2XEPA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
428
structure length
419
Chain Sequence
SVPTPAEAALAAQTALAADDSPMGDAARWAMGLLTRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
total genus 135
structure length 419
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xepA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xepA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xepA02
3IXDA 2EX6A 4JXVA 3OPRA 4PMAA 3ZFZA 1KDWA 3HUMA 4E3NA 3V3SA 4BQMA 1KE3A 2V1ZA 4RX3A 5EECA 1LLBA 3TSGA 4E3JA 4OPQA 2I72A 3WS1A 3M2KA 4FSFA 1VQQA 5FDHA 4GB7A 5DTKA 1XGJA 4IBXA 4N92A 1GHIA 3SS3A 2Y59A 1MWRA 3MKEA 2XR0A 4Y0UA 1LI9A 2WGVA 1K38A 3IXGA 1CK3A 2XD5A 4CJNA 3SS5A 1KVMA 3OC2A 3ISGA 5EPHA 4WZ4A 3WRTA 1H5XA 4BJPA 3HREA 1ZG4A 1IYOA 1YMXA 4QY6A 1XGIA 5FQKA 4EBLA 1RGZA 2Q9MA 4JPMA 2DCFA 3MZFA 4JBFA 4MNRA 5CHMA 3LY3A 2R9XA 1FR6A 3VMAA 5FI7A 1YLYA 2HP5A 1PWCA 4P6BA 5G18A 2JE5A 4S2KA 1DY6A 5F82A 3UE0A 4KZ6A 5CTMA 4A5RA 4JF5A 5TR7A 2WZZA 2WKEA 3SH8A 3E2LA 1U60A 1MPLA 1CEFA 1RP5A 5EUAA 2XGNA 3FZCA 3O86A 4N1XA 2HDUA 2R9WA 3RXXA 1KDSA 3UNWA 4Y0OA 2ZM0A 3N7WA 1FSYA 5F83A 4EV4A 1KGFA 1W79A 4MEZA 3B3XA 4R3BA 1J9MA 2G2WA 2WYXA 4LCLA 3UPOA 3VSLA 1BT5A 2ZM8A 1PI4A 3HLDA 1K25A 3ZNYA 5EOEA 3WRZA 4K0XA 4RX2A 5FQJA 1L0GA 2Y2IA 4PM7A 4QJGA 3VP3A 3GTCA 3PTEA 1KE4A 5E2EA 3V3RA 4U3TA 3S4XA 2IWDA 5HL1A 4B4ZA 3HLCA 3ZNTA 3A3FA 5A91A 1RGYA 3PBRA 4DDYA 4E3LA 1N4OA 1N9BA 3A3EA 4UHUA 4ZBEA 4OQ0A 3ZVTA 5CXWA 3QNCA 5A93A 3BFCA 4QD4A 2RCXA 3FV7A 3ZG8B 4NK3A 4R0QA 5AQAA 4KZ3A 1I2WA 1EI5A 3UE1A 3W4PA 4BLMA 3HLFA 1W8YA 4ZTKA 5GLBA 4P85A 4YFMA 4OP8A 3NY4A 5CRFA 3E2KA 5D3OA 2EFXA 4E6XA 1YLTA 4B4XA 3BFFA 1G68A 4X56A 3ITAA 3C4PA 1IELA 3HUOA 2VGKA 4U0XA 2J8YA 1K6SA 4H8RA 3M2JA 3HL9A 2XFSA 2ZC3B 4DF6A 4OOMA 4DKIA 2C5WB 1ES2A 1KGGA 2EXAA 2RL3A 3MZEA 4OQHA 4WZ5A 3GQZA 3PAGA 3RXWA 3ZVWA 4OLGA 4UA9A 1LHYA 1YLZA 1FSWA 3BRMA 5GLAA 1BSGA 3N4IA 4WZ5C 4HESA 3PBSA 3ZCZA 1EROA 4RA7A 5KZHA 1GHMA 3W8KA 3Q7VA 1IYSA 4OQGA 3HLWA 1GHPA 3IF6C 4GD6A 5IHVA 1NYYA 2ZM2A 4X68A 3VP1A 4KG2A 2WADA 2DRWA 5HAPA 4E6WA 3MFDA 2WZXA 3C7VA 3UPNA 3W4OA 3ZG0A 5F1FA 4X53A 1BUEA 1YLPA 4L0LA 2G2UA 3V39A 3MZDA 5AQ7A 1K54C 5FI6A 4LV0A 2WGWB 2HDSA 3QNBA 4OLDA 3UDFA 3EQVA 4N9KA 3HVFA 3FYZA 4Z9QA 4FH2A 4E3KA 3BEBA 4ID4A 2XQZA 3G2ZA 3NIAA 3IH8A 3GVBA 2PBYA 1HTZA 3ZG5A 1XA1A 4S2JA 1ES5A 3VP2A 3HBRA 1PZOA 2WAEA 4BD1A 2ZJ9A 5GLCA 4EBPA 4DE2A 3AGFA 1HD8A 1EWZA 2C6WB 4K0WA 2ZLYA 4C6YA 4JXSA 2OLUA 5E2HA 2XFTA 2BG1A 2UWXA 1BZAA 3SOIA 3NC8A 1W5DA 3G32A 2P9VA 4KZAA 1O07A 5E43A 2E8IA 1MWSA 3CZDA 2OV5A 1XXMA 4Y7PA 4GDNA 3IWQA 4P0MA 3IF5A 4WBGA 3G2YA 1NXYA 3G34A 3N8RA 1FOFA 3S22A 1K57A 5EVIA 2QPNA 4YINA 3WS0A 2XLNA 4BENA 2HPBA 4BD0A 4O7DA 5EVIC 1JWVA 3V50A 3Q81A 1L2SA 1PIOA 5GL9A 4S2LA 3IXBA 5FQ9A 4Y0TA 3IWOA 1KGEA 4GOGA 3GR2A 2WKHA 2H5SA 3V5MA 2IWBA 2Y2GA 3O88A 3VP4A 3NDEA 4QHCA 2PU2A 1XPBA 2ZC6B 2JCHA 3IT9A 3NBLA 1E3UA 1PW1A 1QMEA 1AXBA 5A90A 4JF6A 3VSKA 3FKWA 1K55A 4N9LA 3ZGAB 2EFUA 2EXBA 5U47A 4XUZA 3GRJA 3GV9A 3VFHA 5KSHA 5AQBA 1K55C 5DF7A 2Y2HA 3Q1FA 4PM8A 1NYMA 2A49A 5EVID 4OOLA 3TG9A 1H8YA 2J9PA 2ZC5B 5EOOA 2H0TA 1M40A 4RVAA 5FQMA 3DTMA 1OMEA 3QHYA 4WMCA 3BM6A 5CEDA 2DNSA 1MY8A 1IYPA 2B5RA 2ZQ7A 2OLVA 4QB8A 5GHZA 4ZDXA 1JTGA 1ZC2A 3AGEA 3LY4A 4S2OA 5HW3A 1HZOA 2Y91A 4OPRA 4R4RA 5FQIA 4R3JA 5CGSA 2Y2PA 3CJMA 2HP9A 2H10A 1ZG6A 2Y4AA 1E3UD 5DVAA 4OPZA 1XX2A 4XXRA 4BL2A 4GDBA 4X55A 4OPYA 4DE3A 1MXOA 1DJAA 1ES3A 2JC7A 3OPHA 5DF8A 3NI9A 4KZ8A 4IBRA 1SCWA 2HP6A 1ES4A 1FCOA 1BLSA 2X71A 3A3IA 4C75A 5E2FA 4DE1A 2IWCA 2Y55A 3UPPA 1ONGA 3ZHHA 1NZUA 5BOHA 3LCEA 3NCKA 3IXHA 4IEDA 3WWXA 2Y2MA 1S0WA 4S2NA 2X01A 4WMCD 3HLEA 3PAEA 3MXSA 5GHYA 5FAOA 3HLGA 5AQ9A 3SH9A 4C3QA 4KZBA 2XF3A 3LO7A 4NETA 4JKTA 1KE0A 1QMFA 4BL3A 5I94A 1PWGA 2ZMAA 4WYYA 3P09A 1H8ZA 3N8LA 3PBOA 3IF6B 3Q7VB 4KZ7A 4S2PA 3WS5A 5A92A 5HFOA 4DXCA 4GKUA 2X02A 3BLMA 4WM9A 1YM1A 3IH9A 2P74A 3MBZA 4IVKA 3NDGA 4M3KA 4X6TA 1SHVA 1YLJA 3O3VA 4LV1A 3G31A 5DF9A 1KVLA 4LV2A 5J8XA 4PM9A 5F1GA 1JTDA 2V2FF 3AGDA 4JXWA 1SDNA 5FQQA 4KZ9A 5CECA 3JYIA 3MXRA 1WYBA 1CEGA 2WGWA 5GLDA 4K91A 4R1GA 1LL5A 3BYDA 5HX9A 2ZQ9A 3Q07A 3ZG7B 4GD8A 1M6KA 3IWIA 1ESIA 1ONHA 1Q2PA 1ZKJA 2WGIA 4EBNA 2Y2OA 1GCEA 2Y2NA 4KQRA 5FATA 3OPLA 1BULA 3UE3A 1ERMA 1K6RA 1ERQA 1FQGA 4IVIA 1W7FA 4MLLA 3G35A 2A3UA 3MKFA 5HAQA 5M19A 3CG5A 5JYOA 1L0EA 1Y54A 4UA7A 4B88A 1IEMA 5FA7A 5HARA 2Y2JA 1CI8A 2P9VB 1NRFA 5FI2A 3VP0A 2Y2KA 1BLPA 1Z6FA 3A3JA 2FFYA 4QU3A 2WUQA 2FFFB 1K57C 4WELA 1IKGA 3ZDJA 5L2FA 4KQOA 1YQSA 1XKZA 2V20A 2XEPA 4EQIA 5EE8A 3FKVA 5EVIB 2XDMA 4DRTA 1DJCA 2EX9A 3S1YA 3BECA 4D2OA 1NZOA 2Z2LB 3IHBA 4OONA 5CHJA 4S2MA 5DTSA 3RJUA 1Q2QA 1S6RA 1E4DA 1K56A 3C5AA 3HLBA 4S2IA 5M18A 2OSUA 3DWZA 1K4FA 5HAIA 1BLCA 5CEBA 1I2SA 2ZQDA 1GA9A 1NJ4A 4OKPA 3G4PA 5FAPA 5JYPA 3VOYA 1G6AA 3N6IA 2HDRA 1TVFA 4WEKA 5EVLA 2XD1A 5M1AA 2WK0A 3M6BA 1XP4A 1PZPA 4FCFA 4OP5A 4MBHA 5FAQA 2Y2LA 2Y2QA 2EX2A 3TOIA 4KG5A 5CERA 2HDQA 4KENB 3WS4A 4MBFA 1ESUA 5TFQA 5FASA 1PI5A 3UDIA 4X69A 1YLWA 3N8SA 5GHXA 1JWPA 4CPKA 1YMSA 4HEFA 