2XEPA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
428
structure length
419
Chain Sequence
SVPTPAEAALAAQTALAADDSPMGDAARWAMGLLTRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 135
structure length 419
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xepA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xepA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xepA02
4ZBEA 1NXYA 2OLUA 4CPKA 4PM5A 3S4XA 3VMAA 5DTKA 4BENA 4D2OA 4DKIA 1DJCA 1ES5A 1BULA 2RL3A 5M19A 1IYQA 4BQMA 5CEBA 1XGIA 4OPRA 3NC8A 2V20A 4OOLA 1PYYA 4KZ8A 4QB8A 5F1GA 3VFFA 3BFDA 3M6BA 3IXDA 4JF4A 4XUZA 2XFSA 5M1AA 2WKHA 1IELA 1ONHA 3GR2A 2XR0A 1NYYA 3VP2A 1KE0A 1FOFA 4JXVA 3WS1A 1JWZA 1IYPA 2PU4A 4K0XA 1NRFA 1PW8A 3UY6A 3Q07A 2ZC5B 1VQQA 3MXRA 3I7JA 2IWBA 4S2KA 5A91A 4E3JA 2Y55A 1E3UA 3G2ZA 3HUOA 1K54A 4OOYA 3SS4A 3IXHA 1RGZA 3WS5A 1AXBA 1L0DA 1MWUA 1EROA 4WEKA 3HVFA 2X01A 5EVIC 4XXRA 4OQIA 1PIOA 4OH0A 2Y2QA 3PBQA 3O87A 5EUAA 1ERQA 4A5RA 3CZDA 2ZQAA 2EFUA 4E3NA 2HDSA 3N4IA 4KQRA 3IHBA 4BL3A 5TGFA 4MEZA 1SCWA 4PM6A 4WM9A 1HTZA 1WYBA 5CEDA 4UA6A 1J9MA 3MFDA 1K6SA 4WBGA 5CGWA 3NDEA 3QHYA 4LV3A 5E2HA 4RA7A 2C6WB 5HAQA 5HL1A 3GQZA 3WRZA 1XX2A 1BZAA 4UHUA 3ZG9B 4U0XA 3HLGA 2Y2LA 4S2NA 1EI5A 4FH4A 3G34A 4R1GA 1EWZA 1RP5A 5CHMA 3OPLA 3OPHA 5FQIA 2Y2KA 1PZOA 1O07A 1MKIA 2FFFB 2UWXA 2XDMA 4FH2A 1MY8A 5J8XA 3SS5A 3P09A 4L0LA 2G2UA 3ISGA 1K57A 4KZAA 1ES2A 2EX6A 1KGEA 3VSKA 4KG6A 3FYZA 1KGGA 4X53A 1KE3A 1NJ4A 2H0TA 2Y2OA 4CJNA 3AGDA 1XA1A 3IF5A 3NDGA 2XF3A 2WGWA 3MKEA 2ZM8A 4KZBA 3ZHHA 1G6AA 5GHXA 5L2FA 1K38A 5EOEA 3OCNA 2EX9A 1NYMA 1L0EA 5CERA 4LENA 3IF6C 2ZQ8A 1VM1A 1YLPA 3IXGA 4FCFA 3ZVTA 4EV4A 3G30A 3N6IA 3O88A 3V39A 4R0QA 2H10A 3IWOA 3A3DA 3FKVA 3G2YA 2P9VB 5CHJA 4N1XA 1ESUA 4KENB 5FAQA 4OPQA 2WKIA 4JBFA 5DF8A 1KDWA 5G18A 2PBYA 1ZG4A 4MBFA 1L0GA 1PI5A 1DJBA 2BLSA 5E2EA 3ZDJA 2EFXA 2XD1A 4OP5A 3A3IA 4FSFA 5F1FA 2A49A 1KVLA 4R4RA 1TDLA 4S2JA 3HLWA 4K0WA 1GHIA 1W5DA 1WYCA 1IKIA 4JLFA 2XK1A 4QD4A 2J7VA 2ZLYA 3GVBA 3OC2A 4UAAA 1S0WA 3SS3A 2J9PA 2BG1A 1FSYA 4E3IA 4PM9A 3MZFA 5GLDA 3IH9A 3PAGA 5DF7A 1H5XA 1BUEA 2RCXA 4OKPA 2Q9MA 5HX9A 1KGFA 1TEMA 3DWZA 4HBTA 4R23A 3EQVA 4KZ7A 3HLBA 5CGSA 1W8QA 4IVKA 4C3QA 1HZOA 5GLCA 4BL2A 3HREA 1BLCA 4X55A 1W79A 3O3VA 3BFEA 2P74A 4ZJ2A 3VP1A 2WKEA 2ZM2A 3HBRA 2X02A 4PM7A 4YFMA 3A3FA 5GLBA 1Z6FA 1PWGA 4B4ZA 3IWQA 3BM6A 2HP9A 3ZGAB 1YM1A 1YLWA 1IYOA 3NBLA 5EVIB 3MBZA 2J8YA 3ZG8B 2ZQ7A 1HVBA 2OSUA 3OZHA 3WWXA 2JC7A 3VOZA 4NETA 5FDHA 5BOHA 3UE0A 4WEJA 1MWRA 1SDEA 1ES4A 3Q7VA 2HDQA 3N8LA 3UE3A 4C75A 2Y91A 5FQ9A 4BJPA 4RX2A 4C6YA 3ITBA 5DTSA 3TSGA 3BYDA 3DTMA 5TFQA 2Y2IA 1TDGA 4KZ4A 5CGXA 3VP0A 4RVAA 1KVMA 3O86A 1MWTA 1LL5A 1K6RA 1XKZA 2R9WA 4R4SA 3W4PA 1TVFA 5FQMA 1QMFA 1ALQA 4LV1A 4M3KA 2WYXA 4F94A 2EXBA 1YMXA 4JXGA 1K54C 1N4OA 2C5WB 3HLFA 3HLDA 4IBRA 1PZPA 2Z2MB 5EVLA 3C7VA 4R3JA 4LV0A 3SH7A 2OLVA 3HUMA 3ZG0A 1BSGA 1XP4A 3N8SA 2ZMAA 3OPRA 1CI8A 5HFOA 1WE4A 3SOIA 4P6BA 3M6HA 4YINA 1FR1A 3UDFA 3C4OA 1CEGA 4OPZA 2Y2MA 4QY5A 3W4OA 2ZM0A 1SKFA 2ZQDA 4UA9A 4OQ0A 3G32A 1W7FA 1I2WA 1SHVA 1FCNA 3PBRA 5KZHA 2EX8A 3PBNA 4K91A 5FI7A 4QJGA 3LO7A 3IXBA 4EQIA 4S2NC 1S6RA 1NY0A 3S22A 4Q8IA 1K55A 4IBXA 5EVID 3RXXA 5AQBA 1ZC2A 1I5QA 5GHZA 3QNCA 5DVAA 3UE1A 3UPPA 3VP4A 3ZVWA 2XH9A 4BLMA 3WS4A 1W8YA 3BFCA 5F82A 4U0TA 3PBOA 3BLMA 1K57C 4Y0OA 3OCLA 1DY6A 2E8IA 3MKFA 4HESA 5A93A 3UPOA 3NY4A 1Q2PA 4JPMA 3BEBA 1YLJA 4R3BA 4GB7A 4WMCD 4E3OA 5FASA 3SH8A 3WS0A 4Y7PA 4GNUA 1K56D 3ZG7B 3MZEA 2WAEA 1JWPA 4X6TA 4B4XA 5CTNA 2VGJA 3AGEA 5F83A 2DRWA 4JF5A 1PWCA 5E43A 4B88A 3RJUA 1I2SA 4GN2A 4GDBA 4P85A 1L0FA 3DWKA 4E6WA 3HUNA 1ONGA 5HARA 1BLPA 5KMWA 3FV7A 2Y2NA 3NIAA 4OQHA 4Y0TA 5AQ9A 1NZOA 4HBUA 4RYEA 5CHUA 3G4PA 1HD8A 2FFYA 2B5RA 5AQAA 5FAPA 4OQGA 2JCHA 1JTGA 3FZCA 4RX3A 4X56A 2J9OA 3UDIA 1LI9A 4U3TA 1CI9A 1FCOA 1XGJA 4GD8A 4X68A 4S2IA 5D3OA 4LCLA 1U60A 5CTMA 3ZNTA 1CK3A 5GLAA 4WZ5A 3BLSA 1CEFA 2H0YA 1IEMA 5TR7A 1GA0A 3UDXA 1FSWA 4MLLA 4BD1A 3HL9A 4QY6A 3LY4A 1ESIA 2I72A 3PBSA 3WRTA 3NI9A 2Q9NA 2EXAA 1M40A 5E2GA 1N9BA 3VFHA 1O7EA 1L2SA 1BTLA 1GHPA 3Q81A 4KZ6A 3Q7ZA 4OP8A 2IWDA 1RCJA 2P9VA 5A90A 1PI4A 1MPLA 3Q82A 1MWSA 1K4FA 1YMSA 2ZQ9A 2OV5A 1SDNA 3MZDA 2HDUA 4MBKA 5FSRA 2JE5A 4S2PA 5FI6A 3VSLA 3B3XA 4DE1A 2ZC7A 2Y2PA 2XGNA 1LL9A 1Y54A 1C3BA 4X69A 5HAIA 2CC1A 1RGYA 3IT9A 4OONA 1NZUA 2DCFA 2HP5A 4OVDA 4E3MA 1IYSA 3GTCA 1ES3A 3E2LA 4OOMA 1G68A 4QHCA 2Y59A 4DE0A 1JTDA 4OLDA 3UNWA 1ZKJA 3ZG5A 1XPBA 4NK3A 3CMZA 4EBLA 1H8YA 2ZQCA 3UPNA 3LCEA 2QPNA 3ITAA 3QNBA 3C4PA 4PPRA 3TG9A 4BD0A 4DDSA 3GMWA 1XXMA 5HAPA 4QU3A 1M6KA 4E3LA 4WZ4A 3IQAA 2WGIA 5CRFA 1OMEA 5EOOA 3M2JA 3ZFZA 1K25A 2GDNA 3GRJA 1JWVA 4KG2A 5KSCA 2WZZA 3JYIA 3CJMA 1YT4A 2ZC4B 5DTTA 5U47A 3IH8A 2HDRA 3GV9A 4HEFA 4MBHA 1PWDA 1YQSA 4ZJ1A 4KQOA 5FQKA 3V3RA 1K4EA 4ID4A 1LLBA 5GHYA 4S2MA 4EWFA 3CG5A 1ZG6A 4DE3A 4DE2A 1ERMA 5EVIA 1MXOA 4LCMA 2WUQA 2DNSA 4P87A 1YLYA 3D4FA 2QZ6A 2WZXA 1BLHA 2Y2GA 4ZAMA 1BT5A 4N9KA 3ZNYA 4ZDXA 4E3KA 1Q2QA 5E2FA 4KZ9A 4KZ5A 3DW0A 3IF6B 4OLGA 2WGWB 1IKGA 1QMEA 1E3UD 