2XEPA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
428
structure length
419
Chain Sequence
SVPTPAEAALAAQTALAADDSPMGDAARWAMGLLTRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 135
structure length 419
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xepA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xepA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xepA02
3PBQA 4MNRA 4QU3A 4Y0UA 3D4FA 3Q7VB 1CI8A 4PM9A 5EUAA 1JVJA 4DF6A 4E3JA 4S2LA 4WZ5A 2VGJA 1EROA 1TVFA 3RXWA 1H5XA 4RYEA 1MWUA 1K57C 2ZQ9A 5M18A 3HL9A 5FQKA 2J8YA 3S4XA 3ISGA 3ITAA 3UNWA 5FAOA 4IBXA 2X01A 1DJAA 4ZJ2A 4OOYA 2EFUA 1CEFA 2E8IA 2HP5A 1KVMA 3UPNA 3OCNA 4E3IA 4KG6A 3RXXA 3V39A 4KZ7A 3DWKA 4KQOA 4MEZA 3ZG8B 2ZMAA 2QZ6A 5EVID 3UDIA 2WADA 5FAQA 3PBRA 2EXAA 1QMFA 3PTEA 4GDNA 4EBPA 2Y2MA 1YT4A 1CEGA 4UHUA 3WRTA 2GDNA 1L0FA 3C7VA 5A90A 2IWDA 1MBLA 1ONGA 1RP5A 2X71A 3G2YA 2ZQCA 3VOZA 1W79A 1JWVA 1ONHA 3ZHHA 5GLBA 5BOHA 1IEMA 1ZG4A 5FQQA 2P9VB 2B5RA 1K4FA 4YFMA 2WGWB 5FDHA 1XGIA 3NI9A 2XQZA 4GN2A 5GLAA 5F1FA 5GHYA 4EUZA 2DRWA 4HBUA 3NCKA 1LLBA 2ZQ8A 3BFDA 2Y2PA 1AXBA 1O07A 1K6RA 1E3UA 2ZJ9A 5CEDA 4Y0TA 1YLTA 1LHYA 3FZCA 2Y2KA 1NRFA 1L0GA 3A3EA 1K25A 3ZFZA 3GTCA 3VP2A 3ZG5A 5TGFA 5CGWA 4JXVA 3HLGA 2RCXA 4OLDA 2R9WA 1K54C 1MPLA 4FCFA 4QD4A 3G35A 3OPLA 4ZJ3A 3UE3A 4JF6A 3SH8A 3MZEA 5D3OA 3HLCA 3WS0A 2P74A 5A92A 3E2LA 3Q07A 1NZOA 3GMWA 2WUQA 4K0WA 2V20A 4KQRA 3G30A 4ZTKA 1CI9A 1I2WA 4K0XA 2XDMA 3GRJA 3A3JA 1BZAA 3M2JA 4XUXA 4X53A 5E2EA 1NYMA 5GHXA 3SS4A 5EVIA 2XD5A 2XFSA 2WKIA 1XA7A 5U47A 4WEJA 4DE0A 2WZXA 2ZC4B 3WS2A 3C7UA 2Y2JA 3DTMA 2Y91A 3G34A 3NY4A 5KZHA 3BLSA 1W5DA 4P0MA 4A5RA 1WE4A 5DF9A 3W4PA 3M6BA 5CXWA 1YLWA 1ZC2A 2JE5A 1FCMA 2XEPA 1SKFA 1ESIA 1MXOA 3ZCZA 4DXBA 1LI9A 4OQHA 4LCLA 5EE8A 5KMWA 3HVFA 4O7DA 3G32A 5CERA 1BLSA 3V3SA 3O87A 3IWOA 1IKGA 4E6WA 4WELA 5CGXA 2J7VA 3IXHA 1ES4A 1K6SA 3Q1FA 5A91A 5HAPA 3IXBA 3IF5A 4NK3A 1NY0A 5AQBA 4JLFA 5F1GA 4FSFA 3ZG7B 2H0TA 1PI5A 3E2KA 1PYYA 4R1GA 1H8ZA 4BJPA 3UPPA 5EVLA 3VP0A 5G18A 4GOGA 3FV7A 1BSGA 2HDUA 2Y2NA 1NJ4A 2J9PA 2WGWA 2Y2GA 3A3DA 4LV2A 4R0QA 2ZLYA 3OPHA 2EX9A 4YINA 1FCNA 5FI2A 3Q81A 4K91A 4DKIA 1ZG6A 2ZQ7A 5I94A 5EVIB 4FH2A 3UDXA 4BLMA 4R4SA 4OQGA 1PZPA 4DXCA 4MBFA 1ALQA 5FQMA 3AGDA 3C5AA 4CJNA 3UO9A 2OLUA 4OP8A 2ZM2A 4GKUA 3W4QA 1JTGA 2XFTA 3OPRA 4OPYA 1KDWA 5E2GA 2Y2HA 5AQ7A 1IYPA 1JWPA 2Z2LB 3MXRA 5JYPA 1KE3A 2RL3A 1FOFA 2Y4AA 3N8LA 2PU2A 3HUMA 3OPPA 4X55A 4WM9A 1ES5A 1EWZA 5DTSA 3V5MA 4D2OA 4EWFA 3MBZA 1K56A 3HLBA 3IWQA 3IH8A 2ZC6B 1YQSA 4KENB 1I5QA 1L0EA 5CGSA 2JBFA 4LCMA 3S22A 3VSLA 3ZVTA 4N1HA 1MWTA 5HX9A 5L2FA 2OSUA 3WS1A 1ES3A 2ZD8A 5CHUA 4S2KA 3FYZA 3VOYA 2BG1A 1OMEA 3UN7A 2IWCA 4OH0A 3LO7A 1DJCA 3BEBA 1IYSA 4XUZA 4H8RA 4OPRA 1W7FA 4P85A 5IHVA 5HW3A 2XGNA 3IWIA 4R4RA 4S2PA 1DY6A 3NC8A 1VM1A 3LCEA 4OOMA 1I2SA 2WYXA 2HP6A 3IF6A 3SS5A 3P98A 4N9LA 4RVAA 2ZM0A 5DF8A 1IKIA 1KE4A 5CTMA 3G31A 2HP9A 4RX2A 2OV5A 3ZDJA 4E3LA 3NBLA 4HESA 5GLDA 3MZDA 3C4PA 3AGFA 5JYOA 3QNCA 4Z9QA 1TDLA 3HREA 4X68A 2XK1A 4CPKA 2WK0A 4QY6A 3A3IA 3GQZA 1DJBA 1GA0A 1KGEA 1IYQA 3FWLA 1K4EA 1L2SA 1YMSA 3CZDA 1KGFA 4QY5A 1ESUA 1GA9A 1XA1A 4OQ0A 5E43A 2DCFA 2ZC3B 1BUEA 4PM8A 3WS5A 3NDGA 1BTLA 1SCWA 2V1ZA 4GB7A 4Y0OA 4S2JA 1PWDA 2PU4A 2A49A 2UWXA 4PMAA 4X6TA 1TDGA 3SH9A 2XR0A 4DDYA 4E6XA 4BL3A 2DNSA 5F83A 1KDSA 4KQQA 1J9MA 5J8XA 4E3NA 4R3BA 4U3TA 1HD8A 4E3OA 3WS4A 3BLMA 5HFOA 1E4DA 4C6YA 5FQIA 5AQAA 3GVBA 3LEZA 3TSGA 4S2NA 1PWCA 1E25A 4GD6A 4IBRA 2JC7A 4M3KA 3P09A 3IF6B 1Z6FA 1RGZA 1EI5A 4OPQA 1GCEA 3BYDA 3BFEA 3O3VA 2HDSA 5DVAA 5GL9A 3VP4A 3DWZA 3VP3A 4BENA 2Y2LA 3UY6A 1SDNA 3O88A 2EX6A 5HL1A 2WGIA 4KZ3A 4U0XA 5FI6A 4EV4A 4OONA 3HBRA 3OCLA 3BECA 2C5WB 2CC1A 3VP1A 4OKPA 4R23A 2J9OA 1K55A 4KZ6A 3SOIA 3HLEA 1Q2QA 3UE0A 4B88A 2BLSA 1Y54A 1GHMA 3HLFA 4X69A 2HPBA 4ZAMA 5HAIA 3ZVWA 5FSRA 2PBYA 3BFCA 5TR7A 3OZHA 1YM1A 2Y2OA 2HDQA 3IXDA 2EX8A 3IHBA 3N8RA 4KZBA 3NIAA 4N9KA 4UA6A 3RJUA 3BM6A 2V2FF 3PBOA 4KZ5A 2Y59A 2Z2MB 4RA7A 4RX3A 1L0DA 3IHAA 2WKHA 3IT9A 4UA7A 4JPMA 4WZ5C 3MKFA 4KZ8A 1NZUA 2G2UA 1N9BA 2JCHA 5CHJA 5E2HA 3SS3A 3BFFA 1W8QA 4R3JA 5KSCA 4MBKA 5FQ9A 4OPZA 2IWBA 4Q8IA 1KGGA 4HEFA 2QPNA 3Q82A 4WBGA 4LENA 4QJGA 3V50A 2Y2QA 2EFXA 2Y55A 3ITBA 3Q7VA 2X02A 4WYYA 1N4OA 3S1YA 3ZNYA 2R9XA 1YLPA 4FH4A 1KVLA 1BLPA 5A93A 4PM6A 1E3UD 1WYBA 1PIOA 3DW0A 1K54A 4OQIA 1U60A 1JWZA 4ID4A 4JF5A 4N92A 4PPRA 3A3FA 5CEBA 3UDFA 1MWRA 1IELA 1GHIA 2H10A 4OLGA 2WGVA 4QHCA 1M6KA 5EECA 1HVBA 3ZNTA 1BT5A 2G2WA 5HAQA 3G4PA 3TG9A 2WZZA 4KG2A 1K55C 5M1AA 4KZ9A 3ZG9B 3PAGA 4JKTA 1PZOA 2ZQDA 4WZ4A 3Q7ZA 4Y7PA 3HUOA 2WKEA 2ZQAA 3FKWA 3G2ZA 1PI4A 5E2FA 5AQ9A 1S0WA 1PW8A 1XXMA 4BQMA 4UAAA 1HZOA 4ZDXA 3W4OA 3EQVA 3SH7A 3C4OA 3UE1A 2QMIA 3HLDA 2H0YA 5GHZA 4DE2A 1FR1A 4MLLA 4X56A 5DF7A 3VFHA 1LI0A 3I7JA 1FSWA 4E3KA 1XP4A 2ZC7A 3TOIA 1LL5A 2XLNA 1PW1A 3JYIA 3MFDA 1XX2A 4OP5A 2OLVA 4QB8A 1K57A 4P87A 1RGYA 1O7EA 3N6IA 4E3MA 1G6AA 1C3BA 5FATA 1ERMA 3GR2A 5CRFA 1XGJA 3CMZA 3IH9A 4KZAA 3BFGA 5EOOA 1HTZA 2I72A 1MWSA 2ZM8A 4DRTA 4N1XA 1ZKJA 2Y2IA 