2XEPA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
428
structure length
419
Chain Sequence
SVPTPAEAALAAQTALAADDSPMGDAARWAMGLLTRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 135
structure length 419
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xepA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xepA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xepA02
5DTTA 3BM6A 3OPPA 2Y2IA 4ID4A 4LV1A 3QHYA 5FATA 3HL9A 1PZOA 3PBNA 4UHUA 5FQMA 2XK1A 2Y59A 3OPRA 2Y2GA 3G31A 5CEBA 2HP6A 4FSFA 1EROA 1K55C 5DTSA 5E2FA 5TR7A 2H10A 1YMXA 5GLCA 3SS5A 2HP9A 4QY6A 2V2FF 3NY4A 4K0WA 2QPNA 4Y0TA 1Q2PA 4X56A 5EVIB 2R9WA 2XLNA 4O7DA 1JWPA 2A49A 2Y2HA 2XEPA 3HUOA 4S2NA 4WZ4A 4EBLA 4WZ5C 1KE0A 4PM5A 1RP5A 3VFHA 1YLTA 3Q7VA 5G18A 4E3OA 1FSYA 3M6BA 1MBLA 3C5AA 4IBRA 1BT5A 3V3SA 1ES4A 5F83A 5AQAA 5GHYA 2EX6A 3O87A 2BG1A 1KGFA 3HLEA 4PM6A 3UDXA 5I94A 1PWCA 4UA7A 2WGVA 3CJMA 3OC2A 4UA6A 3ZG7B 3ZG5A 4DE0A 1RCJA 1NXYA 4WBGA 1BLSA 2QZ6A 3GSGA 3UDIA 3Q81A 3IXHA 3VP3A 1CI8A 1I2WA 1HVBA 1SDEA 1G6AA 1L0EA 3IXDA 4JKTA 2WGIA 4PM8A 4ZAMA 2XFTA 4C3QA 1GHPA 3GR2A 3IF6B 5CECA 1DJCA 2Z2LB 3PAGA 3V50A 5JYPA 1K6SA 4QY5A 1ESUA 4N92A 1TDGA 1KVMA 1S0WA 2PU4A 2ZD8A 2Y2OA 3NI9A 3PAEA 1DJBA 4WELA 1KE3A 2ZQ8A 2PBYA 3O88A 1SKFA 1M6KA 2J8YA 5EUAA 3GRJA 3NDGA 1XGIA 3A3DA 3GVBA 4U0TA 3ZG0A 3LY3A 1IKIA 1MKIA 1YQSA 2P9VA 1M40A 1XKZA 2ZLYA 4Y7PA 3WS1A 2UWXA 3LY4A 3BLSA 3S4XA 3SS4A 4QB8A 4RVAA 3DW0A 3WS4A 1N9BA 3SH8A 3S22A 2C5WB 3HLFA 2X02A 1IEMA 2XD5A 1YMSA 4JXSA 2XR0A 3MBZA 4KZBA 2WKHA 1C3BA 4OPRA 3MZFA 3V39A 1NJ4A 1TVFA 4QHCA 1YT4A 2FFFB 5FAQA 3ZHHA 4Z9QA 2RL3A 2A3UA 1LL9A 1QMFA 4GNUA 4N1HA 4OPYA 4BL3A 2Y2LA 4EUZA 4Q8IA 5CEDA 3W8KA 1BZAA 3RXXA 2XGNA 2Y91A 3PBSA 1ESIA 4ZTKA 4BJPA 5FI7A 4NK3A 1PI5A 2Y2JA 4KZ3A 5CHJA 2DRWA 1ES3A 5EVLA 1XA1A 4R4SA 3UE0A 1K56D 2WGWA 1EI5A 4Y0OA 5TGFA 3NCKA 5GLBA 4LCLA 4UA9A 4OQGA 4DE3A 5DF7A 4KZ8A 3SH7A 3W4PA 1K56A 4JF4A 4HEFA 5KSCA 2ZQ7A 2Y55A 4MLLA 4JF5A 4S2NC 3Q07A 2H0TA 5FI2A 4GZBA 3G34A 4MBKA 3UO9A 4HBTA 1CEFA 1MWRA 1ERQA 4CPKA 1H5XA 3BRMA 4XUXA 5FDHA 4PMAA 5M19A 1IYQA 3G30A 3IWIA 3HLBA 2WYXA 4WM9A 5F82A 1KE4A 2WAEA 5DTKA 3ZVTA 4B4XA 3JYIA 3MZDA 2B5RA 2Y4AA 2ZC6B 4KQOA 1ALQA 4ZDXA 3ZFZA 3Q7VB 5HARA 3LO7A 3VOZA 4GDBA 1E4DA 1MPLA 4P0MA 4XXRA 3PBTA 4S2OA 4ZJ2A 4X6TA 4OP8A 2Y2KA 3IT9A 4GB7A 3N4IA 2EFUA 5AQ9A 3IH8A 4BLMA 1ZKJA 4R3BA 2WUQA 2Q9MA 3UN7A 1K54A 4H8RA 1CI9A 1CK3A 2XDMA 4LV3A 3Q1FA 4DXBA 1MWTA 5CRFA 4OQ0A 5EECA 3C4OA 2JC7A 3HLCA 5U47A 5CTNA 3DWZA 1L2SA 1LLBA 1NY0A 3D4FA 3HVFA 5GHXA 5J8XA 4P6BA 3WS5A 2R9XA 3ITBA 5A90A 1WYCA 4X69A 4JLFA 1BLCA 3ZDJA 3BYDA 1Q2QA 3BFFA 3OCLA 1LHYA 5E2EA 3UE3A 3ITAA 2ZMAA 2ZC7A 4KENB 4QJGA 1Y54A 5EOOA 4JXVA 3VSKA 4GKUA 3M6HA 1S6RA 2J9OA 3CZDA 1EWZA 2P9VB 3WRTA 3EQVA 3AGDA 2ZM0A 3NDEA 4PM9A 3WWXA 1PYYA 1H8ZA 2OLVA 2Y2NA 5FASA 3MKEA 3W4QA 2OSUA 2ZQAA 5FQKA 2EX9A 1YM1A 3G2YA 3OCNA 4R1GA 2DCFA 4NETA 4E6WA 1JWVA 3C7VA 5CXWA 3C7UA 3ZGAB 1SDNA 2V20A 3TOIA 4FH2A 2ZC5B 2C6WB 4YFMA 5GLAA 1RGYA 4FH4A 1I5QA 4K0XA 1BLPA 1PW1A 4KG5A 4L0LA 3FYZA 1FR1A 3VMAA 2VGJA 5L2FA 3P09A 1GA9A 5EVID 2H5SA 2WZZA 3PBQA 3CG5A 4R3JA 5HAPA 4KG6A 2EX2A 3HBRA 3VOYA 1PIOA 3LEZA 4A5RA 2IWDA 1BULA 3WS2A 2WGWB 3NIAA 4N9KA 3A3FA 3BECA 2CC1A 2XD1A 4EBPA 1MWUA 4IVKA 3BEBA 2JE5A 5E43A 1BLHA 5CGXA 4X55A 4HESA 5GL9A 4S2PA 4C6YA 3GMWA 5CHUA 4KZ9A 4WYYA 5CHMA 3O86A 3WS0A 4LV2A 1KDSA 3CMZA 2HDRA 3W4OA 2GDNA 1IELA 1JTGA 3A3IA 2WAFA 3G4PA 5AQ7A 3N6IA 3VP2A 1QMEA 3AGEA 3A3EA 1VM1A 5CERA 3UPOA 5FI6A 2HDQA 4S2IA 3QNBA 4DF6A 1O7EA 2HP5A 4RYEA 1JWZA 2HDUA 2I72A 3IF6A 1K54C 5TFQA 5A91A 3HLGA 4E3KA 1FQGA 4LV0A 4JXGA 3ZNTA 3G35A 3N8RA 1W79A 2ZQCA 4ZJ3A 3O3VA 3OZHA 1SHVA 3E2LA 3ZNYA 1RGZA 1WE4A 1LI9A 4OP5A 4OPQA 4X68A 4RA7A 3IWOA 5KZHA 4EV4A 3AGFA 4RX3A 4DDYA 3M2JA 4JPMA 1IYPA 4JF6A 3WRZA 2Y2PA 4JBFA 1TDLA 3MXSA 5HL1A 4N9LA 5EE8A 1XPBA 1FCMA 1XP4A 2G2WA 3NBLA 2WK0A 3TSGA 5FAPA 4E6XA 2EXAA 4LCMA 4EBNA 4HBUA 1PI4A 2JCHA 2J7VA 4ZJ1A 4QU3A 4FCFA 3VP0A 1W7FA 4OOMA 1U60A 4YINA 1KVLA 4K91A 3GQZA 2X71A 4IVIA 2QMIA 4IBXA 1GCEA 1XXMA 3IHBA 4S2MA 1JTDA 1K6RA 1NZOA 2X01A 5FAOA 1PWGA 3IF5A 3VSLA 3UNWA 1LI0A 3GV9A 4E3NA 1L0FA 4KZ7A 4UAAA 1MWSA 4KQRA 5CTMA 1GHMA 4MEZA 3MXRA 1FCOA 4EWFA 5FQJA 4QD4A 1NYYA 4MNRA 4MBFA 4DE1A 3MFDA 3IXGA 3ISGA 4OOYA 1H8YA 2G2UA 2WADA 2XFSA 5KMWA 1K4FA 3QNCA 4KZ6A 4KQQA 2IWBA 5F1GA 2EXBA 5EVIC 4BQMA 3PBRA 1K57A 3OPLA 4FD8A 3BFGA 3BFCA 1J9MA 1HTZA 2P74A 2Y2QA 3Q82A 3IQAA 2ZC3B 4JXWA 3UDFA 3V5MA 1ZC2A 4DKIA 2FFYA 4OLDA 1PZPA 3GTCA 2E8IA 3UPPA 5JYOA 1WYBA 2XH9A 3UPNA 3SS3A 3I7JA 4S2LA 3E2KA 4B4ZA 4P85A 5DF9A 5F1FA 2ZQ9A 4P87A 4OKPA 1NRFA 1L0GA 4E3JA 5GLDA 3PTEA 5A93A 1OMEA 4DRTA 4GD6A 2HDSA 3RXWA 3RJUA 3SOIA 1K4EA 4DE2A 3PBOA 5FSRA 5IHVA 3ZVWA 1ERMA 2H0YA 2ZM2A 4OOLA 5FQ9A 1FR6A 2WKEA 4R23A 4X53A 4KZ5A 3IF6C 1JVJA 3N8SA 3VP4A 3ZG9B 4GD8A 1TEMA 4OPZA 4E3IA 4PM7A 1ONGA 4OH0A 1MY8A 5EPHA 4BL2A 4OLGA 3NC8A 3DWKA 3EQUA 1DY6A 5EVIA 4ZBEA 2J9PA 3IXBA 2WKIA 2WZXA 3N7WA 3VP1A 3MZEA 3LCEA 1YLPA 1W8QA 1PWDA 1YLYA 1K55A 4MBHA 5FA7A 