3LY3A 1FR6A 3BFFA 3A3EA 1MBLA 4FD8A 3A3JA 4WMCA 5EECA 2IWCA 4PM8A 2X71A 1YLTA 4DRTA 2JBFA 3W8KA 5GL9A 1K56A 1K55C 3OPPA 4JKTA 3N8RA 3S1YA 5FI2A 4GDNA 2Y2HA 5FAOA 1JVJA 4Y0UA 1FCMA 2PU2A 4MNRA 4S2OA 2XLNA 2VGKA 3HLCA 5JYOA 1YLZA 2WK0A 4KQQA 1E25A 3Q1FA 4OPYA 2H5SA 3VOYA 5FQJA 3FWLA 3C7UA 1GA9A 4JXWA 4WYYA 2ZC6B 4KZ3A 1LHYA 2Z2LB 2Y2JA 2WGVA 3E2KA 4S2LA 3SH9A 1GCEA 4KG5A 4ZJ3A 2ZJ9A 4IVIA 3V50A 5AQ7A 4DXBA 4XUXA 4E6XA 2ZD8A 5M18A 3IF6A 3BRMA 1BLSA 3N7WA 1FQGA 3M2KA 4DDYA 2WADA 4EBPA 3BFGA 3V5MA 5HW3A 1KE4A 5DF9A 4N1HA 2V1ZA 3AGFA 2XFTA 5IHVA 3G35A 1PW1A 1KDSA 3ZCZA 3UO9A 1E4DA 2QMIA 2XQZA 3PTEA 3V3SA 2G2WA 4H8RA 4LV2A 4EBNA 3IWIA 5EE8A 4EUZA 5FATA 4GZBA 4WELA 3TOIA 3LEZA 3BECA 4Z9QA 1GHMA 2V2FF 4JF6A 3W4QA 2WAFA 4GD6A 3NCKA 2HP6A 1LI0A 3FKWA 3GSGA 3Q7VB 4WZ5C 3IHAA 3P98A 3MXSA 4N9LA 4PMAA 5FQQA 4JXSA 5EPHA 3UN7A 2EX2A 3G31A 4O7DA 2R9XA 2Y4AA 3PBTA 1XA7A 4UA7A 4GOGA 2XEPA 4IEDA 4GKUA 2ZC3B 5CECA 3HLEA 5A92A 2A3UA 3EQUA 2HPBA 4N92A 4ZTKA 1H8ZA 5FA7A 3VP3A 3RXWA 3PAEA 5KSHA 5I94A 5JYPA 4DXCA 4DF6A 3WS2A 3C5AA 5CXWA 1DJAA 4P0MA 2XD5A
chains in the Genus database with same CATH superfamily
4ZBEA 1JB2A 1YE9A 4IBJA 4X25A 5EQTA 5EP4A 1EFUB 3RGRA 4D2OA 3FUUA 3BOSA 3LCVB 1JZOA 3C3DA 1BULA 4I38A 1F4IA 3N8BA 4BQMA 5CEBA 4GB5A 3CF2A 3B7CA 4OPRA 3FZWA 3CF6E 1JKGB 1TDHA 1ROAA 1OHOA 4ILFA 5AI1A 3E0YA 1TFKA 4QB8A 5F1GA 1AIPC 5DREA 4L9GA 2RBIA 3HCYA 5M1AA 4LJ9A 1SQWA 4GKJM 4EXOA 2WKHA 2Q0OA 3GR2A 3S7QA 2JKGA 5J4EA 1XHBA 4RF1A 3FGYA 3PGBA 4UQIM 3WS1A 2Y79A 3Q07A 1JJ22 2ZC5B 4Q0HA 1AY7A 3RNTA 3I7JA 2I7PA 4GHLA 1N33M 2Y55A 1E3UA 3G2ZA 4OVZA 2AHMA 2Z6BA 4KVHA 1XMQM 3IX8A 4HL4A 1GY5A 2DVWB 1GO5A 1WTHA 4EXRA 1YHQ3 4OH0A 1DP6A 3L28A 2BJWA 2V1LA 1R6BX 3PBQA 3O87A 3T4KA 1ERQA 2J7OA 2Z77A 2K7SA 2O99A 2W2CA 3BIRA 2BU4A 2HJEA 2JKTM 5DYGA 3V76A 2HDSA 3N4IA 1BRKA 1F8NA 4DV6M 2QYBA 5CEDA 1WYBA 2F56A 5HZHA 4FUWA 4ZM8A 1L2BA 5JPPA 3NDEA 4ARZA 3JUQA 3KSFA 5HL1A 3GQZA 5F69A 3WRZA 3C58A 3MQOA 4UHUA 3ZG9B 1YI23 4U0XA 1VQ73 3CPTB 1EI5A 1IXRC 4XBTA 2VA0A 1EWZA 1RP5A 3F1PB 3OPLA 1W2B2 3OPHA 1NU3A 2DWNA 4TUWA 4LRYC 1BSAA 4IJFA 2Y2KA 3I553 3DGNA 4CLCE 1RGEA 2KXEA 1MKIA 1VQM3 3TRCA 2R0IA 2WOFA 4KODA 1MY8A 5FTNA 3P09A 2IYJA 4JGOA 4EEPA 2KZSA 4KZAA 1ES2A 1RRLA 1X37A 4KG6A 3O8YA 4X53A 1KFVA 1NO3A 3NHXA 1NJ4A 3TJZC 4OVMA 3WA3A 4RZMA 2JY6B 1V33A 3U5ZB 2JNHA 3LIAA 4AQYM 5I5LA 4M0DA 1K38A 3OCNA 3U60A 5EQLA 1NYMA 1IFQA 3BQAA 2CFOA 1VQ1A 3JAMS 4EV4A 3IXGA 1WHCA 3G30A 3V39A 2Y21A 2I9VA 1VB6A 1LNHA 1IVVA 2PAVP 2FZ0A 2JY5A 3VK7A 3VLFB 4FMCA 1VQ53 3T4SA 2XZFA 5EVEA 3HWSA 2R41A 1KDWA 3L0RA 3PYPA 5G18A 3FCSB 1DJBA 1AVKA 1RSNA 2GU1A 5E2EA 4OP5A 3T1QB 3A3IA 3EIHA 8CHOA 1OT9A 2UX0A 4S2JA 1OJ5A 1D2NA 1WYCA 2W9QA 2XK1A 2BO9B 2P0XA 4UAAA 1CJFA 4LLOB 4REZA 2DAGA 2W3EA 2YR0A 3AL0C 4RNYA 2J9PA 5KPZA 4WUJA 2JZ0A 4HH3A 5HDDA 2GXFA 3FSDA 4DV0M 3MZFA 3IH9A 1OHPA 1Q02A 1FGRA 1BUEA 2RCXA 1BNFA 2PDRA 2G5GX 2H5XA 3OTOM 2Q2EB 1N8QA 1KGFA 2R45A 3DWZA 1BANA 4HBTA 3MG1A 3HLBA 4IVKA 1G71A 3U97A 4BL2A 4MGKE 1UM8A 4ZJ2A 3VP1A 1Q40A 3ROBA 1OFIA 1OPYA 1DMMA 4NEED 3HGIA 3K2NA 4YFMA 4PM7A 3D9RA 1IXSB 1K734 4IBIA 1Z6FA 1Z6TA 4B4ZA 4LRXC 1RHLA 2STDA 1BRJA 1YM1A 1FILA 1YLWA 3ZGAB 4EV2A 3NBLA 5EVIB 3MBZA 3VFDA 4R6LA 1BNIA 2JQ5A 4LCBA 1LVNA 3X42A 1D0LA 3U6CA 1MWRA 4LF4M 1A67A 1FW7A 1SDEA 2IA2A 4O2HA 2D7HA 3KSGA 3NJAA 3RGSA 2ZMFA 3Q7VA 3UE3A 5HWWA 5K5BA 4C6YA 5CXOA 1W02A 1XFNA 2H0HA 1OTRA 1XC8A 3E4PA 4KZ4A 1W63M 1DGHA 5CGXA 1KVMA 3J7AS 1M1XB 1PJQA 3GAXA 3O86A 1IBMM 1MWTA 3SYUA 1K6RA 5HDCA 2CV1A 2ERCA 3GLGB 1U8CB 4M3KA 3DZLA 4ESPA 3C38A 2V0UA 2JN7A 1N4OA 3PVSA 2LVOC 1I3IA 2KRTA 2Z4SA 5STDA 4WYKA 4HJLB 3B7QA 1DP8A 3C7VA 3MMPA 4LV0A 3T1YM 3MG3A 3SH7A 1P3QQ 2LBCA 3CC43 3ZG0A 3DGYA 1S3SA 2L4EA 4G4QA 1ZS7A 3WOFB 1GSWA 3KSHA 3OPRA 5AIFA 4HP4A 4OX9M 4P6BA 4LZJA 3UDFA 4QWOA 1TRPA 4IJGA 3GZBA 3MJQA 3HX3A 4PDIA 4RBNA 3PHYA 4ETZA 2RSXA 2KHHA 5DKLA 1OHSA 4UA9A 1UDII 3U2AA 3AJIB 3SAVA 2J5YA 1IVXA 4JGRA 4KQDA 2F5MA 4MEIA 1JRQA 2EX8A 3PBNA 5FI7A 3LO7A 3S27A 1BNEA 3S29A 2KNVA 4EQIA 1TTEA 5EXSA 3RXXA 1WR1B 4I81A 2WSEF 1ZC2A 2CH9A 4JN6A 5DVAA 3KP1E 4IBGA 3JVCA 3FUVA 1T2IA 4BBTA 1Q42A 5HGRA 3DTIA 3FUTA 3MF0A 1IY1A 5ITXA 4AG6A 2P09A 1PY3A 3NOUC 4Y0OA 1WIVA 3X40A 4L4UA 3OCLA 4R7GA 8RNTA 2E8IA 4HESA 5A93A 4R9KA 4JPMA 1GSVA 1W00A 3DH2A 4LFCM 5LBRA 5FASA 1BRSA 3S7NA 3WS0A 2CV2A 4GNUA 1K56D 4IBKA 3NXJA 2JY8A 2QA43 3MZEA 3DOAA 3H9WA 3IX3A 3EE1A 4XBYA 3VE3A 2VGJA 3AGEA 3RDEA 1NJI4 2DRWA 3U6EA 3RJUA 1I2SA 3EWKA 4FVMA 2W03A 2IMJA 3DWKA 5D81A 2W0NA 2INXA 3CCQ3 3F7XA 1IM2A 3JPUA 3FV7A 3T1XA 3CD63 2QJ7A 2CWBA 3E4RA 4G3OA 4L9FA 2R65A 3NOPC 1NZOA 2FFYA 5IEOA 2JCHA 4RX3A 2L6OA 1W6GA 2J9OA 5H37D 1E97A 1A2VA 4S2IA 5KP3A 1U60A 4HAAA 1CK3A 4IUHA 4YNRA 4DV1M 4DV4M 3BLSA 3M8CA 1I2EA 5JI3E 5TR7A 2KDLA 3TQSA 2K0BX 4JV5M 3CCL3 1V57A 4R3DA 2W1RA 3PBSA 4JI0M 2Q9NA 5BIRA 1FJGM 1N9BA 5ELUA 1O7EA 1L2SA 1TR8A 5CF2A 1L1ZA 3NQZA 3LFVA 2X8AA 1WGLA 3Q82A 1K4FA 5IWAM 1YMSA 2V1CA 2ZQ9A 1SDNA 2OV5A 4GITA 2CFGA 2UU9M 2MGWA 1LL9A 1LSVA 1RLSA 3MSHA 1TD5A 5HAIA 