3ZG9B 1TEMA 4N1HA 4HBUA 3DW0A 3I7JA 4R23A 3UY6A 1YT4A 3UO9A 4LCMA 1PW8A 1SKFA 3ITBA 2J7VA 3A3DA 4QY5A 4KZ4A 1L0FA 4WEJA 5CHUA 4RYEA 3HUNA 4U0TA 4P87A 4HBTA 1K56D 4DXBA 1FCNA 2WAFA 4XUXA 4ZJ2A 4PM5A 4ZJ3A 4KG6A 4E3MA 3GMWA 4EWFA 4E3OA 1RCJA 3LEZA 4KQQA 5TGFA 3GSGA 3BFDA 3BFEA 3OCNA 1CI9A 3SH7A 3OCLA 4F94A 1L0DA 1MWTA 4JF4A 4OOYA 5FSRA 1ALQA 1MKIA 2ZQAA 5CTNA 4GNUA 1WE4A 5DTTA 3G30A 2JBFA 1C3BA 1MWUA 4DDSA 4E3IA 1I5QA 3PBTA 3VFFA 3VOZA 4Q8IA 3OZHA 5E2GA 1LL9A 1O7EA 1TDLA 2WKIA 1WYCA 5CGWA 4ZJ1A 2ZQ8A 4EUZA 4OH0A 1W8QA 2QZ6A 3PBNA 1GA0A 1E25A 4LENA 3W4QA 4JXGA 3EQUA 1PYYA 1XA7A 1BLHA 1MBLA 3DWKA 3IQAA 2ZD8A 3C4OA 3O87A 4FH4A 4JLFA 4OVDA 4PPRA 3PBQA 4S2NC 4OQIA 1IYQA 3Q82A 1FR1A 1DJBA 1TDGA 4DE0A 5CGXA 2J9OA 1NY0A 2XK1A 3C7UA 2QMIA 1K4EA 2BLSA 2PU4A 1LI0A 2GDNA 3Q7ZA 4MBKA 4R4SA 2Q9NA 3P98A 1PWDA 3D4FA 3OPPA 5KMWA 3UN7A 1HVBA 2VGJA 3BLSA 5KSCA 3WS2A 2Z2MB 4KZ5A 3UDXA 2CC1A 2XH9A 4FD8A 2EX8A 3BFGA 3IF6A 1BTLA 1VM1A 3FWLA 2ZC7A 1JVJA 3M6HA 4UA6A 3CMZA 3IHAA 1FCMA 2ZQCA 4ZAMA 4LV3A 4PM6A 4UAAA 1IKIA 2ZC4B 4GZBA 1JWZA 2H0YA 3SS4A 4GN2A 1SDEA 1K54A
chains in the Genus database with same CATH superfamily
2EX6A 1AVKA 3FZWA 2DHYA 4ORLA 3Q3FA 2XSSA 1FGQA 2GZAA 4BQMA 1IQYA 5EECA 4QNRA 2ZTDA 1WGNA 1UCIA 2FH5A 1VQ43 2QJ7A 3E4QA 2F86B 2C96A 2M1CA 1MWRA 1NY5A 1LI9A 1S5AA 3IBRA 3EIEA 3IXGA 4LJ5A 5FGOA 2XD5A 3IECA 3SS5A 1KVMA 2JY7A 4E04A 1GJTA 1B2SA 3EN8A 2VV8A 5EPHA 4WZ4A 2C4BA 5JPUA 3MSOA 3WRTA 1KWIA 4BJPA 1ZV1A 1ZG4A 1TJDA 1IYOA 4QOZC 2HCBA 2F5MA 4PDIA 2JNHA 3MZFA 3T4SA 4GRIA 4MNRA 2B24B 1O7GB 1OJGA 1QMAA 3EF8A 1FR6A 4Z1WA 3VMAA 3VFDA 2PNCA 2C99A 3MS6A 5FI7A 2HP5A 2QHKA 1PWCA 5J3WA 4P6BA 1X37A 1SKOB 3NOPC 1GY6A 5IREB 4IIWA 2JE5A 4S2KA 1DY6A 3NV0B 1G6OA 5TR7A 1U60A 1B2ZA 4L16A 2OQ4A 2QHOB 4R4KA 1JB0F 1NWWA 4Q0IA 3UGJA 4B08A 3N7WA 5F83A 3LTCA 2F4YA 4OK0A 1LOXA 2G7UA 1PFPA 1R5LA 2CHCA 3U5ZA 5TGNA 2DHRA 3CCV3 2EUCA 1B2MA 2G2WA 3VSLA 1BT5A 3HLDA 3PFIA 2HHHM 1YNVX 1AQZA 2F5WA 4K1UA 3WRZA 4K0XA 4FTXA 4PM7A 3SMPA 3VP3A 3EN1B 3V3RA 3FPVA 4U3TA 1D0MA 4LZZA 4BTYA 1W63M 3UJMA 4N6NB 2HAKA 3MSHA 3BY8A 5A91A 1RGYA 4DDYA 5DKLA 4WL9A 2MH8A 3LMLA 4ZBEA 4JV5M 5ITTA 3G6E3 4Y17A 3KSHA 2K2NA 1J2BA 5F69A 2F5NA 3SAVA 3LT8A 3L26A 5TBMB 1X0OA 3F9SA 2RCXA 2UU9M 3ZG8B 6STDA 3X40A 1STDA 1JBSA 3CI6A 3E2KA 2QWSA 2BJVA 1D6ZA 4E6XA 2JDIH 2LQVA 2UUGC 3AHSA 5D81A 1YLTA 1NU3A 1G68A 2PYPA 2XSOB 1IELA 1MC0A 4GLQA 3Q90A 1QVG2 3NM2A 4HM1B 4W5WA 4Q7JA 4N6TA 1N8R4 4LGQA 2F98A 1OHSA 4I8OA 2JN7A 2RL3A 3MZEA 2DAIA 3GQZA 1V74A 3ZVWA 2FZ0A 3LFVA 1WIVA 4OLGA 2QZ4A 3PGBA 4P6ZM 1VQN3 1LV7A 1FA3A 4WZ5C 1OT9A 1W5ZA 3L0RA 1OCVA 4WURA 3WA2X 4OQGA 4PAUA 3X3ZA 5IHVA 4G4QA 4LLOB 3VP1A 2XZUA 4KG2A 4IBIA 3G713 1L3LA 2DRWA 3IX4A 2E2TA 2J7OA 2OOVA 3UPNA 3ZG0A 1KYIA 1YLPA 4L0LA 1QVF2 3GLIB 2JKTI 4Y5FA 2MROB 3M6AA 1JBTA 2ZL1B 3HHYA 5AQ7A 1VQM3 2VV6A 2OTL3 3UDFA 1TU5A 3DTKA 4N9KA 3W0LB 4FH2A 5IG5A 4WP5A 3G2ZA 1K28A 4GB5A 2XR8B 3VP2A 3I51A 2WAEA 3PNYA 2ZJ9A 4I39A 4AI6A 4R1KA 1EWZA 2RBIA 3LI9A 4HM5B 4C6YA 4DR2M 2XFTA 7CATA 1B27A 3SHFA 1IBKM 3AGOA 1O07A 3QAUA 3LW5F 4LRZE 2BHMA 3CZDA 3C2WA 4NEED 2OV5A 3TE8A 4F3LA 3QP6A 1XXMA 4FCWA 4GDNA 4MB7A 1Z5AA 3IWQA 4P0MA 3M0EA 3IF5A 4WBGA 3UL5A 4BTXA 1NXYA 3BNBA 3G34A 3GPPA 2STDA 3S22A 1K57A 1I0XA 1JB5A 5AVFA 3KW6A 2BMRB 2QPNA 2K9DA 4FCZA 2UX0A 4LGYA 2XLNA 3CHWP 5IG0A 5G2GA 4RNTA 3BWLA 1D06A 2JKGA 5EVIC 4BD0A 3V50A 3Q81A 2JP7A 4EETB 4XGIA 1LXEA 3NULA 4MMNA 2HJ9C 2AVXA 1PYLA 4R80A 4WF0A 4BBVA 4Y15A 1NNVA 5FQ9A 4Y0TA 3B8LA 3GRDA 1A2PA 2WKHA 4JI1M 1XFQA 3LYXA 3MQOA 3O88A 4X65M 1BSEA 4P16A 1W00A 2R46A 5EQLA 1JN5A 1UCJA 1RN4A 1AXBA 5A90A 1NHGC 3VSKA 2EXBA 2CX0A 1IY1A 4O02B 4MDZA 3GRJA 3GV9A 5KSHA 2DMWA 3U5ZB 5G4YA 5DF7A 4PM8A 1Q3BA 2C11A 3EGXC 5DFXA 1E94E 1FNNA 4LPZA 1H8YA 4R70A 3DA1A 2QYBA 4D60A 4M9ZA 4ANRA 2H0TA 3GRRA 1TF0B 1M40A 3CAXA 3IG5A 3IHPA 4L6V6 4NC6A 3BM6A 5CEDA 2DNSA 1SXJE 1IYPA 4ZDXA 2OLVA 2KXEA 1ZC2A 1ORYB 1B20A 3AGEA 3D72A 2D02A 3LY4A 2B02A 4R6LA 1OPYA 1G71A 3WOEB 1ISKA 1I2EA 3CJMA 5F5YA 2JUJA 2HP9A 2H10A 2Y21A 1NJGA 3KCHA 1E3UD 5ITXE 1T18A 2A24A 4XXRA 5LC6A 4X55A 3IG8A 1TDZA 1AY7A 3HJQA 4OPYA 1DGFA 4DJ3A 2CV2A 1R4GA 1DJAA 3DAVA 2R41A 4HM6B 4KZ8A 1YVBI 2V0WA 1SCWA 4FUWA 1IDPA 1ES4A 1FCOA 4EUVA 4NG2A 3KP0E 3SARA 1MGWA 1RRHA 5LMUM 4OUQA 2V9AA 2Y55A 4FCVA 5FTMA 1HQCA 1Q42A 2W82A 1RGGA 4R3DA 4S2NA 4DV1M 1SXJA 4WMCD 1K82A 3SXXA 3PAEA 5FAOA 1G8PA 3U4LP 1XWIA 3LO7A 4NETA 3K1JA 2VEAA 1IFYA 2Y8HA 1I0VA 1KE0A 2CWUA 4LF9M 3KDSE 5ITXA 3SOYA 1F5MA 2ZMAA 7STDA 3P09A 4JGOA 5I94A 2OWPA 1SPUA 3PBOA 4ME4A 3STDA 1RGEA 5EM0A 5HD5A 4KZ7A 1IN8A 4CIZA 3HK4A 5C1BA 2H5XA 2X02A 4DR1M 4AEQA 1MX0A 2Y0TA 2D7EA 4KO8A 1LVNA 1X1UA 2R65A 3MYTA 1BYWA 1YM1A 3FTDA 2P74A 3MBZA 3NDGA 4IVKA 4M3KA 4HP4A 4X6TA 2M7UA 1FJGM 5DF9A 2M7VA 3HWSA 2ZA4A 1KVLA 1W5SA 2JY6B 4QHSA 3AGNA 1A2VA 3B89A 3N54B 5EP1A 4JXWA 3MMHA 4KZ9A 5CECA 4EBGA 5GLDA 2WGWA 1S723 3GQ4A 4R1GA 1LL5A 5HX9A 3NBBA 1IVXA 3ZG7B 3PYJA 3ZCBB 1SIHA 1ESIA 1ONHA 1Q2PA 3QP2A 1FGTA 1GCEA 4X1MA 1GMPA 3OWSA 3CCU3 3GPYA 2Z4SA 1FQGA 