1GA0A 3Q7ZA 4OQIA 1G68A 5CGSA 1YLJA 3HLWA 4PPRA 1YLWA 1NZUA 1KGGA 1K38A 4GOGA 1PW8A 2Q9NA 4F94A 4B88A 4OONA 4WZ5A 4BENA 1BSGA 4BD1A 1ONHA 3HUMA 4C75A 3ZCZA 4EQIA 5HX9A 4RX2A 2Y2MA 3BFDA 3MKFA 5HAIA 5HW3A 4WMCD 5DF8A 2OV5A 4D2OA 3B3XA 5KSHA 1E3UD 3G2ZA 4WEJA 5D3OA 3HREA 2BLSA 4R4RA 4Y0UA 4DDSA 1ES2A 4KG2A 1Z6FA 2V1ZA 4KZ4A 1L0DA 1BUEA 4OQHA 4WMCA 1N4OA 2HPBA 4BD0A 3V3RA 1E3UA 1W8YA 1IKGA 3HLDA 5E2GA 4U0XA 2XQZA 2JBFA 1IYSA 5A92A 3FKWA 1IYOA 3HUNA 1ZG4A 5E2HA 1HD8A 1FSWA 5M18A 2OLUA 2ZM8A 4GDNA 3FKVA 3G32A 3IH9A 5FQQA 2DNSA 3TG9A 3M2KA 2XF3A 4M3KA 1BTLA 4E3MA 4S2JA 3IWQA 3OPHA 1XX2A 5M1AA 1ES5A 1K57C 1YLZA 4R0QA 5HFOA 5DVAA 1FOFA 1HZOA 2PU2A 1O07A 3P98A 2IWCA 3SH9A 2EFXA 3FZCA 4U3TA 4XUZA 1XA7A 3FV7A 4WEKA 2EX8A 4KZAA 2RCXA 4N1XA 1K25A 1CEGA 1XGJA 5CGWA 4IEDA 3IHAA 4OVDA 2VGKA 3BFEA 5BOHA 3FWLA 4DXCA 1GHIA 1LL5A 5AQBA 4GN2A 1MXOA 1ZG6A 3N8LA 5EOEA 3VFFA 1KGEA 2ZC4B 2ZJ9A 3C4PA 1FCNA 1I2SA 1DJAA 3BLMA 4CJNA 1NYMA 4LENA 5GHZA 5FQIA 3UY6A 3UE1A 4E3LA 1VQQA 3DTMA 3S1YA 1E25A 1W5DA 4S2KA 1KDWA 1AXBA 2Z2MB 5HAQA 3ZG8B 1SCWA 2ZQDA 3A3JA
chains in the Genus database with same CATH superfamily
4NOOB 4EEUA 2B18A 4LV1A 3QHYA 4Q0JA 3R9XB 1RNTA 1PZOA 1C7HA 3HL9A 1SZVA 4WYKA 5FQMA 2LBCA 2F5WA 1Y4OA 3VE3A 2E5LM 2V8CA 5BU4A 2FH5A 5EM1A 1ASKA 3LVVA 1VQO3 4IBDA 1ULIB 2V9AA 1GY5A 2DZLA 4GEWA 2H10A 4JGOA 3KSIA 4QY6A 3SS5A 2V2FF 1DMQA 3GWRA 1IBKM 3NV0A 5LMUM 1D2NA 4P6ZS 2Y2HA 1I8VA 3HUOA 5KPTA 5J3WA 1BRGA 2R45A 2WZJA 5EFWA 4PM5A 5KPZA 3LT9A 4GIPA 1WMNA 2EJSA 1OFIA 4HEOA 3OWYA 3U6PA 1FNNA 1YKDA 5J4EA 2OOAA 3KOWE 2JKFA 1JB2A 4IHQA 2EX6A 1QUTA 1LXEA 1YHQ3 1KGFA 4D80A 3HLEA 2O9AA 4LRZE 1L8QA 3W67A 5HDDA 1ODVA 3KE7A 2P09A 3CNXA 4ZM8A 3C2WA 3LIDA 4EUVA 1X1WA 3DZLA 3VK8A 1X1YA 2MF7A 1M1XB 4QWTA 2QZ6A 3Q81A 1T3TA 1I2WA 1NLZA 3JUMA 1SDEA 1T1AA 3LR4A 4IBEA 3L9KA 4FWDA 2ZM6M 5HWVA 2WGIA 1PGYA 4ZAMA 4DR2M 1UGUA 1TDZA 4U13A 4C3QA 2KCDA 1VQK3 2PYPA 3UB9A 3PAGA 3FYCA 5HD5A 1S0WA 3MJ5A 4AKIA 1IU7A 1OTBA 2ZD8A 2B24B 2Y2OA 3NI9A 3PAEA 1DJBA 3DM8A 4KFDA 3HY5A 4QHSA 3THGA 1WHCA 2YFIB 3CCR3 3CPTB 2E2VA 5EUAA 4U0TA 3A3DA 3MF0A 3ZG0A 1H6UA 5AJGA 2EKFA 2PHYA 3LY4A 3T4KA 3S4XA 2O25A 3U6OA 2BTFP 4RVAA 4ARZB 2W1RA 3NOPC 1TF0B 3SH8A 5I97A 2ZL1B 2X02A 4MN7A 2XD5A 2DAIA 1Y4KA 1YMSA 2XR0A 4KZBA 1C3BA 2CMNA 3VKHA 1GYBA 3LMLA 2X8AA 3PHYA 5JPUA 1YT4A 5IENA 1WGLA 3SLUA 1BSCA 2RL3A 2JKGA 4HM1B 2CIUA 2C5RA 2XSZA 1YIJ3 4OPYA 4EUZA 5CEDA 1LV7A 3GSPA 1R4GA 3F7SA 3GRYA 3I04M 4JGQA 3RXXA 4HZBB 1LVNA 4ZTKA 1JV2B 1FIKA 3MR0A 2Y2JA 3TWKA 2DRWA 4R4SA 3UE0A 2N35A 1EI5A 4Y0OA 4D60A 4IIWA 2WO0A 2V1CA 3NCKA 5EP4A 2CWBA 2STDA 2L4FA 1FGOA 4UA9A 4OQGA 3SH7A 3NHXA 3AOEC 3FPWA 1K56A 3H7WA 4FWHA 3CAXA 2Y55A 3TE8A 3HCYA 3MQQA 2LB5A 3NBBA 2H0TA 3RGAA 3CD63 5IG5A 5JPPA 5IG4A 3FPVA 4HBTA 1DRMA 4JN6A 3U5ZA 4G6ZA 4XK8F 1MWRA 3F7XA 3FGYA 3X42A 4NXBA 2G5GX 2L7HA 1BRNL 5M19A 1IYQA 2JKRM 1HJPA 2QPAA 3JUNA 3ZVTA 3ALAA 5G4YA 3MWZA 3GLHA 1BNIA 1JKGA 4CCVA 2YKHA 3SAVA 2XLJA 4GLQA 1ALQA 2HMNB 1A5TA 4AG5A 1WQLB 2EUCA 2FGTA 4JI8M 2GEXA 4GKKM 1E4DA 4P0MA 1GY7A 2P08A 4XXRA 1RGHA 4OVZB 5AIGA 1NLYA 4WF0A 1FGQA 2Y2KA 4HJ6A 4X1LA 3N54B 2JY7A 1NY6A 3A0RA 2R0IA 2KF4A 3UN7A 2Q9MA 1CI9A 5HPIA 4LV3A 3DGLA 3C9PA 1IFYA 4DXBA 2ZMVA 4O02B 3BNBA 5FSWA 2JC7A 3C4OA 3I0YA 5CTNA 4R80A 4LRXC 5A90A 2P0XA 4JLFA 3BLZA 2MGWA 4R70A 4XT2A 3D5IA 1Q2QA 1RGEA 3OCLA 1O7GB 2W0QA 4MJDA 1TS0A 3UE3A 3S5CA 4HZ9B 2ZC7A 3UJMA 3U6SA 4QJGA 1Y54A 5EOOA 3K7CA 3VSKA 3RGSA 3EBYA 1DVCA 1IDPA 4LF4M 3U97A 4LJ4A 4EW7A 3GLGE 5FEGA 2ZM0A 3P01A 3CUEA 3AHSA 3VF1A 2Y73A 1UW1A 1D1JA 3GQ5A 2Y2NA 3WWXA 2WKQA 2BMRB 2OSUA 3EQQB 4DV5M 5FQKA 1XJ2A 3ER7A 5GKNA 3DOAA 2RCDA 5HD3A 4AZFA 2DCFA 3IHPA 2K47A 2YQZA 2VIIA 4DV0M 1SDNA 1XHBA 4WURA 4BTYA 1TH3A 1LQGC 3IG5A 4FH2A 4LF8M 2ZC5B 3VE4A 1QZMA 3E4RA 1Q814 4IT7A 3RNTA 4FH4A 3C38A 3EX9A 4K0XA 3EEHA 2DNAA 2LVAA 4N6NB 2VGJA 5EVEA 2BHMA 1XNRM 2H5SA 3CCE3 4FCWA 3PBQA 3D4AA 4EBGA 4EV5A 4KG6A 1QMAA 1YSPA 3VOYA 3LEZA 2BNKA 3HJ8A 2P0MA 1IVXA 3DTEA 3WS2A 3IPTA 4EBPA 1S723 1MWUA 1KQS2 5DNYA 3BEBA 1F5MA 2JE5A 5CGXA 2BU4A 3C3DA 4GW9A 4Y5FA 1S3SA 3KIIA 1KDSA 2AVXA 1FA3A 1RNBA 3NM7A 3CMZA 1PFPA 3KO6A 3LMMA 1N36M 1UGHI 1J7KA 1CUKA 2WAFA 3DAVA 2H0HA 2SBLA 3NBJA 5FDSA 5TBMA 2HJ9C 3OWSA 1KOUA 2HCBA 1IOUA 5RNTA 4B08A 5FI6A 3VOLA 1OIPA 4JYAM 3QNBA 1IN5A 1Q02A 3C30A 3CC73 2OQEA 3GPXA 1Y28A 2I72A 3PZWA 1LT0A 3DZDA 1F4IA 3LI8A 3RE8A 2I7PA 3EE1A 3F1PB 4LV0A 3O5YA 4JXGA 3ZNTA 3H4JA 4WFOA 2ZQCA 4FCMA 1TIJA 4RNAA 1A67A 3OZHA 1SHVA 1LSWA 2W3GA 4HM4B 2KRUA 1RGZA 3T4JA 3ZNYA 2KRTA 3D3OA 4OP5A 4X68A 4GS9A 5KZHA 3NULA 3Q8XA 3ECFA 1M9GA 4JBFA 4JXJA 4LJ7A 3QWLA 5EE8A 2G2WA 3LR0A 3NBLA 4MCWA 4FD2A 2QEX3 4LCMA 4EBNA 4FCJA 1PI4A 2JCHA 4ZJ1A 3CUEC 1W7FA 3GZXB 2R78A 4DV2M 3CCU3 2WSCF 3S7OA 1T1CA 3QRDA 4PKYG 3DGOA 2PD8A 4G4RA 2AADA 2RGQA 1GCEA 3IF5A 5KIZA 3AJIB 2QCUA 4LSOA 1K8A4 1B2SA 4ANRA 4KZ7A 2JY8A 4DN0A 2M60A 4E3NA 3D9YA 4Q0HA 1GD3A 3UB6A 3L7HA 2ZDJA 4QD4A 1NYYA 1XFQA 3MFDA 1A2KA 5IREB 1H8YA 2G2UA 3JUQA 5KMWA 3T4OA 5AYRB 1N34M 1B3SA 2OTJ3 1OJLA 1HNXM 