4L6V6 1UCLA 1K9M4 4BBVA 1IYSA 3GTCA 1ES3A 1E3RA 3E2LA 4NREA 2P7JA 2W3DA 1O7GB 3IG5A 4JXJA 1ZKJA 2XRNA 4NSRA 2GQFA 1MZUA 2F5OA 3SEDA 3NHQA 4F1IA 4O8GA 1W5TA 3UPNA 2GU3A 2QPNA 3QNBA 3LOYA 3TG9A 4BD0A 1B3SA 2AVXA 1WMPA 1P9WA 1QMAA 1XXMA 2J3TC 3B9PA 2QQ8A 3TE8A 4HOHA 1M6KA 5EOOA 4O01A 1SXJD 4KT0F 5DRVA 3M2JA 4JGPA 4FCMA 4HNBA 3CJMA 2JKRM 5DTTA 3FG8A 2VV6A 2WKQA 4NXMM 4MGIE 4KQOA 5FQKA 4IHQA 3MR0A 1KOUA 3UB5P 4GC5A 4G4OA 1YUBA 1K4EA 3LR4A 4S2MA 3J80S 3CG5A 4KHPM 2VGLS 5EXPA 4LCMA 5HD5A 2W56A 4RQ9A 1IN5A 4HIAA 2RKOA 5LMUM 4P87A 3L25A 2GBWB 1I8VA 5KPRA 1BLHA 5EEOA 2XA7M 4N9KA 3KSJA 3AHWA 4E3KA 5E2FA 4KZ5A 1XXHE 3DW0A 4EERA 3ICYA 1DP9A 1NLZA 1G96A 1IT7A 5KO3A 1VQ43 3A3JA 3TE6A 3JR4A 2IWCA 4PEJA 2WKRA 5ITTA 3KX0X 3BWLA 2JBFA 2HL7A 4N6MA 4N6NB 1VETA 4M0WA 1HZ1A 3V67A 3K9MC 5HPIA 3EN8A 1B2UA 1D06A 4WL9A 2PU2A 1I0XA 2P38A 4GHAA 2OWPA 1ISKA 2XLNA 2M7UA 2VGKA 4KQQA 3KOWE 3H4JA 1V74A 4OPYA 1A5TA 3GLFB 1TFOA 4N6V0 1TU5A 3WDGB 4XM4A 1T3BA 3QP5A 4DV5M 1BIRA 3UK6A 4DR1M 2ZC6B 3EB8A 1XJ2A 3NV0A 3E2KA 3GLHA 4D80A 1CEWI 1GSPA 4KG5A 1YLAA 4ZJ3A 1IDPA 1OAIA 3NBBA 4AKYA 2X49A 2GEXA 4X66M 1IVWA 5FLXS 3V50A 3VOLA 5IEPA 2ZL8A 4DXBA 1N77A 4X62M 4XUXA 1GKIA 3CPW2 2Z6CA 4E6XA 1GLNA 1BLSA 2J3WA 1SXJB 1VDLA 3FTDA 2WGQA 1VQL3 5DNYA 4DR6M 3IECA 4QOZC 1Q40B 5DF9A 1YSYA 2JZ1A 3GLIB 3KOZE 4BTXA 1NLYA 2YKHA 2CHQA 3UO9A 2QMIA 1OUNA 6RNTA 3IWIA 1RGCA 4GZBA 2SARA 2OAP1 1SKOB 3G6OA 2F99A 3DM8A 4Y5FA 3C9PA 2WAFA 2OO9A 1ZHHB 2HP6A 3Q7VB 2Z7JA 1RGGA 3P98A 1DE3A 2LYXA 5FQQA 2F5PA 4YHHM 1VHMA 3HY5A 3UN7A 4IPBA 4O7DA 3T38A 1W6YA 3PBTA 2Z6DA 2XEPA 3I04M 3Q90A 2LVPC 5A92A 1NO1A 3L27A 1GMQA 2C9OA 1PJSA 4HY8A 3KOYE 3U4LP 3VP3A 5KSHA 5I94A 1BSDA 3WS2A 1DGFA 3PZWA 4DMZA 3C5AA 3KSPA 1DJAA 4PM5A 4CPKA 3A0RA 3S4XA 4BENA 1QJGA 5HWVA 1DJCA 3U6OA 2OOVC 5M19A 1AVLA 4MGZE 4OU7A 3LIBA 2V20A 4EESA 2VZWA 1GSXA 4FTXA 4KZ8A 1LTMA 2UXCM 3IXDA 4JF4A 3MHEA 2JUJA 4BU4A 2OCTA 1UCJA 1NYYA 4JI8M 1FYSA 2DKLA 1OJLA 4GH9A 1IYPA 2PU4A 1PW8A 3UY6A 3R9XB 1VQQA 3MXRA 4HBRA 2IWBA 3IS2B 1ZGXA 1IBLM 3J7BA 3HUOA 3SLUA 3BW6A 3SS4A 5FL3A 5HDSA 2NQ8C 1JV2B 4AI6A 1AXBA 2UUBM 2R44A 4J5GA 1HU9A 2VX8A 1RN4A 4PHTA 3D5GA 1PIOA 1VEUA 2W9PA 4B3TM 3ER7A 5TBMA 4HH2A 3D72A 3SOAA 3SFZA 3GPXA 3AV0A 3DGLA 1HT2E 4LYLB 1Q814 3FRIA 1RMSA 2CKFB 1HKXA 2XGLA 3CZDA 3P01A 2VV7A 3FF2A 3CUEA 4BL3A 1HT1E 1RTUA 5AYSC 4UA6A 1G5UA 1K6SA 4WBGA 4LV3A 5E2HA 1XB2B 3B89A 2C6WB 1CYUA 4CDLA 1GOYA 1XX2A 1GL7A 1NNUC 1BZAA 2M1CA 2Y2LA 1DGGA 3SC3A 5CHMA 1NVMA 3ZC7B 1TUHA 3SXXA 5FQIA 3QP4A 2V1BA 3GRUA 1ORYB 2V1AA 4R71A 1O07A 5G1KA 4XBOA 3WODG 5J8XA 3WA2X 2W3FA 2V8CA 3FUXA 1BAOA 2G2UA 4K08A 3PCSA 1EEJA 3S7OA 2XSHB 4B7FA 2Z8YM 5DJUA 2EX6A 3T4QA 1KGEA 3VSKA 1Q3BA 1KGGA 3FYZA 1BNJA 3K2LA 3UMDA 2Y2OA 4DV3M 1LQMB 3I4VA 1N9EA 1WMNA 3G8ZA 5IT9S 4MN5A 1RGHA 3HK4A 1XA1A 4WURA 1NNJA 1W5ZA 2ML6A 3NDGA 1N36M 4XBXA 2WGWA 3MKEA 3LT8A 2F4VM 3GRVA 2EX9A 1RGAA 2SBLA 4X2HA 2ZQ8A 3HHYA 1CUKA 4FCFA 3ZVTA 5F68A 2L1SA 2YFIB 2H10A 3A3DA 2XR8B 3FKVA 3G2YA 4X1LA 1ZO2A 3NWLA 4N1XA 3E9SA 7STDA 5FAQA 4IIWA 3U6MA 2WO0A 1ZG4A 2C98A 4DR3M 4O0PA 5IT5A 4QHSA 3LTCA 4DJ3A 2R6FA 4NOOB 2XD1A 2DZOB 3J27B 3MSOA 4DJ2A 5F1FA 2A49A 4R4RA 1TGUA 3AOEC 3X3YA 1W5DA 4EIWA 1W63Q 3T6PA 3WR2A 2GZAA 3E4QA 3KVWA 2P5TA 2CFKA 3PYJA 1PJJA 5CX7A 2UUAM 3KKGA 1FSYA 5AYRB 4PM9A 1GOUA 1ODVA 1Z09A 2WGOA 1TEMA 4GLQA 4OK0A 5HPFA 3EQVA 4KZ7A 2OOLA 1PYLA 2JDIH 1OTBA 4KUOA 4C3QA 1DRMA 2C5RA 4UN2B 3DXOA 1BLCA 1TDZA 4LGQA 4BTYA 1T3TA 2P74A 3BFEA 4X55A 2KF5A 4CGYB 3AKZA 1P9RA 4O8SA 3HBRA 3L26A 1N8R4 1H8MA 2X02A 3T4JA 5GLBA 3A45A 5L8RF 1MN3A 3F7SA 1PWGA 2XZUA 5L09A 1BRGA 4HM3B 2G3QA 1UCKA 1BRHA 2W56B 3ZG8B 3OZHA 2WOHA 2OSUA 3WWXA 3VOZA 3NBRA 1JR3E 2HZ5A 3L9KA 1OCVA 1C7YA 2HDQA 3EN1B 4C75A 3THGA 3ITBA 3TSGA 5DFLA 2HMKB 2VKSA 3T4TA 1BNRA 4W5WA 2R9WA 3BXWA 4R4SA 1Q864 2BNGA 5HL6A 4FW9A 5C5KA 5FQMA 4LV1A 2WZJA 1X1XA 4P6ZS 1VETB 4GHIA 4F94A 4LFBM 1PM5A 4OUQA 1DVCA 1K54C 4LJAA 2INWA 2C5WB 4L16A 3EIEA 1KSFX 4I4KA 5EVLA 3FKAA 2P04A 3UB8A 4R3JA 3LZAA 2DAEA 1DMQA 3HUMA 1LQGC 3W68A 1C1KA 1XP4A 2BASA 2V1UA 1GOVA 4LJ7A 3M6HA 5HSQA 1FR1A 3NV0B 3C4OA 3GLHB 2MF7A 2CHGA 3G4S3 3W4OA 2Y0TA 1JN5B 4BBUA 2ZM0A 3SYLA 1MGRA 1SKFA 4HQAA 3LVVA 1IN4A 3D3LA 2QWSA 4F3LB 2MROB 3EOIA 1Q7Y4 4K91A 4QJGA 1VDDA 4DUZM 3OWUA 3PXMA 3IXBA 3CAXA 4S2NC 3HOHA 4IIAA 1S6RA 1IQYA 1ZX2A 3P7NA 5EVID 5AQBA 1T19A 3VP4A 7GSPA 3ZVWA 2J7NA 3HU3A 1XMOM 1QVRA 1WQLB 4LSOA 4LF6M 3B47A 4U0TA 2PYPA 3KSED 5FTJA 3FUWA 4EQ1A 1FGQA 3LVWA 1S4RA 3QP1A 5C18A 4N6OB 3UPOA 5JBSA 4K0KM 2L0WA 3ULFA 1PU4A 2EKFA 3BLZA 3BEBA 4GB7A 4R3BA 3X3ZA 4NRWA 2D02A 4R80A 2JP7A 4Y7PA 3K3DA 2K2NA 1YIT3 4JGQA 4JI6M 2E2VA 1NWWA 3DUKA 3HX8A 4AKZA 4AEQA 4LF9M 1FIKA 3ZG7B 5CTNA 2ZBBA 4FWGA 3GZXB 2VEAA 3JUMA 2W27A 3W2ZA 1I3FA 4ANRA 2XLJA 2A15A 1E9RA 3GRYA 3K92A 4GDBA 3MYTA 1KD14 4GN2A 3HUNA 4P85A 4E6WA 1IY0A 4EC6A 4Y28F 3PXGA 1LOYA 4OQHA 1MNLA 2ZA4A 1X1YA 4I4LA 5AQ9A 1EA2A 4HBUA 2HHHM 3UL6A 3LI9A 1OIZA 1AR0A 5FAPA 4OQGA 4KFEA 5JPUA 3FZCA 4ETXA 1Y8GA 3LR3A 4LJ6A 4MN6A 3UDIA 1FGOA 4U3TA 3RTYA 