1K6RA 4IVIA 3TWLA 1GMQA 2PRFA 4O0PA 2UXDM 4I81A 1Q814 4O01A 1N9EA 1L0EA 3C30A 1OACA 1RTUA 1FIKA 4UA7A 1IEMA 4B88A 5A0OB 2QP9X 4MGHA 2LVPC 1NRFA 4LFUA 3UB7A 3TQSA 1GO5A 3HU2A 3EE1A 1YJ93 1HQYE 4F3LB 3DTIA 3ZDJA 5L2FA 4GKKM 2J3TD 3FTFA 5JBSA 2V20A 1RLSA 4D2OA 3T1QB 2EO2A 1W2ZA 1MJGM 2ACGA 2APLA 2DAGA 3D8LA 1E4DA 2OCTA 5TJJA 2O25A 2WZJA 5M18A 2ZTCA 1K4FA 3KSPA 2Q0OA 4LF8M 5CEBA 2WKQA 1I2SA 1ZHHB 1IN4A 1W01A 2R4IA 1GA9A 3G4PA 4CLCA 2A5YB 1RHLA 1S1YA 2EWVA 4WN5A 4XBXA 3VOYA 2IMJA 3FD9A 2E5LM 1TVFA 3T4LA 1WMNA 1IVVA 4AKGA 4J8TA 2O9CA 4OP5A 1JN5B 2Y2LA 2Y2QA 1CJFA 2ZOIA 1L2CA 4Z6YA 4FCTA 4KG5A 2HDQA 3V67A 1YSYA 2QBYA 1ESUA 4MBFA 1OJ5A 5FASA 3UDIA 4X69A 3N8SA 1JWPA 4JI8M 2G5GX 3ZG9B 1TEMA 3W2ZA 2J5YA 2Z76A 3I7JA 4R23A 3CMA3 1SKFA 3EEHA 4QY5A 3B7NA 4KZ4A 3T6PA 1L0FA 5CHUA 1IN5A 3LEQA 3HUNA 4Y2FA 1C7YA 1K56D 3KOYE 2WAFA 4PM5A 2V6ZM 1RDSA 1JR3D 4G6ZA 2OOLA 3U6EA 1B2XA 4L8PA 1IXSA 4E3MA 1I3IA 3LEZA 5TGFA 4B3SM 3T1RA 4F94A 3LQRA 1F98A 1EIJA 3FRIA 4QOSA 4LJ4A 4B3RM 1W5TA 2R44A 2CH9A 4FCMA 1OIZA 3E4OA 5EVEA 2VZWA 4OW0A 2J3WA 4LFAM 2DENA 3U60A 1QJGA 4DDSA 1C3BA 3ZYTA 2GQFA 2KAAA 1DP6A 2A24B 3OWYA 1TDLA 4ZM8A 5CGWA 5FTJA 3KFUG 2CC3A 1KQS2 2B95A 3PBNA 4PCZA 5HSQA 4LENA 1NNUC 3I4VA 2XROA 1RKYA 3EQUA 3DWKA 4KHPM 4FH4A 9RNTA 4RQ9A 2W0QA 2DVWB 2F5PA 5HDSA 5FTLA 1FR1A 1DJBA 3Q82A 2KNAA 3GRUA 1STFI 3CWFA 1AIPC 3GLGA 5CXOA 2YX9A 2LXEA 2QEX3 1NY0A 1SXJB 7GSPA 1GOYA 2XK1A 1P0ZA 3C7UA 3VOLA 1K4EA 4HEOA 2Z77A 2BLSA 2W3FA 1MNLA 3Q7ZA 1F8NA 1HKXA 1XXHE 3LIDA 4RBNA 4MBKA 5E26A 3JUPA 4O3VA 5KSCA 2Z8YM 4NXFA 4KZ5A 3VE4A 1I94M 2GNOA 5J4EA 3B7QA 2O9AA 3TW8A 3K9MC 3IF6A 2BASA 1VDDA 3FWLA 3K8ZA 3KYQA 2ZC7A 1WMPA 3HZPA 5BR8M 2CWTA 4MGIE 3URPA 2CKFB 4UA6A 5EP2A 2V0UA 2O9UX 2NQ8C 1VEUA 3JR5A 4JI4M 4GZBA 1N9JA 2MGWA 5HWTA 4HM2B 1SDEA 1K54A 3IXDA 4N6OB 2OAP1 4KLNA 3UL6A 3ZFZA 1LSVA 4PMAA 1PJSA 1IV7A 3V92A 2HWJA 2BMQB 2V1ZA 3V99A 4RX3A 3FUXA 1D6UA 5DYGA 1XXHA 1UCLA 4FSFA 4YWZA 1VQQA 1JKGA 5FDHA 4EEUA 3MG3A 1XGJA 1DO2A 4JI7M 4MMXB 4N92A 1GHIA 4HYZA 4Y0UA 1TR8A 2WGVA 2W04A 3GWRA 2KDLA 1G41A 1CK3A 1VEGA 5IWAM 1AR0A 2FFJA 4LJ6A 1CH0A 3HHWA 1PY3A 1PM5A 1ROAA 3KOZE 4FCJA 3HREA 1NLZA 3E46A 4F2LA 1XGIA 4EBLA 5HGRA 5EVHA 3DBAA 4JPMA 1WJ7A 4L15A 2DCFA 3UJNA 2Y74A 4GHOA 3D4AA 2R78A 5CHMA 1GJSA 3T8UA 4DUYM 2R9XA 4HJLB 1YLYA 1GOUA 1L8QA 3IMAB 3CPW2 4MJDA 1H8MA 2QQ8A 1OH0A 3KSED 2C10A 4GKJM 3JVUA 5F82A 4A5RA 4X66M 5CTMA 3I01M 3U6MA 1BANA 2WKEA 4LF4M 4BTWA 3H82A 5HDDA 3SH8A 3GZXB 1H3QA 2D01A 3J2PB 1QUSA 2WSFF 3E98A 3U97A 1KC84 3RXXA 1Y4KA 2PD8A 2LNHC 2ZM0A 3HI7A 4K08A 2V8CA 1RGAA 2C5RA 3NJAA 1D0KA 4CLCB 4R3BA 5AIGA 4HL4A 1RGKA 2OQEA 3UMEA 2EKFA 2K6BA 3KOWE 4IBGA 3LTDA 2JZ0A 3SVAA 1A90A 2O5RA 4NXGA 2ZM8A 1PI4A 1BSAA 3DH2A 1XJ2A 4BLCA 1K25A 2KX6A 3MJQA 1N36M 3VSYA 4HY8A 4HOIA 4EQ1A 3O5YA 3L28A 5FQJA 1XMQM 3R8FA 3NOUC 1L0GA 4GL6A 4X2HA 1TS0A 1KE4A 2MF7A 5E2EA 5HL1A 3W67A 3A46A 3JUOA 4DV5M 3UB9A 2B18A 4E3LA 3AHWA 1N4OA 1N9BA 1XB2B 1XJ6A 1Q864 4OQ0A 3ZVTA 1E97A 1O7PB 1Y28A 5CXWA 1QAQA 4JI2M 3QNCA 1IXSB 3C3DA 4QD4A 3W4PA 2VKSA 1I2WA 4JGRA 1UGUA 2QPAA 3HLFA 3GLIE 4ZTKA 2O9BA 4OP8A 5DFYA 4IBFA 2H0IA 4LGMA 2BO9B 3S27A 5IU1A 3MWZA 1R4CA 4NXEA 1XC8A 2E8JA 4B4XA 1VG5A 4RNAA 3SLUA 2K54A 2PYRA 3I0YA 1VHMA 3ITAA 5RNTA 2NUPC 3S7OA 4LYLB 1IYYA 1LL8A 3W68A 3CC73 3FTCA 4DF6A 4AKIA 3DGLA 4DKIA 3JVCA 2VGLS 3S29A 2EXAA 4DR5M 2VK3A 1J5EM 4UA9A 3BRMA 2L4FA 2WSCF 2LVNC 3EOIA 5J7EA 1YHQ3 3VF1A 5EXSA 3GLGB 1DGHA 3A45A 1OGZA 5KZHA 1FUTA 2I7NA 2YQZA 3K9OA 4II7A 1GHMA 4STDA 3LUQA 3Q7VA 3FYDA 4HH2A 1IYSA 3W8KA 2MC8A 3JPUA 3H7WA 3FKEA 3T1HM 3B74A 3PZWA 2P08A 3D3OA 5EXTA 1F9IA 4EYCA 1EE8A 2C9OA 1CQAA 1TFKA 5HAPA 2L2DA 3VLFB 3W4OA 5F1FA 2NUTC 1UDII 3G4S3 5L8MA 2OOVC 5LC7A 2BJWA 3FYCA 3D9YA 3K5TA 4G4RA 5FI6A 3DUKA 4LV0A 3QRDA 3J7Yd 3QNBA 2BT3A 5HPFA 3EQVA 1VEUB 4G3OA 2K3DA 2PDRA 4DJ2A 2DZNB 1IBLM 2XQZA 4ID4A 1D1JA 2PBYA 1A2KA 3Q2PA 4BBUA 3BJNA 1BRHA 4PKYG 3T0UA 4K61A 1PJJA 4DE2A 2PD7A 1PU4A 4R9KA 1HD8A 2RKOA 4DV6M 2C6WB 2ML5A 1XXHB 2ZLYA 2CV1A 1JKGB 2UWXA 1BZAA 1JNQA 4MN5A 3SOIA 3NC8A 1W5DA 4DV3M 4ARZA 3HIGA 3NM7A 4LFCM 3UMMA 5EM1A 4Y7PA 4GEWA 4Y28F 1P97A 3GDIA 2PR6A 3PVSA 3F7XA 2GBXB 4DV7M 3WS0A 3EHCA 1DGGA 2KZUA 2HPBA 4O7DA 3E0YA 1JWVA 4HM3B 2WO0A 2P7JA 1RSNA 1TH2A 1PIOA 1W4NA 4CHTB 3OOVA 2FXTA 1DRMA 4S2LA 1JB4A 1BNFA 3FRHA 3GAXA 1KGEA 4KUOA 3H82B 1OTIA 3DZLA 3V5MA 2Y2GA 3VP4A 3FCSB 4JN6A 3SAWA 1JB2A 3OXAA 2EA0A 1E3UA 1PW1A 2JCHA 3IT9A 3EQQB 1IFQA 3VGNA 3ZGAB 2EFUA 4LG2A 3PCSA 4TUWA 3ICYA 5HWVA 3JUQA 1GY7A 2CX1A 2LVOC 2RGOA 4NREA 2P38A 3ZH9B 4OOLA 3FG3A 3OX9A 3CC23 2J80A 3X3XA 5EOOA 5IG3A 3J7BA 5FQMA 1OMEA 2K7SA 2QGUA 3C38A 4HZ9B 1S4SA 3QHYA 4WMCA 2F5QA 8RNTA 1MY8A 2B5RA 2ZQ7A 5BIRA 5KQ8A 1JTGA 3E4RA 5C5KA 4KZ1A 4JI0M 4OPRA 4Q53A 4UN2B 3C8CA 2RSXA 4IJGA 1ZMUA 5CGSA 2Y2PA 4PEJA 2L4VA 2EA9A 4HH3A 1ZG6A 1IQPA 3CPTB 1R2ZA 1J09A 5DF8A 1ES3A 2R18A 4KT0F 1DETA 1X1XA 3HJSA 3LR0A 3A3IA 2CFOA 4D81A 3P01A 4C75A 1JNUA 1G3IA 2HGVA 4DE1A 3CCM3 4LSOA 3PXPA 3HY5A 2P5TA 1NLYA 2MJ6A 3LCEA 1PJTA 2LVQD 2PT7A 5GHYA 2KNZA 