2XEPA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
428
structure length
419
Chain Sequence
b'SVPTPAEAALAAQTALAADDSPMGDAARWAMGLLTRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 135
structure length 419
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xepA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xepA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xepA02
3A3IA 1M6KA 4H8RA 3G35A 3WS4A 3ZHHA 3ZCZA 4PM7A 5CEBA 1NZUA 1KVMA 5KSCA 1CI9A 4OPYA 5FQJA 2X01A 2OLVA 4EWFA 4OLGA 2ZQ9A 3ZVWA 1EI5A 2Z2LB 1FCOA 3GTCA 3MZEA 4GKUA 4KZ3A 1ZC2A 5D3OA 4FH2A 4R4RA 5M19A 3MFDA 3V5MA 1KVLA 4PM6A 1KGEA 3VFFA 3G4PA 4WBGA 4KZ9A 5FQKA 1IKIA 4KG2A 3UE3A 3C5AA 4R3JA 5FA7A 5GHYA 1K6RA 2Y2NA 4A5RA 3PTEA 3TOIA 1E25A 2ZQAA 2V1ZA 1H8ZA 3DWZA 1FR6A 3FZCA 4ZTKA 1BLPA 5FI6A 3SH7A 4XUZA 4BQMA 1YLWA 2H5SA 3DW0A 4S2KA 3VOZA 5CHUA 2HDRA 3RXXA 1E3UA 3ZVTA 1ERMA 4WYYA 1TDGA 1MWSA 2UWXA 1MXOA 3MBZA 4OP8A 2Y2PA 3M2JA 1GHIA 5E43A 1EROA 3ZG7B 4EUZA 5A91A 4GZBA 2ZC6B 2WKIA 1K38A 1LI0A 4OP5A 3C4OA 3HL9A 3N8LA 1MBLA 3VMAA 2ZQ8A 4X55A 3IHAA 1IYQA 3OPLA 1EWZA 2ZMAA 3O87A 2XGNA 4R1GA 5F82A 4WEKA 4N1HA 5HARA 2XF3A 3IH8A 4JF5A 4IBRA 4DXCA 2BLSA 1RGZA 2VGKA 4KQOA 2QZ6A 2ZC7A 3NDEA 4OOYA 4JXSA 4X56A 2RL3A 3EQUA 3VP4A 4S2LA 4E3LA 3IT9A 1PYYA 3A3DA 3ITBA 4P85A 2OLUA 3MZFA 3V3RA 3RJUA 5CEDA 5F83A 5E2EA 3E2KA 3ISGA 1JWVA 4PM8A 3OCNA 1L0FA 1SDNA 4OOLA 2P74A 4OH0A 5FI2A 1Q2QA 3BM6A 5E2FA 3OPHA 1YLZA 1HZOA 2C5WB 3C4PA 4ZDXA 1PWGA 2V2FF 3A3JA 3MKEA 1ZG6A 3GVBA 1W79A 1KDWA 1NY0A 3IF6A 2XD1A 5FAQA 4RX2A 4OPRA 3FKWA 1JTDA 4BL2A 1HVBA 1K56D 3QNCA 3FYZA 1IYOA 5E2GA 3OPRA 3PBTA 4RA7A 3IF6B 4OQGA 5DF8A 3ZGAB 3FWLA 4FSFA 3OZHA 3NBLA 5CGSA 5CHJA 1N9BA 2FFFB 2EFUA 4JF6A 5EPHA 1K56A 4PPRA 5FI7A 1BUEA 2V20A 3GV9A 4LV3A 3WS1A 2PBYA 5DF7A 2Q9MA 4QD4A 1JWZA 1YLPA 4KZ7A 5EVIB 1KGGA 1PW8A 3G31A 3HVFA 4X69A 1IELA 3V50A 3ZG8B 4ZAMA 4QU3A 4ZBEA 4E3MA 4B4XA 3A3EA 1K6SA 1S6RA 2A49A 2WKHA 1ERQA 3V3SA 1H8YA 3V39A 3GMWA 3ZNYA 1WE4A 4KZ8A 1LLBA 4JXGA 1QMEA 1WYCA 1ESIA 2HDQA 2QMIA 1YQSA 3IXGA 5BOHA 4DF6A 3SS5A 4KZBA 2OSUA 3ITAA 1RP5A 1FCNA 3CG5A 5CGWA 5GLAA 3AGEA 3VP0A 1YLTA 3G30A 1HD8A 3BLSA 3IF6C 3BFEA 3WS5A 4IBXA 3N8SA 4BJPA 3S22A 3AGFA 1PZPA 2WGIA 3IXHA 4LCLA 3DWKA 4OQHA 4UHUA 2DCFA 4GOGA 4QHCA 1IEMA 2X02A 1LI9A 2EX8A 5I94A 1MWRA 3NY4A 2J7VA 3HUNA 1BZAA 5KMWA 2Q9NA 3N4IA 4UA6A 3ZDJA 2WGWA 4E3IA 4U3TA 5EVIC 2Y2HA 5E2HA 1K55A 5CTMA 4MBFA 5EUAA 1MWUA 1XA1A 3BFCA 4U0XA 1ES5A 3NCKA 3A3FA 3Q81A 2IWBA 4E3NA 1CEGA 4Y0TA 2R9WA 4LV1A 1DJAA 3VFHA 2B5RA 3OPPA 4KZ5A 3ZG0A 3MKFA 4UA9A 4WZ4A 5GLDA 5GLBA 1NYYA 2JCHA 4DKIA 5KZHA 2WK0A 1ES2A 5HAIA 1AXBA 3W4OA 3AGDA 4ID4A 4QY6A 2G2UA 4N1XA 1ESUA 4RX3A 5HX9A 1W7FA 2G2WA 3Q07A 5EOEA 3W4PA 4C3QA 4QY5A 1FR1A 3HLFA 4Z9QA 4WEJA 4E6XA 5FASA 3C7UA 2JE5A 3IWIA 4Y0OA 2XQZA 1YMXA 4GB7A 4WELA 4NK3A 1VQQA 5CERA 1RCJA 1KGFA 1YLYA 1ES3A 2WKEA 1OMEA 1L2SA 3SS4A 4DE0A 1XGJA 4BD1A 4F94A 3PBOA 4OOMA 4CJNA 3BYDA 5AQAA 2HDUA 2Y2OA 4X53A 1FSYA 2EXBA 5FATA 3NI9A 1E4DA 4ZJ3A 2C6WB 3UO9A 3WS0A 3G34A 5FAPA 1W8YA 2Y2KA 1NXYA 3QHYA 4GN2A 2WZZA 3G32A 3UY6A 1YM1A 1K55C 4Q8IA 1O07A 1PWDA 5JYOA 2A3UA 2XR0A 2DNSA 3B3XA 5HW3A 1DJCA 5GL9A 3UPPA 3RXWA 1NZOA 3O88A 1SDEA 3LEZA 1M40A 1RGYA 1Q2PA 4S2IA 1FQGA 4GNUA 1XPBA 1ONHA 1YLJA 3HLCA 4JXVA 4E3OA 3HBRA 2H0TA 2ZC5B 3BFDA 3O86A 3ZG9B 2RCXA 2Y55A 1ONGA 4O7DA 3BLMA 5FQIA 4N9LA 3UPNA 5CRFA 5HAPA 5A92A 3ZG5A 4NETA 1JWPA 4MLLA 4HBTA 2Y4AA 2Y2QA 3MZDA 2GDNA 3TSGA 4K91A 2R9XA 2Y2JA 4IEDA 2HP9A 4P87A 4R4SA 4BD0A 1GA0A 1PWCA 3W4QA 2IWDA 4N92A 4S2OA 4BENA 3VSLA 4GDNA 1JTGA 4C75A 3IWQA 2EX9A 4UA7A 4KZ6A 3SS3A 3FKVA 5KSHA 1BULA 3IXBA 1K25A 4HESA 4MNRA 3SH9A 3UN7A 1KE3A 1K54A 5U47A 1KDSA 3BEBA 4R0QA 1G6AA 2XLNA 3VOYA 3HREA 2FFYA 1DJBA 2I72A 5GHZA 2ZLYA 3UE1A 3GQZA 2J9PA 4RVAA 3VP3A 5TR7A 1LL9A 1MY8A 3PAEA 4B4ZA 3M6BA 3OC2A 1NRFA 5AQBA 4OONA 3LY3A 2IWCA 2XFTA 3VP2A 1LL5A 2XFSA 1S0WA 2H0YA 2P9VA 3CZDA 3FV7A 3Q7ZA 3NIAA 1KE0A 1FSWA 1W8QA 3QNBA 4KZ4A 3TG9A 5CECA 1XP4A 4DRTA 2XEPA 2ZJ9A 4OQIA 5DTKA 4C6YA 1XKZA 3C7VA 3S4XA 2WZXA 4EQIA 3E2LA 2X71A 2P9VB 1TDLA 4LCMA 5IHVA 4E3KA 3M2KA 2Z2MB 1PIOA 2ZC3B 4GD6A 1BLCA 2WYXA 1GHPA 3O3VA 4KENB 1BT5A 4JBFA 3HLWA 5CXWA 4P0MA 1K4EA 1ZG4A 2ZQ7A 3GSGA 1J9MA 2J9OA 4ZJ1A 4DDSA 2Y2GA 5FQQA 1H5XA 1SHVA 2WGWB 1XX2A 4OQ0A 4JPMA 3UE0A 2JBFA 3Q7VA 4YFMA 3N8RA 2J8YA 3PBRA 4KQQA 4P6BA 1K54C 3W8KA 4JLFA 3JYIA 2H10A 5FQMA 5L2FA 3LO7A 4FH4A 2Y91A 3IWOA 4GD8A 3IH9A 4PMAA 3P09A 3Q7VB 3D4FA 3Q1FA 3N6IA 4K0WA 3ZNTA 1K4FA 4DXBA 3EQVA 1WYBA 4LENA 1E3UD 2XK1A 3PBSA 5G18A 4KZAA 1I2WA 4LV0A 4XXRA 1GHMA 3LCEA 5EECA 3CMZA 3MXSA 4EBLA 3UNWA 4WM9A 3DTMA 5DTTA 5CHMA 2WAFA 4E3JA 2EX2A 2HDSA 1NJ4A 1CI8A 1IYPA 1ES4A 2WADA 2WGVA 2EFXA 4IVIA 4OPZA 1K57A 1XGIA 4S2PA 4S2NA 3HUMA 1GA9A 4MEZA 5M18A 3WWXA 2E8IA 2DRWA 1BLHA 3G2ZA 4OVDA 3SOIA 4WZ5A 1SCWA 4U0TA 1PZOA 1I5QA 3IHBA 3UDFA 2Y2MA 5F1GA 2HP6A 4KG5A 3CJMA 3SH8A 5GHXA 2ZQCA 4QB8A 5DVAA 4M3KA 1L0EA 4IVKA 4WMCD 1MKIA 4X68A 1BLSA 2CC1A 5JYPA 1XA7A 4PM5A 