1BSCA 1QANA 1IN8A 2LHCA 2AAEA 1Y4OA 4GD8A 4LCLA 1D0KA 3H4MA 2D42A 1KC84 5GLAA 2DAMA 3LTDA 2H0YA 5AVEA 3E99A 2UUCM 3D79A 2HMLB 3HL9A 4QY6A 2I72A 1V92A 3NI9A 1NV9A 3FLJA 1BVIA 4WP5A 1TF1A 4G3VA 4GHOA 3STDA 1GHPA 3Q81A 4FCVA 1BRIA 2LH0A 2IWDA 3K9PA 4CISA 4LF8M 2P9VA 4NXFA 2O0YA 1MPLA 1GD4A 1OAOC 2BJVA 4MBKA 1QUSA 2LB5A 3MZDA 2JE5A 3VSLA 3LCUA 3B3XA 3WHOA 1MX0A 2DWMA 4HM4B 2XGNA 2YKFA 1E9SA 4PD2A 2APLA 3IT9A 1P97A 4OONA 3M0EA 1LOXA 3QP8A 3KFQC 2K0MA 2LQVA 2OOVA 5TBMB 2C10A 4QHCA 4DE0A 1JTDA 4NXGA 3UNWA 3HKPA 1CYVA 2OWJA 1DVDA 3F92A 2KF4A 3ZG5A 1B2MA 1N34M 2QBYB 3KFUG 1UGIA 2RNTA 1H0MA 3ITAA 3OLOA 4HP9A 2LWXA 1QAKA 1Q39A 2VK3A 3MKIA 5JI2E 3BB9A 4NHFA 3H82A 4QU3A 5HAPA 3CGWA 3IQAA 2BTFP 2WGIA 2HCBA 3FTEA 1VZZA 2DMWA 2EWVA 2GDNA 3N54B 5KSCA 1YT4A 1NJGA 3MHVC 3IH8A 2FXTA 3S67A 3NX0A 4HEFA 3A0VA 3OW22 4HM0B 5ITRA 4ZJ1A 2DZLA 1SPUA 1IQPA 3CI6A 2P08A 5GHYA 3T12B 4DR2M 1KQS2 1JNQA 1AUAA 1ERMA 4AZFA 3QP6A 3H7WA 2DNSA 3D4FA 4HHDA 2KNZA 3DBAA 4B7GA 2QZ6A 5LC6A 1BT5A 3BNEA 1Q2QA 1TH2A 4FMDA 2OWHA 3IF6B 4OLGA 3B7ZA 1TS6A 2WGWB 2R4IA 3UMMA 3B74A 4DR7M 2H0IA 4LGWA 1E3UD 3IBRA 4YWZA 1EIJA 2WSFF 2O3OA 3K7CA 5CF1A 4WMCA 2BWEA 2QKPA 2ZTCA 2X71A 4EV5A 3NOTC 1K55C 1M9GA 2QPAA 2ZOHA 3U6SA 1XJ3A 5G2GA 4FCTA 1FCMA 2MC8A 5EV0A 3M6AA 2QIYA 3KSIA 3T50A 4R4KA 4LJ5A 3VDPA 3HLCA 2F5WA 4LPZA 4ZPXA 4WFOA 4J5KA 1JR3A 4K61A 3LMMA 1YGWA 2WK0A 1E25A 4MCWA 1RNTA 3VOYA 3MPHA 5FQJA 3OWYA 3FWLA 1GA9A 5FSWA 1GY7A 1R4YA 2GNXA 4KZ3A 2Z2LB 4XK8F 3AMOA 4LF7M 1X0OA 3CHWP 1QAOA 1GCEA 1L3LA 2ZJ9A 3FTCA 5AQ7A 2RCDA 3NM2A 2QEX3 3NUVA 2WSCF 5FGOA 1B2SA 2V9AA 3E4OA 5M18A 3U6LA 3BRMA 2VF7A 4RF0A 3LYXA 5E26A 3EBYA 5HW3A 3SMSA 2OQEC 2W0QA 2B3TA 4N1HA 4E04A 4NPBA 4JYAM 3AGFA 3OOVA 3CNXA 5IHVA 3G35A 4BLCA 2F5QA 5DFXA 4EUZA 3K63A 1VQK3 4BB9A 1G02A 3CME3 7CATA 4MGYE 3G713 1T18A 3SMPA 1DETA 2CE7A 2KZUA 4GD6A 3W4QA 2JKFA 1W01A 1GL6A 3L29A 4WZ5C 3J7Yd 3MXSA 1UUWB 2O01F 4LRZE 1H3QA 4QNMA 1JB4A 3WHKA 4Q0JA 2CUZA 4CLCA 4N6TA 2MR9A 5EVHA 4QNRA 4WHAA 4B3SM 1O7MB 2E2TA 5CECA 4OVZB 2CG1A 1M1K4 3CLOA 1UCIA 3HHWA 2HPBA 4N92A 4AKHA 3SASA 4PKYG 4HJ3A 3PAEA 5EP3A 4Z1WA 5JYPA 2ZANA 4DXCA 1QZEA 1BVSA 5ITUA 5DKKA 4CHTB 4P0MA 2M5ZA 2XD5A 1NXYA 3GRRA 2OLUA 2E5LM 4HVNA 1T1CA 4R38A 4DKIA 5DTKA 3GLGE 3X3XA 5RNTA 2HMMB 2RL3A 4QHTA 1L1TA 3EJVA 1UWNX 1DYUA 3BNDA 3JR5A 4OOLA 1DO0A 3NM7A 5EXTA 2L4RA 4MH0E 4ARZB 3BFDA 1SARA 2UV0E 1RCKA 3M6BA 3HU2A 3GZYB 4KZ1A 3URPA 3AHSA 5D83A 2HMNB 2C96A 1ACFA 2XR0A 4J8TA 1N9NA 3VP2A 1Z5CA 3CF0A 1TS8A 2FFJA 1R2YA 3B8LA 1QDTA 1IT8A 4K0XA 2Q07A 5BU4A 4S2KA 2DI0A 3MJ5A 4IBCA 2V0WA 3KP0E 4L8PA 2OAQ1 1K54A 3TWLA 4OOYA 3LEQA 3G6E3 1RGZA 3WS5A 2L4VA 1L0DA 1EROA 4WEKA 3FTFA 1EKMA 1VEGA 2ZAMA 4OQIA 4AG5A 5CK6A 4ZRRA 5EP2A 3I563 1E94E 5AIGA 1NDOB 3V98A 3W0LB 4EUVA 2BWBA 1VG5A 1BSBA 3U60B 1SJWA 3MFXA 5EM0A 1QQWA 5G4ZA 2LVQD 3SATA 3LT9A 3V99A 3QAUA 2BIRA 2EFUA 4E3NA 2M7VA 3OV4A 2W3GA 2CMNA 3IHBA 4H6JA 4KQRA 4MEZA 3E21A 4MN7A 4AFIA 1J9MA 4LF5M 4LY6A 3QHYA 4RA7A 1N75A 1K3XA 1U5OA 3BU4A 2RGQA 4M4XA 3HLGA 4S2NA 5G1LA 2DXIA 3HJIA 2FGTA 5L10A 1FNNA 4DV2M 1PZOA 2O25A 5EXXA 2RRUA 3U6DA 2FFFB 2KRKA 4FH2A 1O7WB 3GECA 3LI8A 1WA9A 1Q9EA 5IG0A 3K3CA 2XROA 4HKVB 4L0LA 2PYRA 3NBIA 3DAVA 3MS6A 2CG0A 4B08A 3UJNA 1S5AA 9RNTA 2PD7A 4GMQA 3LQQA 4MJDA 3LR0A 2CWUA 4CJNA 1KE3A 4WF0A 3AGDA 4WWUC 1TS7A 1WNHA 1IXZA 3IF5A 3QP2A 1NHWC 4I5SA 4KZBA 4I3JA 5KIZA 1BOXA 3C8CA 5GHXA 5EOEA 5IS1A 2IY2A 5CERA 1S1YA 3D8BA 3BY8A 2HV1A 2NUPC 3Q1CA 1PRBA 1VQ63 1YLPA 3N6IA 1V34A 3O88A 3OBFA 3IWOA 1DGBA 2P9VB 2F5SA 4KENB 4NSOB 2WKIA 4JBFA 1JB0F 2XSSA 2J8XB 1IOUA 1ZMVA 1KSIA 3TPZA 3VF1A 3EC9A 1PI5A 3LTAA 2BLSA 3ZDJA 3GP1A 1Q3CA 4FCZA 2CW9A 1LV7A 4FSFA 1RU3A 4BMWA 3HI7A 4K0WA 4QD4A 1IKIA 4MMZB 3EHCA 2VLGA 2J7VA 2ZLYA 1DGHB 2DWLA 4IBEA 2BMQB 3DGOA 3HJQA 1QDRA 3OC2A 2IA7A 3SX1A 2JHEA 3ZQJA 4XT2A 4QOSA 5A2QS 1A0KA 2FNQA 5BVBA 5DF7A 1H5XA 3E98A 1T6OA 3H82B 4Y15A 2Q9MA 1JBTA 3T1RA 4R23A 1QVG2 1YJN3 3F1OA 3GDIA 2L7IA 1YAXA 1W8QA 3LIEA 5CGSA 4WYKB 5GLCA 5IREB 3HREA 1DMNA 3J2PB 1W79A 3O3VA 3GQ5A 2CRUA 4Z6YA 5KPTA 2XSOB 2WKEA 2ZM2A 1FZUA 4O3VA 2EA0A 4G4NA 1SXJC 1R4CA 3NBJA 3A3FA 2ZM6M 2KRUA 2HP9A 3VE4A 3FPWA 2J8YA 1BNSA 2EKKA 2HKJA 2BT3A 2Y0QA 4MDZA 1HVBA 4MM3B 3NECA 3H7WB 1BNGA 2JC7A 5EM1A 5L07A 3ZCBB 4NETA 2ZDJA 2UUGC 4WEJA 2KAAA 2EA9A 1ES4A 1IY2A 1RDSA 3N8LA 1R5LA 2Y91A 2O9CA 5FQ9A 4BJPA 4EETB 2VF8A 5DTSA 3L7HA 4I3IA 3DTMA 2KA6B 5TFQA 2Y2IA 4GEWA 5KQ8A 4RNTA 3VP0A 1N9LA 1FUWA 6GSPA 2CC3A 3W4PA 1XKZA 4P17A 4A3VB 1TVFA 3PNYA 3S5CA 5FDSA 2ZBKB 4HOIA 1S4SA 2EXBA 1YMXA 4HM8B 1IYYA 1NY6A 3HLFA 3HLDA 1CQSA 4FD2A 2B24B 2B95A 4M9ZA 5F5YA 2QENA 2ZMAA 1CI8A 4LJ8A 5HFOA 1WE4A 1TS0A 2XA7S 1T5YA 4HM7B 2X4AA 1CEGA 3RFBA 2LB9A 1Q7HA 5FTLA 1HR0M 2Y2MA 4QY5A 1QUTA 2W3HA 3CCV3 3J81S 1WMOA 2H1RA 2FOIC 4FCWA 3JVUA 4OQ0A 1EW0A 3EGDC 3GLFE 1W7FA 1I2WA 1SHVA 1FCNA 3UNLA 1WXQA 1I4WA 3FG4A 1H6UA 1Y28A 2XSZA 3PBRA 5KZHA 3VK8A 4B9OA 1F9IA 5TJJA 1G41A 2L1MA 1LL8A 2KEBA 4Q8IA 1OIPA 1QYRA 1K55A 2OQ4A 1L2CA 1VQ83 4IBXA 2B02A 3QNCA 3UE1A 3UPPA 4BLMA 2LVAA 