3NUVA 1UUWB 3SH9A 1SXJC 4HNBA 4JKTA 5CK6A 1HT1E 4GITA 2V1LA 2K31A 4ESPA 4JI6M 1M904 1DV0A 4BL3A 3K7CA 1VQ1A 4OVZA 1KFVA 1VQP3 3JUNA 4WYYA 1DGHB 2W27A 3OBFA 3N8LA 2JY5A 5JI2E 1I70A 5L09A 1GOVA 3Q7VB 4S2PA 1O7NB 2MR9A 4A3VB 1OTEA 1UI7A 2BIRA 3QK9A 5HFOA 3LIBA 1Q7Y4 3H7WB 2JKTM 3LR5A 5I5LA 1T6OA 4QNMA 4BMWA 5IT9S 2ZMFA 4WWUC 4ETXA 1M1K4 3FLJA 4LGWA 3F40A 1T3TA 1VQO3 4PM9A 4NRVA 3VV4A 3RNTA 3X3YA 1IT8A 1FUWA 1G28A 1SDNA 5FQQA 3B9PA 1NSFA 3MXRA 4ITQA 2JKFA 2DZLA 3U6PA 4LF6M 1QALA 4Z8XA 3CXC2 3BYDA 3Q07A 3NBIA 2HOHA 1UWNX 4GD8A 1OAOC 3X42A 1M6KA 1T19A 4ETZA 1MN3A 3IWIA 2WGIA 2GSPA 2Y2OA 4EBNA 4I4KA 3OPLA 2CP8A 5KPZA 4XBOA 1BULA 3K9PA 1JR3E 5F68A 3LYGA 4GC5A 2VQFM 1WHCA 2A3UA 1C54A 3U6DA 1Q7HA 5EXXA 5M19A 3MKFA 5HAQA 3QP4A 2KF6A 3DTEA 2Y2JA 4IBKA 3BQAA 3IJEB 1GSWA 2Y2KA 1Z6FA 3A3JA 4QU3A 1ACFA 4QWTA 1LT0A 2WUQA 3FG1A 4JI5M 2FFFB 4M0WA 2QSFX 5EV0A 4LF5M 4KQOA 1YQSA 3EX9A 1PJIA 2CG0A 2XEPA 5C18A 2HMNB 5EE8A 3T4QA 1NRJA 2KXGA 4B7HA 1NZOA 3IHBA 5CHJA 3CCR3 1E9SA 1ZTUA 3LCUA 1RCLA 2YFQA 1Q40A 5DTSA 1TIJA 1K56A 3C5AA 3HLBA 2F5SA 2OSUA 1JR3A 1NB3I 2FNAA 3PCRA 4LJ7A 1NJ4A 3KX0X 4OKPA 2LB9A 2XSHB 3F1PA 3ZC7B 2HDRA 3RGSA 2XD1A 3SC3A 1PZPA 4FCFA 4CLCC 1GMRA 3NXJA 3T4TA 4XBYA 3SW1A 1I3FA 3B33A 5CERA 1ULJB 3HOHA 2V1AA 2LHCA 3F7SA 1JBRA 1G59A 2KOIA 1TDHA 3A0SA 4QWOA 3HIIA 3DW0A 2KEBA 3F14A 3UO9A 3UY6A 2V1UA 3FF0A 2BTFP 2J7VA 3F1NA 2R6FA 4UQIS 5IW9A 1I4WA 3FF2A 4U0TA 4P87A 1B2UA 1M9GA 1FCNA 5DKKA 3FG8A 4ZJ2A 4KG6A 1E32A 4FWDA 3GMWA 3N9HA 1BRJA 1AWIA 1RCJA 4KQQA 4HVNA 1CI9A 3OCNA 1XHBA 1L0DA 1MWTA 2OO9A 2G8LA 5EQTA 3AFHA 1ALQA 5DTTA 2PAVP 4E3IA 3S28A 3PBTA 2Y20A 5E2GA 1OAIA 5GSPA 1MZUA 1EKMA 1XNRM 2WKIA 4HM0B 1WYCA 2X49A 3KZTA 3I553 4ZJ1A 3M7GA 1IQ8A 2W9QA 1IVWA 1QAKA 1YVSA 3WHOA 1VETA 3W4QA 4R7GA 4DV2M 1BLHA 1GSPA 1MBLA 3ECFA 3PBQA 3RGPA 4OQIA 4M0DA 2AHMA 2OTJ3 4MH0E 3FUWA 1TDGA 2LVAA 5HWWA 5FEGA 3B42A 1P9RA 3CGWA 3J7AS 5EJCA 1BIRA 4X25A 3OWUA 1PWDA 2Z7JA 2W56A 3D4FA 3BLSA 3OPPA 4LRTA 1R6BX 4LEHA 4GHLA 2CK3H 3UDXA 1N33M 2CIUA 1JRQA 4LZJA 4M9XA 4OVZB 3QP5A 4FD8A 2XH9A 5LMNM 1VM1A 5KPRA 1XMOM 2B1XB 3VDPA 3CMZA 3G6OA 3BU4A 4N6UA 2L09A 3D5IA 1IVUA 1IKIA 3LH4A 4I3IA 1JWZA 4M4XA 3SS4A 3TOIA 3FKAA 2DZOB 4JXVA 3OPRA 1GD3A 4EERA 2I9WA 1BNJA 1KDWA 4E3NA 2HMOB 2WGOA 1QUTA 1LLBA 3BY9A 1MOLA 2KNVA 1RGHA 3KIIA 1LQGC 2I72A 3T38A 3KS8A 3M2KA 2Q2EB 2YFLB 3WS1A 4CLCE 1YUBA 2E2UA 3RGRA 5DTKA 2ZDJA 4KFDA 3SS3A 3MG2A 2XR0A 2VA0A 1DGBA 1K38A 2W2CA 1TP6A 4JGQA 4YY3M 4DR4M 4CDLA 4CJNA 2YKFA 3OC2A 3UB6A 5MC7A 3UNLA 1IK3A 4TX4A 3ISGA 3TPZA 1S1ZA 3T4KA 1H5XA 1BSCA 1Q3CA 2Y0QA 3FUUA 4XK8F 4ZPXA 4QY6A 5FQKA 5AVEA 1RGZA 2Q9MA 1YSPA 3X41A 1TRPA 2FE8A 5ELJA 1DO0A 5G1LA 1OHPA 1RGCA 4CJ6A 3GP1A 1BRNL 1HNZM 4GCZA 1IQXA 1OTAA 3PYPA 2DAKA 4JI3M 3AOGA 4KZ6A 1IU7A 4JF5A 2CWVA 3E2LA 2HMLB 1N9LA 1GS3A 4LRXC 1ZO2A 1PGYA 1CEFA 4IBDA 1Q40B 3S7QA 2B3TA 1QAFA 3FZCA 2Z7AA 3O86A 4N1XA 1DP8A 2HDUA 2R9WA 3CF6E 1KDSA 4Y0OA 4B7GA 4EV4A 1FSYA 1KGFA 1W79A 4K90B 4MEZA 1A5TA 2VF8A 1IOUA 3B3XA 1LSXA 3F1PB 5HOHA 1S3SA 1CYUA 3EIHA 1J9MA 4LJ8A 3NWLA 1OF5A 3F92A 1ROVA 1NB5I 2WYXA 4LCLA 2P04A 4K1VA 4HJ6A 3UPOA 3QWLA 1LOYA 2OQEC 3I04M 3DM8A 3PXMA 3ZNYA 2AADA 4IBBA 2L7IA 1N32M 5L07A 2X8AA 1UGIA 1H0MA 2XZFA 3G0KA 1BVIA 2X4AA 1NV9A 1AUAA 2VQEM 2GNXA 3GTCA 4GW9A 3S4XA 2L0WA 2VJWA 3KSGA 3GLGE 3LIEA 4B4ZA 2W9PA 4PDGA 2A2LA 3ZNTA 3A3FA 4HM7B 3PBRA 1BGSA 1BRGA 3F1NB 1EUIC 4UHUA 3LICA 1GABA 3EBTA 3H4MA 1FGOA 5ELUA 3BW6A 3RH8B 4IPBA 3SBJA 4B93A 5ITQA 3K92A 3IPTA 4U13A 3U1WA 1QQWA 4IT7A 3U61A 5IERA 1R4YA 3BFCA 1J3WA 1LSWA 1LNIA 3FV7A 8CHOA 1UI8A 4R0QA 2V8FA 4B7FA 1O7MB 3CME3 3HU1A 3E99A 1EI5A 1W8YA 4WW0A 1JZOA 5GLBA 4P85A 1Q9EA 4YFMA 3NY4A 4J5GA 4YNRA 3G16A 1HNWM 3MPHA 4DR3M 2YKHA 4FWGA 1D7EA 2WKRA 4X64M 2Y73A 2OWHA 3CU3A 3C4PA 1PJQA 3HUOA 2VGKA 3H9WA 3NECA 4U0XA 3DXOA 2FGTA 1TF1A 4H8RA 1V9ZA 1UWPX 3M2JA 2XFSA 3FGYA 2HF6A 3IX3A 4X2OA 5DREA 3T4JA 3G8ZA 3B4OA 1BSBA 4N6MA 1ES2A 1FUSA 1KGGA 1VETB 4QHTA 4RF0A 5KQDA 3PAGA 3RXWA 2DNAA 4PD2A 3R9XB 3V98A 4J9AA 1YLZA 5GLAA 3BNEA 2L4EA 1FSWA 3AJIB 4GS9A 4EIWA 2HV1A 3N4IA 5F6AA 3PBSA 2PBDP 3B7ZA 3DGYA 6GSPA 1GHPA 2W56B 2CHVA 1UM8A 4LJ9A 3AKZA 3LR3A 3D5GA 4L9GA 3MFDA 1EQKA 1TRQA 3DGOA 1C1KA 4XM4A 3K2NA 4X53A 1K734 1U8CB 1BUEA 1HLUP 2YR0A 2JKRI 2G2UA 2JKRM 3GZBA 3MZDA 3GECA 4BU4A 5IG4A 3UB5P 2WGWB 4OU7A 1QVRA 2HDSA 3WMDA 3DFZA 4NL4H 1YJW3 4Z9QA 3LVWA 5KP1A 1OTBA 1Q824 2CFDA 3L29A 3GVBA 3NBRA 1HTZA 1XA1A 4S2JA 1ES5A 1V34A 5D82A 3KS4A 3ZQ5A 5ITRA 3AGFA 1PFLA 2CHQA 4N6LA 3I4YA 1YIJ3 1W2B2 3UK6A 3PXGA 1ULIB 5E2HA 1VDLA 2F5OA 1OGXA 4DR7M 5DJUA 3FG4A 2P9VA 2ERCA 2E8IA 1XNQM 1X1WA 1A0KA 5BVBA 2VGLM 1GL7A 1YGEA 4FMDA 3G2YA 3E9SA 3N8RA 2RCDA 1OQYA 3KYZA 1YI23 4BENA 1PRQA 2FH0A 3KN4A 1DMQA 2JQ5A 3KFQC 1L2SA 3VKGA 3LVVA 3LTBA 5GL9A 2XRNA 2OWJA 3RE8A 3TE6A 1EEJA 3GR2A 4AZFA 4GOGA 3GRVA 4WP2A 5FTNA 1VQ63 2H5SA 2RRUA 2UGIA 4PT5A 3NDEA 4QHCA 2PU2A 1N34M 1XPBA 2ZC6B 3P7NA 1QMEA 4AG6A 1BU4A 4NOOB 2ZBKB 4OVMA 1NWZA 1TS8A 4JF6A 4B9OA 1K55A 2HZ5A 4NXMM 2QBYB 5U47A 5D83A 3LGOA 4XUZA 