1BULA 4IVKA 1FCOA 3B3XA 4U0TA 1H8YA 3QHYA 4BD0A 3O86A 1LL9A 2P9VA 4DDSA 3M2KA 4WMCA 4KG5A 4BL2A 1WYCA 4LV0A 3PBTA 4GD8A 1MKIA 1YLZA 3QNBA 3FKVA 1ERQA 2VGKA 3LY3A 1BLHA 3GV9A 1Q2PA 2ZC5B 4JXGA 3WRZA 1KE0A 4JF4A 4OOLA 4XXRA 3PBNA 5CHMA 5DTTA 1XPBA 3IF6C 1IYOA 2HDRA 2Q9MA 5M19A 3AGEA 5FI7A 3BRMA 3OC2A 3WWXA 2EXBA 4ZBEA 3V3RA 3ZG0A 4LV1A 3HLWA 4WEKA 1XKZA 4S2MA 1BLCA 1QMEA 3VSKA 4EBLA 4GZBA 2XF3A 3MXSA 5FA7A 5KSHA 4IEDA 3CJMA 4DE1A 1NXYA 2H5SA 3LY4A 3IQAA 4JBFA 5HARA 5EVIC 3W8KA 2XH9A 1TEMA 4PM5A 2FFYA 1FR6A 1G68A 3CG5A 3UPOA 2Q9NA 3N7WA 3PAEA 4DE3A 3VFFA 4GDBA 4LV3A 4B4XA 1W8YA 4IVIA 4S2OA 3N8SA 3ZGAB 4S2NC 4OVDA 2C6WB 3HUNA 4PM7A 1M40A 2WAFA 1JTDA 3NDEA 4P6BA 4C75A 4BD1A 1NYYA 4JXSA 4GNUA 1YLYA 4S2IA 4ZJ1A 2A3UA 2WAEA 5CECA 4WMCD 4UA9A 1VQQA 1YLJA 5CTNA 5DTKA 1GHPA 4FD8A 4EBNA 5EPHA 5EOEA 4EQIA 1ES2A 4KZ4A 5FAPA 1RCJA 3EQUA 1PWGA 3GSGA 4JXWA 4B4ZA 1K56D 4F94A 3IXGA 4HBTA 5TFQA 1SDEA 3N4IA 1S6RA 1YMXA 3PBSA 5GLCA 4C3QA 1SHVA 3MZFA 3MKEA 5FQJA 1K38A 1MY8A 3VMAA 4MBHA 1CK3A 5FASA 1FQGA 2FFFB 2XD1A 2EX2A 5F82A 4NETA 4L0LA 1FSYA 3M6HA
chains in the Genus database with same CATH superfamily
3MQQA 3T1SA 2EKFA 2FE8A 1Q864 2A5YB 1DMNA 4E3JA 4DF6A 3RGPA 3SEDA 2LVQD 2E2VA 3MPHA 1EROA 2MJ6A 5KQ8A 4ZRRA 1Q3BA 1NO1A 1PJJA 4EW5A 5M18A 1K57C 5A8BA 4J5KA 2MROB 2ACGA 1XC8A 2L4EA 1IVUA 5LC7A 2GQFA 4RNAA 2DKLA 1EW0A 2EFUA 7RNTA 2HP5A 3K7CA 3I563 1KVMA 3S28A 1C7HA 3CCL3 3S7OA 2ZMAA 2QZ6A 5EVID 2L1SA 5FAQA 3LT9A 2O9CA 4OVZB 4LRZE 2Y2MA 1CEGA 2V8FA 4UHUA 3LIAA 2STDA 3C7VA 2V1AA 3W67A 2ZAMA 2IWDA 5JI3E 3I553 1MBLA 4JGRA 3GZBA 1ONGA 3G2YA 3CNXA 3VOZA 2F5PA 1JWVA 1ZHHB 5GLBA 1UWNX 1ZG4A 2GU3A 3UB7A 4CLCD 1K4FA 4YFMA 1T2IA 2WGWB 3NI9A 1ZS7A 4GN2A 5AYSC 2DRWA 1DV0A 2ZQ8A 1Z5AA 1K6RA 2ZJ9A 2R62A 2W2CA 1G3IA 4CLCC 1LHYA 3M6HA 1M9GA 4FWGA 5EJCA 3A3EA 1W6CA 3AHWA 1WHCA 2VIIA 4NC6A 1I0VA 2DHYA 1X0OA 2BASA 3BW6A 1GL7A 4X66M 2RCXA 1XFNA 1JKGA 2W9QA 3I0YA 3X3YA 5HOHA 1JBSA 1QDRA 1JQJC 1VQ63 2WOHA 2R9WA 3OOVA 2M7UA 4IBDA 3G35A 3OPLA 4ZJ3A 5DJTA 4KQDA 2W3EA 5A92A 3E2LA 3OBFA 2F5QA 1GMPA 4J9AA 1NZOA 3CPTB 4R70A 2HJEA 2WO0A 3MKIA 1VEUA 3MQOA 4K0XA 2VGLM 3GRJA 4CJ6A 1T3BA 4XUXA 1ZO2A 4X53A 5GHXA 3FGYA 2XD5A 1SG9A 4CCVA 3SAVA 2WKIA 3GAXA 3MG2A 4LGMA 4FCTA 3UK6A 2Y2JA 3G34A 5KZHA 3KP0E 3BLSA 3TDGA 3C2WA 3L28A 1WE4A 2DNAA 3GRUA 3W4PA 3L2AA 1TRQA 1MKMA 1CH0A 2LTUA 4OVMA 2XEPA 1SKFA 1Z5CA 1LSWA 1MXOA 4DXBA 2CEAA 2LBCA 1SXJB 2HWJA 5EE8A 4O7DA 3G32A 5CERA 3IWOA 3WHKA 5G1KA 1LQMB 3NUVA 4LF8M 1KQS2 2SARA 3WHLA 3FRHA 1FUWA 4ZPXA 2CE7A 1QALA 3WOEB 4I5QA 3IF5A 1NY0A 3KE7A 5HL6A 5EQLA 4EEUA 4K0KM 1XJ6A 2CUZA 2UUCM 4YHHM 1VEJA 2KF5A 5MC7A 4GB5A 4JXJA 2Y0QA 1C1KA 5HSQA 4BJPA 1PGYA 2BJVA 1I70A 1H6UA 1JB4A 1KSFX 1VEUB 1GMQA 3EEAA 3N54B 3LICA 1NJ4A 2J9PA 2B24B 3NQYA 3MYTA 2GZAA 2EX9A 3FUUA 4DKIA 4K91A 1ULIB 2W3FA 1B21A 2PYPA 5I94A 2E2UA 5AIHA 1Q40A 1QAOA 8CHOA 2VX8A 4DXCA 4DV5M 5FQMA 3FG1A 4GW9A 3U6SA 4CJNA 3UO9A 4N6NB 3SFZA 1IN4A 1HNZM 1CJFA 3V92A 3FTFA 3OPRA 4OPYA 4N6UA 3EE1A 2Y2HA 1IYPA 1QJGA 1Q7HA 3GZRA 4LFCM 1TDHA 1B2XA 2BO9B 3SYLA 2VDBB 2Y4AA 2J5YA 1RGHA 2LHCA 4X55A 1HQYE 3MG1A 4B08A 3BY9A 1D6YA 1NNVA 3FKAA 3HLBA 1DVCA 3UMMA 1BNGA 3U5ZA 1I5QA 1L0EA 4LCMA 3S22A 2OTJ3 4JGOA 2Z4SA 1XB2B 4I3JA 3WS1A 1GO5A 1BRKA 2ZD8A 2JWSA 1I0XA 5CHUA 3AHSA 3HJSA 3JVCA 4WP5A 1T3TA 2K0BX 4JYAM 1DJCA 1S1YA 3I01M 1IYSA 3LO7A 4XUZA 4EBGA 5C1BA 2W3HA 1F5MA 4HM0B 3T4JA 2CHGA 1OUNA 3JVVA 1I2GA 2FNAA 3GECA 1I2SA 3VE4A 3X42A 3K9PA 3IF6A 1VQK3 1RN1A 4N9LA 3CCS3 4NXEA 2O0YA 3H3HA 3F9SA 3NBLA 1LOWA 3C4PA 1PJSA 4S12A 4Z9QA 3T12B 2Y74A 2LVOC 1X1WA 4HM1B 2NUTC 3A3IA 2L7IA 2CIUA 5I5LA 3FWLA 4X62M 1L2SA 2CG1A 1OCVA 3GPPA 4OU7A 1L2CA 4HIAA 4QY5A 4NXMM 1BRJA 4LYLB 5EEOA 5E43A 2QZ4A 2GEXA 2MGWA 2RGOA 2DWZB 5HDDA 3TW8A 2V1ZA 2PU4A 2A49A 4R3DA 1TDGA 2F4VM 3SH9A 2XR0A 3U6QA 2ZMVA 4DDYA 4L78A 4E6XA 1FA3A 2XA7S 2LXEA 3BOSA 1RSNA 1TIJA 3SLUA 4BL3A 5EM0A 5C5KA 3U61B 1V33A 1YJ93 3TPZA 1QMAA 1CEWI 1TFOA 2K47A 5J8XA 4KFEA 1EUIC 1IT7A 1T6OA 1AWIA 4R4KA 3T1QB 3BLMA 1OPXA 1OIPA 1JB5A 4C6YA 4HQAA 5AQAA 3GVBA 3THGA 2ZL8A 2H1RA 3F1NB 2HKJA 2OOVC 1E25A 1TRPA 1ROAA 2JC7A 1Z6FA 3EGXC 2R46A 3MJ5A 2BNKA 5G1LA 1GCEA 1GSVA 4YNRA 1OQYA 4IPBA 1LQGC 2L09A 2A24B 3O88A 1IY0A 3IX3A 3PXGA 3V67A 3ECFA 2DWLA 5EXPA 2GBWB 1ZTUA 2ZHXB 3F8HA 3NULA 4EV4A 3BECA 1UUGB 3UB5P 4OKPA 3LVWA 3A98B 5DFXA 4EERA 2OOAA 3PCSA 3HLEA 1Q2QA 5FGOA 5HDCA 3E9SA 1EA2A 2CW9A 4X69A 1B20A 1DGGA 1T1AA 3WA3A 1PU4A 3LGOA 4HM7B 4B3MM 3IXDA 5IEOA 1MX0A 1QANA 3KFUG 1YUBA 1N8QA 2JKFA 4GIPA 3T6PA 1O7GB 3AFHA 1YHQ3 3HHYA 3EB8A 2Z2MB 1ZMWA 1W00A 3NV0A 3UB1A 4GHLA 3IHAA 4QWOA 4RX3A 4WZ5C 4KODA 2KXEA 1BOXA 1NB3I 2UUGC 1VQO3 2G2UA 3T4TA 5CHJA 3BFFA 5KSCA 1BNJA 1VQ83 2IWBA 4PD2A 1KGGA 2IYJA 4Q8IA 2QPNA 4LENA 3V50A 2KRUA 4MGZE 2A24A 3E46A 2EFXA 1Q9EA 2DAMA 1QVF2 4NSOB 3S1YA 1LSXA 3WODG 2M1CA 2R9XA 3UMDA 4FH4A 1BLPA 4CISA 5A93A 3GLHB 1WYBA 1ZMUA 5BU4A 1QZEA 4UEYA 3DW0A 3P01A 4LPZA 4XDWA 1XJ3A 4OQIA 4IBFA 1JWZA 1R4YA 1BNIA 4PEJA 1UFZA 1DO0A 2Q07A 2D1WA 3GSPA 1GHIA 1HR0M 4RF1A 