2XH9A 1LXEA 1NV8A 2IUJA 5BPVA 4I5QA 3M7GA 1B21A 3I51A 3BFCA 1J7KA 1HQCA 5LC7A 2OOBA 4XDWA 3RFWA 1OFHA 3PBOA 1K57C 4LJ4A 1DY6A 3D8LA 4Q53A 4D81A 4YY3M 2Y8HA 3NY4A 1SXJE 4JF8A 3FC7A 1X1WA 1YLJA 3EEHA 4E3OA 4LMIA 3GLIE 4HZ9B 4WN5A 2CWTA 1IN6A 1ZMUA 4FR9A 1VEJA 1GS3A 2Z4RA 4P16A 5AJGA 2DNAA 2WAEA 3ECFA 1GMRA 4CLCB 1K41A 2KF6A 5F83A 3T1HM 4JF5A 2I7NA 2FS1A 2ZHXB 4B88A 3KXEC 1GABA 3NULA 3SARA 2CFLA 1YSPA 1B27A 1TH4A 1NRJA 1TIJA 2D1WA 4JI7M 1WJ7A 4FMBA 1BLPA 5KMWA 3RGAA 2OQEA 3A98B 2QHOB 4AKIA 3LGOA 3DMCA 3F40A 4L78A 4EEUA 5CHUA 2I9WA 1PJIA 1J2BA 1XXHA 3KS8A 1HD8A 3G4PA 1I70A 2A5YB 3VGNA 2B5RA 3I4YA 1JTGA 3QRDA 3DTKA 5LMNM 4HM2B 4KFDA 2RGHA 1PFPA 2W04A 3AFHA 1YPRA 1BRNL 3Q8XA 2YFJB 2CIUA 1LI9A 1O7HB 2M60A 1EG9B 3CPOA 1YVSA 4PKYA 2DAKA 4X68A 2RGOA 1CQAA 4RNZA 3AGNA 5D3OA 3ZNTA 3R7WA 2GNOA 1R7RA 3KYZA 1S67L 4WZ5A 3LQRA 3D5IA 3FF0A 1FUSA 1GA0A 5IW9A 1XJ4A 2VV8A 3UDXA 1FSWA 4BD1A 2DZNB 4UEYA 3LY4A 3ZQ5A 4IT7A 1W7CA 2EXAA 3X41A 1EE8A 4DBGB 4K90B 1R4GA 3VFHA 1ULJB 3FG1A 3HIGA 1ZQ9A 2Y20A 4LGMA 1MKMA 4KZ6A 4OP8A 4G3KA 5IF6A 1PI4A 4QWTA 4KLNA 4Y3IA 1C54A 5EP1A 5BR8M 1AQZA 1LSWA 5FSRA 4LZZA 1RKYA 3BQ8A 2ZTDA 3UZUA 5FI6A 4EBGA 2ZC7A 2EJSA 1Y54A 1C3BA 4X69A 1IQXA 4KT3B 1RGYA 2CC1A 1NZUA 2DCFA 4NXNM 1G28A 1TF0B 1S723 1JBSA 4OVDA 2HMOB 1G68A 5IENA 2Y59A 3F8HA 4OLDA 1OGXA 1XPBA 1RRHA 2JXNA 4NK3A 3CCS3 4EW7A 3SW1A 3CMZA 4B3RM 4MMYB 2PD8A 4EBLA 7RNTA 4H6JB 2ZQCA 5ITXE 5AIHA 4DDSA 1M904 2LXEA 2HWJA 3GMWA 5J3WA 3GPYA 1N5PA 3VKHA 4WZ4A 1O7PB 2R18A 2WKPA 1K25A 2ACGA 3GRJA 1JWVA 4KG2A 3IPTA 3JYIA 2ZC4B 3UJMA 1G3IA 4S12A 5HD3A 2HDRA 4STDA 4NC6A 3GWRA 2W1TA 4MBHA 1VQO3 3V3RA 3CTWB 4LRTA 1MJGM 1DV0A 1QAQA 2K3DA 1S66L 4NL4H 1ZG6A 1LSXA 4DE2A 4L8OA 1MXOA 1YGEA 2KDKA 3IBJA 3JVVA 1FUTA 1YJ93 2WUQA 5F6AA 3G16A 4KFFA 2K6BA 5D82A 4ZAMA 1Y4KA 4MB7A 4ZDXA 4KZ9A 1V9ZA 1TP6A 3TW8A 1T2HA 4CJ6A 1SIIA 3D4AA 5FTKA 1QMEA 1GD3A 2PNCA 1FGTA 3BFFA 2W82A 4FD8A 2F86B 1NJFA 4R9LA 2H28A 2LVNC 1I2GA 4LFAM 3CCU3 1IV7A 3WMDA 1P0ZA 1YLTA 3K0ZA 1G6OA 3F9SA 2V6ZM 3TDGA 3DFZA 1QAFA 3CMA3 1K56A 4D82A 4TX4A 3OPPA 4EU0A 3GO8A 1RGFA 5FI2A 4Y0UA 1UWPX 3MK6A 4JI4M 4MNRA 4S2OA 1OQYA 4GS9A 1VQP3 4IBDA 2J80A 1YLZA 4BTWA 5L8MA 3Q1FA 2V8FA 1G0TA 2R4EA 1SIHA 2YFQA 3ILKA 1XJ6A 1N9JA 3C7UA 2L09A 3Q2PA 4JXWA 4WYYA 4FCJA 5FW5A 2PZVA 1OTIA 2A24A 1PFLA 2DAIA 2HMJB 3UGJA 3H51A 2PR6A 1T43A 4XT2B 1HQYE 2O9AA 1KWIA 3HHZA 2CX1A 2GX5A 2QHKA 5AVFA 3ZYTA 3L2AA 3O5YA 2XSZD 1ULIB 1RN1A 1SZVA 1QALA 4U13A 1GYBA 4PCZA 1YVBI 2BHMA 3EEAA 3F1OB 3N7WA 4IJEA 3M2KA 1V58A 4DDYA 3H3HA 2WADA 3V5MA 2V1ZA 2XFTA 2ZAOA 3Q8GA 3KYQA 3ZCZA 4O02B 1ROVA 4CQHA 1Z59A 3E46A 3PTEA 4YOFA 3F1NA 2R46A 2K31A 3U61A 4H8RA 4RKUF 4LV2A 3HJSA 4EBNA 3W0FA 4N6LA 2KCDA 2K47A 3LEZA 3CITA 4LZIA 3K1JA 4HI4A 4DUYM 2V2FF 4JF6A 4X65M 3QYEA 1JNUA 3GLFA 3FKWA 1MU5A 2R4JA 1TTOA 1CH0A 5IG3A 3IHAA 4N9LA 1D7EA 2GJ3A 1F5MA 4PMAA 4JXSA 5C1BA 4H61A 3G31A 4JI2M 1YNVX 3SAWA 1YIJ3 2ZOIA 2C4BA 4UA7A 1XA7A 3V92A 4GOGA 5IERA 4GKUA 2ZC3B 3HLEA 3ALAA 3W67A 4DN0A 5DJTA 1RGKA 2HOHA 4K1UA 4ZTKA 1MOLA 1H8ZA 1BU4A 2D7EA 4WW0A 5CLKA 5FA7A 1B2XA 2FH5A 3GPUA 4G3WA 5DFYA 1OTDA 3UE6A 1T1AA 1XNRM 2YQZA 4Y17A 1VEUB 4G4RA 5CXWA 4II7A 3MQ0A 1OH0A 4DR4M 1MGWA 3JUOA 1SXJA 3KYEA 1B2ZA 1D6YA 4Y13A 3VMAA 2QCUA 1L8QA 2OPFA 3GLIA 1OJGA 1ES5A 3T8UA 1JQJC 1XFQA 2QSFX 1IYQA 1XGIA 3F8XA 3NC8A 4LG2A 1NWZA 3LYGA 1PYYA 3UB7A 4L8RC 3VFFA 3QK9A 4UQIS 1ZV1A 1US1A 1SKOA 1D0MA 4XUZA 2XFSA 2GBXB 3OXAA 1IELA 1ONHA 3FH1A 1LNIA 1KE0A 1FOFA 5IU1A 3FYCA 4JXVA 1RCLA 3BNBA 2QZ4A 1OF5A 1JWZA 4L9EA 4NKPA 1ASKA 1NRFA 3GLHE 1K0KA 4E3JA 5A91A 1NY5A 1A90A 4G6ZA 2KX6A 2B1XB 3IXHA 2G7UA 1MWUA 1K82A 2H0GA 2VQEM 3HVFA 2X01A 1RNBA 5EVIC 4LEHA 3LUQA 4XXRA 3SZTA 4X1MA 2E2UA 2Y2QA 3A5EA 2VGLM 3IMAB 1PNEA 2J3TD 5EUAA 3UL5A 4JI3M 4B7HA 4F2LA 4A5RA 2QNJA 4LGYA 1STDA 5KP4A 2ZQAA 1FA3A 3GQ3A 1GY6A 2D01A 2EO2A 1GJTA 1T1BA 5TGFA 4JI1M 1SCWA 4PM6A 4WM9A 1HTZA 3B4OA 4Q0IA 3HZJA 3MFDA 5CGWA 4XB5A 4J9AA 3CUEC 3TL4X 5HAQA 2XRXB 1NSFA 3PNVA 2A2LA 1NB3I 2YX9A 3B7NA 4HM5B 4FH4A 2QGUA 2VJWA 3G34A 4R1GA 4B93A 4M9XA 1YSQA 1O7NB 3PR6A 4Q7JA 3DY5A 4JI5M 4R3AA 1PRQA 2XDMA 5ITQA 2UWXA 1XXHB 3EF8A 3SS5A 1HNWM 1RGLA 6STDA 3IS2A 4PAUA 1HJPA 2Y74A 3ISGA 1K57A 1RN7A 4GC9A 1V9YA 5IG4A 2JY7A 1E3VA 2H0TA 1IN7A 4NXBA 3R7WB 2RFRA 2ZL1A 1QVF2 2XF3A 3MQQA 2ZM8A 3ZHHA 1G6AA 5L2FA 3Q3FA 4QPRA 1L0EA 4LENA 3LTBA 3IF6C 1VM1A 3AOGA 1PJTA 3RE8A 3VKGA 1F2KA 1OT6A 2MJ6A 2PT7A 4R0QA 3HJ8A 3KIIA 5CHJA 4HEOA 3CU3A 1ESUA 4OPQA 5DF8A 1JBRA 2P05A 2PBYA 4MBFA 1L0GA 3AOEA 3HZPA 2E8JA 2EFXA 2Z7AA 5AEUB 3C2WA 1KVLA 3JUNA 1NB5I 1TDLA 3CCR3 3HLWA 1Z5BA 1GHIA 4L7KA 4N6UA 4JLFA 4DV7M 2ML5A 3IJEB 3GVBA 3SS3A 1S0WA 2KXGA 3B42A 1B20A 2BG1A 5KQDA 4E3IA 3IHPA 2N35A 2CEAA 3LXUX 3KN4A 5HOHA 1BYWA 3VV4A 5GLDA 3PAGA 2OTL3 2CHCA 4GHIB 4OKPA 1Z5AA 4CIZA 5HX9A 1HNXM 2R62A 3GPPA 2Y73A 3PS8A 4GCZA 3T4LA 1HZOA 1I94M 4GW9A 3ZH9B 3I0YA 2KOIA 4XDVA 2K54A 3GQ4A 2CFDA 4PDGA 3U6PA 1D6ZA 1G4AE 1GMPA 1AV4A 3A46A 2CHVA 2W1TB 2IUKA 3DGMA 4ORLA 1S1ZA 3LIFA 3IWQA 3C30A 3BM6A 1IYOA 2QJ5A 1KYIA 