5DJUA 1SXJB 3CI6A 1N8QA 2CP8A 4X25A 1Q824 1J9MA 1HTZA 4LFUA 3RDEA 1K0KA 3D9RA 3SBJA 3SC3A 3L29A 4GHLA 1RHLA 5EP2A 5JYOA 2XH9A 5FTNA 3PS8A 4S2LA 2E8JA 1U5OA 2L2DA 4P85A 2J7OA 3SOYA 2K54A 4OKPA 1NRFA 3G8ZA 3S28A 2INXA 1IY1A 5GLDA 4E3JA 2JZ0A 2B02A 4DRTA 3EWKA 4GD6A 2HDSA 1WNHA 1CJFA 3RXWA 1VETB 2D7HA 5FSRA 1S1ZA 5HDCA 2IA2A 2XA7M 4REZA 3BNCA 2KX6A 2C96A 2OQEC 4X53A 1RGAA 1SQWA 4OPZA 2R65A 4HIAA 2IYJA 1OFHA 2J5YA 4TUWA 3D72A 4MN6A 4EYCA 4OLGA 3EQUA 2O99A 3T4LA 4D82A 2R4JA 2J9PA 1BNFA 3TWLA 1UI7A 3HGIA 3MZEA 4IBGA 5FA7A 3MHEA 3Q7ZA 1GO5A 3ZQJA 2C9CA 2A24A 2KF5A 2EKKA 1YLWA 2I7NA 1JNQA 1KGGA 4WW0A 4GOGA 3GECA 4J5GA 2INWA 2W9QA 3R7WB 1BSGA 3QP5A 3E46A 4HLQA 1ZS7A 4DV3M 1IN4A 5HX9A 5IW9A 3MKFA 5HAIA 4LJ8A 1N33M 3BQ8A 3B3XA 1JZDA 1UUWB 4WP2A 2DAGA 1OACA 4NXGA 5D3OA 1CYUA 3L0RA 3IBRA 2XA7S 1KSIA 3WMDA 4DDSA 2MROB 1G59A 1Q9EA 4WMCA 2JWSA 1B27A 3V3RA 1E3UA 1IKGA 3HLDA 3H3HA 3K3CA 4U0XA 3K9OA 2JBFA 4LGQA 5E2GA 3VLFB 4I81A 1AVLA 3FKWA 3HUNA 3PXPA 3LT8A 3VK7A 5E2HA 5C18A 1FSWA 2M7VA 2CRUA 1TFOA 3D79A 1G02A 3MHVC 3U61A 3R8FA 2UXCM 2YR0A 2M7OA 3AMOB 3A0VA 1PJJA 1MNLA 1T5YA 2KHHA 3TG9A 4PDGA 4E3MA 1XX2A 1G3IA 1NNUC 4R0QA 3NX0A 1FOFA 2VJWA 2RNTA 1HZOA 2PU2A 3P98A 1OF5A 2EFXA 3WODG 4U3TA 1XA7A 2VF8A 4IEDA 3T1SA 5EEOA 4OVDA 1UFZA 3BFEA 1LL5A 3TRCA 8RNTA 5EOEA 4QNRA 2CUZA 5CF2A 2WKRA 2ZC4B 1UM8A 1HQCA 4HM0B 1JBSA 4CJNA 1F9IA 3KSJA 3FRIA 1TTOA 3CNMA 2GQFA 1HT2E 1Z5BA 4E3LA 1VQP3 4R3AA 2Z2MB 5DREA 1Z5CA 4WN5A 1IV7A 1T6OA 2L0WA 3WA2X 2KRKA 3CLOA 3BM6A 4MEIA 3OPPA 5ITUA 4ID4A 4LGMA 1G8PA 3QP1A 3LICA 2ZOIA 2NUTC 5FATA 3PBNA 1K734 2XK1A 1OTAA 3G31A 5CEBA 2HP6A 4FSFA 5L10A 3RTYA 1EROA 3KFQC 5TR7A 1VQM3 1GOVA 1WTHA 3NOUC 2QPNA 2LWXA 2CFDA 5EVIB 3CF0A 1BU4A 4LZIA 4BTWA 2A49A 4IBKA 3B7NA 2XEPA 1X0OA 2ERCA 3F14A 3Q7VA 1NV9A 2XSOB 1N9EA 3CCQ3 3M6BA 3CPOA 4BBAA 1N5PA 4K1VA 1BT5A 5F83A 4F3LB 1BANA 3OLOA 3NBRA 5AQAA 1ZO2A 3CME3 3FSDA 3SYUA 1GSXA 5I94A 1G6OA 4UA7A 3CJMA 4HM2B 4N6V0 3BNDA 4RZMA 3ZG5A 1RCJA 1UUVB 3NBIA 3GRDA 1NXYA 1BLSA 4HNBA 4L6V6 1V74A 2QA43 4I5SA 3CCL3 3PR6A 1HVBA 3K2LA 4LY6A 3UNLA 1Z59A 2AAEA 3UMEA 4KLNA 2KA6B 3AHWA 4AKHA 5HZHA 1LOWA 3IF6B 5CECA 5L09A 3T4SA 3V50A 5JYPA 3KSED 4OX9M 1Q7HA 1ESUA 3JR4A 4N92A 2CV1A 1KVMA 2PU4A 1NO3A 2M5ZA 1E97A 2A15A 4WELA 1KE3A 4UEYA 3O88A 1NJGA 3U6EA 4LG2A 1XGIA 2XRNA 3GVBA 3LY3A 1IKIA 3PFIA 3U6MA 2CX0A 2P9VA 3KKGA 4RKUF 1A2VA 1NV8A 2UWXA 4BMWA 3PVSA 3CC23 3SS4A 3SXXA 1FILA 3DW0A 2ZMFA 1V34A 3F1OB 1QUSA 2C5WB 1ZMUA 4BLCA 2W56A 1TGUA 3KOYE 4B3TM 3FG4A 2C9OA 2Y21A 1XJ3A 3HJIA 1GS3A 1LOVA 4HM8B 1NJ4A 1H3QA 2XR8B 1QAFA 3ZHHA 4I4LA 4Z9QA 3S7PA 3TJZC 1R5LA 4LGYA 1AV4A 3HU3A 1X1XA 1V92A 2OO9A 2QP9X 1QDRA 3S7QA 4BJPA 1G28A 4NK3A 1BNSA 1WIVA 4QHTA 3AV0A 2UU9M 2P04A 4XBYA 4EQ1A 4B7FA 2WGWA 1ROVA 2LVNC 3M6AA 4PT5A 4GHAA 1OTDA 1TS6A 4PAUA 4CHTB 1T2HA 4LCLA 3E4PA 1N32M 1US1A 2VA0A 1B2ZA 3H51A 1GLNA 1BSEA 3MMHA 3FE3A 1W00A 3RGRA 4LF9M 2P7JA 2ZQ7A 2W03A 4HM3B 3K9PA 4KVHA 4OU7A 1PJSA 1OGZA 4MBKA 3UO9A 2VKSA 3R7WA 4LRYC 1H5XA 4DR7M 3BRMA 4XUXA 3OX9A 4HJLB 3G30A 3IWIA 5F82A 2WYXA 1JN5A 1OHOA 4WM9A 3B47A 3JYIA 3MZDA 1OJGA 3WHOA 7GSPA 5JI2E 1WMOA 2ZC6B 4KQOA 2LVQD 1BSDA 3FCSB 3OXAA 1O7MB 5HARA 2KXGA 3VOZA 4DV4M 2KDLA 1MPLA 2J3TD 2CV2A 2UX0A 1EFUB 1MU5A 3TWMA 3BIRA 3HIIA 4S2OA 2EA0A 3T50A 3V76A 2EFUA 3GZRA 5HWWA 2IY2A 5AQ9A 3UJNA 2O3OA 1ZKJA 2HF6A 2ZBKB 1K54A 1V57A 4K90B 3C8CA 1I3IA 2XDMA 3CHWP 3Q1FA 3U6CA 1MWTA 3AOEA 3IX3A 5EECA 4Q53A 3HLCA 2OWHA 1QALA 3DWZA 1LLBA 3OBFA 1SXJC 5KQDA 5GHXA 4P6BA 2QBYA 1IXRC 3WS5A 4BB9A 2APLA 1JQJC 1JBRA 3FYDA 3SYLA 5E2EA 3ITAA 2UGIA 2IUKA 1QDTA 2DMWA 1VQ63 2OOLA 1WGNA 1GSPA 1S6RA 3CZDA 4MGIE 1WJ7A 3A98B 3KDSE 3AGOA 2J8XB 1GL6A 2CFLA 3AGDA 1HR0M 5IZ7D 1TJDA 5KP4A 4PM9A 1IXZA 5FASA 3MKEA 2GNXA 1RJOA 2QYBA 3G2YA 4R1GA 2XZFA 2P5TA 2CH9A 4NETA 4E6WA 3KZTA 1JWVA 5CXWA 2JKRI 4NHFA 4IBJA 2V1AA 3KP0E 4O8SA 2FH0A 3LQRA 4L4UA 4MDZA 3TOIA 3ZQ5A 5GLAA 1B2UA 1DGFA 2Q2EB 3B7CA 3OWUA 2L1MA 4RQ9A 2DVWB 5BR8M 1PW1A 2HKJA 1B20A 1TRPA 3GLFB 4UN2B 4D81A 1DMMA 3P09A 5L2FA 2PZVA 1HKXA 5BXQA 3I51A 3CG5A 2CFOA 3UE6A 4GHIB 5AI1A 4R3JA 2D02A 2ACGA 3HBRA 3F92A 2CHVA 1BRSA 1PIOA 4DJ2A 4A5RA 1RMSA 3AL0C 5KPRA 1SPUA 3NIAA 4N9KA 3BECA 2CC1A 2XD1A 3V92A 4LZJA 1BGSA 5L8RF 1HNWM 1NHWC 1A90A 4L16A 4R3DA 2Q0OA 6RNTA 3K3DA 5GL9A 3KN4A 3GDIA 3GMWA 1YJW3 4WYYA 1SKOA 1D6UA 1DGHA 5CHMA 1T19A 3O86A 4L15A 1XMOM 1IY0A 3MYTA 2OOBA 4G3WA 2L7IA 4FMCA 2GDNA 2MJ6A 2K9DA 1IELA 4Q0IA 3I553 1JTGA 2ML5A 1OHSA 2BIRA 3GQ3A 3DUKA 3S29A 2LHCA 1CYVA 2R4IA 1TD5A 1YGEA 1TH2A 2R46A 4S2IA 3T1YM 2QNJA 3AGNA 3IF6A 1K54C 3MMPA 1R4YA 3B8LA 1JBTA 3KYQA 3HLGA 4KUKA 1JB5A 2JN7A 5FEFA 4ARZA 1VEUB 4CLCB 2CG1A 4ZJ3A 3O3VA 2DWZB 4GB5A 3E2LA 1G96A 5JI3E 5IEOA 3LVWA 4F2LA 2PDRA 4OPQA 4RA7A 3SARA 2I9WA 1GSVA 2YX9A 4HY8A 1VDLA 2O9BA 3LCVB 4RX3A 1VEKA 4JPMA 2JY5A 2KAAA 3FRHA 1BSAA 2SARA 4PCZA 1SJWA 5DFLA 3EB8A 1ZGXA 3FUTA 1Q864 4NPBA 1UWNX 4MMYB 2WK0A 4E6XA 4KT0F 1MGWA 2P05A 2R41A 2EXAA 4ESPA 3BXWA 1G71A 4GRIA 1SXJE 1Q39A 3SASA 2F56A 4HBUA 2J7VA 5IS1A 1H0MA 