3GLGB 5AIGA 1JN5B 2WGVA 1I8VA 2CC3A 3KYZA 4REZA 2IUKA 1BT5A 2G2WA 3NECA 5HAQA 3TG9A 2WZZA 1LOXA 4RZMA 4KZ9A 3ZG9B 1RTUA 3U60B 3QRDA 2XRNA 4JKTA 4F1IA 1NJFA 3Q7ZA 5AIIA 5FEGA 4LRSA 2OAP1 3G2ZA 5E2FA 4LJAA 1OTIA 5HZHA 2GNXA 1W2ZA 4BQMA 4UAAA 2HGVA 2VKSA 1JJ22 3W4OA 3SH7A 4BTYA 1TFKA 3UE1A 4NPBA 3HLDA 2H0YA 4YY3M 3T4OA 4F3LA 3EHCA 4MLLA 4M9SA 2WGOA 3C9PA 1LL8A 3I7JA 2ZC7A 2J3TD 2YFIB 1OTRA 6STDA 1G28A 3GQ3A 1PW1A 3MFDA 3B7QA 3B42A 2P09A 1NWWA 2E2TA 3V98A 1H0MA 1G4AE 4QB8A 3BNDA 2JP7A 1O7WB 1K57A 3LH4A 1D0MA 2ML5A 4HM8B 3F14A 2P04A 3MWZA 1G6AA 1C3BA 1VQP3 1ERMA 3T1YM 3GR2A 5CRFA 3CMZA 2F5WA 1YNVX 4BMWA 3WR2A 4QPRA 3U4LP 1IFYA 3B3XA 1S4SA 1MJGM 4WW0A 1W5SA 3O86A 3Q1CA 4WMCA 4XK8F 1YSQA 3UGJA 4XT2A 3KSJA 3QNBA 1IXSB 3PVSA 1LOYA 1P0ZA 1GY6A 5DFLA 3GV9A 1CYUA 4JXGA 1KE0A 1QVG2 2AADA 2N35A 5CHMA 1DO2A 1XPBA 2WKPA 3J7BA 4BBAA 4D82A 1JZDA 1YLAA 2C99A 3EC9A 3EQQB 1F2KA 2HDRA 3LUQA 4DJ2A 4X65M 2QP9X 4GL6A 3SATA 1YVSA 3DGMA 3LYGA 3MHEA 2INWA 3BRMA 3WWXA 2EXBA 2CK3H 4ZBEA 3V3RA 4CDLA 4LV1A 1VQL3 2GEYA 1LOVA 4S2MA 3MMPA 1QMEA 2XF3A 1T43A 2QEX3 3K1JA 3CJMA 4IEDA 5KSHA 1R5LA 1B3SA 2H5SA 3U1WA 4JBFA 4O8SA 1RGGA 3VFDA 3F92A 3L27A 3EJVA 3DTKA 5ELJA 1TEMA 2CFOA 4GKKM 1J3WA 1G68A 4OW0A 2K6BA 4LRYC 2Q9NA 5ELUA 4LGYA 4Q0HA 3PAEA 1R4GA 5EP3A 4LV3A 4B4XA 4FCMA 1W8YA 2LB5A 4IVIA 5D83A 3N8SA 2HMNB 2ZL1B 4BBVA 3ZGAB 5BVBA 2EUCA 2OCTA 5IWAM 4OVDA 4AFIA 2C6WB 2JQ5A 3HUNA 2EWWA 4JI6M 3RH8B 1O7HB 3H9WA 5JBSA 3ZCBB 4GNUA 3T4KA 2O25A 2KZSA 1G8PA 3FUXA 4P16A 3RGAA 2CHCA 5EOEA 1PY3A 4EWFA 1AUAA 2JUJA 7CATA 3EQUA 3IPTA 4JXWA 1PM5A 5HGRA 1VQ93 2KHHA 5TFQA 3PBSA 4AW4A 5GLCA 4C3QA 2H28A 3MZFA 3MKEA 1L3LA 3GWRA 1A5TA 1MC0A 2J3TC 4FUWA 5KP4A 3VMAA 1CK3A 1DGBA 5FASA 3B74A 4FVMA 2FFFB 3JUMA 1NDOB 4EC6A 3F1PB 1FSYA 1BNEA 3BIRA 4MNRA 2LHGA 1EG9B 2JNHA 1I3IA 5AI1A 1AVLA 3BQ8A 3QP4A 5IENA 4MN7A 3CLOA 3Q7VB 3SARA 4UQIM 3DGOA 4QWTA 1G5UA 2B95A 2W0NA 3DBAA 3NM7A 1H5XA 4DV0M 2CV1A 4HH3A 1TTOA 4Z1WA 2PHYA 2Z4RA 3S4XA 3E0YA 1RNTA 1J2BA 4R7GA 3GDIA 3UNWA 2BU4A 1KSIA 4XBOA 4ZJ2A 3Q90A 1GJTA 3UB9A 3EBYA 2KAAA 1YJN3 1CEFA 4L9FA 3V76A 1BUJA 4E3IA 4LFUA 4HL4A 4LLOB 4KZ7A 4KQOA 5ITTA 4G3VA 4MH0E 3B4PA 3OXAA 5ITQA 3J27B 1SARA 1OKSA 1S3SA 3WRTA 4DBGB 3J7AS 1L0FA 2GDNA 1HQCA 4ME4A 2ZANA 4GRIA 5LBRA 1Q02A 4L9GA 1RP5A 3UL5A 2ZQCA 3X40A 3CWFA 2KEBA 1WJ7A 2P9VB 2R41A 3C30A 2B5RA 2EJSA 3S7PA 5IS1A 5DREA 3GLGE 1Y4OA 2BTFP 3I4YA 3PGBA 1LNHA 1K28A 3NCKA 1P9WA 1LLBA 2V1UA 2EWVA 2Y2PA 1E3UA 4Q53A 3FZCA 5HD3A 2D7EA 2QNJA 4HP4A 2UUBM 3ZG5A 3VP2A 1NLZA 5CGWA 4D60A 3D3LA 2Y79A 3MHVC 4Y3IA 4JI2M 4RBNA 3CC73 2WOFA 5KP1A 3HLCA 4I4KA 2P74A 2FGTA 1SXJD 4R71A 3HX8A 2WUQA 1CI9A 1I2WA 1HYFA 1EFUB 1GABA 4H3UA 2PYRA 2XDMA 4NXBA 5L09A 1NYMA 3KSED 2GX5A 2UX0A 3VGNA 4WP2A 4ETXA 3GPUA 4JI8M 1XA7A 5U47A 2R4IA 2WZXA 2ZC4B 2CWVA 1R4CA 1NV9A 3C7UA 3NY4A 2Y91A 2EO2A 3KW6A 2JKRM 4A5RA 4KO8A 1R6BX 1FGRA 3M6BA 1IYYA 1CQAA 2XSOB 5HDSA 5CXWA 1YLWA 5GSPA 5KPRA 1LVNA 1ZC2A 1LNIA 1FCMA 2JKGA 1OHSA 2AHMA 4FMDA 3RFBA 5BR8M 2CFGA 1K734 3FUTA 2V6ZM 5J3WA 3HGIA 4RNTA 1X1XA 1IKGA 3QP1A 1JKGB 4WELA 2VK3A 5IG3A 4M9XA 1QYRA 1N33M 2OOLA 3NWLA 3A45A 3IXBA 3LIBA 4NK3A 2K3DA 3SX1A 2R4EA 5AQBA 4MCWA 1MU5A 1W5ZA 2MC8A 1IDPA 2H0TA 2KF4A 3U6DA 3UPPA 2L2DA 5EVLA 1ASKA 3FV7A 5KIZA 2HDUA 2G3QA 3BXWA 5EP1A 1LTMA 2WGWA 4LV2A 4R0QA 2SBLA 3TE6A 4I81A 2ZLYA 4FWDA 1A0KA 3EIEA 2DZLA 3C3DA 4WUJA 5FDSA 3DTEA 4CLCE 4B3SM 4JI3M 1RGAA 1H8MA 4FH2A 3KSFA 4X2OA 3MR0A 1PZPA 3EBTA 5FSWA 2ZM6M 4JGQA 1BIRA 3CU3A 3IBRA 3D72A 1OH0A 1UI8A 3GZYB 3W4QA 1RGKA 3KOYE 2XFTA 2V0UA 3L26A 1KDWA 1JWPA 2Z2LB 3F1NA 3RTYA 1BNRA 5JYPA 3CF0A 1J7KA 2GXFA 4WM9A 3CCQ3 1ES5A 4D2OA 3M7GA 1JB2A 1IVWA 1XJ2A 2HZ5A 2BWBA 4DR1M 4LMIA 2KDLA 2ZC6B 3IH8A 1SJWA 2H0HA 1UM8A 4LFAM 2JBFA 3VSLA 1MWTA 1X1UA 2OSUA 3GRRA 1ZX2A 1OF5B 3ZQJA 1ES3A 1T1BA 1RCLA 1OMEA 4LJ8A 1D1JA 2IWCA 3UN7A 5IF6A 3BEBA 2ZMFA 3K5TA 3GZXB 2OAQ1 3G6OA 5IHVA 1N77A 2HV1A 3IWIA 1IBKM 4R4RA 4S2PA 3NC8A 3RNTA 3LCEA 4OOMA 1NY6A 3JAMS 1C7YA 4JI1M 3AOGA 3AL0C 2WYXA 2J7NA 2M7VA 4RVAA 3JVUA 3NX0A 5DF8A 4FTXA 4KLNA 3G31A 2OV5A 3X3XA 3KX0X 5GLDA 3MZDA 3ULFA 3S29A 1TDLA 1NRJA 2ZAOA 4X68A 2XK1A 3GO8A 4YOFA 3GLIE 3G8ZA 2WK0A 4QY6A 3GLFE 2INXA 1GA0A 1BU4A 1UCKA 1KGEA 2I7NA 1IYQA 3F1OA 5L8MA 1K4EA 3LCVB 4JRFA 3I51A 1KGFA 4HHDA 1XJ4A 1E94E 1M1K4 4B7GA 3RGRA 1V9YA 2W56A 3WS5A 2QJ5A 2VF8A 1BTLA 2BMRB 3WA2X 4FMAA 1N75A 4X6TA 5JI2E 3T38A 2A2LA 1OHPA 1MGWA 1FUTA 3U6LA 2EA0A 4KQQA 3BBZA 3GLGA 1RJOA 4GC9A 5A0OB 2MH8A 2JY7A 4E3NA 4N6MA 2HL7A 1BSCA 3CPTA 2LQVA 4L6V6 1SPUA 4LFBM 2ZL1A 3BWLA 3WS4A 4E3OA 3SYKA 2IA7A 1K8A4 5FQIA 4LF6M 2C98A 4IBEA 3S7NA 3TSGA 4S2NA 2HHHM 3AMOB 4ARZB 3LTCA 4JI0M 4IBGA 4RKUF 2PAVP 3BYDA 1XNRM 3BFEA 2HDSA 2L4RA 3DAVA 3P7NA 5GL9A 2RSXA 2HAKA 4STDA 2DENA 3DWZA 3CCE3 2WSEF 1DYUA 3VP3A 1XFQA 1SDNA 2W6JH 3PHYA 3FYDA 3IHPA 1EE8A 2Z7AA 5KP3A 2WGIA 1OIZA 4ETZA 4KZ3A 1N8R4 2KW0A 3C8CA 3VDUA 4L16A 4DR5M 4OONA 1FGQA 3ZC7B 1OF5A 4R23A 2J9OA 2DWMA 2F5OA 3K9OA 2ZBKB 3UE0A 4G1MB 2BLSA 4K1VA 4B88A 1Y54A 2CFKA 3ILKA 6GSPA 3HJ8A 