2JKTI 1PGYA 5I97A 2ZQ7A 2Z3XA 3WOEB 5FDHA 5BOHA 2C11A 3UE0A 2G8LA 4BBAA 1IBKM 1UUVB 4HM1B 1OTEA 3D3OA 2W6JH 4RX2A 3BYDA 3C3EA 1I0VA 1TDGA 4RVAA 4CCVA 3UB6A 2YFLB 3K9OA 4WLAA 4BWIA 2O9BA 1LL5A 3WHLA 3T15A 1UUGB 4X64M 1ALQA 1QMFA 4FMAA 2DHRA 2WYXA 3CC23 2FH0A 2DHYA 1UW1A 4JXGA 4IBBA 3CC73 3G0KA 4GS9B 4IBRA 1PZPA 2QP9X 2Z2MB 3K8ZA 4R70A 4Y2FA 4AW4A 3LW5F 2OLVA 1G59A 3FPVA 1BSGA 1JZDA 1K28A 2B18A 3N8SA 5G4YA 3A76A 3SOIA 1L5GB 1JKGA 4HM6B 1AWIA 4NG2A 3DZDA 4LRSA 1D6UA 1TRQA 2L7HA 3B4PA 1CF0A 2P0MA 2A24B 4YINA 3SVAA 4OPZA 3IX4A 4GL6A 3A0SA 3EGXC 3HHXA 1QZMA 1C7HA 2ZQDA 3G32A 2CP8A 3BBZA 3CCJ3 4IUKA 3TWKA 1IFYA 4HZBB 2VIIA 1WGNA 2AADA 1UI8A 1NY0A 3KDSE 3S22A 1OKSA 2CFWA 1I5QA 2O5RA 5GHZA 1Z1SA 1RJOA 2L2DA 1IV9A 3HJKA 3WS4A 2C9CA 1W8YA 4LFUA 2F98A 5F82A 3OX9A 4R1KA 3F1NB 3U61B 1EUIC 3KSXA 3EQQB 5BXQA 4DR5M 3BLMA 2CK3H 3MKFA 3F14A 2GSPA 3LICA 2R78A 3SAUA 2M7OA 1HNZM 2C99A 2UGIA 1Q2PA 5HWTA 4WMCD 1N9OA 1STFI 2D7GA 3SH8A 3CCE3 1E32A 3CXC2 3TWMA 4HJ4A 2PBDP 1JWPA 4X6TA 4B4XA 3MMHA 4GRIA 3VSYA 3MG2A 3FYDA 5IZ7D 4NXEA 1PWCA 2BNKA 1JN5A 5E43A 5A0OB 2UXDM 1X1UA 1JR3D 1BGSA 1L0FA 3CPTA 1ONGA 2OOAA 4KUKA 5HARA 4F3LA 3S28A 1NHGC 2PHYA 1MC0A 3F1PA 3LR5A 2Y2NA 3NIAA 4FWHA 1FGMA 5AEWB 2KF3A 4Y0TA 4ME4A 1LOWA 1ZMWA 1OACA 3RH8B 4EW5A 4RYEA 5AQAA 3KE7A 4M9SA 3FKEA 3HIIA 5FTMA 4X56A 3LH4A 2LTUA 1CI9A 1N5HA 1FCOA 1OPXA 1XGJA 5EJCA 5CTMA 1TH3A 1UGHI 3IG8A 3S7PA 5F3WA 4FWDA 1BUQA 3EBTA 1CEFA 1IEMA 5E6JA 3GZRA 3U5ZA 3JUPA 2DENA 4MLLA 4XGIA 2VDBB 1ESIA 3RGPA 3WRTA 1TJDA 3I01M 1M40A 1OF5B 5E2GA 2PR5A 3UMEA 3LMLA 4K1VA 3FRHA 1BTLA 1N78A 3Q7ZA 1RCJA 5A90A 4GSPA 4HYZA 1MWSA 4RNAA 4JRFA 1W2ZA 2HDUA 5EFWA 4S2PA 4DE1A 1I2FA 2Y2PA 3FE3A 3AGOA 3T1SA 2KNAA 1ZTUA 1F98A 2HP5A 3BY9A 1XNQM 4CLCD 4E3MA 4BIRA 1EQKA 3BJNA 1K3WA 1N32M 4OOMA 5IG5A 1NNVA 2NUTC 3K5TA 3KOXE 2F5NA 4Z8XA 1H8YA 4AKGA 3PCRA 3LCEA 3C4PA 4PPRA 1JB5A 2Z76A 4HLQA 3CNMA 4E3LA 5CRFA 3ZFZA 1OMEA 5ITYA 1SG9A 1A2KA 1HYFA 3SHFA 1IQ8A 3U1WA 2WZZA 2O9UX 5U47A 2KLIA 2JWSA 3KCHA 2FNAA 4I39A 2UXBM 3SBJA 5FEFA 3GV9A 4P6ZM 1UI7A 1PWDA 2GEYA 1YQSA 1UGUA 4D60A 1IXSA 3FD9A 2YNMD 3R8FA 2PRFA 4ID4A 2DWZB 4EYCA 1LLBA 3AMOB 4EWFA 3QYBA 2LNHC 4DE3A 5EVIA 1HLUP 2HJ9C 3EX9A 2EWWA 1YLYA 3UB9A 1LRAA 2WZXA 2Y2GA 3ZNYA 3KW6A 4OW0A 3MWZA 3T8NA 2ZL1B 4GIPA 2VQFM 5KP1A 1IKGA 3UB1A 2HF6A 3LY3A 1FR6A 3HU1A 3A3EA 1MBLA 4WP2A 1STZA 2BMRB 3A42A 4MMXB 5EECA 2QBYA 1IU7A 1W6CA 4IBFA 4PM8A 1DO2A 3GLGA 4DRTA 5DYIA 3W8KA 5GL9A 2HAKA 2JA2A 3CWFA 3FG3A 3PXPA 4JKTA 3VDUA 1VQ93 3N8RA 3S1YA 1W4NA 4GDNA 1J3WA 2Y2HA 5FAOA 1VQN3 3SYKA 1JVJA 3NQYA 2OTJ3 1LOVA 1UFZA 4MMNA 1OTAA 5JYOA 4I3AA 3T4OA 8CATA 1J09A 4L15A 2H5SA 2L4FA 2CX0A 5GSPA 5A8BA 4G1MB 2MJ5B 2BMOB 1LHYA 2Y2JA 5GKNA 4H3UA 2WGVA 2CWVA 4S2LA 1BUJA 3SH9A 3GSPA 3N9HA 3PFIA 4FOFA 1R2ZA 1J5EM 3MXQA 1VEKA 1ZAEA 4HJ6A 4IVIA 3QWLA 1W5SA 4GKKM 3NBXX 1OGZA 3OWSA 3R4KA 2ZD8A 3IF6A 1QAMA 1GJSA 2CV0A 1FQGA 1IVUA 3DTEA 4EBPA 3CCM3 3BFGA 2F4YA 1KE4A 3B33A 3KO6A 3KZTA 1PW1A 1A2PA 1KDSA 1E4DA 2XQZA 2EUCA 3V3SA 2K9DA 2G2WA 5EE8A 5FATA 4KO8A 4WELA 1G8PA 3TOIA 2KW0A 4B3MM 3BECA 1YKDA 4Z9QA 1GHMA 3LIDA 3NCKA 5MC7A 1LI0A 2HGVA 3GSGA 3SOYA 5J7EA 3KS4A 4PT5A 2FE8A 5EPHA 3D9YA 4N3VA 3T0UA 2EX2A 4X2OA 5FEGA 1D1JA 4MGHA 2R9XA 3DA1A 2Y4AA 2MH8A 2JKRI 3U6QA 5TGNA 1IK3A 4IEDA 2ZMVA 4ITQA 5AIIA 5ELJA 1K8A4 1BSEA 1L2DA 2A3UA 3BNCA 3EQUA 4GJ4A 2LHGA 4CLCC 4NRVA 1GVNA 1XWIA 1YJW3 1Q824 3RXWA 3SHGB 1LT0A 4DF6A 4I8OA 3GRDA
chains in the Genus database with same CATH topology
4ZBEA 1JB2A 1YE9A 4IBJA 5EQTA 5EP4A 3RGRA 4D2OA 3FUUA 3BOSA 1BULA 3N8BA 4BQMA 5CEBA 4GB5A 3CF2A 3B7CA 4OPRA 3FZWA 3CF6E 1JKGB 1TDHA 1ROAA 1OHOA 5AI1A 1TFKA 4QB8A 5F1GA 5DREA 5M1AA 4LJ9A 1SQWA 4GKJM 2WKHA 3GR2A 1XHBA 4RF1A 3FGYA 3PGBA 3WS1A 3Q07A 1JJ22 2ZC5B 3I7JA 2I7PA 4GHLA 1N33M 2Y55A 1E3UA 3G2ZA 4OVZA 2AHMA 2Z6BA 4KVHA 1XMQM 4HL4A 1GY5A 2DVWB 1WTHA 4EXRA 1YHQ3 4OH0A 3L28A 2BJWA 2V1LA 1R6BX 3PBQA 3O87A 1ERQA 2J7OA 2Z77A 2W2CA 5DYGA 2HDSA 3N4IA 1F8NA 4DV6M 5CEDA 1WYBA 4ZM8A 1L2BA 5JPPA 3NDEA 3JUQA 5HL1A 3GQZA 3WRZA 3C58A 4UHUA 3ZG9B 1YI23 4U0XA 1VQ73 1EI5A 1IXRC 4XBTA 1EWZA 1RP5A 3OPLA 1W2B2 3OPHA 1NU3A 2DWNA 4TUWA 4IJFA 2Y2KA 3I553 3DGNA 2KXEA 1MKIA 1VQM3 2WOFA 4KODA 1MY8A 5FTNA 3P09A 2KZSA 4KZAA 1ES2A 1RRLA 1X37A 4KG6A 3O8YA 4X53A 1KFVA 1NO3A 3NHXA 1NJ4A 4OVMA 3WA3A 4RZMA 3U5ZB 4AQYM 4M0DA 1K38A 3OCNA 3U60A 5EQLA 1NYMA 2CFOA 3JAMS 4EV4A 3IXGA 3G30A 3V39A 2Y21A 1LNHA 1IVVA 3VK7A 3VLFB 4FMCA 1VQ53 2XZFA 3HWSA 1KDWA 3L0RA 5G18A 3FCSB 1DJBA 1AVKA 5E2EA 2GU1A 4OP5A 3A3IA 3EIHA 8CHOA 2UX0A 4S2JA 1D2NA 1WYCA 2W9QA 2XK1A 2BO9B 2P0XA 4UAAA 4REZA 2YR0A 3AL0C 4RNYA 2J9PA 5KPZA 2GXFA 3FSDA 4DV0M 3MZFA 3IH9A 1OHPA 1FGRA 1BUEA 2RCXA 2G5GX 3OTOM 2Q2EB 1N8QA 1KGFA 2R45A 3DWZA 4HBTA 3MG1A 3HLBA 4IVKA 3U97A 4BL2A 4MGKE 1UM8A 4ZJ2A 3VP1A 1Q40A 3ROBA 1OFIA 1OPYA 1DMMA 3HGIA 4YFMA 4PM7A 3D9RA 1IXSB 1K734 4IBIA 1Z6FA 1Z6TA 4B4ZA 2STDA 3ZGAB 1YM1A 1YLWA 4EV2A 3NBLA 5EVIB 3MBZA 3VFDA 2JQ5A 4LCBA 1LVNA 3X42A 3U6CA 1A67A 4LF4M 1MWRA 1SDEA 4O2HA 2D7HA 3Q7VA 