5D83A 4B93A 4M0DA 1RN4A 1YNVX 2DWLA 3KOZE 4YINA 1Q40B 2DHYA 1UCJA 2V0UA 4L7KA 1HU9A 3DH2A 3U1WA 4IBXA 3ROBA 1JNUA 5H37D 3A46A 1JTDA 1K6RA 1STFI 1NZOA 5DFXA 3D3LA 2X01A 1Z5AA 3GPUA 3G6E3 4K61A 2Y8HA 3T8UA 4UAAA 2HGVA 2PBDP 4NKPA 5EM0A 5CTMA 3U6DA 3F9SA 1YJN3 1GHMA 3EOIA 1M904 4MEZA 3DFZA 2OCTA 1ACFA 5FL3A 1FCOA 1OHPA 5FQJA 1PJQA 2JY6B 4MNRA 4MBFA 3IXGA 4EC6A 4OOYA 4L8OA 2WADA 5EXXA 3CF6E 3W0LB 1XJ4A 4R71A 5E6JA 3GLIB 5EVIC 4STDA 1CQSA 1NSFA 2HMLB 1OJ5A 3UB1A 2W1TB 3OPLA 1O7PB 2DHRA 3BFCA 2BWBA 5AYSC 3I4YA 4DJ3A 5K5BA 2Y2QA 3KCHA 2XRXB 5AIHA 1XXHB 1W4NA 2ZL8A 5G2GA 4HH3A 5F5YA 3FTDA 3UMDA 2W2CA 1BYWA 2Z76A 3GTCA 3QYEA 3U60B 1EEJA 1WYBA 5JBSA 3UPNA 3SS3A 2VGLM 5DF9A 1NO1A 1K3XA 1UGIA 3MG3A 4FOFA 4H6JA 1TUHA 3KX0X 2RGHA 1Z09A 2F4VM 5A93A 2W3EA 3T8NA 4O0PA 3U4LP 2Z6BA 4CIZA 4R4KA 1DGBA 4GSPA 4BTXA 1OT9A 2BJVA 4DV1M 1K4EA 3A0SA 1G5UA 2H0YA 4LJ6A 2WKEA 4R23A 3S7NA 3IF6C 1JVJA 3NXJA 1S4SA 3ZG9B 2JXNA 3E98A 5MC7A 2CFGA 1ONGA 4X65M 3IS2B 1MY8A 4X1MA 3EGDC 4Y2FA 1W5ZA 3NC8A 1ISKA 3J2PB 4JI7M 4R9LA 3DXOA 1RU3A 3OW22 3GP1A 3CF2A 1YLYA 4NRWA 3J7Yd 5FTJA 4GMQA 3B42A 1UCKA 1IM2A 2CK3H 2Z8YM 4AQYM 1FUWA 5CGSA 1YLJA 5F6AA 1W01A 1F8NA 1Q3CA 4ORLA 2ZBBA 3FF0A 1BIRA 1PW8A 5ITYA 2O5RA 2FZ0A 2UV0E 2VGLS 4OONA 1S1YA 4WZ5A 2DWNA 1ONHA 3HUMA 1VQ43 3ZCZA 3CWFA 1L2CA 4UQIM 2H28A 3LTCA 4IUHA 4RF0A 5DF8A 2OV5A 4WEJA 2CG0A 4RNTA 1ZAEA 2D42A 1ES2A 1Z6FA 3I01M 3CCS3 4PHTA 4QPRA 1VZZA 4AKYA 2HPBA 2Z77A 2HV1A 3UL5A 1W8YA 4ETZA 4XM4A 2XQZA 4EXRA 4FWGA 5A92A 1QVG2 1XFNA 1OIZA 4EEPA 3SAUA 3CPTA 4GDNA 2BO9B 3FTCA 3KSXA 2Q07A 5DFYA 3M2KA 4M3KA 1BTLA 4S2JA 5L8MA 2RGOA 3LCUA 3D8LA 1E94E 5DVAA 1A0KA 1O07A 5KO3A 3I563 2IWCA 3SH9A 1HT1E 2QWSA 1N9JA 1W6CA 1OAIA 2ZL1A 1F2KA 3CCJ3 3FZCA 4KODA 5LBRA 3GRRA 4KT3B 5KP3A 3TPZA 2EX8A 4WEKA 1D6ZA 1LOXA 1OTIA 2RCXA 3EN8A 4YY3M 3JVUA 1AQZA 1K25A 4N1XA 3DTIA 5EJCA 5BVBA 3CCM3 3IHAA 4YNRA 2QHKA 5AQBA 2F5MA 5G1LA 1MXOA 2DAEA 3N8LA 3VFFA 4GC5A 3Q3FA 1KGEA 1GMRA 1PJTA 1DJAA 2OQ4A 2CFWA 3WOFB 4JF8A 2FE8A 5GHZA 3LTAA 1FUSA 4O3VA 4FUWA 3IG8A 4LGWA 3WA3A 3S1YA 2W3FA 4ZPXA 1W5DA 2PRFA 1L3LA 3GO8A 1P0ZA 1N8R4 3UB5P 4DMZA 3LEQA 5FTMA 1DETA 1OPXA 2Y2IA 1EG9B 3H4MA 1UDII 3GAXA 3HZJA 3LR3A 2Y2GA 2NUPC 4NXMM 2VZWA 1PU4A 1YSQA 3GZYB 5DTSA 2KW0A 5E2FA 3HX3A 5GLCA 5A2QS 2QSFX 4Y0TA 1Q2PA 2R9WA 4P16A 4YHHM 4S2NA 4WZ4A 2BMOB 2RFRA 5ELUA 1TR8A 4WZ5C 4RNZA 1CEWI 1RP5A 4EIWA 2C11A 1YLTA 3VFHA 4E3OA 1AY7A 3UK6A 3J80S 3KXEC 1IQXA 1R6BX 5GHYA 2IUJA 4OVZA 4DUYM 3BW6A 3O87A 3UDXA 1E9RA 3FH1A 1PWCA 1BNRA 3UZUA 2WGVA 3OC2A 3DGMA 3W0FA 3CC43 3PCSA 3KSHA 4UA6A 5CX7A 3SEDA 3UDIA 4L9GA 4WBGA 4E04A 3JUOA 3IXHA 1V33A 1CI8A 4YWZA 1G6AA 1L0EA 1QQWA 3IXDA 3IX8A 4JKTA 1KYIA 2BNGA 4GHOA 3K5TA 3V99A 4I3AA 4N3VA 4PM8A 1GHPA 1H8MA 2KEBA 1DJCA 2Z2LB 3F1NB 3SAWA 4QY5A 1NB5I 1VQ1A 1QVRA 3K9MC 4DUZM 4HM6B 4MM3B 1GVNA 2I9VA 2K3DA 3DA1A 3IX4A 1WA9A 2ZQ8A 3UGJA 2M1CA 4IPBA 1SKFA 2FNQA 2B95A 3GRJA 3HX8A 1WXQA 5G1KA 4QWOA 1YQSA 2FS1A 3K63A 1XKZA 2J3WA 2ZLYA 4Y7PA 3WS1A 1S4RA 3Q8GA 3GLGB 1PRQA 2DXIA 3R4KA 4WUJA 4QB8A 1UI8A 1UWPX 3EC9A 1N9BA 4K08A 1JB4A 3WS4A 3KSFA 3S22A 1HNZM 3QP2A 1IXSB 1O7WB 2Z6DA 2PT7A 3MQ0A 2XSZD 2GX5A 3LYXA 4NC6A 2YFJB 3V39A 4LJ9A 2G7UA 3G0KA 1IQ8A 4L9EA 2A3UA 4IIAA 3H82B 4N1HA 2ZA4A 4BL3A 2Y2LA 1BZAA 2WOFA 4I3IA 4NG2A 1YAXA 2XGNA 4J5KA 4EXOA 3PBSA 1ESIA 2JP7A 1ZX2A 2CWUA 2W04A 2PR6A 4G4NA 3ICYA 7CATA 1W6YA 4KFEA 1PI5A 4L8RC 2DI0A 3B4OA 1P3QQ 5CHJA 4KZ3A 4CLCC 2EA9A 1ES3A 2DWMA 1XA1A 4HAAA 1K56D 1DP8A 4FCVA 5IG0A 5TGFA 4BBUA 4HVNA 5HWTA 1FGMA 4B3SM 3TDGA 3MSHA 3DMCA 5DF7A 3W4PA 5D82A 2V0WA 4DE3A 4JF4A 4DR1M 3BOSA 4IJGA 4RBNA 4JF5A 5HL6A 4OK0A 4WYKB 4S2NC 3HIGA 2VQFM 2Y20A 4GZBA 5AVFA 5EQLA 2R62A 4HOIA 1CEFA 4I38A 3M0EA 4CPKA 3MK6A 4HKVB 5FDHA 5CLKA 4PMAA 1PFLA 3HLBA 4B4XA 2WAEA 5IF6A 4IBBA 4LZZA 3PNVA 3UB8A 2C4BA 3TE6A 3MXQA 2Y4AA 2O0YA 4KHPM 3URPA 4ZDXA 1SIHA 3ZFZA 1PNEA 1W63M 3LO7A 1G4AE 2Z3XA 2UXDM 4HHDA 4MMNA 3L25A 3E4QA 3Q2PA 4F1IA 3F8HA 1BAOA 3LXUX 3F1PA 4X6TA 3U2AA 4OP8A 3IT9A 3N4IA 2DAKA 3EBTA 3K1JA 1OTRA 4NL4H 3IJEB 1FJGM 1JR3E 2OTL3 1QAMA 4R3BA 2WUQA 2XROA 4H8RA 3EIEA 1CK3A 1RGFA 2L4RA 5EP1A 1X1UA 1ROAA 3DGYA 1IVUA 1VHMA 4OQ0A 2QQ8A 2ZAMA 1GD4A 5CRFA 3T4TA 2HHHM 1ZHHB 1NY0A 1I94M 5J8XA 3K2NA 2BMQB 3ITBA 5IERA 1GJTA 1WYCA 1STDA 1BLCA 3ZDJA 5CXOA 2LHGA 3E9SA 1YIT3 3FUVA 3BFFA 3GLFE 4ZRRA 1RGCA 1RN1A 5FGOA 4KENB 1I4WA 4CISA 1JRQA 1QAQA 4N6MA 1EWZA 2YKFA 3MJQA 1OCVA 1YGWA 3OV4A 3WRTA 1N75A 3SYKA 2VK3A 5EV0A 2ML6A 3NDEA 3RGPA 1PYYA 1H8ZA 2JZ1A 3VKGA 1HZ1A 2GU3A 4B7GA 1AIPC 1IT7A 2EX9A 2QJ7A 5TJJA 1OPYA 2GEYA 3OCNA 1J2BA 1O7NB 3LIAA 4LFBM 5ITXE 5TGNA 5IU1A 3C7UA 3LOYA 2V20A 4Y28F 1BNEA 5C5KA 2R18A 4WP5A 4YFMA 2C6WB 1RGYA 1R2ZA 1I5QA 1P9RA 1IK3A 4FCTA 4KG5A 1LNIA 3KP1E 1SXJA 3BY8A 1FR1A 3STDA 1TS7A 3NUVA 1GA9A 3VDPA 2A5YB 1T2IA 1BVIA 1RGGA 1TU5A 3CMA3 2EX2A 4KQDA 2IWDA 2L4EA 3LH4A 2A2LA 3FLJA 2WSFF 4DR5M 3WHLA 2KNAA 1OGXA 3ZC7B 4CLCE 1LSVA 3JPUA 1NWZA 4IVKA 4MH0E 3H7WB 3GPYA 1BUJA 4C6YA 3KOXE 2JKTM 4HESA 5FTKA 4MN5A 4S2PA 4LRTA 2ZOHA 4FR9A 