2Y2IA 2XDMA 4HEFA 1C3BA 4EBNA 1ZKJA 5HFOA 4OKPA 1QMFA 4X6TA 3GRJA 3IF5A 5EVLA 3UDIA 2WAEA 3OCLA 5A90A 1G68A 1MPLA 4Y7PA 1NYMA 3WS2A 4S2MA 2EX6A 4RYEA 4WMCA 3BRMA 4DE1A 1DY6A 1XXMA 2PU2A 5AQ7A 4KG6A 4ZJ2A 4QJGA 2Y2LA 3WRZA 4OLDA 4Y0UA 5DTSA 1GCEA 3UDXA 3NDGA 5TGFA 3S1YA 5HL1A 1I2SA 3WRTA 4D2OA 3VSKA 5F1FA 2WUQA 4K0XA 4R3BA 5FQ9A 4DE3A 1L0GA 3P98A 5EVID 1K57C 4JXWA 3HLEA 4S2NC 5CGXA 1KE4A 1YMSA 4HBUA 5A93A 3BECA 3MXRA 5GLCA 1TVFA 2BG1A 2ZC4B 4BL3A 3UPOA 5J8XA 5AQ9A 1JVJA 4JF4A 3PBNA 2Y59A 1U60A 4WZ5C 4UAAA 1N4OA 3LY4A 4B88A 1ALQA 1Y54A 3BFGA 1L0DA 3IXDA 5FSRA 2ZM8A 3HLDA 2ZM2A 1PI5A 1IYSA 4MBKA 2HPBA 5EVIA 1HTZA 5M1AA 5EE8A 4EBPA 1IKGA 2ZM0A 3I7JA 3PAGA 3ZFZA 3N7WA 1CK3A 1BTLA 5HAQA 5CTNA 1YT4A 1MWTA 2XD5A 3HUOA 2VGJA 2QPNA 4GDBA 4OPQA 5FDHA 2ZQDA 5DF9A 1W5DA 2PU4A 4XUXA 2JC7A 2ZD8A 5TFQA 2HP5A 4MBHA 4S2JA 5FAOA 1Z6FA 3BFFA 3G2YA 1FOFA 2OV5A 3VP1A 2EXAA 4R23A 4BLMA 4KQRA 1LHYA 3IQAA 3Q82A 4LV2A 4FCFA 1PI4A 5EOOA 3NC8A 1CEFA 4L0LA 4PM9A 2XH9A 1SKFA 1TEMA 3PBQA 3HLBA 4FD8A 3GR2A 3M6HA 1O7EA 4DDYA 4E6WA 1VM1A 4CPKA 1FCMA 1PW1A 4N9KA 1BSGA 3HLGA 4YINA 4DE2A 4EV4A 4JKTA
chains in the Genus database with same CATH superfamily
1RN4A 1LVNA 4H8RA 5FLXS 2O01F 2KNAA 4M9XA 2W3DA 1CI9A 2HWJA 4OPYA 3K2LA 3GRYA 2DHRA 1OT9A 1ZV1A 3TRCA 3MG3A 2OLVA 4EW7A 3KSGA 3Q82A 3LZAA 3MZEA 2X8AA 1HLUP 1C1KA 2WKPA 4FH2A 5D3OA 4FR9A 1KVLA 1CYUA 5DFLA 1XJ2A 2GBWB 4Q0HA 4ITQA 1WTHA 2JKRI 4RNAA 2BWEA 1Q02A 4WBGA 3VOLA 3UE3A 3B4OA 1RGCA 2JZ1A 5LMNM 4R3JA 5GHYA 4IJFA 3H51A 1K6RA 3V92A 2Y2NA 1MGRA 1BSCA 2P05A 4JGQA 1E25A 2QYBA 3GRVA 1XXHE 4XUZA 3T4QA 3DW0A 4ETXA 2JKRM 3VV4A 2HDRA 1IN4A 2O0YA 3RXXA 4WYYA 1QAMA 1BNGA 2M7OA 3G4S3 3F1NA 5L07A 1KYIA 2Z77A 4JRFA 2LVPC 1GHIA 3I0YA 1EROA 4EUZA 1Z6TA 4YWZA 4LFCM 2YFLB 3UJMA 1K38A 1LI0A 3C4OA 3HL9A 4OP5A 1IXSB 4XBTA 2W1TA 4PKYA 3FTCA 4NC6A 5IEOA 1D7EA 4EEUA 2ZMAA 1G3IA 3W68A 4LF4M 1FNNA 3FZWA 3T12B 4JF5A 4LPZA 1I8VA 1EEJA 3EF8A 2BJWA 1MNLA 1I0XA 3RGSA 1TRPA 2QZ6A 4JXSA 3EQUA 3JVVA 1BAOA 4WURA 2R45A 1A2VA 2W56B 3IT9A 2DXIA 2DWZB 1VB6A 3MG2A 4P85A 3CWFA 1FGRA 4LLOB 4IBEA 4IBJA 3CPOA 4OOLA 1R4GA 1HKXA 4N6V0 3RFWA 1M904 1Q2QA 1VEUB 2I7NA 3GZXB 4TX4A 1HZOA 3MKEA 2CK3H 3LIBA 3LYGA 1ZG6A 3DMCA 4NSOB 2F4VM 1RHLA 1IVXA 4G1MB 4OPRA 6GSPA 2UUGC 2CV2A 3KVWA 3X41A 2K31A 3QNCA 2ML5A 1SIHA 2A5YB 1A0KA 1NJFA 1S67L 3VFDA 2IA2A 4CCVA 1YNVX 3BU4A 4RBNA 3ZGAB 1L2DA 4KUOA 5D83A 3OZHA 4HM3B 3FE3A 2FE8A 3A0VA 4WN5A 2D7HA 3L26A 2XSSA 2KAAA 3LI8A 1OTBA 1X0OA 9RNTA 1NY6A 3BOSA 3GV9A 4LV3A 1LNIA 1F9IA 4DV0M 1IM2A 2Q9MA 5DF7A 2C96A 4QD4A 1VETB 1JWZA 1YLPA 1AWIA 1KGGA 4O01A 1PW8A 4X69A 3Q2PA 1DGFA 2B3TA 3U2AA 3SHFA 4EV5A 4B4XA 4E3MA 2V1CA 1S6RA 2A49A 3V39A 4YOFA 1OJLA 4LZZA 2Q0OA 3PR6A 3CITA 2C9OA 3ZNYA 2VF8A 4KZ8A 3SHGB 1ESIA 2KRUA 3CCQ3 1YQSA 3IXGA 3GPPA 3DGLA 5BOHA 4L9GA 4DF6A 4PT5A 1CH0A 1N36M 1F4IA 4HM0B 5I97A 1IK3A 1NY5A 5CGWA 4ZRRA 1ZGXA 4R6LA 3EBTA 4GC5A 3BLSA 2B18A 1NNUC 4W5WA 3KSFA 2M60A 4LCLA 2L2DA 3RGAA 3S7OA 2UXCM 4GOGA 3FC7A 3V99A 3WMDA 2IY2A 1LI9A 3TWKA 3QP1A 1NWWA 5IERA 2A2LA 3PS8A 2J7VA 2Q9NA 3N4IA 3ZDJA 3Q8GA 5HGRA 2A24A 3FUXA 4E3IA 2C99A 4LFBM 3E98A 2Y79A 3IX3A 2YNMD 2HJEA 1MWUA 1Q9EA 1GMQA 4U0XA 1KC84 3A3FA 2IWBA 5AEUB 4UEYA 3U6DA 1CEGA 3AFHA 2LNHC 2R9WA 3ZCBB 4LV1A 2B5RA 4OK0A 4BBUA 3MR0A 1M1K4 1NV9A 3J27B 3H82B 2WK0A 2ZTCA 1I2FA 3H4JA 3C38A 3W4OA 3AGDA 1QDTA 1TH3A 1VZZA 4QOZC 4GHLA 2G2UA 4QHSA 2CH9A 2LTUA 1FIKA 4WFOA 1W7FA 2G2WA 3T4OA 1IYYA 3W4PA 3PGBA 4S12A 1GJTA 1HNXM 4C3QA 4NRVA 1IT7A 4O0PA 1QQWA 3CF2A 4WEJA 3C7UA 3RNTA 2L0WA 4Y0OA 2SBLA 2J3TD 3T38A 1RSNA 4NK3A 1VQQA 1RCJA 3GQ3A 4AKIA 2WKEA 3VE4A 1CUKA 4FMDA 4L8PA 2KF6A 1TS8A 3LCUA 2R41A 5BXQA 2X49A 2DWNA 2D42A 1VQN3 2L09A 2JP7A 4NEED 2ZMFA 4X53A 3MQOA 1B2XA 3WS0A 3G34A 4PAUA 1EG9B 1A5TA 3DA1A 1N33M 4GN2A 1N9NA 2BJVA 4LF7M 1VEGA 2WZZA 3G32A 2RCDA 5BIRA 2JZ0A 2L4FA 3D79A 3LQQA 3M6AA 2DNSA 5G4YA 5JYOA 2CFKA 5GL9A 5HDSA 2QHKA 4AFIA 3GWRA 2XSZA 1W5TA 2KZSA 1Q2PA 4GNUA 4HP9A 1SKOB 4LZJA 3HLCA 4E3OA 2UXBM 1ULJB 3O86A 1Z09A 1UUGB 3JUNA 3LMLA 4Y5FA 5FSWA 1I2EA 5STDA 5CF2A 1C54A 3E4RA 3LFVA 3R7WA 4O7DA 3BLMA 1OFHA 1KSFX 3AOEA 4O2HA 4CGYB 4JI1M 2ZDJA 2AAEA 3RH8B 3B74A 1G8PA 2CX0A 2WZJA 5BPVA 2IA7A 1JWPA 1TS0A 4HBTA 2QCUA 1YPRA 3MZDA 2GDNA 3B7CA 1TH4A 3TSGA 1BVSA 1TS6A 2HP9A 2Y0QA 2C98A 4FCVA 1IQPA 1DRMA 4G3OA 3SW1A 2LBCA 3UGJA 2JKTI 1C7HA 1O7WB 3AMOB 3OWSA 4KZ6A 1R6BX 1C7YA 5BVBA 2H0IA 1BULA 4KQDA 4WL9A 3BNCA 2KF4A 4LFUA 2JY8A 3GSPA 2PBDP 2BU4A 4P17A 2I7PA 3BQ8A 1SXJD 1OTEA 1OHSA 1OF5A 3BEBA 4IBIA 1S1ZA 2XLNA 3VOYA 2E8JA 2FFYA 2XZUA 2I72A 1TH2A 2ZBBA 3UB5P 3GQZA 3A0RA 2OOLA 2HHHM 3GLFA 1YAXA 3KX0X 3DH2A 1G02A 2BNGA 3E4OA 3LY3A 1Q864 2IWCA 3HY5A 3VP2A 1WXQA 1SXJA 2HOHA 3T4JA 3LYXA 3CZDA 4KZ4A 3AJIB 5CECA 2W3GA 2ZOHA 3NX0A 2W27A 3C3DA 2V1UA 1P9WA 2ZJ9A 4DRTA 1GO5A 1BVIA 3VK8A 3MPHA 3S4XA 3GO8A 2MJ5B 4EQIA 2BMRB 4ESPA 1YHQ3 2ZL1B 4LF8M 3M2KA 3CXC2 1IQ8A 4GKJM 4GL6A 4R3AA 3N54B 1BLCA 4AG6A 1GHPA 3HLWA 4MGIE 1LNHA 2F5WA 7RNTA 3UMMA 2V1AA 