3FTEA 1OF5B 2L4RA 3CLOA 2Y2HA 1LNHA 3TRCA 5HL6A 1NYMA 3K3DA 5EVID 2R0IA 2VDBB 1B21A 1YIT3 3KSJA 2OOAA 3TG9A 2J9PA 1K41A 1BNIA 1H6UA 3H3HA 2ZC5B 1D2NA 3KP1E 4CISA 1BNEA 3QP8A 2K47A 3I563 2IYJA 5HW3A 3GLHE 4PKYA 4S2OA 1HZOA 3T1XA 4R4RA 5FQIA 1VQK3 4R3JA 1SQWA 1VQL3 1QAMA 3GSPA 4G3VA 4PHTA 1G4AE 4GSPA 5FTKA 3K0ZA 5CF2A 3U60B 1OJLA 4OPZA 3U61B 1T2HA 2WOFA 4H3UA 4BL2A 3VKHA 2JC7A 2D7HA 3OPHA 3NI9A 1N5HA 3A0RA 4IBRA 3MK6A 1FZUA 3CF0A 3UB8A 2HP6A 3T1YM 3U2AA 3U6OA 2GU1A 4HLQA 4DV4M 5KPTA 3HJIA 3ZHHA 2AAEA 1NZUA 5BOHA 2ZAMA 3NCKA 3WWXA 3BQ8A 2Y2MA 3L25A 2GEYA 1S0WA 1KSIA 3OTOM 3GZRA 3HLEA 3GLHA 3LTAA 3MXSA 1W63Q 1HR0M 1AVLA 4LF7M 4KZBA 3S7NA 2J7NA 2XF3A 1UUVB 2WOHA 4AKZA 1K8A4 1MU5A 2BNGA 5FW5A 3NOTC 2EWWA 4GHIA 1EW0A 1QMFA 4DR6M 2OOBA 1LRAA 4CCVA 2EKKA 1NJFA 1WTHA 2QKPA 3IF6B 3UZUA 1OFHA 3QYBA 1S4RA 5A92A 4DXCA 2ZM6M 2CRUA 4WM9A 2G3QA 4FVMA 2W1TA 1SHVA 1YLJA 3CUEA 5F3WA 4LV2A 5J8XA 3BNDA 4I38A 2V2FF 4UEYA 3AGDA 2BMOB 1WYBA 1CEGA 4GIPA 1WQLB 2GJ3A 1RCKA 1QDRA 2J3TC 4HP9A 2ZQ9A 3CTWB 4AKHA 2N35A 3F1OA 2W03A 2JA2A 2IUKA 2Q07A 4MMYB 2Y2NA 5LBRA 4KQRA 5FATA 2VF7A 3EBYA 3UE3A 1MKMA 4NXBA 1K9M4 1ERQA 1T1CA 1W7FA 1DMNA 4HZBB 3G35A 3MHVC 2CFKA 4F1IA 2YNMD 4DUZM 5KP3A 5STDA 2JHEA 2F56A 3CG5A 2XA7S 4HBRA 5HARA 1VQ53 1CI8A 1Y8GA 2P9VB 4MGZE 5CLKA 5CF1A 4EU0A 1Z1SA 1BLPA 2FFYA 1SIIA 3CD63 3IX8A 1J7KA 1GD4A 4NXNM 3AOEA 1F4IA 1OIPA 1K57C 2FS1A 3A42A 2I9VA 4EXRA 1EFUB 2DKLA 1R7RA 3BB9A 4EQIA 1UW1A 1PRBA 2XDMA 2P05A 1DJCA 2EX9A 4MCWA 3BECA 3S1YA 2L1MA 3RJUA 4OONA 1T3BA 1T1AA 3E21A 2UV0E 3DWZA 3F8HA 2UXCM 5HAIA 1BLCA 1W02A 4WYKA 1QZEA 2HMMB 3OW22 1GSXA 2F4VM 4WEKA 5EVLA 3M8CA 1N77A 3M6BA 4XDWA 1SZVA 1IN7A 2CMNA 5FAQA 4LFBM 1ZGXA 1VQ73 2H0GA 5IEPA 3WS4A 3Q8XA 1I8VA 4FMBA 5G4ZA 1IXZA 5DYIA 1CEWI 3KSFA 3KXEC 4YHHM 1NO3A 1CQSA 1W7CA 1PI5A 3MXQA 4CPKA 1BOXA 2VX8A 1YJN3 5G1KA 4HEFA 5GHXA 3LOYA 1EA2A 4CGYB 1OHOA 1IBMM 4I5SA 4LCMA 4GHAA 1T43A 3OLOA 3K2LA 1VEJA 4RYEA 4B3TM 4MGKE 3PS8A 2M5ZA 4HBTA 3KVWA 5HDCA 4DXBA 4XUXA 4Y3IA 4ZJ3A 2GXFA 2ML6A 1SJWA 1QDTA 1ZX2A 4MGYE 4EWFA 4E3OA 1N75A 3SH7A 1TS6A 1T1BA 1V57A 3OCLA 3RFBA 3SEDA 4D80A 3EEAA 5FSRA 1MKIA 2ZQAA 4GNUA 1WE4A 2O0YA 3G30A 1MWUA 3NQZA 3NHQA 2IA2A 3VFFA 3VOZA 4Q8IA 2RFRA 1O7EA 3HHXA 3LT9A 1JV2B 2XSZD 2ZQ8A 5DNYA 3DGNA 3HHZA 5EXPA 2QZ6A 1Y4OA 1GYBA 4NKPA 1GA0A 1PNEA 1E25A 3RDEA 4D82A 2FOIC 1JQJC 2KLIA 3L9KA 3O87A 4OVDA 4S2NC 4GC9A 2ZD8A 3C4OA 4JLFA 4PPRA 2E2VA 4XBTA 3BNCA 3KKGA 5JPPA 4DE0A 2P09A 2J9OA 3SYKA 1ASKA 1WA9A 2QENA 3GLHB 2FNQA 4N3VA 2PU4A 2JZ1A 1LI0A 1QANA 4R4SA 3AV0A 3BIRA 1S67L 2Q9NA 2VGJA 1KOUA 4MN7A 4GHIB 5FLXS 3BBZA 2JY8A 4LMIA 3ER7A 3S7PA 2LTUA 2EX8A 3C3EA 1BTLA 4EW7A 3AMOA 4X62M 4HJ4A 1JVJA 3IHAA 1FCMA 1YKDA 2ZQCA 4BBAA 4UQIM 4LV3A 4ZAMA 3SYLA 3KYEA 4IUHA 4PM6A 4FWHA 3CF2A 2CG1A 5IENA 2W1TB 1XFNA 2ZC4B 4BWIA 1RNTA 1OTDA 3S5CA 4Q0JA 3D8BA 2X01A 1X1YA 2KF4A 4IJEA 2GU3A 4EW5A 1UUGB 3DGMA 3HUMA 3V3SA 3UMDA 2SBLA 1KE3A 2BWEA 4QPRA 3TSGA 4EESA 4E3JA 3ILKA 4OPQA 1MGRA 2CUZA 4J5KA 4KQDA 3EGDC 3RTYA 1RN7A 3AL0C 4BB9A 3R7WA 4GB7A 2LH0A 1EG9B 1OFIA 3EJVA 2KRKA 1HYFA 2ZHXB 3F1OB 4IBXA 3VE3A 2Y59A 3MFXA 4OX9M 3MKEA 4FD2A 4ARZB 3LIFA 1I2FA 4R9LA 1P3QQ 1Z5BA 4REZA 4I4LA 1SARA 4BBTA 2O01F 3GLFE 1BAOA 3DOAA 3WDGB 3A76A 1YMXA 2INWA 2KDKA 3KOXE 1K3WA 1JZDA 1YGWA 2KRUA 5L8RF 3JR4A 4JBFA 3GRYA 5IT5A 1VEKA 2XRXB 4RZMA 3LXUX 5EFWA 4P17A 1NNJA 1STZA 1D6YA 3BOSA 3LY3A 3MQQA 4RNYA 1M1XB 2RGHA 1WNHA 2KCDA 5G18A 4FOFA 4L4UA 4ZRRA 3UE0A 1BRSA 1DMMA 2WZZA 4R3AA 5AYRB 1BUJA 4DMZA 1MPLA 3B47A 4EEPA 1RP5A 3MMPA 5EUAA 4NPBA 2DAEA 2XGNA 1OUNA 5AEUB 2V1BA 3HJKA 3UNWA 4RF1A 4NSRA 1L1ZA 4WYKB 3SHGB 3NQYA 3DY5A 4HM4B 4P6ZS 3GLFA 2ZOHA 3DMCA 3LQQA 1NHWC 2UUBM 3THGA 4NSOB 2D42A 3B4PA 5KP4A 2D1WA 1DP9A 1BSDA 1L1TA 1IY2A 2KF5A 3EC9A 1E3VA 4AKYA 5K5BA 2KA6B 2Z3XA 3GPUA 2LYXA 5EOEA 5DJTA 4RX2A 4LRSA 4YOFA 4K0KM 1WXQA 2Y2IA 3BLZA 2KZSA 2BWBA 4QJGA 4NHFA 3TL4X 2LWXA 3PTEA 1K0KA 5ITYA 2IWDA 2ZAOA 3GO8A 2LHGA 3B7CA 2C98A 3HLCA 3HGIA 2Z6CA 1NJI4 1NO1A 1BNRA 4CQHA 3A3EA 5FEFA 1NY6A 2KRTA 2K0MA 3ROBA 2ZL8A 1TTEA 2L1SA 2GEXA 5KO3A 1IM2A 5A93A 2H1RA 3MQ0A 4IIAA 4IBEA 4RKUF 4NK3A 5AQAA 2EJSA 4KZ3A 3UE1A 4BLMA 4IBJA 1N8QA 5CRFA 2DWZB 5D3OA 2EFXA 2DAMA 2KW0A 4L8OA 4I5QA 1GL6A 3W0FA 3BFFA 4X56A 1RGLA 2RNTA 2QA43 3QP1A 1BVSA 2J8YA 1K6SA 4LCBA 4O8GA 3HL9A 3S67A 2ZC3B 4XDVA 2JXNA 3IBJA 4HAAA 4L9EA 3HCYA 4OOMA 2W0NA 2MJ5B 2C5WB 2DI0A 4IHQA 5EEOA 4OQHA 4WZ5A 4WLAA 4X1LA 1LHYA 1BNGA 1W6GA 5IS1A 1BSGA 4HESA 3SMSA 3ZCZA 3U6QA 1GY5A 1EROA 5DFLA 4RA7A 4G3KA 1L5GB 4AW4A 3HLWA 2LBCA 1O7HB 1DYUA 3IF6C 4MN6A 4GD6A 1NYYA 2D7GA 2ZM2A 4HI4A 4X68A 4HIAA 2R62A 2WADA 1TUHA 4E6WA 2WZXA 2QJ5A 3T12B 1W6CA 1Z09A 3AMOB 3C7VA 3HX8A 2Z6DA 3K63A 1OPXA 1LTMA 3V39A 3BXWA 1BUQA 1K54C 1IY0A 3L27A 4OLDA 1HNXM 3J27B 2HKJA 5BPVA 4M9SA 1I2GA 3FYZA 3HVFA 3NX0A 3TJZC 4E3KA 3BEBA 5L10A 1TD5A 3NIAA 3IH8A 3ZG5A 4BD1A 3L2AA 5IZ7D 2BU4A 1PZOA 2PR5A 3HBRA 5GLCA 4EBPA 5HPIA 1WMOA 4EXOA 2CFLA 3C58A 1GSVA 2CE7A 4K0WA 4JXSA 2OLUA 3A98B 3WODG 3D3LA 3R7WB 2BG1A 4KODA 4LJAA 3F8XA 