1TF1A 1IVWA 3WS0A 1FW7A 2J7NA 1VETA 1A2PA 3PCRA 2HDRA 3U5ZB 2GXFA 3HKPA 3UMMA 3Q90A 2KNVA 1M1K4 1CF0A 4JI2M 3G4PA 3L28A 4CDLA 3N6IA 3UB7A 3HOHA 3HJQA 1IYYA 1L2BA 1VQL3 3ZH9B 2G8LA 3GLHB 1QYRA 4LCBA 1JKGB 1QJGA 3L27A 1EA2A 5IEPA 1E3RA 4DF6A 1O7EA 2HMKB 3SHFA 2PNCA 3LFVA 2K0MA 4X2OA 2DZOB 4JI6M 3HK4A 3FUUA 4NXFA 1DMNA 3G35A 3W2ZA 4NXEA 4MGYE 1W79A 5AVEA 1QAKA 3HU2A 3U6LA 4X66M 3V98A 3G713 1WE4A 1I3FA 1LI9A 3NWLA 3SMPA 3CGWA 3NECA 1W5TA 2VV6A 3LYGA 3MQOA 4JF6A 3RFBA 5EXTA 1LTMA 2CHGA 3MXSA 5HL1A 1AVKA 4LPZA 1XPBA 1FCMA 1XP4A 3PYPA 4GCZA 2XSHB 4GL6A 4XT2B 3C58A 3GLIE 1YJ93 1LL8A 2Y0QA 3CU3A 2HJEA 4QU3A 3VP0A 1NVMA 1VDDA 1L2DA 3KS8A 3A45A 1KWIA 2C10A 4OOMA 1TTEA 1T3BA 1U60A 5L07A 2UXBM 1W02A 1XXHE 3LTDA 1KVLA 3BBZA 1B2MA 4HP9A 4K91A 3T1QB 4DR6M 2O9CA 4N6UA 2X71A 2O9UX 1QANA 4IVIA 3A42A 4S12A 1GSWA 3AMOA 1XXMA 3IHBA 4S2MA 4DXCA 3HHZA 2R44A 4Q7JA 5IT9S 2Z4RA 1LI0A 3KVWA 4PD2A 1VQ83 5AEWB 3PGBA 3A5EA 2Z4SA 2JA2A 2CW9A 3VGNA 3MXRA 3LR5A 4NREA 2EO2A 1TP6A 1N78A 3DBAA 4EWFA 4Z1WA 2VV8A 5ITRA 4DE1A 1IBMM 3G16A 4K1UA 5IG3A 1MJGM 3SZTA 3SATA 1K4FA 1W6GA 3QNCA 3RFWA 4KQQA 2F5QA 4X62M 2KZSA 2CFKA 3PBRA 2KF6A 2VEAA 4BU4A 3BFGA 3CITA 5HSQA 2EWWA 3CTWB 2P74A 3Q82A 3FG3A 3UDFA 4JXWA 4L8PA 3V5MA 1JZOA 2C98A 1IQPA 2FFYA 2LVPC 1KFVA 2OOVC 1IVVA 3KS4A 2E8IA 3UPPA 3I7JA 4OW0A 3KSPA 3E2KA 1BRIA 2E2UA 2K7SA 1KC84 4B4ZA 2PR5A 4P87A 5A8BA 1KSFX 3IBJA 3PTEA 4WL9A 4JGRA 3ZYTA 3HU1A 2HAKA 3RJUA 5BPVA 8CHOA 3SOIA 4DE2A 2LNHC 4JI3M 5IHVA 3G6OA 5FQ9A 4OOLA 2ZM2A 3NQYA 4G1MB 4KZ5A 2Y0TA 5ITQA 2V1LA 3VP4A 2H0GA 1TEMA 5TBMB 2F98A 1IN7A 1NHGC 3EIHA 4FW9A 5LMNM 3BB9A 4J9AA 4BL2A 4KFFA 3DWKA 3CCV3 2G3QA 3T1HM 1I2EA 5EVIA 1FGRA 4ZBEA 3IXBA 2WKIA 2WZXA 5FTLA 4DR3M 3N7WA 2AHMA 3H9WA 1DO0A 3LCEA 1YLPA 4MBHA 4QNMA 1K55A 4FMAA 4OUQA 4F3LA 1NNVA 1G68A 1DE3A 4P17A 4FCZA 3HLWA 3P7NA 4PPRA 1GMPA 1NZUA 2YFQA 1Q7Y4 1K38A 2Q9NA 1MX0A 4GS9B 4JI4M 4B88A 4BD1A 3SMSA 3MS6A 2C99A 1T18A 1MC0A 4C75A 1LQMB 1D0KA 3RH8B 1XB2B 2B3TA 4RX2A 2Y2MA 3BFDA 2X49A 4Y3IA 1SARA 1GY6A 1NJI4 5HGRA 4WMCD 1I2GA 5KSHA 1E3UD 2YFLB 4M9XA 3HREA 6STDA 3T6PA 4Y0UA 4DV7M 1GJSA 1NU3A 2RRUA 4KG2A 2V1ZA 2OPFA 4KZ4A 3W68A 1L0DA 1BUEA 1N4OA 2CKFB 3LW5F 1EKMA 1IYSA 3FG1A 3FKEA 1IYOA 1RKYA 1FUTA 4AKZA 1BUQA 3BWLA 4HP4A 4MB7A 4HYZA 4JRFA 5M18A 1TRQA 3LIBA 5DKKA 2ZM8A 2FOIC 3FKVA 3G32A 3IH9A 4PKYA 5FQQA 3VV4A 5EXPA 3SVAA 1VEJA 3B7ZA 3EHCA 1OAOC 4GITA 2XF3A 2WOHA 1R2YA 2D1WA 1OH0A 3HWSA 5M1AA 4NXNM 1YLZA 4EESA 2GU1A 2DZNB 3F1OA 2H1RA 1V9YA 3OTOM 3K92A 3QYBA 2BWEA 1NRJA 5CGWA 2F5OA 2VGKA 3FD9A 2HMJB 5EVHA 3PXGA 3TQSA 3AKZA 2BT3A 5HPFA 1ZG6A 3LUQA 2XZUA 4O01A 2XSSA 3C4PA 1FCNA 3JVCA 2K0BX 1I2SA 3OOVA 5HOHA 2MC8A 1ZMVA 1T43A 3WHKA 1NYMA 1YUBA 2EWVA 4IUKA 1LNHA 4Z8XA 3AFHA 1XMQM 5EQTA 1UCIA 2GBWB 1VQQA 2PD7A 3DY5A 4BBVA 4I39A 1RGLA 1E25A 4S2KA 8CATA 2W82A 3ZG8B 1SCWA 1K82A 3HJSA 2WGOA 2ZQDA 3A3JA 2JDIH 5DTTA 2QIYA 2F5NA 4KZ1A 2W9PA 2LTUA 2V1BA 3FTEA 4UHUA 3EF8A 4HBRA 2FFJA 4R7GA 2Y59A 3OPRA 1WR1B 1IQYA 1K55C 2WGQA 1YMXA 1P97A 2M7UA 1IT8A 2HP9A 2KLIA 3NY4A 4K0WA 4X56A 2XLNA 4O7DA 3ILKA 4PDIA 1JWPA 3E4OA 3X41A 2MH8A 4H3UA 2VLGA 1G0TA 1V58A 4EBLA 1KE0A 1C1KA 3EJVA 5G18A 1FSYA 1K3WA 1MBLA 1N9NA 3C5AA 5D81A 1SIIA 4IBRA 3T1RA 1ES4A 3V3SA 2FXTA 3HHWA 1K41A 2A24B 1LOYA 5ELJA 2BG1A 2VF7A 2JHEA 2W0NA 4PM6A 1DV0A 1PJIA 1W7CA 3CPW2 1NNJA 2F86B 3ZG7B 4DE0A 1HYFA 3GSGA 4XBTA 3ULFA 3VP3A 1IN6A 1MN3A 4W5WA 4LMIA 4JI5M 2QENA 1K28A 2ZANA 4LJ5A 4H61A 3NJAA 4CGYB 2O01F 2XFTA 3GR2A 1ULJB 5DRVA 4L78A 1SXJD 1ZV1A 4JV5M 1K6SA 3LIEA 1TDGA 4M9ZA 3HJKA 4DBGB 3N9HA 1W63Q 2PBYA 3X3YA 4EERA 4I8OA 5DYGA 3U61B 1IBLM 1M6KA 2J8YA 3NDGA 2GZAA 1MKIA 1R7RA 1FGTA 1RGKA 1M40A 3V67A 4NRVA 2F4YA 3BLSA 1JR3A 1OF5B 2IMJA 3HLFA 2MJ5B 2V8FA 1IEMA 2BJWA 4X2HA 4JXSA 3FUWA 3MBZA 5DYIA 2WKHA 2BASA 4OPRA 3MZFA 1ZMWA 4O8GA 1TVFA 2HL7A 4QHCA 5KQ8A 4B3RM 1WMPA 2FFFB 5FAQA 2GNOA 2LVOC 1R4CA 1LL9A 1QMFA 3J7BA 1QZEA 4GNUA 4IBFA 4Q8IA 1NDOB 4Y13A 3W8KA 1YSYA 2RKOA 1DGGA 3GLFA 2Y91A 4LFCM 3N8BA 3JAMS 2QGUA 3UL6A 1U8CB 3T0UA 5FI7A 1C54A 4GHIA 4RNYA 4ILFA 2LB9A 5STDA 2D7GA 5EVLA 2W3DA 1B21A 1TH4A 2KNZA 3MG2A 2R4EA 1F98A 4R9KA 3PYJA 2X4AA 4J8TA 1GL7A 2OWJA 1VQ53 1PM5A 4G3VA 5GLBA 1VEGA 3PNYA 3DTKA 1OUNA 3LTBA 1IFQA 4KZ8A 3L2AA 3M7GA 4L9FA 4EETB 4HEFA 5KSCA 4MLLA 4MMZB 2WKPA 3BQAA 4UQIS 4IBCA 2H0IA 5ITXA 3Q07A 5FI2A 1OTEA 3G34A 3TL4X 1ERQA 3BY9A 4GJ4A 2LYXA 3BJNA 1MGRA 1GMQA 2HZ5A 1KE4A 5DTKA 2HMOB 3SHGB 2CE7A 3SW1A 3KFUG 2B5RA 4LFAM 2Y79A 2D01A 3T38A 3Q7VB 5FW5A 2QJ5A 1STZA 4G3KA 2V1UA 4IJFA 4GDBA 3VDUA 4II7A 4G4OA 2DKLA 3B89A 3PBTA 4ZJ2A 3FG8A 1VEUA 4CLCA 1EIJA 3JR5A 2HMMB 4GB7A 1UUGB 4MGHA 1S67L 2H5XA 1YI23 4AKGA 1HQYE 1YE9A 3IH8A 4BLMA 4M9SA 4I3JA 2CHCA 5DJTA 3LQQA 3B7QA 5CK6A 1RLSA 5U47A 2L6OA 2VX8A 1L2SA 1FYSA 2B1XB 4FMDA 3D4FA 3HVFA 1PY3A 4GC9A 2R9XA 2QZ4A 4X69A 1RN7A 3MG1A 3O8YA 4PEJA 2KOIA 5AEUB 3BYDA 1LSXA 4B9OA 4AW4A 1BRKA 4AEQA 3LIFA 1NWWA 4XBOA 5KP1A 1N9LA 1LHYA 2DENA 1G41A 2ZMAA 4HQAA 1DYUA 1I70A 1Q3BA 4JXVA 4GKUA 2CWTA 3M6HA 1L5GB 1Q40A 2J9OA 2KF3A 2JUJA 