3RGSA 3UE3A 4C6YA 5CXOA 1W02A 1XC8A 4KZ4A 5CGXA 1DGHA 1KVMA 3J7AS 1M1XB 3GAXA 3O86A 1IBMM 1MWTA 1K6RA 2CV1A 2ERCA 3GLGB 1U8CB 4M3KA 3DZLA 1N4OA 3PVSA 2KRTA 2Z4SA 5STDA 4WYKA 4HJLB 3C7VA 4LV0A 3T1YM 3MG3A 3SH7A 3CC43 3ZG0A 3OPRA 1S3SA 4G4QA 3WOFB 5AIFA 4P6BA 4OX9M 4LZJA 3UDFA 3GZBA 4PDIA 4RBNA 2RSXA 1OHSA 4UA9A 3AJIB 3SAVA 1IVXA 4MEIA 1JRQA 2EX8A 3PBNA 5FI7A 3LO7A 3S27A 3S29A 4EQIA 5EXSA 3RXXA 4I81A 1ZC2A 2CH9A 4JN6A 5DVAA 3KP1E 4IBGA 3JVCA 3FUVA 1Q42A 5HGRA 3FUTA 1IY1A 5ITXA 4AG6A 2P09A 4Y0OA 3X40A 4L4UA 3OCLA 4R7GA 2E8IA 4HESA 5A93A 4R9KA 4JPMA 1W00A 4LFCM 5FASA 3WS0A 2CV2A 4GNUA 1K56D 4IBKA 3NXJA 2QA43 3MZEA 3DOAA 3EE1A 4XBYA 2VGJA 3AGEA 3RDEA 1NJI4 2DRWA 3U6EA 3RJUA 1I2SA 4FVMA 2W03A 2IMJA 3DWKA 5D81A 2INXA 3CCQ3 3F7XA 1IM2A 3FV7A 3CD63 3E4RA 2R65A 1NZOA 2FFYA 5IEOA 2JCHA 4RX3A 2L6OA 1W6GA 2J9OA 5H37D 1E97A 1A2VA 4S2IA 5KP3A 1U60A 1CK3A 4DV1M 4DV4M 3BLSA 3M8CA 5JI3E 5TR7A 3TQSA 4JV5M 3CCL3 4R3DA 3PBSA 4JI0M 2Q9NA 1FJGM 1N9BA 5ELUA 1O7EA 1L2SA 5CF2A 1L1ZA 3NQZA 2X8AA 3Q82A 1K4FA 5IWAM 1YMSA 2V1CA 2ZQ9A 1SDNA 2OV5A 4GITA 2CFGA 2UU9M 1LL9A 5HAIA 1K9M4 1IYSA 3GTCA 1ES3A 1E3RA 3E2LA 4NREA 1O7GB 3IG5A 4JXJA 1ZKJA 4NSRA 2F5OA 3SEDA 1W5TA 3UPNA 2GU3A 2QPNA 3QNBA 3LOYA 3TG9A 4BD0A 1WMPA 1QMAA 1XXMA 3B9PA 1M6KA 5EOOA 1SXJD 5DRVA 3M2JA 4FCMA 3CJMA 5DTTA 4NXMM 4MGIE 4KQOA 5FQKA 4GC5A 4G4OA 1YUBA 1K4EA 4S2MA 3J80S 3CG5A 4KHPM 5EXPA 4LCMA 2W56A 1IN5A 2RKOA 5LMUM 4P87A 3L25A 2GBWB 5KPRA 1BLHA 5EEOA 4N9KA 3KSJA 4E3KA 5E2FA 4KZ5A 3DW0A 1G96A 1IT7A 5KO3A 1VQ43 3A3JA 3TE6A 3JR4A 2IWCA 4PEJA 5ITTA 2JBFA 2HL7A 4N6MA 4N6NB 4M0WA 3K9MC 3EN8A 2PU2A 2P38A 4GHAA 2OWPA 1ISKA 2XLNA 2VGKA 4KQQA 3KOWE 1V74A 4OPYA 3GLFB 1TFOA 4N6V0 1TU5A 3WDGB 4XM4A 4DV5M 3UK6A 4DR1M 2ZC6B 3EB8A 3NV0A 3E2KA 3GLHA 4D80A 1CEWI 4KG5A 4ZJ3A 1IDPA 3NBBA 4AKYA 2X49A 2GEXA 4X66M 1IVWA 5FLXS 3V50A 5IEPA 2ZL8A 4DXBA 1N77A 4X62M 4XUXA 1GKIA 3CPW2 4E6XA 1GLNA 1BLSA 1SXJB 3FTDA 2WGQA 1VQL3 5DNYA 4DR6M 1Q40B 4QOZC 5DF9A 1YSYA 3GLIB 3KOZE 4BTXA 2CHQA 3UO9A 2QMIA 1OUNA 3IWIA 4GZBA 2F99A 3DM8A 2WAFA 2HP6A 3Q7VB 2Z7JA 3P98A 2LYXA 5FQQA 2F5PA 4YHHM 3UN7A 4IPBA 4O7DA 3T38A 1W6YA 3PBTA 2XEPA 3Q90A 5A92A 3L27A 2C9OA 3KOYE 3VP3A 5KSHA 5I94A 3WS2A 1DGFA 3PZWA 3C5AA 3KSPA 1DJAA 4PM5A 4CPKA 3S4XA 4BENA 1QJGA 1DJCA 3U6OA 2OOVC 5M19A 1AVLA 4MGZE 4OU7A 2V20A 4KZ8A 2UXCM 3IXDA 4JF4A 3MHEA 2OCTA 1NYYA 4JI8M 1OJLA 4GH9A 1IYPA 2PU4A 1PW8A 3UY6A 3R9XB 1VQQA 3MXRA 4HBRA 2IWBA 1IBLM 3J7BA 3HUOA 3SLUA 3SS4A 2NQ8C 1JV2B 4AI6A 1AXBA 2UUBM 1HU9A 1PIOA 2W9PA 4B3TM 3ER7A 3SOAA 3SFZA 3GPXA 3AV0A 3DGLA 1HT2E 1Q814 3CZDA 2CKFB 1HKXA 2XGLA 3FF2A 4BL3A 1HT1E 5AYSC 4UA6A 1K6SA 4WBGA 4LV3A 5E2HA 2C6WB 1CYUA 4CDLA 1XX2A 1GL7A 1NNUC 1BZAA 2Y2LA 1DGGA 3SC3A 5CHMA 1NVMA 3ZC7B 1TUHA 3SXXA 5FQIA 3GRUA 1ORYB 1O07A 4XBOA 3WODG 5J8XA 3WA2X 3FUXA 2G2UA 3PCSA 2XSHB 4B7FA 2EX6A 1KGEA 3VSKA 1Q3BA 1KGGA 3FYZA 3K2LA 2Y2OA 4DV3M 1WMNA 3I4VA 1N9EA 3G8ZA 5IT9S 3HK4A 1XA1A 4WURA 1NNJA 1W5ZA 2ML6A 3NDGA 1N36M 4XBXA 2WGWA 3MKEA 3LT8A 2F4VM 3GRVA 2EX9A 2SBLA 4X2HA 2ZQ8A 3HHYA 4FCFA 3ZVTA 2YFIB 2H10A 3A3DA 2XR8B 3FKVA 3G2YA 1ZO2A 3NWLA 4N1XA 3E9SA 7STDA 5FAQA 4IIWA 3U6MA 2WO0A 1ZG4A 2C98A 4DR3M 4QHSA 3LTCA 4NOOB 2XD1A 2DZOB 3J27B 3MSOA 5F1FA 2A49A 4R4RA 1TGUA 3AOEC 3X3YA 1W5DA 4EIWA 3KVWA 2P5TA 2CFKA 3PYJA 1PJJA 2UUAM 3KKGA 1FSYA 5AYRB 4PM9A 2WGOA 1TEMA 4OK0A 3EQVA 4KZ7A 2JDIH 4C3QA 2C5RA 3DXOA 1BLCA 1TDZA 4LGQA 4BTYA 1T3TA 2P74A 3BFEA 4X55A 4CGYB 3AKZA 3HBRA 4O8SA 3L26A 1N8R4 2X02A 5GLBA 3A45A 3F7SA 1PWGA 2XZUA 4HM3B 2W56B 3ZG8B 3OZHA 2WOHA 2OSUA 3WWXA 3VOZA 3NBRA 1OCVA 2HDQA 3EN1B 4C75A 3THGA 3ITBA 3TSGA 2HMKB 4W5WA 2R9WA 4R4SA 1Q864 2BNGA 4FW9A 5FQMA 4LV1A 4F94A 4LFBM 1PM5A 4OUQA 1DVCA 1K54C 4LJAA 2C5WB 4L16A 3EIEA 1KSFX 4I4KA 5EVLA 3FKAA 4R3JA 3LZAA 1DMQA 3HUMA 1C1KA 1XP4A 2V1UA 4LJ7A 3M6HA 1FR1A 3NV0B 3C4OA 3GLHB 2MF7A 2CHGA 3G4S3 3W4OA 2Y0TA 1JN5B 2ZM0A 3SYLA 1SKFA 3LVVA 1IN4A 3D3LA 1Q7Y4 4K91A 4QJGA 1VDDA 4DUZM 3OWUA 3PXMA 3IXBA 4S2NC 1S6RA 4IIAA 1IQYA 1ZX2A 5EVID 5AQBA 3VP4A 3ZVWA 2J7NA 3HU3A 1XMOM 1QVRA 1WQLB 4LSOA 4LF6M 4U0TA 3KSED 5FTJA 3FUWA 1FGQA 3LVWA 5C18A 4N6OB 3UPOA 5JBSA 4K0KM 1PU4A 3BEBA 3BLZA 4R3BA 4GB7A 3X3ZA 4NRWA 4R80A 4Y7PA 1YIT3 4JI6M 2E2VA 1NWWA 3DUKA 3HX8A 4AKZA 4AEQA 4LF9M 3ZG7B 5CTNA 4FWGA 3GZXB 3JUMA 2XLJA 2A15A 1E9RA 3GRYA 3K92A 4GDBA 3MYTA 1KD14 4GN2A 3HUNA 4P85A 4E6WA 1IY0A 4EC6A 3PXGA 4OQHA 1MNLA 4I4LA 5AQ9A 1EA2A 4HBUA 2HHHM 3UL6A 5FAPA 1AR0A 4OQGA 4KFEA 5JPUA 3FZCA 4LJ6A 3UDIA 1FGOA 4U3TA 4GD8A 1QANA 1IN8A 4LCLA 3H4MA 2D42A 1KC84 5GLAA 3LTDA 2H0YA 3E99A 2UUCM 2HMLB 3HL9A 4QY6A 2I72A 3NI9A 3FLJA 4WP5A 3STDA 1GHPA 3Q81A 4FCVA 2LH0A 2IWDA 4CISA 4LF8M 2P9VA 1MPLA 1GD4A 2BJVA 4MBKA 3MZDA 2JE5A 3VSLA 3B3XA 1MX0A 2DWMA 4HM4B 2XGNA 1E9SA 4PD2A 3IT9A 4OONA 3M0EA 1LOXA 3KFQC 2K0MA 2LQVA 2OOVA 2C10A 4QHCA 4DE0A 1JTDA 3UNWA 3HKPA 1CYVA 1DVDA 3ZG5A 1N34M 2QBYB 3KFUG 3ITAA 2LWXA 1QAKA 1Q39A 3MKIA 5JI2E 3BB9A 4NHFA 5HAPA 4QU3A 3IQAA 2WGIA 2HCBA 3FTEA 1VZZA 2GDNA 3N54B 5KSCA 1YT4A 1NJGA 3MHVC 3IH8A 