1I94M 1OGXA 4B7HA 2LQVA 3DTEA 4HHDA 2JHEA 1H5XA 4N3VA 1SHVA 1W2ZA 3KXEC 4KT0F 5DRVA 1XX2A 4OQ0A 4JPMA 1Z59A 3FRHA 4NSRA 2W03A 1JKGA 2JBFA 3N8RA 2J8YA 2VF7A 3FD9A 2C5RA 1K54C 3FF2A 5LC6A 4KQQA 1GKIA 4JV5M 1G0TA 4X1MA 4FH4A 1FUWA 4I81A 3IBRA 4OW0A 3TPZA 1S5AA 4GD8A 3IH9A 2PT7A 4WWUC 3K2NA 3SAVA 4NHFA 5JPPA 3P7NA 3D4FA 1YIT3 3GLHB 1STDA 4DV4M 3K3DA 3V76A 2UX0A 3CPW2 1SPUA 3PBSA 5C18A 4LV0A 1G41A 3AHWA 2W82A 1P3QQ 3N9HA 3UMEA 2ZL8A 3B89A 2F56A 4LGQA 3R4KA 5CHMA 4E3JA 1UFZA 2EX2A 2ZAOA 2HMJB 1W63M 5HL6A 1NJ4A 5EP2A 1OTRA 3IS2B 1IY1A 1IQYA 1VQ73 1XGIA 3ROBA 4S2NA 3HUMA 3C3EA 4X2HA 1NJI4 4LJ9A 4MEZA 3BWLA 5M18A 3DFZA 4Y28F 2QGUA 1S3SA 3KZTA 3UZUA 1BSBA 2Z4SA 3SZTA 3T4KA 1GLNA 3W0FA 4J5GA 2CX1A 2JY5A 3MKIA 1BNSA 4JI0M 3HIGA 3SH8A 2ZQCA 4AI6A 4L7KA 4QB8A 2WOFA 1L0EA 4M3KA 1P9RA 1BLSA 4PM5A 4HBRA 4EEPA 2DAGA 3JUMA 2IUKA 2VV6A 4LCBA 3IF5A 3TE6A 3UDIA 4GS9A 5A90A 4Y7PA 2JDIH 2EX6A 2ZOIA 3H3HA 1XXHB 1X1YA 1RN7A 1LSXA 1H8MA 1DY6A 2KEBA 4ZJ2A 2D7EA 3KP0E 1LRAA 1BUQA 2Y2LA 1T5YA 2OOAA 2V8FA 3UDXA 5TGFA 3MMPA 3TDGA 2HCBA 5HWTA 3SMSA 3GP1A 5FQ9A 1DE3A 1L0GA 5EVID 2ERCA 1K57C 4XM4A 5A93A 5EV0A 1UI8A 1D06A 3EWKA 4MGZE 3VK7A 5AIGA 1TVFA 3MXRA 1VG5A 3G6E3 2J3TC 4R9KA 4DR3M 2H0HA 2OWHA 4XDVA 4B88A 4MEIA 4UAAA 4QHTA 3BFGA 3U6EA 4H61A 4R9LA 1YJN3 3IXDA 1PI5A 5DJUA 4J8TA 5EVIA 1HTZA 3F1OB 1N9EA 3HHWA 4BBAA 3MSHA 2ZM0A 5TGNA 1I4WA 1MU5A 1BTLA 1V74A 1ZX2A 4CLCE 1YT4A 1HT2E 2CWTA 2QPNA 3CF0A 3JAMS 3HUOA 4OPQA 5FDHA 2PU4A 2HP5A 1R5LA 2MH8A 2QENA 4IIWA 3NV0B 2K54A 4MBHA 1Z6FA 3BFFA 1FOFA 4REZA 1YVBI 1TGUA 4JI2M 1EIJA 4L0LA 3T1SA 3DM8A 4BIRA 2L1MA 5ITXA 3HLBA 3PBQA 5EM1A 3GR2A 5L09A 3C9PA 1AV4A 3M6HA 2ZBKB 3HOHA 2UUBM 4DDYA 3T1RA 3EEHA 4E6WA 1N8R4 1BSGA 4YINA 5HPIA 1GY7A 3A3IA 1M6KA 1UM8A 1A90A 1NZUA 1GOYA 1DV0A 4WP2A 5KSCA 1H6UA 7GSPA 2LB9A 2X01A 1IFYA 2LH0A 2C10A 4O8SA 5EP3A 4DR4M 1EE8A 3D72A 1DP9A 1EI5A 4GKUA 5HWWA 1N32M 1GVNA 5M19A 3V5MA 3CGWA 2J7NA 2FOIC 3DZLA 1XNRM 1YI23 3R9XB 3U60B 4IBDA 1D2NA 4KZ9A 3HHZA 2W3EA 1UW1A 1IKIA 1LT0A 4KG2A 3C5AA 1SXJC 3LTAA 2YX9A 4HKVB 4HIAA 3PTEA 4HI4A 2L4RA 3T8NA 1PRBA 2M1CA 2V1ZA 1H8ZA 4HJ6A 3SH7A 2CE7A 1E9RA 1Q39A 3HCYA 1LTMA 5AEWB 1OFIA 1PM5A 1MC0A 4S2KA 5CX7A 1TDGA 4AQYM 2QJ5A 3LVVA 4GIPA 1QVF2 5ITYA 3NBRA 2CFGA 3MBZA 2Y2PA 4IJGA 3KSXA 3WODG 1W02A 2CFLA 1STZA 4H6JA 5E43A 3ZG7B 3EHCA 3EIEA 2ZC6B 5C5KA 5AYSC 3AGNA 3T0UA 3HJQA 4I8OA 2CG0A 4QPRA 1NLZA 3VMAA 1BNEA 3EIHA 4X55A 2ACGA 2ZMVA 1AUAA 3QWLA 1EWZA 3O87A 3LR0A 4RZMA 4FWHA 4N1HA 4DR7M 3GLGA 2W0NA 4IBRA 1NB5I 3A42A 1NDOB 2G7UA 4OOYA 2W1TB 3OV4A 4X56A 4DXCA 2Z8YM 1NHGC 2W0QA 2RL3A 4R4KA 1QVG2 3PCRA 4G3WA 1OPXA 4EQ1A 3MFXA 2F5PA 1JZOA 2OLUA 1O7PB 5F83A 5E2EA 3E2KA 2FXTA 3A45A 2CHGA 1L0FA 2VQFM 4OH0A 3OPHA 1YLZA 3BNBA 2C5WB 1QANA 1PWGA 4L15A 5IENA 3HX8A 4NREA 1NY0A 2B24B 4O02B 5IT5A 4RQ9A 1JTDA 3S7NA 3T1QB 1EFUB 4BL2A 1K56D 1S723 2QKPA 3BB9A 1RNBA 3FYZA 3SFZA 2CIUA 4AKYA 3OPRA 2VKSA 3A0SA 5ITXE 3MS6A 3FWLA 4FSFA 4DV5M 2CV1A 1STFI 2HKJA 1PJIA 5IU1A 4FWDA 4XK8F 3T1XA 5LBRA 3T4SA 4GW9A 3LMMA 1L8QA 1XJ3A 4K1VA 1MKMA 2FFFB 2GJ3A 1K56A 3IJEB 3LIFA 1K9M4 2V20A 3W0LB 4KHPM 1IVUA 2PR6A 3IMAB 4R38A 1F8NA 1JR3A 3H7WA 2VGLM 5TBMB 2B1XB 3G31A 3HVFA 1IELA 2XRNA 4QU3A 4ZBEA 3U61A 1QZEA 3A3EA 2KA6B 4QOSA 4P16A 1NVMA 2DAEA 1XNQM 1BRGA 3M0EA 1K6SA 2VA0A 4FCWA 2WKHA 2NUTC 3V3SA 3K92A 5ELJA 5FDSA 1L5GB 8RNTA 1B27A 3NOTC 4JXGA 1WYCA 2DMWA 2HDQA 4BWIA 3HU1A 3MHEA 4ORLA 3SS5A 1NNJA 1IBKM 1TIJA 2OSUA 1RP5A 3H9WA 4KZBA 1AVKA 1IN7A 3TWLA 4WYKA 3AGEA 1K82A 3JVCA 2F86B 3IF6C 4OU7A 3BFEA 2F98A 3ULFA 1PZPA 4LF5M 1QDRA 1BRIA 2HMLB 4OQHA 2XA7S 4UHUA 4WHAA 1NLYA 1CJFA 1IEMA 1V34A 2X02A 4I3AA 2EX8A 4DUZM 1Q814 1MWRA 5F5YA 2QWSA 3NY4A 5FTLA 3A46A 1BZAA 4DMZA 1ACFA 3VKGA 1FGMA 2WGWA 2F5MA 1VQ53 1T1BA 3F14A 5EVIC 3L25A 1G71A 2V1LA 5E2HA 4FUWA 4MBFA 1NU3A 1RRLA 1D6UA 4IT7A 4X62M 3CC43 3BFCA 3LGOA 3NCKA 4UQIS 3SLUA 4WF0A 1BNRA 5G4ZA 4NPBA 4LYLB 2Z7JA 3VFHA 3OPPA 4GSPA 3MKFA 3F7SA 3F1PB 4MN5A 1WJ7A 1NYYA 2JCHA 4D82A 2V0WA 5KZHA 2YFIB 2ZA4A 1ES2A 4KFEA 1DMQA 1OAIA 5FTJA 1AXBA 5HZHA 5IF6A 3DTIA 1NWZA 1ODVA 4N1XA 4RX3A 2EKKA 3L7HA 3LT9A 2R62A 3DZDA 4QY5A 3TE8A 3IG5A 2OTL3 1BSDA 1YSPA 5FASA 3VE3A 3V98A 2XQZA 1Q40A 4STDA 1KGFA 1IU7A 4X64M 1QAOA 3MJ5A 4K90B 2BTFP 2Y73A 2QEX3 1XGJA 5AYRB 1Z5CA 1MZUA 3PBOA 2FZ0A 4OOMA 4CJNA 4HNBA 5TJJA 1JBSA 2VQEM 3UO9A 1FSYA 2EXBA 4ZPXA 2R78A 3KSPA 1ZTUA 5AIHA 1KQS2 3QHYA 3KSHA 3BLZA 3UY6A 1MN3A 4Q8IA 4IJEA 1VEJA 2A3UA 1RGGA 3F8HA 4WLAA 2KDLA 3UPPA 2K3DA 1NZOA 3O88A 1SDEA 3LEZA 3U5ZB 3MQ0A 4LG2A 2PYRA 4S2IA 1CF0A 4LJ7A 1TFOA 4JXVA 1ORYB 5EP4A 2ZC5B 1HQCA 2JNHA 3ZG9B 2DENA 3NUVA 1RTUA 1G96A 3LQRA 1TFKA 3D8BA 3L2AA 1D6ZA 4NXGA 1GY5A 3UPNA 3U6MA 3SOAA 3ZG5A 2Y8HA 2BNKA 2JY6B 2W9QA 2JQ5A 1HNZM 4XBYA 1OTAA 2Y2JA 4IEDA 4P87A 4R4SA 4NXEA 2IWDA 3CCE3 3HJKA 1VQP3 4C75A 1JTGA 3OWUA 4ZM8A 1JQJC 3I563 3FH1A 1O7MB 1T6OA 4O8GA 3CUEC 3FTEA 5KSHA 4FOFA 4P6ZS 2KW0A 5IWAM 4MNRA 1Q824 4R3DA 1KE3A 4HJLB 1K54A 4NXNM 1KDSA 5U47A 3WA2X 4R0QA 1BRKA 2CUZA 