2P38A 4B3MM 2P9VB 3EQVA 4KO8A 2E2TA 3J81S 1QAOA 2OLVA 1OQYA 7STDA 2QKPA 4TX4A 4XDVA 4ETXA 3W4QA 1GOYA 2ZQAA 2QHOB 4HJ3A 1E9SA 2F99A 3E0YA 3X3XA 2W56B 1YM1A 4XB5A 3E99A 3B9PA 4KUOA 1NY5A 4HM5B 3C7VA 2LH0A 4JI1M 1I0XA 3ZGAB 1RCLA 2RSXA 2ZTCA 2RBIA 3BU4A 2ZTDA 1BRHA 1SG9A 5EXSA 2W3HA 4X64M 3ZCBB 3GLIA 1BLPA 1GOUA 1VQ93 2CWVA 4JGPA 3FYZA 3GLHE 2W1TA 4L0LA 3VMAA 2UUBM 5LC6A 4ITQA 5EVID 1N77A 2WZZA 4LRSA 4CJ6A 2ZAOA 3GZBA 5HAPA 3EN1B 2KZUA 2D7EA 1XXHA 4M4XA 3X3ZA 1P9WA 3QP4A 3F8XA 4LF7M 1BULA 3T12B 1FZUA 3FKAA 2WGWB 2MR9A 4O2HA 4NSOB 1TS8A 3A3FA 4MMXB 3U60A 2XGLA 3LZAA 1CH0A 1S66L 3HHXA 1L1TA 3PXMA 1E3VA 4BIRA 3MPHA 1YLAA 3G4S3 3Q1CA 5E43A 5GSPA 2F5PA 1BLHA 1D06A 4X55A 1B2XA 4I5QA 5CHUA 4KZ9A 9RNTA 2PAVP 5LC7A 2UUGC 1I2FA 1W5SA 1L1ZA 3FUXA 4LV2A 3D5GA 3W4OA 4WWUC 5F3WA 1BNJA 1T1BA 3A3IA 3B74A 4I4KA 5AQ7A 3VP2A 1JJ22 1QMEA 1IN8A 3AGEA 1EE8A 4WLAA 1XNQM 3A3EA 1JN5B 4XDWA 5J7EA 1VM1A 4FVMA 3IS2A 5CERA 3KYEA 3UPOA 1OKSA 1TFKA 2HDQA 5IT5A 3DGNA 2J3TC 2HP5A 4CQHA 4RYEA 1JWZA 4DV6M 2HDUA 1CQAA 5TFQA 5A91A 5IWAM 2Z7AA 2Z7JA 1FQGA 4E3KA 4N6TA 4N6OB 3T4QA 3N8RA 3J27B 4FTXA 1J5EM 1GABA 2FNAA 1EW0A 2GBXB 1BOXA 3IWOA 1ZQ9A 4BWIA 4EV4A 3AGFA 3I4VA 4LJAA 4DDYA 1YVBI 3M2JA 3T15A 1IYPA 3B33A 3S27A 1PYLA 2Y2PA 3IMAB 3WRZA 1TDLA 3LGOA 4QOZC 4N9LA 3NV0B 2VV7A 2QBYB 1V9ZA 1W2B2 4HL4A 4N6LA 4M0WA 3L26A 2OAQ1 3TSGA 5FAPA 3K8ZA 4IJEA 1RTUA 2KDKA 5G4ZA 4FCFA 5C1BA 4AI6A 1EUIC 1VQ73 3FZWA 1IV9A 1GKIA 1LRAA 3HI7A 1BVSA 4Y17A 5ITTA 1XWIA 3GQZA 2LQVA 2PYRA 3M8CA 2QMIA 4XGIA 2JKTI 2K2NA 3VSLA 1XJ6A 4MGZE 3QP6A 1PWGA 5FAOA 2DAMA 3LI9A 2CC3A 3UNWA 3A76A 3GV9A 1L0FA 2VQEM 1MWSA 1ORYB 1J3WA 4KQRA 3GRUA 1EQKA 2Y74A 2Z6CA 1C7YA 1XC8A 1MOLA 1AWIA 4ME4A 4EV2A 2CEAA 1RDSA 3GPPA 3B4PA 1BRJA 3AOGA 1IY2A 1Y8GA 3GQ4A 3ISGA 2XFSA 5I5LA 4KZ6A 5F68A 5HDSA 3J7AS 4DR4M 5F1GA 2EXBA 2IWBA 4BQMA 1K57A 4R38A 4XBXA 4FD8A 2W6JH 3IECA 3FF2A 1DP9A 1Q42A 3KYZA 1NJFA 3IQAA 2ZC3B 4DKIA 1ZC2A 3SFZA 3NQZA 4G3OA 1OT6A 1PZPA 4OLDA 4B7HA 3EEAA 4MGKE 3JUPA 2IA7A 1MKMA 5F1FA 3E21A 1AR0A 2L1SA 4LF6M 2ZQ9A 4RF1A 1L0GA 4LEHA 3HHYA 1OMEA 1SKOB 1DGHB 4NSRA 4EW5A 2JNHA 3MKIA 3F40A 3VSYA 3PBOA 4HOHA 3ZVWA 3NBXX 1BNGA 1ERMA 1FR6A 2W27A 5EP3A 3N8SA 4AFIA 4GD8A 4E3IA 5DKLA 4PM7A 4OH0A 2UUAM 5EPHA 4G4QA 2UUCM 3VFDA 2J80A 1BSBA 3NHQA 3FC7A 2HOHA 2CV0A 1DY6A 3QAUA 2GJ3A 3NM2A 4QOSA 4EU0A 2OAP1 5F69A 3VP1A 4OVMA 1W8QA 2JQ5A 1PWDA 1TDHA 3S67A 5E26A 4R6LA 1GA0A 2YNMD 1RRHA 1QVF2 5AIFA 2VDBB 4OQIA 5A0OB 4YOFA 4LF5M 1ZTUA 2WSEF 3JVVA 3T1XA 2R6FA 2L4VA 2OOVA 1D7EA 6GSPA 1DO2A 1K9M4 4F94A 4BBTA 4K0KM 4BENA 1JR3D 2OWPA 3SOAA 1DP6A 3BNEA 1VB6A 4Y15A 4JI0M 1S5AA 2ZHXB 7RNTA 4EQIA 2HWJA 3QK9A 4GKJM 2V6ZM 5CF1A 5HW3A 3KW6A 1UCLA 3MSOA 4D2OA 3G2ZA 3QP8A 1PRBA 4GH9A 2BLSA 4R4RA 1VQN3 1N9OA 4OQHA 5BIRA 4BD0A 2K6BA 4HH2A 3F1NA 3EGXC 3TW8A 4R1KA 2LXEA 1DVDA 1VG5A 1ZG4A 1YPRA 1RRLA 3U6QA 1HD8A 1W2ZA 1E32A 2OLUA 1N5HA 3C3EA 2CX1A 2DNSA 1HLUP 4WHAA 3IWQA 3OPHA 3CXC2 3SX1A 1ES5A 3GRVA 3GLGA 1K57C 5HFOA 1AUAA 3WOEB 4LYLB 4IBIA 3WDGB 2L09A 1IXSA 4A3VB 1RCKA 3HZPA 4XUZA 4HI4A 3FV7A 4Z6YA 3FTFA 4KZAA 3K0ZA 5FLXS 1KD14 2KXEA 1CEGA 1XGJA 3NOTC 2GSPA 4NEED 4P6ZM 2CHQA 1D6YA 4HJ4A 5BOHA 1I0VA 2F5SA 3FWLA 4LLOB 1GHIA 3H82A 3MFXA 2K31A 4GN2A 4AG6A 1X37A 1Z1SA 2ZJ9A 3BLMA 3D8BA 1D0MA 1NB3I 4LENA 1MZUA 1J09A 2NQ8C 1YVSA 5FQIA 1Z6TA 3UE1A 3UY6A 5AIIA 3DTMA 3KSGA 4FMBA 4HM7B 3WR2A 1KDWA 1AXBA 4H6JB 1D0LA 4CLCD 1O7HB 5HAQA 1JB0F 3X40A 1RSNA
chains in the Genus database with same CATH topology
4NOOB 4LV1A 3QHYA 3R9XB 3HL9A 1PZOA 1C7HA 4WYKA 5FQMA 2E5LM 1ASKA 3LVVA 1VQO3 4IBDA 1ULIB 1GY5A 2H10A 3SS5A 4QY6A 2V2FF 1DMQA 3GWRA 1IBKM 3NV0A 5LMUM 1D2NA 2Y2HA 3HUOA 5KPTA 2R45A 4PM5A 5KPZA 3LT9A 4GIPA 1WMNA 1OFIA 3OWYA 3U6PA 1FNNA 3KOWE 1JB2A 2EX6A 1LXEA 1YHQ3 1KGFA 4D80A 3HLEA 1L8QA 3KE7A 2P09A 3CNXA 4ZM8A 3DZLA 3VK8A 2MF7A 4QWTA 1M1XB 2QZ6A 3Q81A 1T3TA 1I2WA 3JUMA 1SDEA 4IBEA 4FWDA 2ZM6M 2WGIA 4ZAMA 4DR2M 1TDZA 4U13A 4C3QA 2KCDA 1VQK3 3PAGA 3FYCA 1S0WA 3MJ5A 4AKIA 1IU7A 2ZD8A 2B24B 2Y2OA 3NI9A 3PAEA 1DJBA 3DM8A 4KFDA 4QHSA 3THGA 2YFIB 3CCR3 2E2VA 5EUAA 4U0TA 3A3DA 3ZG0A 1H6UA 3LY4A 3S4XA 3U6OA 4RVAA 3SH8A 5I97A 2X02A 2XD5A 1YMSA 1Y4KA 2XR0A 4KZBA 1C3BA 3VKHA 1GYBA 3LMLA 2X8AA 5JPUA 1YT4A 5IENA 3SLUA 2RL3A 4HM1B 2CIUA 2C5RA 2XSZA 1YIJ3 4OPYA 4EUZA 5CEDA 1LV7A 3F7SA 3GRYA 3RXXA 4HZBB 1LVNA 4ZTKA 1JV2B 2Y2JA 3TWKA 2DRWA 4R4SA 3UE0A 1EI5A 4Y0OA 4IIWA 2WO0A 2V1CA 3NCKA 5EP4A 2STDA 1FGOA 4UA9A 4OQGA 3SH7A 3NHXA 3AOEC 1K56A 4FWHA 2Y55A 3NBBA 2H0TA 3RGAA 3CD63 5IG5A 5JPPA 5IG4A 4HBTA 4JN6A 3U5ZA 4G6ZA 3X42A 3F7XA 3FGYA 1MWRA 2G5GX 2L7HA 5M19A 1IYQA 2QPAA 3JUNA 3ZVTA 3ALAA 3MWZA 3GLHA 1JKGA 4CCVA 3SAVA 2XLJA 1ALQA 2HMNB 4AG5A 1WQLB 2EUCA 2FGTA 4JI8M 2GEXA 4GKKM 1E4DA 4P0MA 1GY7A 4XXRA 4OVZB 5AIGA 1FGQA 2Y2KA 3N54B 1NY6A 3UN7A 2Q9MA 1CI9A 4LV3A 3DGLA 4DXBA 4O02B 3BNBA 5FSWA 2JC7A 3C4OA 3I0YA 5CTNA 4R80A 5A90A 2P0XA 4JLFA 3BLZA 1Q2QA 3OCLA 1O7GB 2W0QA 4MJDA 3UE3A 3S5CA 4HZ9B 2ZC7A 3UJMA 3U6SA 4QJGA 1Y54A 5EOOA 3K7CA 3VSKA 3RGSA 3EBYA 1DVCA 