2FXTA 3S67A 3NX0A 4HEFA 3OW22 4HM0B 5ITRA 4ZJ1A 1SPUA 1IQPA 5GHYA 4DR2M 1KQS2 1JNQA 1ERMA 4AZFA 2DNSA 3D4FA 4B7GA 2QZ6A 5LC6A 1BT5A 3BNEA 1Q2QA 1TH2A 4FMDA 4OLGA 3IF6B 2WGWB 2R4IA 3UMMA 4DR7M 1E3UD 2O3OA 3K7CA 5CF1A 4WMCA 2X71A 4EV5A 1K55C 1M9GA 2QPAA 3U6SA 5G2GA 4FCTA 1FCMA 2MC8A 3M6AA 2QIYA 4R4KA 4LJ5A 3VDPA 3HLCA 4ZPXA 4WFOA 1JR3A 4K61A 3LMMA 2WK0A 1E25A 3VOYA 3MPHA 5FQJA 3OWYA 3FWLA 1GA9A 5FSWA 1GY7A 4KZ3A 2Z2LB 3AMOA 4LF7M 1QAOA 1GCEA 2ZJ9A 3FTCA 5AQ7A 2RCDA 3NM2A 2QEX3 3NUVA 5FGOA 5M18A 3U6LA 3BRMA 4RF0A 5E26A 3EBYA 5HW3A 3SMSA 2OQEC 2W0QA 4N1HA 3AGFA 4JYAM 5IHVA 3CNXA 3G35A 4BLCA 2F5QA 4EUZA 3K63A 1VQK3 4BB9A 3CME3 7CATA 4MGYE 3G713 3SMPA 2CE7A 2KZUA 4GD6A 3W4QA 1W01A 1GL6A 3L29A 4WZ5C 3J7Yd 3MXSA 1UUWB 4QNMA 1JB4A 3WHKA 2CUZA 4N6TA 5EVHA 4QNRA 4WHAA 4B3SM 1O7MB 2E2TA 5CECA 4OVZB 2CG1A 1M1K4 3HHWA 2HPBA 4N92A 4AKHA 3SASA 3PAEA 5EP3A 5JYPA 2ZANA 4DXCA 5ITUA 4CHTB 4P0MA 2M5ZA 2XD5A 1NXYA 3GRRA 2OLUA 2E5LM 4HVNA 4DKIA 5DTKA 3X3XA 2HMMB 2RL3A 4QHTA 1L1TA 3EJVA 1DYUA 3BNDA 3JR5A 4OOLA 1DO0A 3NM7A 5EXTA 4MH0E 3BFDA 3M6BA 3HU2A 3GZYB 4KZ1A 5D83A 2HMNB 2C96A 2XR0A 4J8TA 3VP2A 1Z5CA 3CF0A 2FFJA 1R2YA 3B8LA 1IT8A 4K0XA 2Q07A 4S2KA 3MJ5A 4IBCA 3KP0E 4L8PA 1K54A 3TWLA 4OOYA 3G6E3 1RGZA 3WS5A 2L4VA 1L0DA 1EROA 4WEKA 3FTFA 1EKMA 2ZAMA 4OQIA 4AG5A 5CK6A 5EP2A 3I563 1E94E 5AIGA 1NDOB 3V98A 3W0LB 3U60B 1SJWA 1QQWA 3LT9A 3SATA 3V99A 3QAUA 2EFUA 4E3NA 3OV4A 4KQRA 3IHBA 4MEZA 1J9MA 4LF5M 4LY6A 3QHYA 4RA7A 1N75A 1K3XA 1U5OA 2RGQA 3HLGA 4S2NA 2DXIA 2FGTA 1FNNA 4DV2M 1PZOA 5EXXA 3U6DA 2FFFB 2KRKA 4FH2A 1O7WB 5IG0A 4HKVB 4L0LA 3NBIA 2CG0A 4B08A 3UJNA 1S5AA 4GMQA 3LQQA 4MJDA 2CWUA 1KE3A 4CJNA 3AGDA 4WWUC 1WNHA 1IXZA 3IF5A 1NHWC 4I5SA 4KZBA 5GHXA 5EOEA 5CERA 3D8BA 3Q1CA 1VQ63 1YLPA 3N6IA 3O88A 3IWOA 1DGBA 2P9VB 2F5SA 4KENB 4NSOB 2WKIA 4JBFA 1KSIA 3TPZA 3VF1A 3EC9A 1PI5A 3LTAA 2BLSA 3ZDJA 3GP1A 1Q3CA 4FCZA 2CW9A 1LV7A 4FSFA 3HI7A 4K0WA 4QD4A 1IKIA 4MMZB 3EHCA 2J7VA 2ZLYA 1DGHB 2DWLA 4IBEA 2BMQB 3DGOA 3HJQA 3OC2A 2IA7A 3SX1A 4QOSA 5A2QS 2FNQA 5BVBA 5DF7A 1H5XA 2Q9MA 4R23A 1QVG2 1YJN3 2L7IA 5CGSA 1W8QA 4WYKB 5GLCA 5IREB 3HREA 1DMNA 3J2PB 1W79A 3O3VA 3GQ5A 4Z6YA 5KPTA 2XSOB 2WKEA 2ZM2A 4O3VA 2EA0A 4G4NA 1SXJC 1R4CA 3NBJA 3A3FA 2ZM6M 2KRUA 2HP9A 2J8YA 2HKJA 2BT3A 2Y0QA 1HVBA 4MM3B 2JC7A 3ZCBB 4NETA 2ZDJA 4WEJA 1ES4A 1IY2A 3N8LA 2Y91A 5FQ9A 4BJPA 5DTSA 3DTMA 2KA6B 5TFQA 2Y2IA 5KQ8A 3VP0A 1FUWA 2CC3A 3W4PA 1XKZA 4A3VB 1TVFA 3PNYA 3S5CA 2ZBKB 2EXBA 1YMXA 4HM8B 1NY6A 3HLFA 3HLDA 1CQSA 4FD2A 2B24B 4M9ZA 2QENA 2ZMAA 1CI8A 4LJ8A 5HFOA 1WE4A 1T5YA 4HM7B 2X4AA 1CEGA 5FTLA 1HR0M 2Y2MA 4QY5A 3CCV3 3J81S 1WMOA 2H1RA 2FOIC 4FCWA 4OQ0A 1W7FA 1I2WA 1SHVA 1FCNA 3UNLA 1WXQA 1I4WA 3FG4A 1H6UA 3PBRA 2XSZA 5KZHA 3VK8A 1G41A 4Q8IA 2KEBA 1QYRA 1K55A 4IBXA 2OQ4A 1L2CA 1VQ83 3QNCA 3UE1A 3UPPA 4BLMA 2XH9A 1LXEA 2IUJA 5BPVA 3M7GA 3BFCA 3I51A 1J7KA 1HQCA 5LC7A 4XDWA 3RFWA 1OFHA 3PBOA 1K57C 4LJ4A 1DY6A 3D8LA 4Q53A 4D81A 4YY3M 3NY4A 1SXJE 4JF8A 4E3OA 1YLJA 4LMIA 4HZ9B 2CWTA 1IN6A 4FR9A 1GS3A 2Z4RA 4P16A 2WAEA 3ECFA 1K41A 5F83A 3T1HM 4JF5A 2I7NA 4B88A 3KXEC 3SARA 2CFLA 1TH4A 1TIJA 2D1WA 4JI7M 4FMBA 1BLPA 5KMWA 3RGAA 2OQEA 3A98B 4AKIA 3DMCA 3F40A 4L78A 5CHUA 2I9WA 1PJIA 1J2BA 1XXHA 3KS8A 1HD8A 3G4PA 2A5YB 3VGNA 2B5RA 3I4YA 1JTGA 3QRDA 5LMNM 4HM2B 4KFDA 2RGHA 1PFPA 2W04A 3AFHA 3Q8XA 2YFJB 2CIUA 1LI9A 1O7HB 2M60A 1EG9B 3CPOA 3ZNTA 4X68A 2RGOA 5D3OA 4RNZA 1R7RA 4WZ5A 3LQRA 3FF0A 1GA0A 5IW9A 3UDXA 1FSWA 4BD1A 2DZNB 3LY4A 4IT7A 1W7CA 2EXAA 3X41A 1EE8A 3VFHA 4K90B 1ULJB 3FG1A 3HIGA 1ZQ9A 2Y20A 4LGMA 4KZ6A 4OP8A 5IF6A 1PI4A 4QWTA 4KLNA 5EP1A 5BR8M 5FSRA 4LZZA 1RKYA 5FI6A 3UZUA 4EBGA 2ZC7A 1Y54A 1C3BA 4X69A 1IQXA 2CC1A 1RGYA 1NZUA 2DCFA 4NXNM 1S723 4OVDA 2HMOB 1G68A 5IENA 2Y59A 3F8HA 4OLDA 1OGXA 1XPBA 1RRHA 4NK3A 3CCS3 3CMZA 4B3RM 4MMYB 4EBLA 2ZQCA 5ITXE 5AIHA 4DDSA 1M904 2LXEA 3GMWA 3GPYA 1N5PA 3VKHA 4WZ4A 1O7PB 2R18A 1K25A 3GRJA 1JWVA 4KG2A 3IPTA 3JYIA 2ZC4B 3UJMA 1G3IA 4S12A 2HDRA 4STDA 3GWRA 4MBHA 1VQO3 3V3RA 3CTWB 4LRTA 1QAQA 4NL4H 1ZG6A 4DE2A 4L8OA 1MXOA 1YGEA 1YJ93 2WUQA 3G16A 4KFFA 5D82A 4ZAMA 1Y4KA 4MB7A 4ZDXA 4KZ9A 1TP6A 1SIIA 5FTKA 1QMEA 1GD3A 2PNCA 1FGTA 3BFFA 2W82A 4FD8A 2F86B 1NJFA 4R9LA 4LFAM 3CCU3 1IV7A 3WMDA 1YLTA 3K0ZA 3F9SA 2V6ZM 3TDGA 3DFZA 1QAFA 3CMA3 1K56A 4D82A 4TX4A 3OPPA 3GO8A 5FI2A 4Y0UA 3MK6A 4JI4M 4MNRA 4S2OA 1VQP3 4IBDA 1YLZA 4BTWA 3Q1FA 2R4EA 1SIHA 2YFQA 3ILKA 1N9JA 3C7UA 2L09A 3Q2PA 4JXWA 4WYYA 4FCJA 5FW5A 2PZVA 2HMJB 3UGJA 3H51A 1HQYE 1KWIA 3HHZA 3L2AA 2XSZD 1ULIB 1QALA 4U13A 1GYBA 4PCZA 1YVBI 2BHMA 3N7WA 4IJEA 3M2KA 4DDYA 3H3HA 2WADA 3V5MA 2V1ZA 2XFTA 2ZAOA 3ZCZA 4O02B 1ROVA 1Z59A 3PTEA 2R46A 3U61A 4H8RA 4LV2A 4EBNA 3HJSA 3W0FA 4N6LA 2KCDA 2K47A 3LEZA 4LZIA 3K1JA 4DUYM 2V2FF 4JF6A 4X65M 3GLFA 3FKWA 1MU5A 2R4JA 5IG3A 3IHAA 4N9LA 4PMAA 4JXSA 5C1BA 4H61A 3G31A 4JI2M 1YIJ3 3SAWA 4UA7A 1XA7A 3V92A 4GOGA 5IERA 4GKUA 2ZC3B 3HLEA 3ALAA 4K1UA 4ZTKA 1MOLA 1H8ZA 2D7EA 4WW0A 5CLKA 5FA7A 3GPUA 1XNRM 2YQZA 4G4RA 5CXWA 4II7A 1OH0A 4DR4M 3JUOA 1SXJA 1D6YA