3S67A 2CWBA 3GQ5A 3CCJ3 4HM6B 2ZLYA 3UE1A 3HI7A 3M6BA 3OC2A 2PD8A 4EYCA 4B4ZA 3I01M 4A3VB 4F2LA 5AQBA 3UMDA 2QSFX 3FCSB 1K28A 1OF5B 1VQ83 4DN0A 3E46A 3THGA 3MF0A 4G3KA 4YNRA 2P9VA 1E3RA 1WR1B 1JNUA 1KE0A 1G28A 4HOIA 1XP4A 5DYGA 4OQIA 3ZQ5A 4C6YA 5EQLA 1XKZA 3C7VA 1WMOA 2YR0A 4LCMA 4MMNA 1GOUA 3FTFA 5IHVA 2GX5A 3M7GA 2Z2MB 4Z1WA 1B2UA 2Z76A 4LRTA 2CHCA 4EW5A 1GJSA 1BT5A 2BASA 3IPTA 5CXWA 1J5EM 1T1CA 1K4EA 4HEOA 1ZG4A 2CEAA 1XB2B 3K7CA 4DDSA 2Y2GA 5HD5A 3RDEA 5BR8M 4DV2M 1DMNA 2AADA 5D82A 5EEOA 3J80S 2GU1A 1L3LA 2EA0A 3UE0A 2ML6A 3Q7VA 4YFMA 3PBRA 4RNZA 2XZFA 1Z5AA 3E99A 1UGHI 3LO7A 4CLCB 1CQSA 3LTBA 5JI2E 1QJGA 2P7JA 4MGYE 3WHLA 3F8XA 4PMAA 4G4NA 3QAUA 1JKGB 5ELUA 3P09A 1OCVA 2PNCA 3KE7A 3Q1FA 5ITQA 1D0KA 4LENA 1E3UD 4KZAA 3FPVA 1LSWA 3LCEA 2UUAM 1PFLA 1QAKA 1HZ1A 2RFRA 4BMWA 4EBLA 1TJDA 4MGHA 2QA43 4WM9A 3HHXA 1JZDA 5DTTA 3CPTA 3LUQA 1CI8A 1ES4A 2WADA 2WGVA 4OPZA 4IVIA 1V9ZA 3SAUA 1K57A 2QQ8A 2GEXA 2DAIA 5DYIA 3U4LP 3WHOA 4I5SA 5IEPA 3PCSA 1IXSA 2E8IA 2XGLA 1AIPC 2JY7A 2P5TA 1A2PA 3NBXX 4U0TA 7STDA 3UDFA 3IHBA 1XC8A 2Y2MA 3L0RA 4AEQA 1JN5B 2HP6A 3I4VA 3R8FA 4LEHA 4KG5A 3CJMA 2Z6CA 5GHXA 2JKFA 1SZVA 4IUHA 4EESA 3F7XA 1XJ4A 4D60A 4HAAA 1TU5A 1SARA 1MKIA 3TW8A 4GMQA 1LL8A 1BRSA 3EJVA 3VF1A 4M4XA 1LOVA 4EV2A 1IN8A 2OOVC 1C3BA 5CXOA 4JN6A 5HFOA 2ZM6M 3DGNA 1VEUA 2R4EA 2Y0TA 1MPLA 1NYMA 1XMQM 4RYEA 3MK6A 5DNYA 1AY7A 3HU3A 4DE1A 5A2QS 1ZS7A 4XBXA 2PU2A 4XBOA 4QJGA 2EA9A 3NHQA 4OLDA 4GS9B 3WRZA 1GCEA 1Y4OA 1QUSA 4EIWA 1IBLM 2FNQA 3GPYA 1KSIA 1Q3CA 5F1FA 5CLKA 3IECA 3A76A 1E9SA 1YMSA 3CCL3 2H1RA 4K61A 4HP4A 3LIEA 1VDDA 3PBNA 1U60A 4WZ5C 1N4OA 3X3YA 3LY4A 3L29A 1Y54A 3LXUX 3HWSA 5JBSA 2ZM2A 3J7Yd 1VETA 4MBKA 3EBYA 2ZAMA 5M1AA 1Q7Y4 5EE8A 3CU3A 1IKGA 1G4AE 3SX1A 5HAQA 3J2PB 1UGIA 5EFWA 5DF9A 1W5DA 4XUXA 3CHWP 1XFNA 3QYEA 2Q07A 4B9OA 2UU9M 3G2YA 4BLMA 4MJDA 3DGYA 4LV2A 4NOOB 2P04A 3NC8A 4L16A 1ZMUA 1X1UA 1OJ5A 4IBKA 2QPAA 4IUKA 1SKFA 1Z1SA 1TEMA 3RFBA 4B08A 4FD8A 3FYCA 3KOZE 1X1XA 2J7OA 7CATA 4FCJA 1GL7A 1EA2A 2AHMA 4CPKA 1PW1A 4HM5B 4DE2A 3NOPC 3U6OA 3URPA 1NHWC 4LGWA 2ZHXB 1YJW3 1T1AA 3G35A 3ZHHA 2G3QA 3ZCZA 1K3WA 2XR8B 4I4KA 4PM7A 1P97A 3S27A 2P08A 2JXNA 4AKHA 5FQJA 3F40A 4PKYG 4FW9A 4FD2A 5FEGA 4EWFA 4CLCD 5LC7A 1J3WA 4OLGA 3I553 1YIJ3 2Z2LB 3NWLA 1XWIA 5KQ8A 5G1KA 1FCOA 3GTCA 1NO3A 2D1WA 4FCTA 1ZC2A 4R4RA 3CCV3 2CFDA 3MFDA 4YHHM 4PM6A 5EJCA 1PYLA 3ZH9B 1YJ93 5AIFA 3VFFA 2FNAA 5HOHA 1LSVA 3H82A 1DGHB 1S66L 3U6QA 5FA7A 2STDA 4HOHA 3PZWA 4R1KA 1T3BA 5RNTA 1Z5BA 3HJIA 4A5RA 3PFIA 1K8A4 1CYVA 2ZQAA 4LGMA 3MSOA 2J80A 1OIZA 3OX9A 4NXBA 3FG8A 4ZTKA 4BB9A 1P0ZA 4GHIA 4QNMA 1YLWA 3TJZC 1BUJA 1N34M 2KF5A 5CHUA 4Y13A 1OTDA 1W6YA 1ERMA 4HYZA 3D8LA 3O8YA 1TDHA 2UWXA 1MXOA 2K2NA 2KDKA 3P01A 1L2BA 2QBYB 4BU4A 3M2JA 5G2GA 3QP2A 1UDII 1IBMM 5A91A 4Y3IA 4GZBA 4XB5A 2RRUA 3K9PA 3N8LA 3KKGA 1OKSA 1WGLA 1MBLA 1M1XB 3KOWE 5E26A 4GRIA 3K9OA 3IHAA 4XT2B 5H37D 3LH4A 3A5EA 2XGNA 4R1GA 2EO2A 1JB0F 4BLCA 2JKGA 5HARA 3IH8A 1IY2A 2BLSA 3Q90A 2ZC7A 3VP4A 4ARZA 4WW0A 4B3MM 2OPFA 4E3LA 2KX6A 3ICYA 1PYYA 2VEAA 3CNMA 3A3DA 3ITBA 2F5OA 3ALAA 1IY0A 1X37A 1S4RA 1X1WA 3V3RA 1PJJA 3GLFE 1JB4A 3RJUA 3ISGA 1YSYA 2BMQB 2IYJA 3OCNA 4NL4H 2GZAA 5E2FA 4ZDXA 3C4PA 2V2FF 1SXJE 2Z3XA 3A3JA 3BW6A 1KDWA 2GU3A 3SAWA 3IF6A 2XD1A 3FKWA 5FL3A 3QP5A 3ECFA 1HVBA 4L78A 2CFOA 2I9VA 1IYOA 1T2HA 1LQGC 1RGKA 1MOLA 1N8QA 5AI1A 3PBTA 1FGTA 4L6V6 5DF8A 1PRQA 2E2TA 3AMOA 3MJQA 3NBLA 5CHJA 1N5HA 1M9GA 3MXQA 4GH9A 4CISA 1I2GA 2EFUA 4BTYA 3EC9A 4EERA 4PPRA 1BUEA 1BNIA 3EB8A 2KRKA 2L7HA 2PBYA 3EGDC 1W7CA 3NBJA 1IV7A 1RJOA 3DOAA 4KZ7A 3GPUA 4KVHA 1YLAA 1K3XA 4NXFA 4O3VA 2N35A 3JVUA 3I4YA 1IXZA 2KZUA 4MH0E 4LFAM 1H8YA 3C2WA 5L10A 1QUTA 3GMWA 1J09A 2W6JH 5FTMA 4J5KA 1QMEA 2KOIA 2QMIA 5EVEA 1PJTA 3GZYB 5DKKA 3U61B 3T4TA 1CEWI 3ITAA 1BYWA 1FCNA 2HL7A 5GLAA 3GZRA 3BBZA 3IBJA 1YLTA 3G30A 1HD8A 2R44A 2OWPA 3G0KA 3WS5A 4IBXA 1IN6A 2WSEF 3N8SA 4LMIA 4BJPA 3S22A 1TRQA 3QYBA 2BHMA 5IG5A 4JI8M 4L8RC 2WGIA 3DWKA 4GCZA 1BSEA 1VQO3 3RTYA 1UI7A 4HH2A 3T1YM 4PDIA 1UUWB 4LRZE 1E97A 2MJ6A 4QHCA 4FCZA 1GOVA 5DFYA 5I94A 4MMZB 3HUNA 4JXJA 1D1JA 2GEYA 4UA6A 5ITTA 3CC23 4U3TA 2NUPC 1DVCA 3BXWA 2WGOA 4Z6YA 1RNTA 1RDSA 2OTJ3 3TWMA 1GMRA 2Y2HA 5CTMA 1GSPA 4XDWA 4DR6M 1XA1A 3F9SA 1LV7A 3FG4A 3K5TA 4HVNA 4ANRA 3KOYE 2EKFA 1NNVA 3MHVC 4MB7A 1NRJA 3ZG0A 1DJAA 2GXFA 1TD5A 4KZ5A 4UA9A 5GLDA 2DWLA 3GLHA 4DKIA 1XMOM 4L8OA 3VSYA 3I51A 4PEJA 4QWOA 1UCLA 5E6JA 3W2ZA 3NM2A 3GECA 5HAIA 4PD2A 1IDPA 3E4QA 4FTXA 4LJ5A 1US1A 5F68A 1ESUA 5HX9A 5FTKA 2DZOB 1LOXA 5EOEA 4Z8XA 3LTDA 1GD4A 5IG0A 3VDPA 2JE5A 3RGPA 3IWIA 3D5IA 4RF1A 1YMXA 4GB7A 4JI3M 5CERA 1T43A 2P38A 3FPWA 3QK9A 2L1SA 3BIRA 1ES3A 5GKNA 3KN4A 3F1NB 3KS8A 1OMEA 2G8LA 1JB5A 1L2SA 2CMNA 3CUEA 1RLSA 4H3UA 4I3JA 1UWPX 2O9CA 2WSCF 3OOVA 5AQAA 1HT1E 4JF8A 4HZBB 2Y2OA 5JI3E 1ROAA 4ZJ3A 1OACA 2C6WB 4BTWA 1A67A 3MQQA 1NXYA 4JI5M 3KDSE 1TTOA 1K55C 1VDLA 1O07A 3KOXE 1PWDA 2LVAA 4G6ZA 3B3XA 5HW3A 1DJCA 1PJSA 3RXWA 5EXSA 4CLCC 5KQDA 2K7SA 2VK3A 3U1WA 