1IDPA 4LF4M 3U97A 4LJ4A 2ZM0A 3WWXA 3VF1A 2Y73A 1UW1A 2Y2NA 3GQ5A 2BMRB 2OSUA 3EQQB 4DV5M 5FQKA 3ER7A 5GKNA 3DOAA 2RCDA 4AZFA 2DCFA 2K47A 2YQZA 2VIIA 4DV0M 1SDNA 1XHBA 4WURA 4BTYA 1TH3A 3IG5A 4FH2A 4LF8M 2ZC5B 1QZMA 3E4RA 1Q814 4IT7A 4FH4A 3EX9A 4K0XA 4N6NB 2VGJA 2BHMA 1XNRM 2H5SA 3CCE3 4FCWA 3PBQA 4EBGA 4EV5A 4KG6A 1QMAA 3VOYA 3LEZA 2BNKA 3HJ8A 2P0MA 1IVXA 3WS2A 3IPTA 4EBPA 1S723 1MWUA 1KQS2 5DNYA 3BEBA 2JE5A 5CGXA 1S3SA 3KIIA 1KDSA 3CMZA 1FA3A 3NM7A 1PFPA 3LMMA 1N36M 1J7KA 2WAFA 2SBLA 3NBJA 3OWSA 2HCBA 4B08A 5FI6A 4JYAM 3QNBA 1IN5A 3CC73 2OQEA 3GPXA 2I72A 3PZWA 3DZDA 3RE8A 2I7PA 3EE1A 4LV0A 4JXGA 3ZNTA 4WFOA 2ZQCA 4FCMA 1TIJA 4RNAA 1A67A 3OZHA 1SHVA 4HM4B 2KRUA 1RGZA 3ZNYA 2KRTA 4OP5A 4X68A 5KZHA 3Q8XA 3ECFA 1M9GA 4JBFA 4JXJA 4LJ7A 3QWLA 5EE8A 2G2WA 3NBLA 4FD2A 2QEX3 4LCMA 4EBNA 4FCJA 1PI4A 2JCHA 4ZJ1A 1W7FA 3GZXB 4DV2M 3CCU3 3QRDA 3DGOA 4G4RA 1GCEA 2RGQA 3IF5A 3AJIB 2QCUA 4LSOA 1K8A4 4E3NA 4KZ7A 2M60A 1GD3A 2ZDJA 4QD4A 1NYYA 3MFDA 1A2KA 5IREB 1H8YA 2G2UA 3JUQA 5KMWA 5AYRB 1N34M 2OTJ3 1OJLA 1HNXM 1SXJB 1N8QA 1Q824 1J9MA 1HTZA 3RDEA 3D9RA 3SBJA 3SC3A 3L29A 4GHLA 5EP2A 5JYOA 2XH9A 5FTNA 3PS8A 4S2LA 1U5OA 4P85A 2J7OA 3SOYA 2K54A 4OKPA 1NRFA 3G8ZA 3S28A 2INXA 1IY1A 5GLDA 4E3JA 4DRTA 4GD6A 2HDSA 1WNHA 3RXWA 2D7HA 5FSRA 4REZA 3BNCA 2C96A 2OQEC 4X53A 1SQWA 4OPZA 2R65A 1OFHA 4TUWA 4EYCA 4OLGA 3EQUA 4D82A 2R4JA 2J9PA 3TWLA 1UI7A 3HGIA 3MZEA 4IBGA 5FA7A 3MHEA 3Q7ZA 2C9CA 1YLWA 2I7NA 1JNQA 1KGGA 4WW0A 4GOGA 2W9QA 1BSGA 4HLQA 4DV3M 1IN4A 5HX9A 5IW9A 3MKFA 5HAIA 4LJ8A 1N33M 3B3XA 1UUWB 1OACA 5D3OA 1CYUA 3L0RA 1KSIA 3WMDA 4DDSA 1G59A 4WMCA 3V3RA 1E3UA 1IKGA 3HLDA 3H3HA 4U0XA 5E2GA 2JBFA 4LGQA 3VLFB 4I81A 1AVLA 3FKWA 3HUNA 3LT8A 3VK7A 5E2HA 5C18A 1FSWA 1TFOA 3MHVC 3U61A 3R8FA 2UXCM 2YR0A 2M7OA 3AMOB 1PJJA 1MNLA 1T5YA 3TG9A 4PDGA 4E3MA 1XX2A 1G3IA 1NNUC 4R0QA 3NX0A 1FOFA 1HZOA 2PU2A 3P98A 1OF5A 2EFXA 3WODG 4U3TA 1XA7A 4IEDA 5EEOA 4OVDA 3BFEA 1LL5A 5EOEA 4QNRA 2CUZA 5CF2A 2ZC4B 1UM8A 1HQCA 4HM0B 4CJNA 3KSJA 3CNMA 1HT2E 1Z5BA 4E3LA 1VQP3 2Z2MB 5DREA 1Z5CA 1IV7A 3WA2X 2KRKA 3BM6A 4MEIA 3OPPA 5ITUA 4ID4A 4LGMA 1G8PA 5FATA 3PBNA 1K734 2XK1A 3G31A 5CEBA 2HP6A 4FSFA 1EROA 3KFQC 5TR7A 1VQM3 1WTHA 2QPNA 2LWXA 2CFDA 5EVIB 3CF0A 4LZIA 4BTWA 2A49A 4IBKA 2XEPA 2ERCA 3F14A 3Q7VA 2XSOB 1N9EA 3CCQ3 3M6BA 3CPOA 4BBAA 1N5PA 4K1VA 1BT5A 5F83A 3NBRA 5AQAA 1ZO2A 3CME3 3FSDA 5I94A 4UA7A 3CJMA 4HM2B 4N6V0 3BNDA 4RZMA 3ZG5A 1RCJA 1UUVB 3NBIA 3GRDA 1NXYA 1BLSA 1V74A 2QA43 4I5SA 3CCL3 1HVBA 3K2LA 4LY6A 3UNLA 1Z59A 4KLNA 2KA6B 4AKHA 3IF6B 5CECA 3V50A 5JYPA 3KSED 4OX9M 1ESUA 3JR4A 4N92A 2CV1A 1KVMA 2PU4A 1NO3A 2M5ZA 1E97A 2A15A 4WELA 1KE3A 3O88A 1NJGA 3U6EA 4LG2A 1XGIA 3GVBA 3LY3A 1IKIA 3PFIA 3U6MA 2P9VA 3KKGA 1A2VA 2UWXA 3PVSA 3CC23 3SS4A 3SXXA 3DW0A 2C5WB 4BLCA 2W56A 3KOYE 1TGUA 4B3TM 3FG4A 2C9OA 2Y21A 1GS3A 4HM8B 1NJ4A 2XR8B 1QAFA 3ZHHA 4I4LA 4Z9QA 4LGYA 1AV4A 3HU3A 2QP9X 4BJPA 4NK3A 4QHTA 3AV0A 2UU9M 4XBYA 4B7FA 2WGWA 1ROVA 4PT5A 3M6AA 4GHAA 4CHTB 4LCLA 1N32M 1US1A 3H51A 1GLNA 1W00A 3RGRA 4LF9M 2ZQ7A 2W03A 4HM3B 4KVHA 4OU7A 1OGZA 4MBKA 3UO9A 1H5XA 4DR7M 3BRMA 4XUXA 3OX9A 4HJLB 3G30A 3IWIA 5F82A 2WYXA 1JN5A 1OHOA 4WM9A 3JYIA 3MZDA 5JI2E 1WMOA 2ZC6B 4KQOA 3FCSB 3OXAA 1O7MB 5HARA 2KXGA 3VOZA 4DV4M 1MPLA 2CV2A 2UX0A 1MU5A 3TWMA 3HIIA 4S2OA 2EA0A 2EFUA 3GZRA 5AQ9A 3UJNA 2O3OA 1ZKJA 2ZBKB 1K54A 4K90B 2XDMA 3Q1FA 3U6CA 1MWTA 3AOEA 5EECA 4Q53A 3HLCA 1QALA 3DWZA 1LLBA 5GHXA 1SXJC 5KQDA 4P6BA 2QBYA 1IXRC 3WS5A 4BB9A 1JQJC 3FYDA 3SYLA 5E2EA 3ITAA 2IUKA 1VQ63 1S6RA 3CZDA 4MGIE 3A98B 3KDSE 1GL6A 2CFLA 3AGDA 1HR0M 5IZ7D 5KP4A 4PM9A 1IXZA 5FASA 3MKEA 1RJOA 3G2YA 4R1GA 2XZFA 2P5TA 2CH9A 4NETA 4E6WA 3KZTA 1JWVA 5CXWA 4NHFA 4IBJA 3TOIA 3KP0E 4O8SA 3LQRA 4L4UA 5GLAA 1DGFA 2Q2EB 3B7CA 3OWUA 2DVWB 5BR8M 1PW1A 2HKJA 3GLFB 1DMMA 4D81A 5L2FA 3P09A 2PZVA 1HKXA 5BXQA 3I51A 3CG5A 2CFOA 4R3JA 5AI1A 3HBRA 2CHVA 1PIOA 4A5RA 3AL0C 5KPRA 1SPUA 3NIAA 4N9KA 3BECA 2CC1A 2XD1A 3V92A 4LZJA 1HNWM 1NHWC 1A90A 4L16A 4R3DA 5GL9A 3KN4A 3GMWA 1YJW3 4WYYA 1D6UA 1DGHA 5CHMA 3O86A 4L15A 1XMOM 1IY0A 3MYTA 2L7IA 4FMCA 2GDNA 1IELA 3I553 1JTGA 2ML5A 1OHSA 3GQ3A 3DUKA 3S29A 2R4IA 1CYVA 1YGEA 1TH2A 2R46A 4S2IA 3T1YM 3IF6A 1K54C 3B8LA 3HLGA 1JB5A 2CG1A 4ZJ3A 3O3VA 2DWZB 4GB5A 3E2LA 1G96A 5JI3E 5IEOA 3LVWA 4OPQA 4RA7A 3SARA 2I9WA 2YX9A 4RX3A 4JPMA 4PCZA 1SJWA 3EB8A 3FUTA 1Q864 4E6XA 4MMYB 2WK0A 2P05A 2EXAA 4GRIA 1SXJE 1Q39A 3SASA 4HBUA 2J7VA 5D83A 4M0DA 2DWLA 3KOZE 4YINA 1Q40B 4L7KA 1HU9A 3U1WA 4IBXA 3ROBA 1JTDA 5H37D 3A46A 1K6RA 1NZOA 1STFI 2X01A 3D3LA 1Z5AA 3GPUA 3G6E3 4K61A 3T8UA 4UAAA 5CTMA 3U6DA 3F9SA 1YJN3 1GHMA 1M904 4MEZA 3DFZA 2OCTA 1FCOA 1OHPA 5FQJA 4MNRA 4MBFA 3IXGA 4EC6A 4OOYA 4L8OA 2WADA 5EXXA 3CF6E 3W0LB 5E6JA 3GLIB 5EVIC 4STDA 1CQSA 1NSFA 2HMLB 3UB1A 3OPLA 1O7PB 2DHRA 3BFCA 5AYSC 3I4YA 2Y2QA 2XRXB 5AIHA 1XXHB 1W4NA 2ZL8A 5G2GA 3FTDA 2W2CA 2Z76A 3GTCA 3U60B 1WYBA 5JBSA 3UPNA 3SS3A 5DF9A 1K3XA 3MG3A 1TUHA 2RGHA 5A93A 2F4VM 3T8NA 2Z6BA 4R4KA 1DGBA 4BTXA 2BJVA 4DV1M 1K4EA 2H0YA 4LJ6A 