1XJ4A 3G32A 4HQAA 4KZAA 5E43A 4L7KA 1RRLA 1MWSA 3UB1A 1BRKA 2HJEA 2Y79A 3Q1CA 3SFZA 1BNSA 1FOFA 3CITA 2PZVA 5EP4A 5EVIA 4YINA 1TH4A 3EB8A 1NV8A 1HJPA 1G5UA 2IY2A 3T4OA 4IJFA 3WA3A 4O2HA 5JI3E 5BU4A 2CEAA 3T8NA 2XLJA 4ILFA 4JF8A 3IXBA 3LZAA 1HT2E 1ZQ9A 2UXBM 1RGFA 1VQ83 3IWOA 2CFWA 3MR0A 5AJGA 2IWBA 1YSQA 1TFOA 4EV2A 4FW9A 2UUCM 4HKVB 1IXRC 3MKIA 2M60A 3NBLA 1N9NA 3JVVA 2ZANA 1G02A 2R45A 2P0MA 3FKWA 4N9LA 4HOHA 5I97A 1KD14 1VQ93 3GLFB 3VFHA 5AQBA 1K55C 3CNMA 2Z4RA 3H4JA 3T15A 3DZDA 3Q1FA 3MJ5A 4XB5A 1ZMWA 2A49A 1YPRA 1G0TA 4MM3B 3HX3A 1VZZA 4JXJA 4RVAA 3DTMA 3TWMA 5GKNA 4Q0HA 3FSDA 3K3CA 4QB8A 5GHZA 3RFWA 4GMQA 1ZS7A 2YFIB 2PHYA 4NRWA 3A0VA 2W3HA 1YAXA 2Y91A 5FDSA 3J81S 2LB5A 3T1SA 1HU9A 3CNXA 4DV0M 8CATA 3A5EA 2Y4AA 5DVAA 4LZIA 3ZQJA 1V58A 1XX2A 2INXA 3IS2A 2KF3A 4GDBA 4H6JA 4DE3A 1MXOA 1XJ3A 4XT2A 3FUTA 3SYUA 1IN6A 1V92A 1FILA 3GQ3A 4KVHA 1BLSA 3LMMA 2X71A 4AFIA 2V1CA 2L6OA 1AV4A 5E2FA 2W3EA 2IWCA 3UPPA 1ONGA 1ZMVA 4WUJA 2RGQA 5A2QS 4G4OA 3IXHA 4IEDA 2BNKA 2CW9A 4IUKA 3NHXA 3KE7A 2DWNA 4DN0A 4S12A 2W6JH 3C9PA 3HLGA 5AQ9A 4C3QA 3HU3A 4KUKA 1TGUA 3D79A 1OKSA 1UFZA 3CPOA 2QIYA 1Q02A 1T2IA 3VK8A 1PWGA 2DXIA 3GPXA 1H8ZA 3MF0A 3SX1A 3SZTA 5BXQA 3CCL3 2ZMVA 4FR9A 2H28A 3WS5A 4GKUA 1N78A 1DVCA 3BLMA 4H61A 1ZAEA 3IH9A 3LI8A 3U6LA 3QYEA 1BRIA 3U6CA 2HMJB 4HHDA 3T50A 4HM8B 1FW7A 3G31A 3O3VA 4LV1A 1Q39A 4AG5A 1RNBA 4G1MB 3ALAA 5AIHA 1ODVA 5F1GA 1Z59A 1W6YA 1JTDA 4R38A 3CUEC 5IEOA 5ITUA 3JYIA 5FSWA 3WHKA 4K91A 5AEWB 1SXJD 5IF6A 3SASA 5CX7A 1N9OA 2C9CA 3VDUA 3H51A 3GQ5A 3SOAA 4KFFA 1UGHI 1QAOA 1ZKJA 3CCS3 2VV7A 5KIZA 1ERMA 4JYAM 4GH9A 2XGLA 3LIAA 4MLLA 3JUMA 2OAQ1 3HJ8A 3MHEA 4WHAA 4LY6A 3EWKA 2CWBA 1V9YA 5JYOA 1Y54A 3FUVA 3OV4A 3O8YA 5FA7A 1C7HA 1E9RA 1U5OA 2YFJB 3KSIA 5FI2A 2WGQA 3VP0A 4O8SA 1RJOA 4JGPA 4EV5A 4WELA 2GX5A 3GZYB 2VLGA 1IKGA 5HZHA 3TWKA 1FGRA 1SKOA 1XKZA 5A8BA 3AOEC 1GVNA 3NV0A 2J8XB 3FKVA 5EVIB 3SAUA 2VIIA 4DRTA 2Z2LB 3FE3A 4S2MA 1DVDA 2A15A 3WHLA 3WOFB 1Q2QA 1S6RA 3CCJ3 1QZMA 5H37D 4S2IA 1FYSA 2O99A 3HZJA 4KFEA 2DWLA 3ULFA 3UE6A 1WR1B 2HMKB 4IBCA 1E3RA 3MG1A 2ZQDA 5FAPA 2KHHA 2JWSA 3J80S 5JYPA 3CC43 4RNZA 5AIFA 1G6AA 3N6IA 1R2YA 2GBWB 3Q8GA 1KSFX 4MEIA 5M1AA 2WK0A 1XP4A 2W3GA 3VK7A 4L9FA 4MBHA 1US1A 1YE9A 3L7HA 2EX2A 1IV9A 1K3XA 4KENB 2R4JA 1JJ22 1D0LA 2H0HA 2XSZA 3KSXA 5TFQA 4EC6A 4GJ4A 1YLWA 4JRFA 1YMSA 4L78A 4WFOA 3LCVB 3JAMS 1O7WB 3KO6A 4HBUA 4N1HA 2QCUA 1YT4A 2M7OA 1PW8A 3ITBA 1NDOB 3A3DA 3FPWA 1SG9A 3SATA 4WEJA 4G3WA 3D9RA 2IA7A 2P0XA 2CFGA 3FC7A 1S66L 5DRVA 3PR6A 3V76A 4DBGB 4B3MM 2XA7M 3HKPA 6RNTA 1VB6A 2K0BX 2CHGA 1CYVA 1L2BA 5TBMA 5AYSC 1GKIA 3GSGA 3TDGA 2WKPA 3BFDA 3BFEA 4CLCD 1TS7A 2L7HA 2IUJA 1P9WA 3N8BA 4JF4A 4N6V0 4OOYA 4HJ3A 1CF0A 2UUAM 5EP3A 1B3SA 5CTNA 1TH3A 3CPTA 2JBFA 4Y13A 1A67A 1I5QA 2R4EA 1T5YA 4AQYM 3U6SA 3OZHA 2O3OA 3IS2B 1LL9A 4KT3B 4L8RC 4I3AA 2HL7A 4BIRA 4H6JB 1FGMA 1Z5CA 4XT2B 2DWMA 4OH0A 2CV0A 1W8QA 4EUZA 1RN1A 3CCE3 1L2DA 2SARA 5AI1A 4JXGA 7RNTA 2I7PA 1PYYA 1NVMA 1XA7A 3IQAA 3PNVA 1OTRA 1DE3A 3PHYA 1QYRA 1IT7A 1V33A 2OPFA 4G4NA 1UCKA 1IYQA 5FL3A 3CCQ3 5CGXA 4GS9B 4I3JA 2QMIA 1LQMB 1CUKA 1Z6TA 1RMSA 1HZ1A 2GDNA 2QNJA 3FH1A 1WGLA 4MMZB 3P98A 3R4KA 5KMWA 3UN7A 1HVBA 3E4PA 3WS2A 2Z6BA 2Z2MB 2W1RA 4FMCA 4LRYC 3RGAA 1OT6A 5E6JA 2W3DA 1LOVA 4FMAA 2CC1A 3BFGA 2WSEF 1G96A 1LOWA 2ZBBA 5AIIA 1YLAA 3NBXX 3NBJA 3GLIA 3M6HA 1RU3A 1GLNA 1TTOA 2ZL1A 1F2KA 5HD3A 3LR4A 4UAAA 4R71A 2F99A 3WR2A 2H0YA 1N5PA 4GN2A
chains in the Genus database with same CATH topology
2EX6A 1AVKA 3FZWA 4ORLA 1FGQA 4BQMA 1IQYA 5EECA 4QNRA 1VQ43 2F86B 2C96A 1MWRA 1NY5A 1LI9A 1S5AA 3EIEA 3IXGA 4LJ5A 5FGOA 2XD5A 3SS5A 1KVMA 5EPHA 3EN8A 4WZ4A 5JPUA 3WRTA 3MSOA 1KWIA 4BJPA 1ZG4A 1IYOA 4QOZC 2HCBA 4PDIA 3MZFA 4GRIA 4MNRA 2B24B 1O7GB 1QMAA 3EF8A 1FR6A 3VMAA 3VFDA 2PNCA 2C99A 5FI7A 2HP5A 1PWCA 4P6BA 1X37A 1GY6A 5IREB 4IIWA 2JE5A 4S2KA 1DY6A 3NV0B 5TR7A 1U60A 4L16A 2OQ4A 4R4KA 1NWWA 3UGJA 4B08A 3N7WA 5F83A 3LTCA 4OK0A 1LOXA 1PFPA 2CHCA 3U5ZA 5TGNA 2DHRA 3CCV3 2EUCA 2G2WA 3VSLA 1BT5A 3HLDA 3PFIA 2HHHM 4K1UA 3WRZA 4K0XA 4PM7A 3SMPA 3VP3A 3EN1B 3V3RA 4U3TA 4LZZA 4BTYA 3UJMA 4N6NB 5A91A 1RGYA 4DDYA 3LMLA 4ZBEA 4JV5M 5ITTA 3G6E3 1J2BA 2F5NA 3SAVA 3LT8A 3L26A 3F9SA 2RCXA 2UU9M 3ZG8B 6STDA 3X40A 1STDA 3E2KA 2BJVA 1D6ZA 4E6XA 2JDIH 2LQVA 5D81A 1YLTA 1NU3A 1G68A 2XSOB 1IELA 3Q90A 1QVG2 3NM2A 4HM1B 4W5WA 4N6TA 1N8R4 4LGQA 2F98A 1OHSA 4I8OA 2RL3A 3MZEA 3GQZA 1V74A 3ZVWA 4OLGA 2QZ4A 3PGBA 1VQN3 1LV7A 1FA3A 4WZ5C 1W5ZA 3L0RA 1OCVA 4WURA 3WA2X 4OQGA 3X3ZA 5IHVA 4G4QA 3VP1A 2XZUA 4KG2A 4IBIA 3G713 2DRWA 2E2TA 2J7OA 2OOVA 3UPNA 3ZG0A 1KYIA 1YLPA 4L0LA 1QVF2 3GLIB 3M6AA 5AQ7A 3HHYA 1VQM3 2OTL3 3UDFA 1TU5A 4N9KA 3W0LB 4FH2A 5IG5A 4WP5A 3G2ZA 1K28A 4GB5A 2XR8B 3VP2A 3I51A 2WAEA 3PNYA 2ZJ9A 4AI6A 4R1KA 1EWZA 4HM5B 4C6YA 4DR2M 2XFTA 7CATA 3SHFA 1IBKM 1O07A 3QAUA 2BHMA 3CZDA 2OV5A 1XXMA 4FCWA 4GDNA 4MB7A 1Z5AA 3IWQA 4P0MA 3M0EA 3IF5A 4WBGA 3UL5A 4BTXA 1NXYA 3BNBA 3G34A 3GPPA 2STDA 3S22A 1K57A 1JB5A 3KW6A 2BMRB 2QPNA 4FCZA 2UX0A 4LGYA 2XLNA 5IG0A 