3MXQA 4MGKE 4MEIA 3MMHA 2HPBA 2QHOB 5HAIA 4ITQA 3BFCA 4G4RA 2Y2OA 2XLJA 1N9EA 3JPUA 1ROVA 4HM4B 2WSCF 2G7UA 3PBOA 2V2FF 2W82A 2HMKB 2CV0A 4EU0A 2Y59A 3VV4A 1Q42A 3LIEA 3A0VA 4I39A 4RA7A 1QUSA 2CH9A 1OT6A 1UUVB 3LCUA 3MKFA 2XSZD 4KZ8A 4B9OA 5EV0A 1Z59A 1W8QA 3HHZA 1PNEA 2P38A 1D6UA 4IJGA 1Z1SA 3Q82A 3LEQA 2Y2QA 1SQWA 1ZMVA 5ITXE 3LTBA 5IW9A 4CHTB 4EXOA 2X02A 5HPIA 3LR4A 3HHXA 1YLPA 3GPXA 4PM6A 1E3UD 1N5PA 1DGFA 1PIOA 1K54A 1IBMM 2V1LA 5KO3A 1WNHA 1U60A 3U61A 4M9ZA 2OQEC 1L5GB 4Q0JA 3G16A 1BSBA 4L8OA 1AQZA 1RU3A 4EW7A 5IU1A 1RRLA 1UCJA 3D5IA 4BTWA 2H10A 4OLGA 4B93A 2MJ5B 1MNLA 2D02A 1G96A 4DV7M 5CX7A 3LR0A 3OW22 1P97A 3SVAA 1K55C 1PFLA 1NSFA 1ORYB 3LIDA 2ZQDA 4X25A 1Y8GA 1OT9A 3JUOA 3WMDA 3G4S3 2KA6B 1PI4A 2ZQAA 3FKWA 4HP9A 2UXDM 2WGQA 1XXMA 1I2FA 5IZ7D 1OGZA 1ULJB 1GS3A 3CCM3 1TDZA 3U6EA 1UCIA 1OFHA 1GOVA 3T4SA 2V0WA 3NOUC 1TF0B 1WQLB 1X1YA 5DF7A 3R7WA 3HCYA 3K92A 4LZIA 1OPYA 1FSWA 3TOIA 1T18A 5AEUB 1OGXA 2VA0A 3VK8A 1U8CB 2IUJA 2OLVA 3R8FA 1RGYA 1O7EA 1ZV1A 1GSPA 3GP1A 3EGDC 2PT7A 4FD2A 3CNMA 3ICYA 2W04A 5HWWA 1XGJA 3LYXA 3IH9A 3BFGA 2QQ8A 3SBJA 1VQN3 3MSHA 1GJSA 2QSFX 3HHWA 4N1XA 5L07A 1ZKJA 2Y2IA 4G6ZA 4IBCA 1H8YA 3RDEA 2DWNA 3NOPC 4DDSA 1IBLM 1VDLA 2O9AA 3M2KA 4BL2A 4EESA 4JGPA 4EXRA 1L8QA 2GJ3A 2JKTI 2KNZA 2OWHA 4R6LA 3SZTA 3W68A 1JV2B 3LY3A 1BLHA 3PNVA 3WRZA 2ZC5B 2UXBM 2XZFA 3CI6A 4JF4A 4XXRA 5AVEA 3PBNA 4JI4M 1UGUA 2YFJB 3E4RA 3VKGA 4D80A 5M19A 4TUWA 2Q9MA 4DJ3A 1U5OA 2RKOA 2XRXB 1QVRA 4BU4A 3Q2PA 1UCLA 3BJNA 3H7WA 4ILFA 4LJ9A 1PFPA 1UGIA 3HLWA 4CLCB 1UW1A 4ZM8A 3VSKA 3AV0A 1VQM3 3X3ZA 4NOOB 2PNCA 1YIT3 4DE1A 1Y28A 3DMCA 4CGYB 3N8BA 5DRVA 3CCU3 3A46A 2K2NA 3DXOA 3KKGA 4WYKB 2XH9A 1AR0A 3IG5A 3CD63 4PM5A 3U6OA 1US1A 2F5MA 1W6YA 1FR6A 3CG5A 1VETA 5IEPA 1RGCA 3OLOA 1YAXA 1VEGA 3VFFA 1E3VA 4LSOA 4L15A 2VQFM 4QHTA 1YSYA 3HU3A 3DY5A 3BY8A 1GLNA 5C18A 4PM7A 2WAFA 1W63Q 4BD1A 1Q40B 1NYYA 1EEJA 1YLYA 3CMA3 3D3OA 4ARZA 3HZPA 4K61A 5DFYA 2ZTCA 4FD8A 1JRQA 4PKYG 4PAUA 4EQIA 5BXQA 1DE3A 4AKGA 3GQ5A 3W2ZA 1V92A 4FCWA 1HU9A 1S6RA 1YMXA 2B1XB 5FQJA 2O5RA 2R65A 1L2BA 2PD8A 1CF0A 5IG5A 1MY8A 2QBYB 4WLAA 4EYCA 4HZBB 4WURA 5ITYA 1K3WA 4CIZA 4HM6B 2EX2A 5F82A 4NETA 4A3VB 2Z77A 1V58A 1YI23 4QU3A 3MQ0A 4Y0UA 2Y21A 4AEQA 3D9RA 3EN1B 2CHQA 5EUAA 2HMJB 1JVJA 5CK6A 2Y20A 1BVIA 4S2LA 2LVNC 1XWIA 4KFFA 4H61A 1TVFA 1VQ43 3RXWA 4RYEA 3KOZE 1MWUA 3OX9A 2J8YA 5TBMA 1L1ZA 3GRYA 3ISGA 3ITAA 5FAOA 3H82B 2X01A 2W56B 4LJ4A 4Y15A 1T1CA 4OOYA 3UPNA 5IT9S 1QAMA 1NWZA 4KG6A 3V39A 3R4KA 4Y5FA 1JN5A 4GJ4A 3ZG8B 3VDPA 3SHFA 3R9XB 3UDIA 5F69A 2WADA 1SKOB 3PTEA 2EXAA 4MMNA 3FE3A 4EBPA 1NJGA 4HAAA 3DA1A 1YT4A 4M0DA 2GNOA 3MJQA 5A90A 2CP8A 4NKPA 2OWJA 1W79A 3U5ZB 1KWIA 3ZHHA 5CF1A 1IEMA 5FQQA 2W27A 1QQWA 3KS4A 2CX1A 4WYKA 1XGIA 2ZOHA 4K08A 1IXSA 5F1FA 3PYJA 2LWXA 1BRIA 1JBTA 5GHYA 4EUZA 5F3WA 4IT7A 2L1MA 2M7OA 1AXBA 2CFDA 3CUEA 5FW5A 5CEDA 2UV0E 1YLTA 5KPZA 4NREA 3L29A 4IUKA 1GYBA 2QHKA 2Y2KA 3E4OA 1OFIA 1L0GA 2CWUA 1OJLA 3ZFZA 1K25A 2LH0A 3GTCA 1TH2A 2KLIA 5TGFA 3EN8A 4AKHA 2ZOIA 1PJTA 1XNQM 2CG0A 3ZYTA 4FCFA 1BVSA 4QD4A 1E97A 3CHWP 4J5GA 4JF6A 3MZEA 5D3OA 3PNYA 1RGFA 3ZQ5A 5FTKA 1BANA 1RN7A 1Q7Y4 4K0WA 2RGHA 2V20A 1LV7A 3HI7A 4KQRA 4GHAA 4DV6M 3A76A 4GSPA 1BZAA 5E2EA 2FZ0A 1FUSA 5EVIA 2Y8HA 4WEJA 1VQ53 1TS8A 2W1TA 4OVZA 5EXTA 1YGEA 4LGQA 4M4XA 1A90A 3G6E3 3H4MA 3U60A 2OO9A 2BHMA 5DF9A 4O01A 2OOVA 1IFQA 1UWPX 8CATA 1NY5A 1ESIA 3T15A 2O9BA 3T1RA 1FGOA 5TBMB 1Y4KA 2QKPA 4OQHA 4Y28F 5LMUM 1Q39A 2F4YA 3HIGA 4EUVA 5KMWA 3HVFA 1VZZA 4G3KA 3V3SA 3URPA 3O87A 3WDGB 2UUAM 5CLKA 3MK6A 3FF2A 3R7WB 1R7RA 1K6SA 3BU4A 3Q1FA 4MMYB 2W1RA 5HAPA 1VHMA 2L7HA 3QYBA 2ZA4A 4MDZA 5F1GA 1CYVA 2DMWA 4FSFA 3E2KA 4XBXA 1I4WA 3FPWA 4R1GA 1H8ZA 1MOLA 3VP0A 2BMQB 3SAUA 2DZOB 1OTEA 4GHIA 3JUQA 2OPFA 1YIJ3 1RNBA 3U2AA 1JBRA 5HWTA 4II7A 3SOYA 3A3DA 2Y2GA 4RNZA 2BNGA 4ORLA 3KS8A 1A2KA 3PFIA 3OPHA 3KP1E 2W9PA 3HK4A 4YINA 5FI2A 1FGMA 3CXC2 3Q81A 2ZQ7A 1GKIA 2AAEA 3EX9A 4BLMA 4WN5A 4R4SA 4MBFA 2VGLS 3OWUA 1IY2A 3AGDA 3KOWE 3C5AA 3W0LB 2RRUA 7STDA 2L6OA 2OLUA 1RCKA 2ZM2A 5AYRB 4GKUA 1IOUA 1XXHA 4G4OA 4GC5A 5E2GA 1CQSA 4WWUC 2WKQA 3U97A 3N8LA 2Q2EB 3OPPA 3UJNA 1S67L 1JR3A 4LF7M 1EWZA 5DTSA 3UB8A 2GSPA 1K56A 4XBTA 3IWQA 1DETA 3M0EA 4XB5A 1YQSA 4KENB 4NRVA 1B27A 2QWSA 3QWLA 1DP9A 5CGSA 3ZVTA 3MS6A 2V1CA 1F4IA 3S5CA 1BYWA 5L2FA 3T4LA 1STZA 1N78A 2CFLA 1RRHA 3CAXA 3IECA 3FYZA 2OOBA 1N34M 3FCSB 4HOHA 1D0KA 3K3DA 4OH0A 3UE6A 1NNUC 4H8RA 4OPRA 5HW3A 2XGNA 4I3IA 1VM1A 4N6LA 5LMNM 2HP6A 2J7OA 3AJIB 3E4QA 4DN0A 2ZM0A 1NHGC 2ZTDA 2FH5A 1IKIA 3MSOA 1KE4A 2PDRA 5CTMA 1SIIA 5EM1A 1IQ8A 4HESA 2W03A 3HJQA 1OJGA 3QP2A 5BPVA 4FMBA 3AGFA 3QNCA 3PS8A 5RNTA 3HREA 2CV2A 2XR8B 1W63M 3BNEA 3UL6A 3GQZA 1DJBA 2KOIA 4IBBA 2W3GA 3KCHA 3DFZA 2R4JA 1YMSA 4NXFA 1E9RA 3QYEA 3A0RA 2L0WA 1UUWB 5IG4A 1GA9A 4R9KA 2I9WA 2ZC3B 2EA9A 3CCR3 1BUEA 2C96A 3LR3A 4HVNA 1W5TA 3IS2B 4PM8A 3NDGA 4GB7A 1SCWA 4Y0OA 4R80A 1PWDA 2JY6B 2UWXA 4PMAA 4HEOA 1TUHA 5TJJA 3S7QA 4BBTA 1HNWM 1HKXA 3A0SA 4GHIB 3B4OA 4RQ9A 2CMNA 3L0RA 4HYZA 3CITA 