3V67A 4L9FA 1FQGA 1XPBA 1ONHA 2P09A 2H0TA 3HBRA 2K0MA 2Y55A 3VDUA 4IBBA 4L9EA 5FQIA 4N9LA 5CRFA 2Y21A 5HAPA 4NETA 4MLLA 1IOUA 3T4LA 2Y4AA 2CG1A 2Y2QA 3A98B 3HJSA 3GLIA 1W6CA 2LYXA 1PWCA 1R7RA 4BD0A 2XROA 1OJGA 4N92A 4BENA 1JNQA 3VSLA 2LHCA 4AKZA 2VV7A 3IWQA 3UL6A 1MGWA 2D7GA 2EX9A 4UA7A 3FKVA 5EVHA 4DR2M 1TR8A 3GRDA 3LIAA 2B02A 1OIPA 1QALA 3PYPA 1N5PA 3S7PA 1G6AA 3UE6A 5GHZA 2J9PA 4RVAA 5F69A 4LRXC 2GQFA 1LL9A 1MY8A 2R65A 2WKQA 4AG5A 2LVNC 3PNYA 2XFTA 1LL5A 2OOBA 2XFSA 4CJ6A 3LEQA 3E9SA 2H0YA 1I70A 1T2IA 1LXEA 3CAXA 3X40A 3TL4X 2UXDM 3FV7A 3NIAA 1FSWA 4Q0IA 1W8QA 3TG9A 4DR5M 4N6LA 3EQQB 1HQYE 2KHHA 4KO8A 1FUTA 3C8CA 3MG1A 5JPUA 2VX8A 3E2LA 4DV1M 4MM3B 4LJ4A 2P9VB 2X71A 1TDLA 4OX9M 5K5BA 5FTNA 3NECA 1KFVA 1GSXA 2ZC3B 3KSIA 4E3KA 2NQ8C 1YUBA 4OVMA 1VQ43 5ITRA 3O3VA 1NJGA 1GL6A 2RGOA 4RNYA 2A15A 4P0MA 3KYQA 3LOYA 1SQWA 6RNTA 1YVSA 5I5LA 3OWYA 3FKAA 3GSGA 2R18A 4K08A 1NB3I 4ZJ1A 2J9OA 5FQQA 4N6TA 2IUJA 2A24B 5A8BA 2E2VA 3F92A 1HU9A 3SYKA 2RNTA 3GZBA 1GD3A 3K8ZA 4M0WA 3GLGE 1VQ1A 2KNVA 5L2FA 4F3LA 3U60A 4X2OA 2Y91A 2ZANA 4LJ6A 3JUQA 2F5QA 2OOVA 1VQK3 1V33A 3SATA 4CDLA 3RGRA 3IWOA 3UK6A 3CMA3 3CI6A 4K0KM 3CME3 3Q7VB 4PHTA 4QNRA 1OUNA 3WDGB 1K4FA 2J8XB 2PDRA 4DXBA 1L2CA 3EQVA 1WYBA 2V9AA 2RKOA 1G6OA 3B42A 4HLQA 2JWSA 4NRWA 1GHMA 5EECA 3HKPA 4II7A 3MXSA 1B2ZA 1DP8A 3G16A 1DETA 5DKLA 2CP8A 2WAFA 2PRFA 1RGFA 1RKYA 3IX4A 2EFXA 2FFJA 1T18A 4NKPA 4AW4A 1ZMWA 4S2PA 3KFQC 1UCJA 4UN2B 1GA9A 3J7BA 2GNXA 4HM7B 1BIRA 2DRWA 3CPTB 1BLHA 3G2ZA 3B7ZA 4OVDA 1AQZA 1FGQA 3MYTA 3SBJA 4HM4B 3FF0A 2O5RA 2XLJA 3S29A 1SCWA 4WZ5A 1YGEA 4MDZA 3LICA 3PYJA 3GLIE 5F1GA 4DV3M 3DXOA 3CLOA 3GDIA 3D9YA 3UNLA 3MMHA 1WMPA 2VDBB 3JPUA 4EC6A 5IG4A 2XRXB 4WMCD 3CD63 1JR3E 4JI7M 4X68A 4B93A 2CC1A 5JYPA 3T8UA 3NOUC 2W1RA 3PNVA 3DUKA 2XDMA 5HWVA 1L1TA 3QP4A 4JGOA 4EBNA 3OTOM 1ZKJA 2VIIA 1QMFA 4OKPA 4X6TA 3GRJA 4I39A 2OQEA 3CCS3 4OVZA 4WUJA 2WAEA 3OCLA 2CC3A 3KW6A 3NULA 4DJ3A 3WS2A 1FW7A 4S2MA 3ZQJA 8CHOA 1NSFA 4WMCA 4IPBA 3BRMA 1BSAA 2P0XA 2LB5A 4Q7JA 1L1ZA 2RSXA 3R7WB 1YGWA 3HIIA 5AQ7A 4KG6A 2O25A 1EW0A 2W3HA 5DJTA 5HL1A 3WRTA 3C58A 2QJ7A 4R3BA 4DE3A 1IVWA 2DNAA 3GPXA 3NM7A 3P98A 4JXWA 2Y74A 5EQTA 2O3OA 1KE4A 3GAXA 4HBUA 3BECA 3UPOA 5GLCA 2YQZA 2BG1A 2ZC4B 3B33A 5J8XA 5AQ9A 4JF4A 2XA7M 1K0KA 2CHVA 5IT9S 2VLGA 5FSRA 2ZM8A 2MGWA 2APLA 2LVQD 1IYSA 1R2ZA 5TBMA 5HSQA 3G8ZA 2HPBA 4GKKM 1B3SA 4K1UA 1IV9A 4X65M 2Z4RA 1YE9A 3H4MA 2PZVA 2OWJA 3PAGA 1IVVA 2KNZA 4N6OB 3FGYA 5KPZA 2XD5A 3UB8A 3ZYTA 2W04A 2ZQDA 4UQIM 2JC7A 3EN8A 3GLFB 3U6PA 2OQ4A 1OH0A 3B8LA 4S2JA 3CCR3 2KCDA 2OV5A 3VP1A 4R23A 2W9PA 2QHOB 4KFDA 3U6CA 5KP1A 4HM2B 5AIIA 2V0UA 3IQAA 1SXJB 4RKUF 1UUVB 1PI4A 1IQXA 4FCFA 4ETZA 1DVDA 3FG3A 4LF9M 4PM9A 2XH9A 4F1IA 3DGMA 2BWBA 2Z6BA 4TUWA 2EJSA 1UGUA 1IT8A 3HU2A 2DI0A 1VM1A 5AVFA 3UB6A 1DP6A 3K1JA 2EWVA 1GY6A 4EV4A 1S4SA 3EEAA 3AL0C 4JKTA 5F3WA 3LR4A 4LSOA 3S5CA 1FZUA 1VQ63 3D5GA 3IX8A 3WS4A 5CEBA 2QIYA 5CK6A 1NV8A 1KVMA 5IREB 1H0MA 3LR5A 2BIRA 3WOFB 1SIIA 4B7GA 3UJNA 2ZQ9A 3ZVWA 2VJWA 4KZ3A 4IBGA 3C30A 4EU0A 2AVXA 2YFQA 4LJ8A 1D0LA 3F1PA 3PHYA 3GRRA 3VKHA 1KGEA 3UB9A 4BBVA 3G4PA 5FQKA 3S28A 1F5MA 4RNTA 4MGKE 3D4AA 1R2YA 4AZFA 1TP6A 3TOIA 3U97A 3SXXA 5HDCA 5KP4A 1GABA 1OHOA 2DAKA 1QMAA 4FMCA 3BY8A 3BY9A 1FR6A 3CCM3 5FW5A 1BLPA 3DWZA 3FUVA 3FZCA 3FRIA 4XGIA 3JUPA 5FI6A 4BQMA 3VLFB 3B47A 1FUSA 2H5SA 5J4EA 3VOZA 2K6BA 2K47A 1Y28A 3SASA 4LRSA 1E3UA 3ZVTA 1SG9A 1WHCA 3EE1A 1MWSA 1B21A 1PU4A 4GHIB 2ZTDA 3T6PA 3TQSA 4OP8A 5AJGA 1G59A 3PXPA 1G5UA 3HZJA 1V57A 2WKIA 3KP1E 3Q8XA 1GMPA 5EM0A 2LWXA 2CW9A 3B9PA 2ZQ8A 5L8MA 3UL5A 1W6GA 2YKHA 2V6ZM 1DGGA 1BNJA 2W56A 1IYQA 1T19A 3OPLA 3U6LA 1OTIA 4ME4A 5F82A 4WEKA 1F2KA 2XF3A 2MF7A 1N75A 4MCWA 1RGZA 4HM1B 2VGKA 2UUCM 2BO9B 3Q1CA 3NDEA 4KQOA 2XSZD 1WNHA 4FMBA 4S2LA 2WO0A 4LRYC 4P6ZM 3U5ZA 4G4OA 4BTXA 1RGHA 2MR9A 1QYRA 3G713 3AKZA 3MZFA 5CEDA 4M9SA 4PCZA 2EUCA 4OUQA 1JWVA 4ARZB 2F5NA 4PM8A 1SDNA 5IG3A 2P74A 4GHAA 4EETB 5FI2A 3BM6A 5KP3A 2HZ5A 3KSED 3CTWB 1OGZA 4GHOA 3GVBA 1W79A 1WIVA 1W01A 5FAQA 4RX2A 4GB5A 4GEWA 5LMUM 1WGNA 1QAFA 3KYZA 1XHBA 4JI6M 2YKFA 1IFQA 5E2GA 3E0YA 2OO9A 3KYEA 4RA7A 3IF6B 3LR3A 4OQGA 4NG2A 4IBCA 1RGLA 4JI4M 5CGSA 1DYUA 4JGRA 4EUVA 3E21A 4R71A 1N9BA 1D0MA 2O9BA 4JF6A 1B2MA 3OXAA 1RMSA 3FSDA 2L7IA 4I3IA 4R70A 5EPHA 2XSOB 5FI7A 3D3OA 4I5QA 3WS1A 2KXEA 1FYSA 3OBFA 2FS1A 5DFXA 5EVIB 4G4QA 4Y2FA 3V50A 2MC8A 3ZG8B 4ZAMA 2OQEC 4HJ4A 1DO0A 4B3TM 1WMNA 5MC7A 1ERQA 4IHQA 2J5YA 1E94E 1A2KA 3HZPA 2M7UA 1WE4A 3DBAA 2JKTM 1W00A 1LLBA 4LGYA 2XSHB 4X66M 5G1LA 2PHYA 3CG5A 4WP5A 5KO3A 3JR5A 2B95A 3VP0A 1N77A 1ASKA 1RGAA 4Q0JA 4GC9A 1N9LA 4G4RA 1XFQA 4MN7A 1VQ93 2I9WA 2INWA 3AGFA 4LY6A 1QZMA 2P0MA 3IXHA 2R4JA 1RU3A 2CWVA 3VGNA 1GSWA 2GSPA 2DCFA 2MROB 4AKGA 3BQAA 2CRUA 4HZ9B 3N8BA 5A0OB 4QWTA 3AV0A 1EKMA 1O7NB 5KMWA 4N6MA 3UB1A 2R6FA 5KPTA 3WA3A 2R0IA 4B3SM 3W67A 4DV7M 2DWMA 4KODA 2UGIA 3SC3A 1VQL3 2Y20A 2OCTA 1TF0B 1K55A 3X3ZA 5EUAA 3KFUG 3GRUA 1ES5A 3HHYA 1BRNL 3Q81A 4E3NA 3FUWA 1N9JA 2CKFB 