5G2GA 4BD0A 5EVIC 3V50A 3Q81A 4XGIA 1LXEA 4R80A 5FQ9A 4Y0TA 3B8LA 3GRDA 2WKHA 4JI1M 3O88A 4X65M 1W00A 4P16A 2R46A 5EQLA 1JN5A 1AXBA 5A90A 1NHGC 3VSKA 2EXBA 1IY1A 4O02B 3GRJA 3GV9A 5KSHA 3U5ZB 5DF7A 4PM8A 1Q3BA 2C11A 1E94E 1FNNA 1H8YA 3DA1A 4M9ZA 2H0TA 3GRRA 1M40A 3IG5A 3BM6A 5CEDA 2DNSA 1SXJE 1IYPA 4ZDXA 2OLVA 2KXEA 1ZC2A 1ORYB 3AGEA 3LY4A 1OPYA 3WOEB 1ISKA 3CJMA 2HP9A 2H10A 2Y21A 1NJGA 1E3UD 5ITXE 4XXRA 5LC6A 4X55A 3IG8A 1TDZA 3HJQA 4OPYA 1DGFA 2CV2A 1DJAA 4HM6B 4KZ8A 1YVBI 1SCWA 1IDPA 1ES4A 1FCOA 3KP0E 3SARA 1RRHA 5LMUM 4OUQA 2Y55A 4FCVA 5FTMA 1HQCA 1Q42A 2W82A 4R3DA 4S2NA 4DV1M 1SXJA 4WMCD 1K82A 3SXXA 3PAEA 5FAOA 1G8PA 1XWIA 3LO7A 4NETA 3K1JA 1KE0A 2CWUA 4LF9M 3KDSE 5ITXA 3SOYA 2ZMAA 5I94A 7STDA 3P09A 2OWPA 1SPUA 3PBOA 3STDA 4KZ7A 1IN8A 3HK4A 5C1BA 2X02A 4DR1M 4AEQA 1MX0A 2Y0TA 2D7EA 4KO8A 1LVNA 1YM1A 2R65A 3MYTA 2P74A 3MBZA 3FTDA 3NDGA 4IVKA 4M3KA 4X6TA 1FJGM 5DF9A 3HWSA 1KVLA 1W5SA 4QHSA 3N54B 1A2VA 5EP1A 4JXWA 4KZ9A 5CECA 4EBGA 5GLDA 2WGWA 1S723 3GQ4A 4R1GA 1LL5A 5HX9A 3NBBA 1IVXA 3ZG7B 3PYJA 3ZCBB 1SIHA 1ESIA 1ONHA 1Q2PA 1FGTA 1GCEA 3OWSA 3CCU3 3GPYA 2Z4SA 1FQGA 1K6RA 4IVIA 3TWLA 2UXDM 4I81A 1Q814 1N9EA 1L0EA 1OACA 4UA7A 4B88A 1IEMA 5A0OB 2QP9X 4MGHA 1NRFA 3TQSA 3HU2A 3EE1A 1YJ93 1HQYE 3ZDJA 5L2FA 4GKKM 3FTFA 5JBSA 2V20A 4D2OA 2EO2A 1W2ZA 1E4DA 3D8LA 2OCTA 5M18A 1K4FA 3KSPA 4LF8M 5CEBA 1I2SA 1IN4A 1W01A 2R4IA 1GA9A 3G4PA 2A5YB 4XBXA 3VOYA 2IMJA 3FD9A 2E5LM 1TVFA 1WMNA 1IVVA 4AKGA 4J8TA 4OP5A 1JN5B 2Y2LA 2Y2QA 1L2CA 4Z6YA 4FCTA 4KG5A 2HDQA 1YSYA 2QBYA 1ESUA 4MBFA 5FASA 3UDIA 4X69A 3N8SA 1JWPA 4JI8M 2G5GX 3ZG9B 1TEMA 2Z76A 3I7JA 4R23A 3CMA3 1SKFA 4QY5A 4KZ4A 1L0FA 5CHUA 1IN5A 3HUNA 1K56D 3KOYE 2WAFA 4PM5A 2V6ZM 1JR3D 4G6ZA 3U6EA 4L8PA 4E3MA 3LEZA 5TGFA 4B3SM 4F94A 3LQRA 4QOSA 4LJ4A 4B3RM 1W5TA 2CH9A 4FCMA 4OW0A 4LFAM 3U60A 1QJGA 4DDSA 1C3BA 3OWYA 1TDLA 4ZM8A 5CGWA 5FTJA 3KFUG 2CC3A 1KQS2 3PBNA 4PCZA 4LENA 1NNUC 3I4VA 1RKYA 3EQUA 3DWKA 4KHPM 4FH4A 2W0QA 2DVWB 2F5PA 5FTLA 1FR1A 1DJBA 3Q82A 3GRUA 1STFI 3GLGA 5CXOA 2YX9A 2LXEA 2QEX3 1NY0A 1SXJB 2XK1A 3C7UA 1K4EA 2Z77A 2BLSA 1MNLA 3Q7ZA 1F8NA 1HKXA 4MBKA 4RBNA 5E26A 3JUPA 4O3VA 5KSCA 4KZ5A 1I94M 3K9MC 3IF6A 1VDDA 3FWLA 3K8ZA 2ZC7A 1WMPA 3HZPA 5BR8M 2CWTA 4MGIE 4UA6A 2CKFB 5EP2A 2O9UX 2NQ8C 3JR5A 4JI4M 4GZBA 1N9JA 4HM2B 1SDEA 1K54A 3IXDA 4N6OB 4KLNA 3UL6A 4PMAA 3ZFZA 1IV7A 3V92A 2BMQB 2V1ZA 3V99A 4RX3A 3FUXA 1D6UA 5DYGA 1XXHA 4FSFA 1VQQA 1JKGA 5FDHA 3MG3A 1XGJA 1DO2A 4JI7M 4MMXB 4N92A 1GHIA 4HYZA 4Y0UA 2WGVA 2W04A 3GWRA 1G41A 1CK3A 5IWAM 1AR0A 2FFJA 4LJ6A 3HHWA 1PM5A 1ROAA 3KOZE 4FCJA 3HREA 1XGIA 4EBLA 5HGRA 5EVHA 4JPMA 4L15A 2DCFA 3UJNA 2Y74A 5CHMA 3T8UA 4DUYM 2R9XA 4HJLB 1YLYA 1L8QA 3IMAB 3CPW2 4MJDA 1OH0A 3KSED 2C10A 4GKJM 5F82A 4A5RA 4X66M 5CTMA 3U6MA 2WKEA 4LF4M 4BTWA 3SH8A 3GZXB 3J2PB 3U97A 1KC84 3RXXA 1Y4KA 2LNHC 2ZM0A 3HI7A 2C5RA 4R3BA 5AIGA 4HL4A 2OQEA 3KOWE 4IBGA 3LTDA 3SVAA 1A90A 2O5RA 2ZM8A 1PI4A 4BLCA 1K25A 1N36M 3VSYA 3L28A 5FQJA 1XMQM 3R8FA 1L0GA 4GL6A 4X2HA 1KE4A 2MF7A 5E2EA 5HL1A 3A46A 3JUOA 4DV5M 4E3LA 1N4OA 1N9BA 4OQ0A 3ZVTA 1Q864 1E97A 1O7PB 5CXWA 1QAQA 4JI2M 3QNCA 1IXSB 4QD4A 3W4PA 1I2WA 2QPAA 3HLFA 4ZTKA 4OP8A 4IBFA 4LGMA 2BO9B 3S27A 3MWZA 1R4CA 1XC8A 4B4XA 4RNAA 3SLUA 2K54A 3I0YA 3ITAA 3CC73 3FTCA 4DF6A 4AKIA 3DGLA 4DKIA 3JVCA 3S29A 2EXAA 4DR5M 1J5EM 4UA9A 3BRMA 1YHQ3 3VF1A 5EXSA 3GLGB 1DGHA 3A45A 1OGZA 5KZHA 2I7NA 2YQZA 4II7A 1GHMA 3W8KA 4STDA 3Q7VA 3FYDA 1IYSA 2MC8A 3FKEA 3T1HM 3PZWA 5EXTA 4EYCA 1EE8A 2C9OA 5HAPA 1TFKA 3VLFB 3W4OA 5F1FA 3G4S3 2OOVC 5LC7A 2BJWA 3FYCA 3K5TA 4G4RA 5FI6A 3DUKA 4LV0A 3QRDA 3J7Yd 3QNBA 2BT3A 3EQVA 2DZNB 1IBLM 2XQZA 4ID4A 2PBYA 1A2KA 3Q2PA 3T0UA 4K61A 1PJJA 4DE2A 1PU4A 4R9KA 1HD8A 2RKOA 4DV6M 2C6WB 2ML5A 1XXHB 2ZLYA 2CV1A 1JKGB 2UWXA 1BZAA 1JNQA 3SOIA 3NC8A 1W5DA 4DV3M 3HIGA 3NM7A 4LFCM 3UMMA 4Y7PA 3PVSA 3F7XA 2GBXB 4DV7M 3WS0A 3EHCA 1DGGA 2KZUA 2HPBA 4O7DA 1JWVA 4HM3B 2WO0A 1TH2A 1PIOA 1W4NA 4CHTB 4S2LA 2FXTA 1JB4A 3GAXA 1KGEA 3DZLA 3V5MA 2Y2GA 3VP4A 3FCSB 4JN6A 3SAWA 1JB2A 3OXAA 2EA0A 1E3UA 1PW1A 2JCHA 3IT9A 3EQQB 3VGNA 3ZGAB 2EFUA 4LG2A 3PCSA 4TUWA 3JUQA 1GY7A 2RGOA 4NREA 2P38A 3ZH9B 4OOLA 3FG3A 3OX9A 3CC23 3X3XA 5EOOA 5IG3A 3J7BA 5FQMA 1OMEA 2QGUA 4HZ9B 3QHYA 4WMCA 2F5QA 1MY8A 2B5RA 2ZQ7A 5KQ8A 1JTGA 3E4RA 4KZ1A 4JI0M 4OPRA 4Q53A 2RSXA 5CGSA 2Y2PA 4PEJA 2L4VA 1ZG6A 1IQPA 1R2ZA 1J09A 5DF8A 1ES3A 2R18A 3HJSA 3A3IA 2CFOA 4D81A 4C75A 1G3IA 4DE1A 3CCM3 4LSOA 2P5TA 3LCEA 5GHYA 3NUVA 1UUWB 3SH9A 1SXJC 4JKTA 5CK6A 1HT1E 4GITA 2V1LA 4JI6M 1M904 4BL3A 3K7CA 1KFVA 4OVZA 1VQP3 3JUNA 4WYYA 1DGHB 3N8LA 5JI2E 3Q7VB 4S2PA 1O7NB 4A3VB 1UI7A 5HFOA 3QK9A 1Q7Y4 4QNMA 5IT9S 4WWUC 1M1K4 3FLJA 3F40A 1T3TA 1VQO3 4PM9A 4NRVA 3X3YA 1IT8A 1FUWA 1SDNA 5FQQA 3B9PA 1NSFA 3MXRA 4ITQA 3U6PA 4LF6M 1QALA 4Z8XA 3CXC2 3BYDA 3Q07A 3NBIA 4GD8A 3X42A 1M6KA 3IWIA 2WGIA 4EBNA 2Y2OA 4I4KA 3OPLA 5KPZA 4XBOA 1BULA 3LYGA 4GC5A 2VQFM 2A3UA 3U6DA 5EXXA 3MKFA 5HAQA 5M19A 2Y2JA 4IBKA 3IJEB 2Y2KA 1Z6FA 3A3JA 4QU3A 4QWTA 2WUQA 3FG1A 4JI5M 2FFFB 4M0WA 