5F83A 1KDSA 1PJQA 4AKZA 3SC3A 1LSVA 1W7CA 3FLJA 4DV4M 2F5SA 1R2YA 2WSFF 1S1ZA 4I8OA 2KF6A 3KFQC 1HD8A 4GCZA 1A2VA 1IQXA 3SW1A 3FPVA 3PZWA 3NHQA 5HD5A 4GH9A 1RLSA 1G41A 4GD6A 2JA2A 4DR7M 3P09A 2C9OA 3IF6B 1RGZA 3PCRA 4OPQA 4F2LA 3O3VA 4LJ5A 3JR5A 1QAKA 5DVAA 2FH0A 1N9OA 1QAFA 2Y2LA 2JHEA 3SAWA 4O02B 4IUHA 2EX6A 4UQIS 4FWHA 4DV3M 3F1OB 2F56A 5FI6A 1G6OA 1VB6A 3HBRA 3OCLA 4KZ1A 2CC1A 1AVKA 3HWSA 1K55A 2X49A 3ALAA 2H5XA 1ODVA 1HT1E 1I3FA 4XT2B 4PCZA 4B7HA 4HM3B 5KQDA 3KO6A 2LYXA 5FSRA 4MB7A 2PBYA 2UU9M 4WL9A 1DMMA 4QOZC 2Z3XA 1IVVA 1PRQA 3VK7A 2UXCM 1XMOM 1WMOA 3IHBA 4N9KA 3NIAA 2JKRI 1BRNL 3KSPA 3K8ZA 5F68A 4GMQA 5EXSA 4AG5A 1L0DA 1K9M4 1I94M 4UA7A 2LNHC 1NZUA 2WZJA 4F3LB 4Y2FA 4TX4A 3SS3A 1MZUA 3S67A 4MBKA 4L8RC 1K0KA 1YKDA 3T50A 4WBGA 3DTIA 3IS2A 3IX8A 5IREB 5FLXS 3LTAA 3TQSA 3GLIA 4GS9A 5DYIA 3Q7VA 2Z8YM 4WYYA 2X4AA 1E3RA 3NBIA 2YKHA 1WMPA 2VJWA 1RHLA 2YQZA 1KC84 2J3WA 2K0MA 2DAGA 3B7NA 4H6JB 4JF5A 4ID4A 3SYUA 2P05A 2LVAA 4PPRA 1BRSA 3SMSA 3D79A 5EVHA 3UDFA 5IERA 3HJIA 3S27A 3GPYA 1MWRA 3LT8A 4K90B 5I97A 4BLCA 2YFQA 1HVBA 4EIWA 4O2HA 5IG0A 3G4PA 2CWTA 2ML6A 5M1AA 5E6JA 2P5TA 5L10A 3PAGA 3L9KA 1PZOA 1GL6A 3ZH9B 2MR9A 3QP6A 4LF5M 2XSHB 1P9RA 4Y7PA 2WKEA 3U6PA 1WR1B 5AQ9A 1S0WA 1PW8A 3SMPA 4HNBA 4AKIA 3CPW2 2GU1A 4HM2B 3EQVA 4G4NA 1S723 3C4OA 4O0PA 3DZDA 2R0IA 2Q0OA 2RBIA 1FR1A 4X56A 3L25A 1LI0A 1G71A 2OWPA 5ITRA 1YJW3 3LIFA 1W4NA 2C4BA 2V8CA 3NJAA 1XP4A 4E3KA 1LL5A 2RNTA 1D6ZA 2Z6BA 5DJUA 3V99A 3HY5A 4W5WA 4NSRA 1XX2A 4OP5A 2PD7A 3KYEA 3U6MA 1V34A 3N6IA 3VF1A 1S66L 4E3MA 5EP4A 1B2UA 1EIJA 2D7GA 5FATA 2P08A 3LVVA 3BQAA 2I9VA 3GQ4A 3HKPA 3B89A 3QP8A 3TRCA 3D8LA 4HJ3A 4KZAA 3LQRA 2R44A 4DUYM 1MWSA 2I72A 2ZM8A 1SXJE 4WHAA 3HU2A 3C38A 1BULA 4IVKA 1VDDA 3K9MC 1GOUA 3LFVA 2NQ8C 1LL9A 5AEWB 1UGHI 1TS7A 4KG5A 4LV0A 3CF6E 3PBTA 4GD8A 1MKIA 2C11A 1B2SA 1A2PA 1BSDA 1M904 2HF6A 3GLFA 2VGKA 4EV5A 4MGIE 4B3TM 5G4YA 2QGUA 2HOHA 3JUNA 4N6V0 1ISKA 3GLIB 1NHWC 1W01A 4P6ZS 2RFRA 3LZAA 5DNYA 1L2DA 4I4LA 3IF6C 2D01A 5DKKA 3IX4A 4UN2B 1H3QA 2OQEA 1E32A 2OTL3 5STDA 1Z09A 4QNRA 2O01F 1B2ZA 1BUQA 2ZDJA 5AIFA 1SKOA 4N3VA 3KSIA 3ZG0A 1MN3A 3NOTC 3W0FA 3UB6A 4KHPM 5BIRA 2V1BA 1XKZA 1BLCA 4DR6M 3IMAB 1V57A 3PXMA 4EBLA 2BT3A 5FA7A 4L8PA 2D7HA 4LJ7A 1OAIA 3IQAA 3PR6A 5HARA 2FFJA 1J5EM 1WMNA 3SXXA 5EVIC 2BWEA 3G713 1L1TA 2FFYA 2GBXB 4IBIA 3UPOA 1G59A 2KZUA 4DE3A 4GDBA 4M0WA 1GY5A 3T0UA 1OJ5A 3KYQA 1KOUA 1M40A 1JTDA 3NDEA 4R9LA 3FH1A 4JXSA 1IN6A 2A3UA 2Y73A 2WAEA 1VQQA 3KSHA 3CGWA 1YLJA 1GHPA 1YE9A 3FD9A 2FNQA 1BRHA 1SZVA 1IY1A 3JR4A 3FG4A 3Q3FA 1SXJA 4EBNA 5EPHA 2RCDA 1ES2A 4KZ4A 5FAPA 1RCJA 1FNNA 1JB0F 1PWGA 3EEHA 4B4ZA 1K56D 4MN5A 5FTJA 4HBTA 1LXEA 4LZJA 1TJDA 4L7KA 3NBXX 2O3OA 3K0ZA 2IA2A 4HY8A 1SHVA 2OQ4A 2H0IA 3T4QA 2VZWA 1YGWA 2F99A 4AQYM 3VE3A 3UZUA 5GKNA 1FQGA 2APLA 2Z76A 3RFWA 4HJ6A 1OTBA 3O5YA 3PBQA 3GLHA 3ER7A 3KN4A 3D4FA 4X64M 4NRWA 1CI8A 2VEAA 4PM9A 3NBBA 4WZ5A 2VGJA 1ACFA 1VETB 3TJZC 1N36M 1DGHA 3B7CA 3DGLA 1S4RA 2F86B 2HCBA 1NU3A 2ZQ9A 3HL9A 4HH2A 5FQKA 1QZMA 3F8XA 1TTEA 1HNXM 4PT5A 4IBXA 5J7EA 1DJAA 3J80S 1A67A 3GLFB 2E8IA 3HZJA 2JZ1A 1DMQA 4I3AA 3OCNA 3CPOA 5ITXA 3EF8A 3RXXA 3DWKA 3DH2A 4MEZA 2I7PA 4JI7M 1BSEA 2XROA 4AKYA 5IT5A 3PBRA 4GDNA 1QMFA 1AY7A 1D7EA 4N6TA 1GD3A 2O9UX 3EOIA 4HJLB 2X71A 2J8XB 1PRBA 3OWYA 1ONHA 5BOHA 2VV7A 3UMEA 5FDHA 1YPRA 1C54A 2XQZA 5GLAA 2VLGA 4LEHA 1JR3E 2Z6CA 4OX9M 4LRXC 2M60A 1TS6A 2PR6A 4HBUA 2K7SA 1NV8A 2BJWA 4I38A 3BFDA 2QBYA 1O07A 4Y0TA 1XXHE 2JY5A 2M5ZA 3B7ZA 4HKVB 2VV8A 1SXJC 7GSPA 5FTNA 1VG5A 3CCJ3 1NRFA 2LB9A 1K41A 5F5YA 2VQEM 3K2NA 2JDIH 2B18A 1KD14 2K9DA 3HLGA 3D5GA 4JXVA 2CX0A 4OLDA 1K3XA 1K54C 1XXHB 1MPLA 4BB9A 4Y17A 4FOFA 5EVEA 4B3RM 3SH8A 3UE3A 5FEFA 2CKFB 3WS0A 4P6ZM 3Q07A 3GMWA 1YVBI 3G30A 4ZTKA 3BLZA 3NXJA 4D81A 3A3JA 3M2JA 5K5BA 2R45A 3C3EA 3SS4A 4NXGA 5DYGA 4WF0A 2XFSA 2Z6DA 1IM2A 2Y0TA 3VLFB 4DE0A 3WS2A 1BAOA 1NB5I 1N32M 4BTXA 3AGNA 4HZ9B 3DTMA 1RKYA 1N9LA 5FTLA 3LR5A 1W5DA 4P0MA 2PRFA 4QNMA 3LOYA 2K31A 3BB9A 1HLUP 3LI8A 2JZ0A 3AGOA 1WIVA 2CHVA 5ITUA 2JE5A 1IN8A 4E04A 3JUPA 1EQKA 2QYBA 3ZCZA 4PKYA 3KZTA 4EEPA 3FUWA 1LI9A 5G4ZA 1DP6A 4IJFA 4LCLA 1CUKA 2X8AA 4L4UA 1BLSA 1NNJA 5D82A 3LQQA 1HT2E 3H7WB 2HMLB 1D0LA 4GKJM 4E6WA 4KT3B 4DMZA 5CGXA 2J7VA 2R78A 3IXHA 2CRUA 1ES4A 1O7PB 4PDGA 1RDSA 2DVWB 1Z5BA 3SASA 5A91A 3F1PA 3GLHE 4LGWA 5HPFA 4R3AA 2JKTM 1Z6TA 1E9SA 4Z6YA 3T8UA 1UDII 4JLFA 4JF8A 4OK0A 2G5GX 2HMMB 3ZG7B 3OWSA 1PI5A 4DR3M 1PYYA 1FIKA 1FGTA 1Q824 4JI5M 4IBJA 5G18A 4GOGA 2PBDP 1BSGA 4LCBA 2Y2NA 4EV2A 2KRKA 3A5EA 4DR4M 2EKKA 3VKHA 3DGNA 2DI0A 1G02A 4ANRA 1F98A 4EQ1A 1FCNA 2QIYA 2BIRA 2QCUA 4MMXB 1ZG6A 5EVIB 3UDXA 3MG3A 1TP6A 3B33A 3PXPA 3KSGA 4OQGA 1VQ73 1ALQA 2KDKA 3FG8A 4R38A 1PJIA 1VQ1A 6RNTA 3D8BA 4DV1M 4OP8A 1TGUA 1STFI 1ZAEA 3F7XA 5J4EA 1IV9A 1JTGA 4B7FA 2K54A 2P7JA 5AQ7A 2DZNB 3CUEC 3MXRA 1KE3A 2RL3A 1FOFA 4FCVA 3CTWB 2PU2A 3HUMA 4YWZA 4JV5M 4PHTA 5E26A 3PYPA 2DXIA 1TS0A 5EP2A 3V5MA 3TL4X 3MBZA 3H51A 3J7Yd 1N9NA 1TH3A 2F98A 2DAEA 4Y13A 2QPAA 3FKEA 4N1HA 4GEWA 5HX9A 2KX6A 