2WKEA 4R23A 3IF6C 1JVJA 3NXJA 3ZG9B 2CFGA 1ONGA 4X65M 1MY8A 1W5ZA 3NC8A 1ISKA 3J2PB 4JI7M 4R9LA 3DXOA 3OW22 3GP1A 3CF2A 1YLYA 4NRWA 3J7Yd 5FTJA 4GMQA 1IM2A 2CK3H 4AQYM 1FUWA 5CGSA 1YLJA 1W01A 1F8NA 1Q3CA 4ORLA 3FF0A 1PW8A 5ITYA 2O5RA 4OONA 4WZ5A 2DWNA 1ONHA 3HUMA 1VQ43 3ZCZA 1L2CA 3LTCA 4RF0A 5DF8A 2OV5A 4WEJA 2CG0A 1ZAEA 2D42A 1ES2A 1Z6FA 3CCS3 1VZZA 4AKYA 2HPBA 2Z77A 3UL5A 1W8YA 4XM4A 2XQZA 4EXRA 4FWGA 5A92A 1QVG2 3SAUA 4GDNA 2BO9B 3FTCA 3KSXA 2Q07A 3M2KA 4M3KA 1BTLA 4S2JA 2RGOA 3D8LA 1E94E 5DVAA 1O07A 5KO3A 3I563 2IWCA 3SH9A 1HT1E 1N9JA 1W6CA 3FZCA 3CCJ3 4KODA 3GRRA 5KP3A 4WEKA 3TPZA 2EX8A 1D6ZA 1LOXA 2RCXA 3EN8A 4YY3M 4N1XA 1K25A 5EJCA 5BVBA 3CCM3 3IHAA 5AQBA 1MXOA 3N8LA 3VFFA 4GC5A 1KGEA 1DJAA 2OQ4A 2CFWA 3WOFB 4JF8A 2FE8A 5GHZA 3LTAA 4O3VA 3IG8A 3WA3A 3S1YA 4ZPXA 1W5DA 3GO8A 1N8R4 5FTMA 2Y2IA 1EG9B 3H4MA 3GAXA 2Y2GA 4NXMM 1PU4A 3GZYB 5DTSA 2KW0A 5E2FA 5GLCA 5A2QS 4Y0TA 1Q2PA 2R9WA 4P16A 4YHHM 4S2NA 4WZ4A 2BMOB 2RFRA 5ELUA 4WZ5C 4RNZA 1CEWI 1RP5A 4EIWA 2C11A 1YLTA 3VFHA 4E3OA 3UK6A 3J80S 3KXEC 1IQXA 1R6BX 5GHYA 2IUJA 4OVZA 4DUYM 3O87A 3UDXA 1E9RA 3FH1A 1PWCA 3UZUA 2WGVA 3OC2A 3DGMA 3W0FA 3CC43 3PCSA 4UA6A 3SEDA 3UDIA 4WBGA 3JUOA 3IXHA 1CI8A 1G6AA 1L0EA 1QQWA 3IXDA 4JKTA 1KYIA 2BNGA 3K5TA 3V99A 4PM8A 4N3VA 1GHPA 2KEBA 1DJCA 2Z2LB 3SAWA 4QY5A 1NB5I 1QVRA 3K9MC 4DUZM 4HM6B 4MM3B 1GVNA 3DA1A 2ZQ8A 3UGJA 4IPBA 1SKFA 2FNQA 3GRJA 3HX8A 1WXQA 1YQSA 3K63A 1XKZA 2ZLYA 4Y7PA 3WS1A 3GLGB 2DXIA 4QB8A 1UI8A 3EC9A 1N9BA 3WS4A 1JB4A 3S22A 1HNZM 1IXSB 1O7WB 2XSZD 2YFJB 3V39A 4LJ9A 3G0KA 1IQ8A 2A3UA 4IIAA 4N1HA 4BL3A 2Y2LA 1BZAA 2WOFA 2XGNA 3PBSA 1ESIA 1ZX2A 2W04A 2CWUA 4G4NA 7CATA 1W6YA 4KFEA 1PI5A 4L8RC 3B4OA 5CHJA 4KZ3A 1ES3A 2DWMA 1XA1A 1K56D 4FCVA 5IG0A 5TGFA 4HVNA 1FGMA 4B3SM 3TDGA 3DMCA 5DF7A 3W4PA 5D82A 4DE3A 4JF4A 4DR1M 3BOSA 4RBNA 4JF5A 4OK0A 4WYKB 4S2NC 3HIGA 2VQFM 2Y20A 4GZBA 5EQLA 2R62A 1CEFA 3M0EA 4CPKA 3MK6A 4HKVB 5FDHA 5CLKA 4PMAA 3HLBA 4B4XA 2WAEA 5IF6A 4IBBA 4LZZA 3PNVA 3TE6A 2Y4AA 4KHPM 4ZDXA 1SIHA 3ZFZA 3LO7A 1G4AE 2Z3XA 2UXDM 3L25A 3Q2PA 3F8HA 3LXUX 4X6TA 4OP8A 3IT9A 3N4IA 3EBTA 3K1JA 4NL4H 3IJEB 1FJGM 2OTL3 1QAMA 4R3BA 2WUQA 4H8RA 3EIEA 1CK3A 5EP1A 1ROAA 5CRFA 1IVUA 4OQ0A 2ZAMA 1GD4A 2HHHM 1NY0A 1I94M 5J8XA 2BMQB 3ITBA 5IERA 1WYCA 1STDA 1BLCA 3ZDJA 5CXOA 3E9SA 1YIT3 3FUVA 3BFFA 5FGOA 4KENB 1I4WA 4CISA 1JRQA 1QAQA 4N6MA 1EWZA 1OCVA 3OV4A 3WRTA 1N75A 3SYKA 2ML6A 3NDEA 3RGPA 1PYYA 1H8ZA 3VKGA 2GU3A 4B7GA 1IT7A 2EX9A 1OPYA 2GEYA 3OCNA 1J2BA 1O7NB 4LFBM 5ITXE 5TGNA 3C7UA 3LOYA 2V20A 2R18A 4WP5A 4YFMA 2C6WB 1RGYA 1R2ZA 1I5QA 1IK3A 4FCTA 4KG5A 3KP1E 1SXJA 1FR1A 3STDA 3NUVA 1GA9A 3VDPA 2A5YB 1TU5A 3CMA3 2EX2A 2IWDA 3LH4A 3FLJA 4DR5M 3WHLA 1OGXA 3ZC7B 4IVKA 4MH0E 3GPYA 4C6YA 3KOXE 4HESA 4S2PA 5FTKA 4LRTA 4FR9A 1IVWA 3WS0A 2J7NA 3PCRA 2HDRA 3U5ZB 2GXFA 3HKPA 3UMMA 3Q90A 1M1K4 3G4PA 4JI2M 3N6IA 3L28A 4CDLA 3HJQA 1L2BA 1VQL3 3ZH9B 2G8LA 3GLHB 1QYRA 4LCBA 1JKGB 1QJGA 3L27A 1EA2A 5IEPA 1E3RA 4DF6A 1O7EA 2HMKB 3SHFA 2PNCA 2K0MA 4X2OA 2DZOB 4JI6M 3HK4A 3FUUA 1DMNA 3G35A 4MGYE 1W79A 1QAKA 3HU2A 3U6LA 4X66M 3V98A 3G713 1WE4A 1LI9A 3NWLA 3SMPA 1W5TA 3LYGA 4JF6A 5EXTA 2CHGA 3MXSA 5HL1A 1AVKA 1XPBA 1FCMA 1XP4A 2XSHB 4GL6A 3C58A 1YJ93 2Y0QA 3CU3A 4QU3A 3VP0A 1NVMA 1VDDA 1L2DA 3KS8A 3A45A 1KWIA 2C10A 4OOMA 1U60A 2UXBM 1W02A 1KVLA 3LTDA 4K91A 4DR6M 4N6UA 2X71A 2O9UX 1QANA 4IVIA 3A42A 4S12A 3AMOA 1XXMA 3IHBA 4S2MA 4DXCA 3HHZA 5IT9S 2Z4RA 1LI0A 3KVWA 4PD2A 1VQ83 5AEWB 3PGBA 2Z4SA 2JA2A 2CW9A 3VGNA 3MXRA 4NREA 2EO2A 1TP6A 1N78A 4EWFA 5ITRA 4DE1A 1IBMM 3G16A 4K1UA 5IG3A 3SATA 1K4FA 1W6GA 3QNCA 3RFWA 4KQQA 2F5QA 4X62M 2KZSA 2CFKA 3PBRA 3BFGA 3CTWB 2P74A 3Q82A 3FG3A 3UDFA 4JXWA 4L8PA 3V5MA 2C98A 1IQPA 2FFYA 1KFVA 2OOVC 1IVVA 3KS4A 2E8IA 3UPPA 3I7JA 4OW0A 3KSPA 3E2KA 4B4ZA 2E2UA 1KC84 4P87A 1KSFX 3PTEA 3HU1A 3RJUA 5BPVA 8CHOA 3SOIA 4DE2A 2LNHC 4JI3M 5IHVA 5FQ9A 4OOLA 2ZM2A 3NQYA 4G1MB 4KZ5A 2Y0TA 5ITQA 2V1LA 3VP4A 1TEMA 2F98A 1IN7A 1NHGC 3EIHA 4FW9A 5LMNM 3BB9A 4J9AA 4BL2A 4KFFA 3DWKA 3CCV3 3T1HM 5EVIA 1FGRA 4ZBEA 3IXBA 2WKIA 2WZXA 5FTLA 4DR3M 3N7WA 2AHMA 1DO0A 3LCEA 1YLPA 4MBHA 4QNMA 1K55A 4FMAA 4OUQA 1G68A 4FCZA 3HLWA 4PPRA 1NZUA 2YFQA 1Q7Y4 1K38A 2Q9NA 1MX0A 4B88A 4JI4M 4BD1A 3SMSA 2C99A 4C75A 4RX2A 2Y2MA 3BFDA 2X49A 1NJI4 1GY6A 5HGRA 4WMCD 5KSHA 1E3UD 2YFLB 4M9XA 3HREA 6STDA 4Y0UA 4DV7M 1NU3A 4KG2A 2V1ZA 2OPFA 4KZ4A 1L0DA 1BUEA 1N4OA 2CKFB 1EKMA 1IYSA 3FG1A 3FKEA 1IYOA 1RKYA 1BUQA 4AKZA 4MB7A 4HYZA 4JRFA 5M18A 5FQQA 2ZM8A 2FOIC 3FKVA 3G32A 3IH9A 5EXPA 3SVAA 3EHCA 4GITA 2XF3A 2WOHA 1R2YA 2D1WA 1OH0A 3HWSA 5M1AA 4NXNM 1YLZA 2GU1A 2DZNB 2H1RA 3OTOM 3K92A 5CGWA 2F5OA 2VGKA 3FD9A 2HMJB 5EVHA 3PXGA 3TQSA 3AKZA 2BT3A 1ZG6A 2XZUA 3C4PA 1FCNA 3JVCA 1I2SA 2MC8A 3WHKA 1NYMA 1YUBA 4Z8XA 3AFHA 1XMQM 1LNHA 5EQTA 2GBWB 1VQQA 3DY5A 1E25A 4S2KA 8CATA 2W82A 3ZG8B 1SCWA 1K82A 3HJSA 2WGOA 2ZQDA 3A3JA 2JDIH 5DTTA 2QIYA 2F5NA 4KZ1A 2W9PA 3FTEA 4UHUA 3EF8A 4HBRA 2FFJA 4R7GA 2Y59A 3OPRA 1IQYA 1K55C 2WGQA 1YMXA 1IT8A 2HP9A 3NY4A 4K0WA 4X56A 2XLNA 4O7DA