4LF5M 4KQOA 1YQSA 3EX9A 1PJIA 2CG0A 2XEPA 5C18A 2HMNB 5EE8A 2KXGA 4B7HA 1NZOA 3IHBA 5CHJA 3CCR3 1E9SA 5DTSA 2YFQA 1Q40A 1TIJA 1K56A 3C5AA 3HLBA 2F5SA 2OSUA 1JR3A 1NB3I 2FNAA 3PCRA 4LJ7A 1NJ4A 4OKPA 2XSHB 3ZC7B 2HDRA 3RGSA 2XD1A 3SC3A 1PZPA 4FCFA 3NXJA 4XBYA 5CERA 1ULJB 3F7SA 1G59A 1TDHA 3HIIA 3DW0A 2KEBA 3F14A 3UO9A 3UY6A 2V1UA 3FF0A 2J7VA 5IW9A 1I4WA 3FF2A 4U0TA 4P87A 1M9GA 1FCNA 4ZJ2A 4KG6A 1E32A 4FWDA 3GMWA 3N9HA 1RCJA 4KQQA 4HVNA 1CI9A 3OCNA 1XHBA 1L0DA 1MWTA 2G8LA 5EQTA 3AFHA 1ALQA 5DTTA 4E3IA 3S28A 3PBTA 2Y20A 5E2GA 1EKMA 1XNRM 2WKIA 4HM0B 1WYCA 2X49A 3KZTA 3I553 4ZJ1A 3M7GA 2W9QA 1IQ8A 1IVWA 1QAKA 3W4QA 4R7GA 4DV2M 1BLHA 1MBLA 3ECFA 3PBQA 3RGPA 4OQIA 4M0DA 2AHMA 2OTJ3 4MH0E 3FUWA 1TDGA 3J7AS 5EJCA 3OWUA 1PWDA 2Z7JA 2W56A 3D4FA 3BLSA 3OPPA 4LRTA 1R6BX 4LEHA 4GHLA 2CK3H 3UDXA 1N33M 2CIUA 1JRQA 4LZJA 4M9XA 4OVZB 4FD8A 2XH9A 5LMNM 1VM1A 5KPRA 1XMOM 2B1XB 3VDPA 3CMZA 4N6UA 2L09A 1IVUA 1IKIA 3LH4A 1JWZA 3SS4A 3TOIA 3FKAA 2DZOB 4JXVA 3OPRA 1GD3A 2I9WA 1KDWA 4E3NA 2HMOB 2WGOA 1LLBA 1MOLA 3KIIA 2I72A 3T38A 3KS8A 3M2KA 2Q2EB 2YFLB 3WS1A 1YUBA 2E2UA 3RGRA 5DTKA 2ZDJA 4KFDA 3SS3A 3MG2A 2XR0A 1DGBA 1K38A 2W2CA 1TP6A 4YY3M 4DR4M 4CDLA 4CJNA 3OC2A 3UNLA 1IK3A 4TX4A 3ISGA 3TPZA 1H5XA 1Q3CA 2Y0QA 3FUUA 4ZPXA 4QY6A 5FQKA 1RGZA 2Q9MA 3X41A 2FE8A 5ELJA 1DO0A 1OHPA 3GP1A 1HNZM 1IQXA 4JI3M 3AOGA 4KZ6A 1IU7A 4JF5A 2CWVA 3E2LA 2HMLB 1GS3A 1ZO2A 1CEFA 4IBDA 1Q40B 1QAFA 3FZCA 2Z7AA 3O86A 4N1XA 2HDUA 2R9WA 3CF6E 1KDSA 4Y0OA 4B7GA 4EV4A 1FSYA 1KGFA 1W79A 4K90B 4MEZA 3B3XA 1CYUA 1S3SA 3EIHA 1J9MA 4LJ8A 3NWLA 1OF5A 1ROVA 1NB5I 2WYXA 4LCLA 4K1VA 3UPOA 3QWLA 2OQEC 3DM8A 3PXMA 3ZNYA 4IBBA 2L7IA 1N32M 2X8AA 2XZFA 3G0KA 2X4AA 2VQEM 3GTCA 3S4XA 4B4ZA 2W9PA 4PDGA 3ZNTA 3A3FA 4HM7B 3PBRA 4UHUA 3EBTA 3H4MA 1FGOA 5ELUA 4IPBA 3SBJA 5ITQA 3K92A 3IPTA 4U13A 3U1WA 1QQWA 4IT7A 3U61A 5IERA 3BFCA 3FV7A 8CHOA 1UI8A 4R0QA 4B7FA 1O7MB 3CME3 3HU1A 3E99A 1EI5A 1W8YA 4WW0A 5GLBA 4P85A 4YFMA 3NY4A 3G16A 1HNWM 3MPHA 4DR3M 4FWGA 4X64M 2Y73A 3CU3A 3C4PA 3HUOA 2VGKA 4U0XA 3DXOA 2FGTA 4H8RA 3M2JA 2XFSA 3FGYA 4X2OA 5DREA 3G8ZA 3B4OA 4N6MA 1ES2A 1KGGA 4QHTA 4RF0A 5KQDA 3PAGA 3RXWA 4PD2A 3R9XB 3V98A 4J9AA 1YLZA 5GLAA 3BNEA 1FSWA 3AJIB 4EIWA 3N4IA 3PBSA 1GHPA 2W56B 2CHVA 1UM8A 4LJ9A 3AKZA 3MFDA 1EQKA 3DGOA 1C1KA 4XM4A 4X53A 1K734 1U8CB 1BUEA 2YR0A 2G2UA 3GZBA 3MZDA 5IG4A 2WGWB 4OU7A 1QVRA 2HDSA 3WMDA 3DFZA 4NL4H 1YJW3 4Z9QA 3LVWA 5KP1A 1Q824 2CFDA 3L29A 3GVBA 3NBRA 1HTZA 1XA1A 4S2JA 1ES5A 5D82A 3KS4A 5ITRA 3AGFA 2CHQA 4N6LA 3I4YA 1YIJ3 1W2B2 3UK6A 3PXGA 1ULIB 5E2HA 2F5OA 1OGXA 4DR7M 3FG4A 2P9VA 2ERCA 2E8IA 1XNQM 5BVBA 1GL7A 1YGEA 4FMDA 3G2YA 3E9SA 3N8RA 2RCDA 1YI23 4BENA 3KN4A 1DMQA 2JQ5A 3KFQC 1L2SA 3VKGA 3LVVA 3LTBA 5GL9A 3RE8A 3TE6A 4GOGA 3GR2A 4AZFA 3GRVA 5FTNA 2H5SA 1VQ63 4PT5A 3NDEA 4QHCA 2PU2A 1N34M 1XPBA 2ZC6B 1QMEA 4AG6A 4NOOB 2ZBKB 4OVMA 4JF6A 1K55A 4NXMM 2QBYB 5U47A 5D83A 4XUZA 3FTEA 1OF5B 2Y2HA 1LNHA 1NYMA 5EVID 1YIT3 3TG9A 3KSJA 2J9PA 1K41A 3H3HA 1H6UA 2ZC5B 3KP1E 1D2NA 4CISA 2K47A 3I563 5HW3A 4S2OA 1HZOA 4R4RA 5FQIA 1VQK3 4R3JA 1SQWA 1VQL3 1QAMA 1G4AE 5FTKA 3K0ZA 5CF2A 3U60B 1OJLA 4OPZA 3U61B 4H3UA 2WOFA 4BL2A 3VKHA 2JC7A 2D7HA 3OPHA 3NI9A 1N5HA 4IBRA 3MK6A 3CF0A 2HP6A 3T1YM 3U6OA 2GU1A 4HLQA 4DV4M 5KPTA 3ZHHA 1NZUA 5BOHA 2ZAMA 3NCKA 3WWXA 2Y2MA 3L25A 2GEYA 1S0WA 1KSIA 3OTOM 3GZRA 3HLEA 3GLHA 3LTAA 3MXSA 1HR0M 1AVLA 4LF7M 4KZBA 2J7NA 2XF3A 1UUVB 2WOHA 4AKZA 1K8A4 1MU5A 2BNGA 5FW5A 1QMFA 4DR6M 4CCVA 1WTHA 1NJFA 3IF6B 3UZUA 1OFHA 5A92A 4DXCA 2ZM6M 4WM9A 4FVMA 1SHVA 1YLJA 5F3WA 4LV2A 5J8XA 3BNDA 2V2FF 3AGDA 2BMOB 1WYBA 1CEGA 4GIPA 1WQLB 2ZQ9A 3CTWB 4AKHA 2W03A 2JA2A 2IUKA 2Q07A 4MMYB 2Y2NA 4KQRA 5FATA 3EBYA 3UE3A 1K9M4 1ERQA 1W7FA 1DMNA 4HZBB 3G35A 3MHVC 2CFKA 2YNMD 4DUZM 5KP3A 5STDA 3CG5A 4HBRA 5HARA 1VQ53 1CI8A 2P9VB 4MGZE 5CLKA 5CF1A 1Z1SA 1BLPA 2FFYA 1SIIA 3CD63 1J7KA 1GD4A 4NXNM 3AOEA 1K57C 3A42A 4EXRA 1R7RA 3BB9A 4EQIA 1UW1A 2XDMA 2P05A 1DJCA 2EX9A 3S1YA 3BECA 3RJUA 4OONA 3DWZA 3F8HA 2UXCM 5HAIA 1BLCA 1W02A 4WYKA 2HMMB 3OW22 2F4VM 4WEKA 5EVLA 3M8CA 1N77A 3M6BA 4XDWA 1IN7A 5FAQA 4LFBM 1VQ73 5IEPA 3WS4A 3Q8XA 4FMBA 1IXZA 5DYIA 1CEWI 3KXEC 4YHHM 1NO3A 1CQSA 1W7CA 1PI5A 5GHXA 4CPKA 1YJN3 4HEFA 3LOYA 1EA2A 4CGYB 1OHOA 1IBMM 4I5SA 4LCMA 4GHAA 3K2LA 4RYEA 4B3TM 4MGKE 3PS8A 2M5ZA 4HBTA 3KVWA 4DXBA 4XUXA 4ZJ3A 2GXFA 2ML6A 1SJWA 1ZX2A 4MGYE 4EWFA 4E3OA 1N75A 3SH7A 3OCLA 3SEDA 4D80A 5FSRA 1MKIA 2ZQAA 4GNUA 1WE4A 3G30A 1MWUA 3NQZA 3VFFA 3VOZA 4Q8IA 2RFRA 1O7EA 3HHXA 3LT9A 1JV2B 2XSZD 2ZQ8A 5DNYA 3DGNA 3HHZA 5EXPA 2QZ6A 1GYBA 1GA0A 1E25A 3RDEA 4D82A 2FOIC 1JQJC 3O87A 4OVDA 4S2NC 4GC9A 2ZD8A 3C4OA 4JLFA 4PPRA 2E2VA 4XBTA 3BNCA 3KKGA 5JPPA 4DE0A 2P09A 2J9OA 3SYKA 1ASKA 2QENA 3GLHB 2FNQA 4N3VA 2PU4A 1LI0A 1QANA 4R4SA 3AV0A 2Q9NA 2VGJA 5FLXS 4LMIA 3ER7A 2EX8A 1BTLA 3AMOA 4X62M 1JVJA 3IHAA 1FCMA 2ZQCA 4BBAA 4ZAMA 4LV3A 3SYLA 4PM6A 4FWHA 3CF2A 2CG1A 5IENA 2ZC4B 3S5CA 3D8BA 2X01A 4IJEA 2GU3A 3DGMA 3HUMA 3V3SA 2SBLA 1KE3A 3TSGA 4E3JA 3ILKA 4OPQA 2CUZA 1RN7A 3AL0C 4BB9A