CUZA 3O8YA 2GU3A 4DR6M 4HZ9B 3PGBA 1YLTA 3MXRA 4JXGA 3GP1A 1XNRM 3G31A 2PBYA 2XQZA 3V92A 3U6PA 5GL9A 2R4JA 1SDEA 2OLVA 3U60B 1GHIA 5IF6A 2W0QA 2HL7A 4AKYA 3CPOA 1ZAEA 4IVKA 1ASKA 1KWIA 3SS4A 3L0RA 2Q2EB 2HMMB 5BPVA 1DGFA 4KHPM 3FYZA 1I4WA 1KGEA 3ZVWA 5KQDA 3FTDA 1GD3A 4WZ5A 3VOYA 1RRHA 1DGBA 2WGQA 3PFIA 3IF6A 4N3VA 5AYRB 1GVNA 2HMJB 1SXJB 4KZ5A 2V1ZA 3TG9A 1K734 1L2SA 2FXTA 4GHLA 4ORLA 1JR3A 1FNNA 5CTMA 3ZG8B 1YJ93 2F5OA 1IVUA 1G96A 1IQ8A 1NWWA 3N54B 1SQWA