3AOEA 1IVXA 1F8NA 4KUKA 3BNCA 4S2KA 4FCZA 4G3WA 2B3TA 4IJEA 1OACA 2BG1A 3VOYA 5G2GA 2E8JA 1W7FA 2G8LA 4P85A 2C5RA 1DY6A 1EKMA 1DVDA 1WA9A 1TH4A 1M1XB 1S5AA 4WFOA 2QJ7A 2CWBA 3SHGB 3SS5A 3P98A 3J2PB 2JY8A 4KUOA 4RF0A 1T5YA 2FOIC 4KVHA 2HP9A 4RX2A 3ZDJA 4I5SA 1NVMA 4E3LA 2D42A 1KYIA 4MJDA 3LI9A 3FTEA 5JYOA 1K82A 2FS1A 1RMSA 1JR3D 4EETB 1NO3A 3STDA 4LG2A 4CPKA 2PZVA 2L4VA 1FJGM 3KDSE 3FZWA 3J81S 3CZDA 3KIIA 1ESUA 1XA1A 4OQ0A 2DCFA 4XGIA 1T2HA 1B2MA 1NLYA 3KVWA 1GOYA 5CXOA 1I2EA 1X37A 1O7NB 3CC43 4S2JA 4LJ6A 5AVFA 1NJI4 4DV2M 2DNSA 3VOLA 3WHOA 1J9MA 3K3CA 2RGQA 1AIPC 3B47A 3GRVA 3EWKA 3D4AA 2IMJA 2H0GA 4R3BA 4AG6A 3L7HA 4U3TA 4IIWA 1XHBA 1TD5A 2BMOB 3NV0B 3BNBA 1E4DA 5HFOA 4OUQA 3HX3A 5EQTA 3LEZA 3QAUA 4XM4A 1PWCA 2QENA 5F6AA 5AJGA 4IBRA 3CC23 4M3KA 4LZZA 2NUPC 3E21A 1EI5A 1IU7A 3VP4A 4MMZB 4HBRA 4BENA 3U6CA 3UY6A 4K1UA 5HL1A 3RE8A 4KT0F 3LMLA 1QAQA 4FW9A 3CF2A 1GSXA 4U0XA 1G0TA 1IN7A 2XA7M 2C5WB 2W3DA 5EXXA 3VP1A 4KZ6A 3M8CA 3B8LA 9RNTA 3SOIA 4L9EA 2XZUA 5DKLA 1WTHA 1XMQM 4HOIA 1BNSA 3E98A 4QHSA 3WOFB 1GHMA 3HLFA 2JXNA 4QOSA 1SIHA 4HLQA 4ZAMA 3ZVWA 1W6GA 1OAOC 2J80A 2C10A 5TR7A 1TU5A 3OZHA 3I04M 2QA43 4AI6A 1YM1A 3Q8GA 1LRAA 2HDQA 2KRTA 2JN7A 1DGHB 5FL3A 2EX8A 4R1KA 3GRDA 3FSDA 3MFXA 1WGLA 2DAIA 3N8RA 4KZBA 4UA6A 3RJUA 3BM6A 1F9IA 4KZ5A 3IT9A 2WKHA 3FG3A 4JPMA 2VF7A 5A2QS 3AOEC 1N9BA 1IXRC 3F40A 4PDIA 2JCHA 5E2HA 2C9CA 4R3JA 5FQ9A 3IJEB 4IIAA 3IBJA 4DR2M 2HJ9C 4OPZA 3TWKA 4NXNM 1O7MB 4XBYA 4HEFA 3MF0A 4NG2A 4QJGA 2Y55A 3ITBA 2XGLA 1P3QQ 1Q3CA 2KCDA 4XDVA 2AVXA 5FTMA 1N4OA 3ZNYA 4FMCA 4NEED 3TWLA 3LMMA 4IBKA 3F7SA 4O3VA 1KVLA 3NBRA 3CME3 1HZ1A 3FTCA 4G4QA 4X2HA 4LF4M 2W1TB 3NQZA 2W0QA 1STDA 5L8RF 3H4JA 4NHFA 1OTAA 4N92A 3A3FA 5CEBA 4X1LA 3RGSA 3DZLA 3TWMA 1IELA 3IG8A 1IN5A 4QHCA 1M6KA 2XSZA 5EECA 3C58A 1GSWA 1V74A 3ZNTA 3UNLA 4KG2A 1JNQA 1GMRA 2E5LM 3FRIA 1VEKA 3EIHA 1W02A 1PYLA 2YX9A 3B9PA 4WZ4A 4HI4A 3CCV3 3HUOA 1D2NA 1GD4A 1WGNA 2IY2A 4U13A 2PR5A 1HZOA 4ZDXA 3NM2A 2R18A 3NBJA 2MF7A 2QMIA 5GHZA 2KXGA 2L4FA 4DE2A 3VFHA 4MM3B 3DUKA 1QUTA 2YNMD 1T19A 1IT8A 2XLNA 4H6JA 4G3OA 4GS9B 3JYIA 1KFVA 3DGYA 2R6FA 1IV7A 8RNTA 1OTDA 3FC7A 1RGEA 5JPUA 1FZUA 3FF0A 4CLCA 4AZFA 2ZBBA 4P87A 4DUZM 2F5NA 3D9YA 3QK9A 4P17A 3QP5A 5EFWA 3HJKA 3DOAA 5CF2A 1BRGA 5HWVA 2O99A 3OTOM 4CQHA 3HIIA 1W2B2 4LY6A 5EOOA 1HTZA 1IXZA 4FCJA 4DRTA 2ERCA 1BSAA 2KNAA 3AKZA 1D06A 4U0TA 1FCOA 1RN4A 3UJMA 1MGRA 3QHYA 4BD0A 1J09A 1TF1A 2P9VA 4X1MA 1WYCA 4HM5B 4O8GA 1OHOA 3T8NA 4GHOA 1AV4A 1YLZA 4LRTA 1Q814 3FKVA 1LT0A 1ERQA 4FR9A 3K2LA 1QDTA 1Q2PA 5H37D 4KFDA 1ZQ9A 4OOLA 2P0XA 2YFLB 5DTTA 4IHQA 1RGLA 3O8YA 4ESPA 1IYOA 4BWIA 3HOHA 1IQYA 5TGNA 5JPPA 3AGEA 3NHXA 5FI7A 4MN6A 1HJPA 1IK3A 1JZOA 3OC2A 4HJ4A 1FILA 4BBUA 2UGIA 3DM8A 3T1XA 3G0KA 4WEKA 4GLQA 2A15A 4BIRA 3AMOA 2V9AA 4GZBA 3MXSA 2LVPC 3HU1A 4RNYA 1NXYA 1ZGXA 1DP8A 1N9JA 1BNFA 3LY4A 4Q7JA 5LC6A 3W8KA 3FTDA 2XSSA 5D81A 3I4VA 3T1HM 2VV6A 3KXEC 1BGSA 1UI7A 4N6OB 2FXTA 3N7WA 3N9HA 3K63A 2KNVA 4S2OA 4S2NC 2WKRA 1V9ZA 3KSXA 4P6BA 3X41A 1WXQA 2B02A 3H82A 4C75A 1N5HA 3FUVA 3ROBA 2KF3A 4S2IA 3FYCA 3SOAA 4ZJ1A 1R2ZA 4WMCD 2YR0A 5CECA 4UA9A 1TR8A 3E4PA 4MGYE 2Z7JA 1IQPA 2YKFA 5CTNA 5DTKA 3TE8A 4GITA 2DHRA 1GVNA 3VSYA 3E99A 1YSPA 3GSGA 2HMOB 4J8TA 4Q0IA 1FYSA 3M6AA 4F94A 3IXGA 2P0MA 3LTDA 1SDEA 3Q8XA 5KPTA 3N4IA 4NL4H 1DRMA 2DAKA 3A42A 4MGHA 1JNUA 3LXUX 1K38A 4Z8XA 3KOXE 4MBHA 1GY7A 4LF9M 1FW7A 2XD1A 3LW5F 3OV4A 4L0LA 4JN6A 2CFWA
chains in the Genus database with same CATH topology
2FE8A 1Q864 2A5YB 1DMNA 4E3JA 4DF6A 3RGPA 3SEDA 2E2VA 3MPHA 1EROA 5KQ8A 1Q3BA 1PJJA 1K57C 5M18A 1XC8A 1IVUA 5LC7A 4RNAA 2EFUA 2HP5A 3K7CA 3I563 1KVMA 3S28A 1C7HA 3CCL3 2ZMAA 2QZ6A 5EVID 5FAQA 3LT9A 4OVZB 2Y2MA 1CEGA 4UHUA 2STDA 3C7VA 2ZAMA 2IWDA 5JI3E 3I553 1MBLA 3GZBA 1ONGA 3G2YA 3CNXA 3VOZA 2F5PA 1JWVA 5GLBA 1ZG4A 2GU3A 1K4FA 4YFMA 2WGWB 3NI9A 4GN2A 5AYSC 2DRWA 2ZQ8A 1Z5AA 1K6RA 2ZJ9A 2W2CA 2R62A 1G3IA 1LHYA 3M6HA 1M9GA 4FWGA 5EJCA 3A3EA 1W6CA 2VIIA 1GL7A 4X66M 2RCXA 1JKGA 2W9QA 3I0YA 3X3YA 2R9WA 1VQ63 1JQJC 2WOHA 4IBDA 3G35A 3OPLA 4ZJ3A 5A92A 3E2LA 2F5QA 4J9AA 1NZOA 2WO0A 3MKIA 4K0XA 3GRJA 4XUXA 1ZO2A 4X53A 5GHXA 3FGYA 2XD5A 4CCVA 3SAVA 2WKIA 3GAXA 3MG2A 4LGMA 4FCTA 3UK6A 2Y2JA 3G34A 5KZHA 3KP0E 3BLSA 3TDGA 3L28A 1WE4A 3W4PA 3GRUA 3L2AA 4OVMA 2XEPA 1SKFA 1Z5CA 1MXOA 4DXBA 2CEAA 1SXJB 5EE8A 4O7DA 3G32A 5CERA 3IWOA 3WHKA 3NUVA 4LF8M 1KQS2 3WHLA 1FUWA 4ZPXA 2CE7A 1QALA 3WOEB 3IF5A 1NY0A 3KE7A 5EQLA 4K0KM 2CUZA 2UUCM 4YHHM 4GB5A 4JXJA 2Y0QA 1C1KA 4BJPA 1JB4A 2BJVA 1H6UA 1KSFX 3N54B 1NJ4A 2J9PA 2B24B 3NQYA 3MYTA 2EX9A 3FUUA 4DKIA 4K91A 1ULIB 5I94A 2E2UA 5AIHA 1Q40A 1QAOA 8CHOA 4DXCA 4DV5M 5FQMA 3FG1A 3U6SA 4CJNA 3UO9A 4N6NB 3SFZA 1IN4A 1HNZM 3V92A 3FTFA 3OPRA 4OPYA 4N6UA 3EE1A 2Y2HA 1IYPA 1QJGA 3GZRA 4LFCM 1TDHA 3SYLA 2BO9B 2Y4AA 4X55A 1HQYE 3MG1A 4B08A 1D6YA 3HLBA 3FKAA 1DVCA 3UMMA 1I5QA 3U5ZA 1L0EA 4LCMA 3S22A 2OTJ3 2Z4SA 3WS1A 2ZD8A 5CHUA 3HJSA 3JVCA 4WP5A 1T3TA 4JYAM 1DJCA 3LO7A 1IYSA 4XUZA 4EBGA 5C1BA 4HM0B 2CHGA 1OUNA 2FNAA 1I2SA 