4CLCA 5FGOA 1BRHA 3EX9A 1R4CA 4Y0TA 1HYFA 1YKDA 4WZ4A 2INXA 5GLBA 1RGEA 1OPYA 4BBTA 4I38A 1TS7A 3KS4A 2GNOA 2C9CA 1RCKA 4B7FA 2O99A 4ID4A 3FUUA 4QY6A 2HV1A 4YY3M 4L4UA 3BNDA 3Q07A 3NBIA 1LQMB 3KIIA 2CWUA 4EXRA 1FR1A 3HLFA 2K9DA 4Z9QA 4E6XA 4JYAM 1OQYA 5KPRA 4X25A 1GS3A 1I0VA 2UV0E 3WR2A 4WELA 1R4YA 2FGTA 5CF1A 1LOYA 2QZ4A 3CNXA 1YLYA 1ZQ9A 2QP9X 4GITA 3SS4A 5BU4A 4H6JB 1ISKA 4DE0A 4BD1A 4HM8B 4F94A 2WSFF 3FTDA 2RGHA 2PR5A 3BYDA 1JN5A 2YFJB 2HDUA 2CHQA 5F6AA 1F98A 3QP8A 5FATA 3B7NA 3MWZA 1E4DA 1UWNX 3FYDA 3NI9A 5FAPA 2LVOC 1W8YA 5EXTA 2Y2KA 4X1LA 1ZO2A 3EN1B 4HY8A 1YM1A 1SKOA 1W2B2 1PFPA 4KFFA 2PAVP 3GLGB 3EGXC 2XR0A 4DV6M 1B2SA 1M40A 2HGVA 4Q53A 4G3VA 1ROVA 1RGYA 2J3WA 5HD3A 3PVSA 3J81S 3J7AS 1YLJA 1I3IA 3K63A 1W4NA 2LHGA 3BFDA 3L28A 1BU4A 1HR0M 1W5SA 1BGSA 2RCXA 3CC73 2SARA 1K41A 1ONGA 3LW5F 3NQZA 1I3FA 1AVLA 5A92A 1V92A 1FGOA 1Q3BA 2JN7A 3FUTA 1BOXA 3CF6E 5IZ7D 3GQ4A 1AR0A 4K91A 2R9XA 1HNWM 1GA0A 3LIDA 3W4QA 4S2OA 1VEKA 2R4IA 2KRTA 4GDNA 8CATA 1GYBA 4KZ1A 1ZMVA 3B7QA 1OHPA 3AGOA 3SS3A 4FVMA 3GLIB 1K25A 3IXBA 1Q7HA 3NXJA 4HESA 2K0BX 2WGQA 1KWIA 3SH9A 3UN7A 1TUHA 1WQLB 1J2BA 2IMJA 3IG8A 2WOHA 5HDDA 3OW22 3HREA 3UB7A 1E3VA 1DJBA 3K0ZA 3H7WB 3VP3A 3OLOA 1TDZA 3NBBA 1XJ6A 5TR7A 5IS1A 3PAEA 2OAQ1 1NRFA 4OONA 2FH0A 2F5SA 2HMKB 5C1BA 2Z7AA 2DAMA 1TTEA 1S0WA 3LTCA 2HMOB 1V58A 4D80A 1BRJA 5EXXA 3FKEA 2ZL1A 3Q7ZA 2R46A 3DY5A 2VV8A 3QNBA 5J7EA 4NXMM 3QRDA 2D01A 1DMMA 2E2UA 2XEPA 3DTKA 4LF6M 1N9OA 5DTKA 2Z6DA 1DGBA 1ULIB 3AOEC 4KLNA 2WZXA 3BNEA 4D81A 4WYKB 4E04A 3L9KA 4HQAA 2E5LM 3T50A 1PIOA 4GD6A 2O9UX 4EBGA 1SJWA 2W3FA 1GSVA 2WYXA 5D81A 4KENB 1LOWA 3NHXA 4JBFA 3AOGA 2HJ9C 1OAOC 2H0GA 3DGOA 4HH3A 1RCLA 2ZQ7A 5EXPA 2F4YA 1S1YA 1WA9A 1T3TA 2HMNB 1J9MA 2LXEA 3X3XA 2HF6A 2VGLS 3NQYA 1H3QA 2WGWB 3SEDA 2KXGA 2D02A 3JR4A 1FA3A 2DHYA 4FMAA 3FLJA 3STDA 5IW9A 2G5GX 4P6BA 1K734 3T1HM 4JLFA 3JYIA 2H10A 2DZNB 1VHMA 5FQMA 4R7GA 2KLIA 3W8KA 1DGHA 4IIAA 2BT3A 2FH5A 2V1BA 1JBRA 3PXGA 4M9ZA 3LI9A 4DBGB 6STDA 4J9AA 4DJ2A 2C4BA 1PGYA 3N6IA 4K0WA 4KUKA 3ZNTA 4LZIA 2H5XA 4DUYM 4F3LB 1BNFA 3WHKA 3RE8A 4N6UA 3IS2A 2XK1A 5G18A 2DKLA 3B4PA 3HX3A 2L4VA 1I2WA 4XXRA 3CMZA 2RBIA 4R80A 4GJ4A 2V8CA 1PY3A 4DR1M 3BJNA 3UNWA 3DTMA 2OAP1 1PJQA 1Y8GA 2HDSA 2WKRA 3IHPA 3T15A 1EQKA 2KF3A 1MJGM 4LJAA 2QBYA 1IYPA 1JBTA 4JGPA 5HPFA 1B20A 3KCHA 3EOIA 1OT6A 4N6NB 5J3WA 4MN6A 1Q40B 3D3LA 2PYPA 3Q3FA 3SVAA 3WWXA 1VQM3 1BANA 2M7VA 1JB2A 4MMYB 2PD7A 3SOIA 1TF1A 1PZOA 4XT2A 5ITUA 3HGIA 1I5QA 1O7GB 5EP1A 3LT8A 3K9MC 3DAVA 3HJ8A 4FWGA 3AHSA 4CIZA 2Q2EB 4RF0A 3E4PA 1U8CB 1UCIA 1NO1A 3O5YA 5DVAA 1KD14 4IVKA 5KIZA 1Q42A 2GBXB 5AVEA 1XA7A 2DVWB 1XXHA 2Y2IA 2L4EA 4U13A 4HEFA 3WOEB 3LCVB 3JUOA 3ER7A 3SYUA 3G6OA 2CV0A 3NJAA 5EVLA 1MX0A 1W5ZA 1G68A 1EUIC 4MMXB 1FJGM 5GSPA 3ZC7B 4B3RM 2W2CA 5DREA 1YSQA 1D6YA 1XXMA 2VZWA 4OVZB 3LVWA 4Y0UA 1J7KA 1U5OA 5DTSA 4EXOA 3NDGA 4HJ3A 3S1YA 1ZHHB 1I2SA 4D2OA 1O7HB 3VSKA 2JA2A 1JV2B 1Y4KA 2WUQA 4K0XA 3SARA 3CCU3 3SYLA 4PDGA 4Y17A 3HLEA 4S2NC 5CGXA 1RN1A 5L8RF 4Y15A 3PXMA 1CQAA 4HL4A 4BL3A 3F1OA 3FG1A 3X42A 1E32A 3D9RA 1JVJA 1JR3D 3U6SA 2Y59A 3K3CA 1DO2A 3SMPA 3QP6A 1ALQA 2RGQA 1L0DA 2X4AA 3HLDA 4GLQA 4KT3B 1IXRC 3NV0A 1HJPA 2L6OA 4EBPA 2QNJA 3ZFZA 3I7JA 3M8CA 1W63Q 1CK3A 3N7WA 1ZAEA 1IN5A 1FILA 5CTNA 1KOUA 2O9AA 2C11A 1MWTA 3ILKA 2VGJA 2HMMB 4GDBA 4M0DA 2ZD8A 3KSJA 5TFQA 4I4LA 4CHTB 1JRQA 4FCMA 3GLHE 1N78A 1RRHA 2JUJA 5FAOA 1QAQA 2EXAA 4KQRA 1LHYA 2DZLA 4CQHA 5EOOA 3HK4A 1PNEA 3KO6A 1CEFA 3L27A 1UCKA 4ILFA 3SOYA 1V9YA 2EWWA 2CFWA 2BMOB 4IBFA 1O7EA 2H28A 2M5ZA 1JJ22 2F99A 5FEFA 2HAKA 1FCMA 4N9KA 3S7QA 3HLGA 3I04M 1QVRA
chains in the Genus database with same CATH topology
1LVNA 4H8RA 5FLXS 4M9XA 1CI9A 4OPYA 3K2LA 3GRYA 2DHRA 3MG3A 2OLVA 3LZAA 3MZEA 2X8AA 1C1KA 5D3OA 4FH2A 4FR9A 1KVLA 1CYUA 2GBWB 4ITQA 1WTHA 4RNAA 4WBGA 3UE3A 3B4OA 5LMNM 4R3JA 5GHYA 4IJFA 3H51A 1K6RA 3V92A 2Y2NA 2P05A 1E25A 3GRVA 4XUZA 3DW0A 2HDRA 1IN4A 3RXXA 4WYYA 1QAMA 2M7OA 3G4S3 1KYIA 2Z77A 4JRFA 1GHIA 3I0YA 1EROA 4EUZA 1Z6TA 4LFCM 2YFLB 3UJMA 1K38A 1LI0A 3C4OA 3HL9A 4OP5A 1IXSB 4XBTA 3FTCA 5IEOA 2ZMAA 1G3IA 4LF4M 1FNNA 3FZWA 4JF5A 3EF8A 2BJWA 1MNLA 3RGSA 2QZ6A 4JXSA 3EQUA 4WURA 2R45A 1A2VA 2W56B 3IT9A 2DXIA 2DWZB 3MG2A 4P85A 1FGRA 4IBEA 4IBJA 3CPOA 4OOLA 4N6V0 1HKXA 3RFWA 1M904 1Q2QA 2I7NA 3GZXB 4TX4A 1HZOA 3MKEA 2CK3H 3LYGA 1ZG6A 3DMCA 4NSOB 2F4VM 1IVXA 4G1MB 4OPRA 2CV2A 3KVWA 3X41A 3QNCA 2ML5A 1SIHA 2A5YB 1NJFA 3VFDA 4CCVA 4RBNA 3ZGAB 1L2DA 5D83A 3OZHA 4HM3B 2FE8A 2D7HA 3L26A 1NY6A 3BOSA 3GV9A 4LV3A 4DV0M 1IM2A 2Q9MA 5DF7A 2C96A 4QD4A 1JWZA 1YLPA 1KGGA 1PW8A 4X69A 3Q2PA 1DGFA 3SHFA 4EV5A 4B4XA 4E3MA 2V1CA 1S6RA 2A49A 3V39A 1OJLA 4LZZA 3ZNYA 2C9OA 4KZ8A 3SHGB 1ESIA 2KRUA 3CCQ3 1YQSA 3IXGA 3GPPA 3DGLA 5BOHA 4DF6A 4PT5A 1N36M 4HM0B 5I97A 1IK3A 1NY5A 5CGWA 3EBTA 4GC5A 3BLSA 1NNUC 4W5WA 2M60A 4LCLA 3RGAA 2UXCM 4GOGA 3V99A 3WMDA 1LI9A 3TWKA 1NWWA 5IERA 3PS8A 2J7VA 2Q9NA 3N4IA 3ZDJA 5HGRA 4E3IA 3FUXA 2C99A 4LFBM 2YNMD 1MWUA 4U0XA 1KC84 3A3FA 