3X42A 3IF6A 1VQK3 4N9LA 3CCS3 3H3HA 3F9SA 3NBLA 3C4PA 4S12A 4Z9QA 2Y74A 4HM1B 3A3IA 2L7IA 2CIUA 3FWLA 4X62M 1L2SA 2CG1A 1OCVA 3GPPA 4OU7A 1L2CA 4QY5A 4NXMM 5EEOA 5E43A 2QZ4A 2GEXA 2RGOA 2DWZB 2V1ZA 2PU4A 2A49A 4R3DA 1TDGA 2F4VM 3SH9A 2XR0A 3U6QA 4DDYA 4L78A 4E6XA 1FA3A 2LXEA 3BOSA 1TIJA 3SLUA 4BL3A 3U61B 1YJ93 3TPZA 1QMAA 1CEWI 1TFOA 2K47A 5J8XA 4KFEA 1IT7A 4R4KA 3BLMA 1JB5A 4C6YA 5AQAA 3GVBA 3THGA 2ZL8A 2H1RA 2HKJA 2OOVC 1E25A 1ROAA 2JC7A 1Z6FA 2R46A 3MJ5A 2BNKA 1GCEA 4IPBA 2L09A 3O88A 1IY0A 3PXGA 3ECFA 2DWLA 5EXPA 2GBWB 4EV4A 3F8HA 3BECA 4OKPA 3LVWA 3A98B 3PCSA 3HLEA 1Q2QA 5FGOA 3E9SA 1EA2A 2CW9A 4X69A 1DGGA 3WA3A 1PU4A 4HM7B 4B3MM 3IXDA 5IEOA 1MX0A 1QANA 3KFUG 1YUBA 1N8QA 4GIPA 1O7GB 3AFHA 1YHQ3 3HHYA 3EB8A 2Z2MB 3UB1A 1W00A 3NV0A 4RX3A 4GHLA 3IHAA 4WZ5C 4KODA 2KXEA 1VQO3 1NB3I 2G2UA 5CHJA 3BFFA 5KSCA 1VQ83 2IWBA 4PD2A 1KGGA 4Q8IA 2QPNA 4LENA 3V50A 2KRUA 4MGZE 2EFXA 1QVF2 4NSOB 3S1YA 3WODG 2R9XA 4FH4A 1BLPA 4CISA 5A93A 3GLHB 1WYBA 3DW0A 4XDWA 4OQIA 4IBFA 1JWZA 4PEJA 1DO0A 2Q07A 2D1WA 1GHIA 1HR0M 4RF1A 3GLGB 5AIGA 1JN5B 2WGVA 2CC3A 4REZA 2IUKA 1BT5A 2G2WA 5HAQA 3TG9A 2WZZA 1LOXA 4RZMA 4KZ9A 3ZG9B 3QRDA 3U60B 4JKTA 1NJFA 3Q7ZA 5AIIA 4LRSA 3G2ZA 5E2FA 4LJAA 1W2ZA 4BQMA 4UAAA 1JJ22 3W4OA 3SH7A 4BTYA 1TFKA 3UE1A 3HLDA 2H0YA 4YY3M 3EHCA 4MLLA 4M9SA 2WGOA 3I7JA 2ZC7A 2YFIB 6STDA 3GQ3A 1PW1A 3MFDA 2P09A 1NWWA 2E2TA 3V98A 1G4AE 4QB8A 3BNDA 1O7WB 1K57A 3LH4A 2ML5A 4HM8B 3F14A 3MWZA 1G6AA 1C3BA 1VQP3 1ERMA 3T1YM 3GR2A 5CRFA 3CMZA 3B3XA 4WW0A 1W5SA 3O86A 3Q1CA 4WMCA 3UGJA 3KSJA 3QNBA 1IXSB 3PVSA 1GY6A 3GV9A 1CYUA 4JXGA 1KE0A 1QVG2 5CHMA 1DO2A 1XPBA 3J7BA 4BBAA 4D82A 3EQQB 3EC9A 2C99A 2HDRA 4X65M 2QP9X 4GL6A 3SATA 3DGMA 3LYGA 3MHEA 3BRMA 3WWXA 2EXBA 2CK3H 4ZBEA 3V3RA 4CDLA 4LV1A 1VQL3 2GEYA 4S2MA 1QMEA 2XF3A 2QEX3 5KSHA 3K1JA 3CJMA 4IEDA 2H5SA 3U1WA 4JBFA 4O8SA 3VFDA 3L27A 3EJVA 5ELJA 1TEMA 2CFOA 4GKKM 1G68A 4OW0A 2Q9NA 5ELUA 4LGYA 3PAEA 5EP3A 4LV3A 4B4XA 4FCMA 1W8YA 4IVIA 5D83A 3N8SA 2HMNB 3ZGAB 5BVBA 2EUCA 2OCTA 5IWAM 4OVDA 2C6WB 2JQ5A 3HUNA 4JI6M 1O7HB 5JBSA 3ZCBB 4GNUA 2KZSA 1G8PA 3FUXA 4P16A 3RGAA 2CHCA 5EOEA 4EWFA 7CATA 3EQUA 3IPTA 4JXWA 1PM5A 5HGRA 1VQ93 5TFQA 3PBSA 4AW4A 5GLCA 4C3QA 3MZFA 3MKEA 3GWRA 5KP4A 3VMAA 1CK3A 1DGBA 5FASA 4FVMA 2FFFB 3JUMA 1NDOB 4EC6A 1FSYA 4MNRA 1EG9B 5AI1A 1AVLA 5IENA 3Q7VB 3SARA 3DGOA 4QWTA 3NM7A 1H5XA 4DV0M 2CV1A 2Z4RA 3S4XA 1J2BA 4R7GA 3UNWA 1KSIA 4XBOA 4ZJ2A 3Q90A 3EBYA 1YJN3 1CEFA 4E3IA 4HL4A 4KZ7A 4KQOA 5ITTA 4MH0E 3B4PA 3OXAA 5ITQA 3J27B 3WRTA 1S3SA 3J7AS 2GDNA 1L0FA 1HQCA 2ZANA 4GRIA 1RP5A 3UL5A 2ZQCA 3X40A 2KEBA 2P9VB 2B5RA 5DREA 3I4YA 3PGBA 1LNHA 1K28A 3NCKA 1LLBA 2V1UA 2Y2PA 1E3UA 4Q53A 3FZCA 2D7EA 2UUBM 3VP2A 3ZG5A 5CGWA 3D3LA 3MHVC 4JI2M 4RBNA 3CC73 2WOFA 5KP1A 3HLCA 4I4KA 2P74A 2FGTA 1SXJD 3HX8A 2WUQA 1CI9A 1I2WA 2XDMA 4H3UA 1NYMA 3KSED 2UX0A 3VGNA 3GPUA 4JI8M 1XA7A 5U47A 2R4IA 2WZXA 2ZC4B 2CWVA 1R4CA 3C7UA 3NY4A 2Y91A 2EO2A 3KW6A 4A5RA 4KO8A 1R6BX 1FGRA 3M6BA 2XSOB 5CXWA 1YLWA 5KPRA 1LVNA 1ZC2A 1FCMA 1OHSA 2AHMA 4FMDA 5BR8M 2CFGA 1K734 3FUTA 2V6ZM 3HGIA 1IKGA 1JKGB 4WELA 5IG3A 4M9XA 1QYRA 1N33M 3NWLA 3A45A 3IXBA 4NK3A 3SX1A 2R4EA 5AQBA 1MU5A 1W5ZA 2MC8A 1IDPA 2H0TA 3U6DA 3UPPA 5EVLA 1ASKA 3FV7A 2HDUA 5EP1A 4R0QA 2WGWA 4LV2A 2SBLA 3TE6A 4I81A 2ZLYA 4FWDA 3EIEA 4B3SM 4JI3M 4FH2A 4X2OA 1PZPA 3EBTA 5FSWA 2ZM6M 3CU3A 1OH0A 1UI8A 3GZYB 3W4QA 3KOYE 2XFTA 3L26A 1KDWA 1JWPA 2Z2LB 5JYPA 3CF0A 1J7KA 2GXFA 4WM9A 3CCQ3 1ES5A 4D2OA 3M7GA 1JB2A 1IVWA 4DR1M 4LMIA 3IH8A 2ZC6B 1SJWA 1UM8A 4LFAM 2JBFA 3VSLA 1MWTA 2OSUA 3GRRA 1ZX2A 1OF5B 1ES3A 1OMEA 4LJ8A 3UN7A 2IWCA 5IF6A 3BEBA 3K5TA 3GZXB 5IHVA 1N77A 3IWIA 1IBKM 4R4RA 4S2PA 3NC8A 3LCEA 4OOMA 1NY6A 3JAMS 2WYXA 4JI1M 3AOGA 3AL0C 2J7NA 4RVAA 3NX0A 5DF8A 4KLNA 3G31A 2OV5A 3X3XA 5GLDA 3MZDA 3S29A 1TDLA 2ZAOA 4X68A 2XK1A 3GO8A 2WK0A 3G8ZA 4QY6A 2INXA 1GA0A 1KGEA 2I7NA 1IYQA 1K4EA 4JRFA 3I51A 1KGFA 1E94E 1M1K4 4B7GA 3RGRA 2W56A 3WS5A 1BTLA 2BMRB 3WA2X 4FMAA 1N75A 4X6TA 5JI2E 3T38A 1OHPA 3U6LA 2EA0A 4KQQA 3GLGA 1RJOA 4GC9A 5A0OB 4E3NA 4N6MA 2HL7A 2LQVA 1SPUA 4LFBM 4E3OA 3WS4A 3SYKA 2IA7A 1K8A4 5FQIA 4LF6M 2C98A 4IBEA 3TSGA 4S2NA 2HHHM 3AMOB 3LTCA 4JI0M 4IBGA 3BYDA 1XNRM 3BFEA 2HDSA 5GL9A 2RSXA 4STDA 3DWZA 3CCE3 1DYUA 3VP3A 1SDNA 2W6JH 3FYDA 1EE8A 2Z7AA 5KP3A 2WGIA 4KZ3A 1N8R4 2KW0A 3VDUA 4L16A 4DR5M 4OONA 1FGQA 3ZC7B 1OF5A 4R23A 2J9OA 2DWMA 2F5OA 2ZBKB 3UE0A 4G1MB 2BLSA 4K1VA 4B88A 1Y54A 2CFKA 3ILKA 3HJ8A 4MGKE 4MEIA 2HPBA 5HAIA 4ITQA 3BFCA 4G4RA 2Y2OA 2XLJA 1N9EA 1ROVA 4HM4B 3PBOA 2V2FF 2W82A 2HMKB 2CV0A 2Y59A 1Q42A 4RA7A 2CH9A 1UUVB 3MKFA 4KZ8A 2XSZD 1Z59A 1W8QA 3HHZA 2P38A 1D6UA 1Z1SA 3Q82A 2Y2QA 1SQWA 5ITXE 3LTBA 5IW9A 4CHTB 2X02A 3HHXA 1YLPA 3GPXA 4PM6A 1E3UD 1N5PA 1DGFA 1PIOA 1K54A 1IBMM 2V1LA 5KO3A 1WNHA 1U60A 3U61A 4M9ZA 2OQEC 1L5GB 3G16A 4L8OA 1RRLA 4BTWA 2H10A 4OLGA 1MNLA 1G96A 4DV7M 3OW22 3SVAA 1K55C 1NSFA 1ORYB 2ZQDA 2ZQAA 3JUOA 3WMDA 3G4S3 2KA6B 1PI4A 3FKWA 2UXDM 2WGQA 1XXMA 1OGZA 5IZ7D 1ULJB 1GS3A 3CCM3 1TDZA 3U6EA 1OFHA 1WQLB 5DF7A 3K92A 4LZIA 1OPYA 1FSWA 3TOIA 5AEUB 1OGXA 3VK8A 1U8CB 2IUJA 2OLVA 3R8FA 1RGYA 1O7EA 3GP1A 4FD2A 3CNMA 2W04A 1XGJA 3IH9A 3BFGA 3SBJA 1VQN3 3HHWA 4N1XA 1ZKJA 2Y2IA 4G6ZA 4IBCA 1H8YA 3RDEA 2DWNA 4DDSA 1IBLM 3M2KA 4BL2A 4EXRA 1L8QA 1JV2B 3LY3A 1BLHA 3PNVA 3WRZA 2ZC5B 2UXBM 2XZFA 4JF4A 4XXRA 3PBNA 4JI4M 2YFJB 3E4RA 3VKGA 4D80A 2Q9MA 4TUWA 5M19A 1U5OA 2RKOA 2XRXB 1QVRA 3Q2PA 4LJ9A 1PFPA 3HLWA 1UW1A 4ZM8A 3VSKA 3AV0A 1VQM3 3X3ZA 4NOOB 2PNCA 1YIT3 4DE1A 3DMCA 4CGYB 3N8BA 5DRVA 3CCU3 3A46A 3DXOA 3KKGA 4WYKB 2XH9A 1AR0A 3IG5A 3CD63 4PM5A 3U6OA 1US1A 1W6YA 1FR6A 3CG5A 5IEPA 3VFFA 1E3VA 4LSOA 4L15A 2VQFM 4QHTA 1YSYA 3HU3A 3DY5A 1GLNA 5C18A 4PM7A 2WAFA 4BD1A 1Q40B 1NYYA 1YLYA 3CMA3 3HZPA 4K61A 4FD8A 1JRQA 4EQIA 5BXQA 4AKGA 3GQ5A 4FCWA 1HU9A 1S6RA 1YMXA 2B1XB 5FQJA 2O5RA 2R65A 1L2BA 5IG5A 1MY8A 2QBYB 4EYCA 4HZBB 4WURA 5ITYA 1K3WA 4HM6B 2EX2A 5F82A 4NETA 2Z77A 4A3VB 1YI23 4QU3A 4Y0UA 2Y21A 4AEQA 3D9RA 3EN1B 2CHQA 5EUAA 2HMJB 1JVJA 5CK6A 2Y20A 4S2LA 1XWIA 4KFFA 4H61A 1TVFA 1VQ43 3RXWA 4RYEA 3KOZE 3OX9A 1MWUA 2J8YA 1L1ZA 3GRYA 3ISGA 3ITAA 5FAOA 2X01A 2W56B 4LJ4A 4OOYA 3UPNA 5IT9S 1QAMA 4KG6A 3V39A 1JN5A 3ZG8B 3VDPA 3SHFA 3R9XB 3UDIA 2WADA 3PTEA 2EXAA 4EBPA 1NJGA 3DA1A 1YT4A 4M0DA 5A90A 1W79A 3U5ZB 1KWIA 3ZHHA 5CF1A 1IEMA 5FQQA 1QQWA 3KS4A 4WYKA 1XGIA 5F1FA 3PYJA 2LWXA 5GHYA 4EUZA 5F3WA 4IT7A 2M7OA 1AXBA 2CFDA 5FW5A 5CEDA 1YLTA 5KPZA 4NREA 3L29A 1GYBA 2Y2KA 1OFIA 1L0GA 2CWUA 1OJLA 1K25A 3ZFZA 2LH0A 3GTCA 1TH2A 5TGFA 3EN8A 4AKHA 1XNQM 2CG0A 4FCFA 4QD4A 1E97A 4JF6A 3MZEA 5D3OA 3PNYA 5FTKA 1RN7A 4K0WA 1Q7Y4 2RGHA 2V20A 1LV7A 3HI7A 4KQRA 4GHAA 4DV6M 3A76A 1BZAA 5E2EA 5EVIA 4WEJA 1VQ53 4OVZA 5EXTA 1YGEA 4LGQA 1A90A 3G6E3 3H4MA 3U60A 2BHMA 5DF9A 2OOVA 8CATA 1NY5A 1ESIA 3T15A 1FGOA 1Y4KA 4OQHA 5LMUM 1Q39A 3HIGA 5KMWA 3HVFA 1VZZA 3V3SA 3O87A 3WDGB 2UUAM 5CLKA 3MK6A 3FF2A 1R7RA 1K6SA 3Q1FA 4MMYB 5HAPA 2L7HA 5F1GA 1CYVA 4FSFA 3E2KA 4XBXA 1I4WA 4R1GA 1H8ZA 1MOLA 3VP0A 2BMQB 3SAUA 2DZOB 3JUQA 2OPFA 1YIJ3 4II7A 3SOYA 3A3DA 2Y2GA 4RNZA 2BNGA 4ORLA 3KS8A 1A2KA 3PFIA 3OPHA 3KP1E 2W9PA 3HK4A 4YINA 5FI2A 1FGMA 3CXC2 3Q81A 2ZQ7A 1GKIA 3EX9A 4BLMA 4R4SA 4MBFA 3OWUA 1IY2A 3AGDA 3KOWE 3C5AA 3W0LB 7STDA 2L6OA 2OLUA 2ZM2A 5AYRB 4GKUA 1XXHA 4G4OA 4GC5A 5E2GA 1CQSA 4WWUC 3U97A 3N8LA 2Q2EB 3OPPA 3UJNA 1JR3A 4LF7M 1EWZA 5DTSA 1K56A 4XBTA 3IWQA 3M0EA 4XB5A 1YQSA 4KENB 4NRVA 3QWLA 5CGSA 3ZVTA 2V1CA 3S5CA 5L2FA 1N78A 2CFLA 1RRHA 3FYZA 1N34M 3FCSB 4OH0A 1NNUC 4H8RA 4OPRA 5HW3A 2XGNA 1VM1A 4N6LA 5LMNM 2HP6A 2J7OA 3AJIB 2ZM0A 1NHGC 1IKIA 3MSOA 1KE4A 5CTMA 1SIIA 1IQ8A 4HESA 2W03A 3HJQA 5BPVA 4FMBA 3AGFA 3QNCA 3PS8A 3HREA 2CV2A 2XR8B 3BNEA 3UL6A 3GQZA 1DJBA 4IBBA 3DFZA 2R4JA 1YMSA 1E9RA 1UUWB 5IG4A 1GA9A 4R9KA 2I9WA 2ZC3B 3CCR3 1BUEA 2C96A 4HVNA 1W5TA 4PM8A 3NDGA 4GB7A 1SCWA 4Y0OA 4R80A 1PWDA 2UWXA 4PMAA 1TUHA 1HNWM 1HKXA 3B4OA 3L0RA 4HYZA 5F83A 1KDSA 4AKZA 3SC3A 1W7CA 3FLJA 4DV4M 2F5SA 1R2YA 4I8OA 3KFQC 1HD8A 1A2VA 1IQXA 3PZWA 4GH9A 1G41A 4GD6A 2JA2A 4DR7M 3P09A 2C9OA 3IF6B 1RGZA 3PCRA 4OPQA 3O3VA 4LJ5A 3JR5A 1QAKA 5DVAA 1QAFA 2Y2LA 3SAWA 4O02B 2EX6A 4FWHA 4DV3M 5FI6A 3HBRA 3OCLA 4KZ1A 2CC1A 1AVKA 3HWSA 1K55A 2X49A 3ALAA 1HT1E 4PCZA 4B7HA 4HM3B 5KQDA 2LYXA 5FSRA 4MB7A 2PBYA 2UU9M 1DMMA 4QOZC 2Z3XA 1IVVA 3VK7A 2UXCM 1XMOM 1WMOA 3IHBA 4N9KA 3NIAA 3KSPA 3K8ZA 4GMQA 5EXSA 4AG5A 1L0DA 1K9M4 1I94M 4UA7A 2LNHC 1NZUA 4TX4A 3SS3A 4MBKA 3S67A 4L8RC 4WBGA 5IREB 5FLXS 3LTAA 3TQSA 3GLIA 5DYIA 3Q7VA 4WYYA 2X4AA 1E3RA 3NBIA 1WMPA 2YQZA 1KC84 2K0MA 4JF5A 4ID4A 4PPRA 2P05A 3SMSA 5EVHA 3UDFA 5IERA 3S27A 3GPYA 1MWRA 3LT8A 4K90B 5I97A 4BLCA 2YFQA 1HVBA 4EIWA 4O2HA 5IG0A 3G4PA 2CWTA 2ML6A 5M1AA 5E6JA 2P5TA 3PAGA 1PZOA 1GL6A 3ZH9B 4LF5M 2XSHB 4Y7PA 2WKEA 3U6PA 5AQ9A 1S0WA 1PW8A 3SMPA 4AKIA 3CPW2 2GU1A 4HM2B 3EQVA 4G4NA 1S723 3C4OA 3DZDA 1FR1A 4X56A 3L25A 1LI0A 2OWPA 5ITRA 1YJW3 1W4NA 4E3KA 1XP4A 1LL5A 1D6ZA 2Z6BA 3V99A 4W5WA 4NSRA 1XX2A 4OP5A 3U6MA 3N6IA 3VF1A 4E3MA 5EP4A 2D7GA 5FATA 3LVVA 3GQ4A 3HKPA 3D8LA 4KZAA 3LQRA 4DUYM 1MWSA 2I72A 2ZM8A 1SXJE 4WHAA 3HU2A 1BULA 4IVKA 1VDDA 3K9MC 2NQ8C 1LL9A 5AEWB 4KG5A 4LV0A 3CF6E 3PBTA 4GD8A 1MKIA 2C11A 1M904 3GLFA 2VGKA 4EV5A 4MGIE 4B3TM 2QGUA 3JUNA 4N6V0 1ISKA 3GLIB 1NHWC 1W01A 2RFRA 3LZAA 5DNYA 1L2DA 4I4LA 3IF6C 2OQEA 1E32A 2OTL3 5STDA 4QNRA 1BUQA 2ZDJA 5AIFA 4N3VA 3ZG0A 3W0FA 4KHPM 1XKZA 1BLCA 4DR6M 3IMAB 3PXMA 4EBLA 2BT3A 5FA7A 4L8PA 2D7HA 4LJ7A 5HARA 3IQAA 2FFJA 1J5EM 1WMNA 3SXXA 5EVIC 3G713 1L1TA 2FFYA 2GBXB 4IBIA 3UPOA 1G59A 2KZUA 4DE3A 4GDBA 4M0WA 1GY5A 3T0UA 1M40A 1JTDA 3NDEA 4R9LA 3FH1A 4JXSA 1IN6A 2A3UA 2Y73A 2WAEA 1VQQA 1YLJA 1GHPA 1YE9A 3FD9A 2FNQA 1IY1A 3JR4A 3FG4A 4EBNA 1SXJA 5EPHA 2RCDA 1ES2A 4KZ4A 5FAPA 1RCJA 1FNNA 1PWGA 4B4ZA 1K56D 5FTJA 4HBTA 1LXEA 4LZJA 4L7KA 2O3OA 3K0ZA 1SHVA 2OQ4A 2F99A 4AQYM 3UZUA 5GKNA 1FQGA 2Z76A 3RFWA 3PBQA 3GLHA 3ER7A 3KN4A 3D4FA 4X64M 4NRWA 1CI8A 4PM9A 3NBBA 4WZ5A 2VGJA 1N36M 1DGHA 3B7CA 3DGLA 2ZQ9A 2F86B 2HCBA 1NU3A 3HL9A 5FQKA 1QZMA 3F8XA 1HNXM 4PT5A 4IBXA 1DJAA 3J80S 1A67A 3GLFB 2E8IA 1DMQA