2IWBA 5AEUB 3U6DA 1CEGA 3AFHA 2LNHC 2R9WA 3ZCBB 4LV1A 2B5RA 4OK0A 1M1K4 3J27B 2WK0A 3W4OA 3AGDA 1TH3A 1VZZA 4QOZC 4GHLA 2G2UA 4QHSA 2CH9A 1W7FA 4WFOA 2G2WA 3W4PA 4C3QA 3PGBA 4S12A 1HNXM 4NRVA 1IT7A 1QQWA 3CF2A 4WEJA 3C7UA 4Y0OA 2SBLA 3T38A 4NK3A 1VQQA 1RCJA 3GQ3A 4AKIA 2WKEA 4FMDA 4L8PA 5BXQA 2X49A 2DWNA 2D42A 1VQN3 2L09A 4X53A 3WS0A 3G34A 1EG9B 3DA1A 1N33M 4GN2A 2BJVA 4LF7M 2WZZA 3G32A 2RCDA 5JYOA 3LQQA 3M6AA 2DNSA 2CFKA 5GL9A 3GWRA 2XSZA 1W5TA 2KZSA 1Q2PA 4GNUA 4E3OA 4LZJA 3HLCA 2UXBM 1ULJB 3O86A 3JUNA 3LMLA 5FSWA 5STDA 5CF2A 3E4RA 4O7DA 3BLMA 1OFHA 1KSFX 3AOEA 4O2HA 4CGYB 4JI1M 2ZDJA 2IA7A 1G8PA 5BPVA 1JWPA 4HBTA 2QCUA 3MZDA 2GDNA 3B7CA 1TH4A 3TSGA 2HP9A 2Y0QA 2C98A 4FCVA 1IQPA 3UGJA 1C7HA 1O7WB 3AMOB 3OWSA 4KZ6A 1R6BX 1BULA 5BVBA 3BNCA 2I7PA 1SXJD 1OHSA 1OF5A 3BEBA 4IBIA 2XLNA 3VOYA 2FFYA 2XZUA 2I72A 1TH2A 3GQZA 2HHHM 3GLFA 2BNGA 3LY3A 1Q864 2IWCA 3VP2A 1WXQA 1SXJA 3CZDA 4KZ4A 3AJIB 5CECA 3NX0A 4DRTA 2V1UA 2ZJ9A 3VK8A 3MPHA 3S4XA 3GO8A 4EQIA 2BMRB 1YHQ3 4LF8M 3M2KA 3CXC2 1IQ8A 4GKJM 4GL6A 3N54B 1BLCA 4AG6A 1GHPA 3HLWA 4MGIE 1LNHA 3UMMA 1I94M 1OGXA 4B7HA 2LQVA 1H5XA 4N3VA 1SHVA 1W2ZA 3KXEC 1XX2A 5DRVA 4OQ0A 4JPMA 1Z59A 2W03A 4NSRA 1JKGA 2JBFA 3N8RA 2J8YA 3FD9A 2C5RA 4KQQA 1K54C 3FF2A 5LC6A 1GKIA 4JV5M 4FH4A 1FUWA 4I81A 4OW0A 3TPZA 1S5AA 4GD8A 3IH9A 4WWUC 3SAVA 4NHFA 5JPPA 3D4FA 1YIT3 3GLHB 1STDA 4DV4M 2UX0A 3CPW2 1SPUA 3PBSA 5C18A 4LV0A 1G41A 2W82A 3N9HA 2ZL8A 4LGQA 5CHMA 4E3JA 2EX2A 2ZAOA 2HMJB 1NJ4A 5EP2A 1IY1A 1IQYA 1VQ73 1XGIA 3ROBA 4S2NA 3HUMA 4X2HA 1NJI4 4LJ9A 4MEZA 5M18A 3DFZA 2QGUA 1S3SA 3KZTA 3UZUA 2Z4SA 1GLNA 3W0FA 3MKIA 4JI0M 3HIGA 3SH8A 2ZQCA 4AI6A 4L7KA 4QB8A 2WOFA 1L0EA 4M3KA 1BLSA 4PM5A 4HBRA 3JUMA 2IUKA 4LCBA 3IF5A 3TE6A 3UDIA 5A90A 4Y7PA 2JDIH 2EX6A 3H3HA 1XXHB 1RN7A 1DY6A 2KEBA 4ZJ2A 2D7EA 3KP0E 1BUQA 2Y2LA 1T5YA 3UDXA 5TGFA 3TDGA 2HCBA 3SMSA 3GP1A 5FQ9A 1L0GA 5EVID 2ERCA 1K57C 4XM4A 5A93A 1UI8A 4MGZE 3VK7A 5AIGA 1TVFA 3MXRA 3G6E3 4R9KA 4DR3M 4B88A 4XDVA 4MEIA 4UAAA 4QHTA 3BFGA 3U6EA 4H61A 4R9LA 1YJN3 3IXDA 1PI5A 4J8TA 5EVIA 1HTZA 3HHWA 1N9EA 4BBAA 2ZM0A 5TGNA 1I4WA 1MU5A 1BTLA 1V74A 1ZX2A 1YT4A 1HT2E 2CWTA 2QPNA 3CF0A 3JAMS 3HUOA 4OPQA 5FDHA 2PU4A 2HP5A 3NV0B 2QENA 4IIWA 4MBHA 2K54A 1Z6FA 3BFFA 1FOFA 4REZA 1YVBI 1TGUA 4JI2M 4L0LA 3DM8A 5ITXA 3HLBA 3PBQA 3GR2A 1AV4A 3M6HA 2ZBKB 2UUBM 4DDYA 4E6WA 1N8R4 1BSGA 4YINA 1GY7A 3A3IA 1M6KA 1UM8A 1A90A 1NZUA 5KSCA 1H6UA 2X01A 2LH0A 2C10A 4O8SA 5EP3A 4DR4M 1EE8A 1EI5A 4GKUA 1N32M 1GVNA 5M19A 3V5MA 2J7NA 2FOIC 3DZLA 1XNRM 1YI23 3R9XB 3U60B 4IBDA 1D2NA 4KZ9A 3HHZA 1UW1A 1IKIA 4KG2A 3C5AA 1SXJC 3LTAA 2YX9A 4HKVB 3PTEA 3T8NA 2V1ZA 1H8ZA 3SH7A 2CE7A 1E9RA 1Q39A 5AEWB 1OFIA 1PM5A 4S2KA 1TDGA 4AQYM 3LVVA 4GIPA 1QVF2 5ITYA 3NBRA 2CFGA 3MBZA 2Y2PA 3KSXA 3WODG 1W02A 2CFLA 5E43A 3ZG7B 3EHCA 3EIEA 2ZC6B 5AYSC 3T0UA 3HJQA 4I8OA 2CG0A 3VMAA 3EIHA 4X55A 3QWLA 1EWZA 3O87A 4RZMA 4FWHA 4N1HA 4DR7M 3GLGA 4IBRA 4DXCA 1NB5I 3A42A 1NDOB 4OOYA 4X56A 3OV4A 2W0QA 1NHGC 2RL3A 4R4KA 1QVG2 3PCRA 2F5PA 2OLUA 1O7PB 5F83A 5E2EA 3E2KA 2FXTA 3A45A 2CHGA 1L0FA 2VQFM 4OH0A 3OPHA 1YLZA 3BNBA 2C5WB 1QANA 1PWGA 4L15A 5IENA 3HX8A 4NREA 1NY0A 2B24B 4O02B 1JTDA 4BL2A 1K56D 1S723 3BB9A 3FYZA 3SFZA 2CIUA 4AKYA 3OPRA 5ITXE 3FWLA 4FSFA 4DV5M 2CV1A 1STFI 2HKJA 1PJIA 4FWDA 3LMMA 1L8QA 2FFFB 4K1VA 1K56A 3IJEB 1K9M4 2V20A 3W0LB 4KHPM 1IVUA 3IMAB 1F8NA 1JR3A 2B1XB 3G31A 3HVFA 1IELA 4QU3A 4ZBEA 3U61A 3A3EA 2KA6B 4QOSA 4P16A 1NVMA 1XNQM 1K6SA 2WKHA 3M0EA 3V3SA 4FCWA 3K92A 5ELJA 1L5GB 4JXGA 1WYCA 2HDQA 3HU1A 3MHEA 4ORLA 3SS5A 1NNJA 1IBKM 1TIJA 2OSUA 1RP5A 4KZBA 1AVKA 1IN7A 3TWLA 4WYKA 3AGEA 1K82A 3JVCA 2F86B 3IF6C 4OU7A 3BFEA 2F98A 1PZPA 4LF5M 2HMLB 4OQHA 4UHUA 4WHAA 1IEMA 2X02A 2EX8A 4DUZM 1Q814 1MWRA 3NY4A 5FTLA 3A46A 1BZAA 3VKGA 1FGMA 2WGWA 1VQ53 5EVIC 3F14A 3L25A 2V1LA 5E2HA 4MBFA 1NU3A 1RRLA 1D6UA 4IT7A 4X62M 3CC43 3BFCA 3NCKA 3SLUA 2Z7JA 3VFHA 3OPPA 3MKFA 3F7SA 1NYYA 2JCHA 4D82A 5KZHA 2YFIB 1ES2A 4KFEA 1DMQA 5FTJA 1AXBA 5IF6A 4N1XA 4RX3A 3LT9A 2R62A 3DZDA 4QY5A 3IG5A 2OTL3 5FASA 3V98A 2XQZA 1Q40A 4STDA 1KGFA 1IU7A 4X64M 1QAOA 3MJ5A 4K90B 2Y73A 2QEX3 1XGJA 5AYRB 1Z5CA 3PBOA 4OOMA 4CJNA 2VQEM 3UO9A 1FSYA 2EXBA 4ZPXA 3KSPA 3QHYA 5AIHA 1KQS2 3BLZA 3UY6A 4Q8IA 4IJEA 2A3UA 3F8HA 3UPPA 1NZOA 3O88A 1SDEA 3LEZA 3U5ZB 4LG2A 4S2IA 4LJ7A 1TFOA 4JXVA 1ORYB 5EP4A 2ZC5B 1HQCA 3ZG9B 3NUVA 1G96A 3LQRA 1TFKA 3D8BA 3L2AA 1D6ZA 1GY5A 3UPNA 3U6MA 3SOAA 3ZG5A 2BNKA 2W9QA 2JQ5A 1HNZM 4XBYA 2Y2JA 4IEDA 4R4SA 4P87A 2IWDA 3CCE3 1VQP3 4C75A 1JTGA 3OWUA 4ZM8A 1JQJC 3I563 3FH1A 1O7MB 3FTEA 5KSHA 2KW0A 5IWAM 4MNRA 1Q824 4R3DA 1KE3A 4HJLB 1K54A 4NXNM 1KDSA 5U47A 3WA2X 4R0QA 2CUZA 3S67A 3GQ5A 3CCJ3 4HM6B 2ZLYA 3UE1A 3HI7A 3M6BA 3OC2A 4B4ZA 4EYCA 4A3VB 5AQBA 3FCSB 1VQ83 1K28A 1OF5B 3THGA 2P9VA 1E3RA 1KE0A 1XP4A 5DYGA 4OQIA 4C6YA 5EQLA 1XKZA 3C7VA 1WMOA 2YR0A 4LCMA 3FTFA 5IHVA 3M7GA 2Z2MB 2Z76A 4LRTA 2CHCA 1BT5A 5CXWA 3IPTA 1J5EM 1K4EA 1ZG4A 2CEAA 3K7CA 4DDSA 2Y2GA 3RDEA 5BR8M 4DV2M 1DMNA 5D82A 5EEOA 3J80S 2GU1A 2EA0A 3UE0A 2ML6A 3Q7VA 4YFMA 3PBRA 4RNZA 2XZFA 1Z5AA 3E99A 3LO7A 1CQSA 3LTBA 5JI2E 1QJGA 4MGYE 3WHLA 3F8XA 4PMAA 4G4NA 3QAUA 1JKGB 5ELUA 3P09A 1OCVA 2PNCA 3KE7A 3Q1FA 5ITQA 4LENA 1E3UD 4KZAA 3LCEA 2UUAM 1QAKA 2RFRA 4EBLA 4MGHA 2QA43 4WM9A 3HHXA 5DTTA 1CI8A 1ES4A 2WADA 2WGVA 4OPZA 4IVIA 3SAUA 1K57A 2GEXA 5DYIA 4I5SA 5IEPA 3PCSA 2E8IA 2XGLA 2P5TA 4U0TA 7STDA 3UDFA 3IHBA 1XC8A 2Y2MA 3L0RA 4AEQA 1JN5B 2HP6A 3I4VA 3R8FA 4LEHA 4KG5A 3CJMA 5GHXA 3F7XA 1TU5A 1MKIA 4GMQA 3EJVA 3VF1A 4EV2A 1IN8A 2OOVC 1C3BA 5CXOA 4JN6A 5HFOA 2ZM6M 3DGNA 2R4EA 2Y0TA 1MPLA 1NYMA 1XMQM 4RYEA 3MK6A 5DNYA 3HU3A 4DE1A 5A2QS 4XBXA 2PU2A 4XBOA 4QJGA 3WRZA 4OLDA 1GCEA 4EIWA 1IBLM 2FNQA 3GPYA 1KSIA 1Q3CA 5F1FA 5CLKA 3A76A 1E9SA 1YMSA 3CCL3 2H1RA 4K61A 1VDDA 3PBNA 1U60A 4WZ5C 1N4OA 3X3YA 3LY4A 3L29A 1Y54A 3LXUX 3HWSA 5JBSA 2ZM2A 3J7Yd 4MBKA 3EBYA 2ZAMA 1Q7Y4 5M1AA 5EE8A 3CU3A 1IKGA 1G4AE 3SX1A 5HAQA 3J2PB 5DF9A 1W5DA 4XUXA 2Q07A 2UU9M 3G2YA 4BLMA 4MJDA 4LV2A 4NOOB 3NC8A 4L16A 4IBKA 2QPAA 1SKFA 1Z1SA 1TEMA 4B08A 4FD8A 3FYCA 3KOZE 2J7OA 7CATA 4FCJA 1GL7A 1EA2A 2AHMA 1PW1A 4CPKA 4HM5B 4DE2A 3U6OA 1NHWC 1YJW3 3G35A 3ZHHA 3ZCZA 1K3WA 2XR8B 4I4KA 4PM7A 3S27A 4AKHA 5FQJA 3F40A 4FW9A 4FD2A 4EWFA 5LC7A 4OLGA 3I553 1YIJ3 2Z2LB 3NWLA 1XWIA 5KQ8A 1FCOA 3GTCA 1NO3A 2D1WA 4FCTA 1ZC2A 4R4RA 3CCV3 2CFDA 3MFDA 4YHHM 4PM6A 5EJCA 3ZH9B 1YJ93 5AIFA 3VFFA 2FNAA 1DGHB 3U6QA 5FA7A 2STDA 3PZWA 4R1KA 1Z5BA 4A5RA 3PFIA 1K8A4 1CYVA 2ZQAA 4LGMA 3MSOA 3OX9A 4ZTKA 4BB9A 4QNMA 1YLWA 1N34M 5CHUA 1W6YA 1ERMA 4HYZA 3D8LA 3O8YA 1TDHA 2UWXA 1MXOA 1L2BA 2QBYB 3M2JA 5G2GA 1IBMM 5A91A 4GZBA 4XB5A 3N8LA 3KKGA 1MBLA 1M1XB 3KOWE 5E26A 4GRIA 3IHAA 5H37D 3LH4A 2XGNA 4R1GA 2EO2A 4BLCA 5HARA 3IH8A 1IY2A 2BLSA 3Q90A 2ZC7A 3VP4A 4WW0A 4B3MM 2OPFA 4E3LA 1PYYA 3CNMA 3A3DA 3ITBA 2F5OA 3ALAA 1IY0A 1X37A 3V3RA 1PJJA 1JB4A 3RJUA 3ISGA 1YSYA 2BMQB 3OCNA 4NL4H 5E2FA 4ZDXA 3C4PA 2V2FF 1SXJE 2Z3XA 3A3JA 1KDWA 2GU3A 3SAWA 3IF6A 2XD1A 3FKWA 3ECFA 1HVBA 4L78A 2CFOA 1IYOA 1MOLA 1N8QA 5AI1A 3PBTA 1FGTA 5DF8A 2E2TA 3AMOA 3NBLA 5CHJA 1N5HA 1M9GA 4GH9A 4CISA 2EFUA 4BTYA 3EC9A 4PPRA 1BUEA 3EB8A 2KRKA 2L7HA 2PBYA 1W7CA 3NBJA 1IV7A 1RJOA 3DOAA 4KZ7A 3GPUA 4KVHA 1K3XA 4O3VA 3I4YA 1IXZA 2KZUA 4MH0E 4LFAM 1H8YA 3GMWA 1J09A 2W6JH 5FTMA 1QMEA 2QMIA 3GZYB 3U61B 1CEWI 3ITAA 1FCNA 2HL7A 5GLAA 3GZRA 1YLTA 3G30A 1HD8A 2OWPA 3G0KA 3WS5A 4IBXA 1IN6A 3N8SA 4LMIA 4BJPA 3S22A 2BHMA 5IG5A 4JI8M 4L8RC 2WGIA 3DWKA 1VQO3 1UI7A 3T1YM 4PDIA 1UUWB 1E97A 4QHCA 4FCZA 5I94A 4MMZB 3HUNA 4JXJA 2GEYA 4UA6A 5ITTA 3CC23 4U3TA 1DVCA 2WGOA 4Z6YA 2OTJ3 3TWMA 2Y2HA 5CTMA 4XDWA 4DR6M 1XA1A 3F9SA 1LV7A 3FG4A 3K5TA 4HVNA 3KOYE 3MHVC 4MB7A 3ZG0A 1DJAA 2GXFA 4KZ5A 4UA9A 5GLDA 2DWLA 3GLHA 4DKIA 1XMOM 4L8OA 3VSYA 3I51A 4PEJA 5E6JA 3NM2A 5HAIA 4PD2A 1IDPA 4LJ5A 1US1A 1ESUA 5HX9A 5FTKA 2DZOB 1LOXA 5EOEA 4Z8XA 3LTDA 1GD4A 5IG0A 3VDPA 2JE5A 3RGPA 3IWIA 4RF1A 1YMXA 4GB7A 4JI3M 5CERA 2P38A 3QK9A 1ES3A 5GKNA 3KN4A 3KS8A 1OMEA 2G8LA 1JB5A 1L2SA 4H3UA 5AQAA 1HT1E 4JF8A 4HZBB 2Y2OA 5JI3E 1ROAA 4ZJ3A 1OACA 2C6WB 4BTWA 1A67A 1NXYA 4JI5M 3KDSE 1K55C 1O07A 3KOXE 1PWDA 3B3XA 4G6ZA 5HW3A 1DJCA 3RXWA 5EXSA 5KQDA 3U1WA 1FQGA 1XPBA 1ONHA 2P09A 2H0TA 3HBRA 2K0MA 2Y55A 3VDUA 4IBBA 5FQIA 4N9LA 5CRFA 2Y21A 5HAPA 4NETA 4MLLA 2Y4AA 2CG1A 2Y2QA 3A98B 3HJSA 3GLIA 1W6CA 2LYXA 1PWCA 1R7RA 4BD0A 4N92A 4BENA 1JNQA 3VSLA 4AKZA 3IWQA 3UL6A 2D7GA 2EX9A 4UA7A 3FKVA 5EVHA 4DR2M 3GRDA 1QALA 1N5PA 1G6AA 5GHZA 2J9PA 4RVAA 1LL9A 1MY8A 2R65A 4AG5A 3PNYA 2XFTA 1LL5A 2XFSA 3E9SA 2H0YA 1LXEA 3X40A 3TL4X 2UXDM 3FV7A 3NIAA 1FSWA 1W8QA 3TG9A 4DR5M 4N6LA 3EQQB 1HQYE 4KO8A 3MG1A 5JPUA 3E2LA 4DV1M 4MM3B 4LJ4A 2P9VB 2X71A 1TDLA 4OX9M 5FTNA 4E3KA 1KFVA 2ZC3B 2NQ8C 1YUBA 4OVMA 1VQ43 5ITRA 3O3VA 1NJGA 1GL6A 2RGOA 4RNYA 2A15A 4P0MA 3LOYA 1SQWA 3OWYA 3FKAA 3GSGA 2R18A 1NB3I 4ZJ1A 2J9OA 5FQQA 4N6TA 2IUJA 2E2VA 1HU9A 3SYKA 3GZBA 1GD3A 3K8ZA 4M0WA 5L2FA 3U60A 4X2OA 2Y91A 2ZANA 4LJ6A 3JUQA 2F5QA 2OOVA 1VQK3 3SATA 3IWOA 4CDLA 3RGRA 3UK6A 3CMA3 4K0KM 3CME3 3Q7VB 4QNRA 1OUNA 3WDGB 1K4FA 4DXBA 1L2CA 3EQVA 1WYBA 2RKOA 4HLQA 4NRWA 1GHMA 5EECA 3HKPA 4II7A 3MXSA 3G16A 2WAFA 1RKYA 2EFXA 2FFJA 4AW4A 4S2PA 3KFQC 1GA9A 3J7BA 4HM7B 2DRWA 1BLHA 3G2ZA 4OVDA 4HM4B 1FGQA 3MYTA 3SBJA 4WZ5A 3FF0A 2O5RA 2XLJA 3S29A 1SCWA 1YGEA 3PYJA 5F1GA 4DV3M 3DXOA 3UNLA 1WMPA 4EC6A 5IG4A 2XRXB 4WMCD 3CD63 4JI7M 4X68A 2CC1A 5JYPA 3T8UA 3PNVA 3DUKA 2XDMA 1L1TA 4EBNA 3OTOM 1ZKJA 2VIIA 1QMFA 4OKPA 4X6TA 3GRJA 2OQEA 3CCS3 4OVZA 2WAEA 3OCLA 2CC3A 3KW6A 3WS2A 4S2MA 8CHOA 1NSFA 4WMCA 4IPBA 3BRMA 2P0XA 1L1ZA 2RSXA 3HIIA 5AQ7A 4KG6A 5HL1A 3WRTA 3C58A 4R3BA 4DE3A 1IVWA 3GPXA 3NM7A 3P98A 4JXWA 2Y74A 5EQTA 2O3OA 1KE4A 3GAXA 4HBUA 3BECA 3UPOA 5GLCA 2YQZA 2BG1A 2ZC4B 5J8XA 5AQ9A 4JF4A 2CHVA 5IT9S 5FSRA 2ZM8A 1IYSA 1R2ZA 3G8ZA 2HPBA 4GKKM 4K1UA 1IV9A 4X65M 2Z4RA 1YE9A 3H4MA 2PZVA 3PAGA 1IVVA 4N6OB 3FGYA 5KPZA 2XD5A 2W04A 2ZQDA 2JC7A 3EN8A 3GLFB 3U6PA 2OQ4A 1OH0A 3B8LA 4S2JA 3CCR3 2KCDA 2OV5A 3VP1A 4R23A 2W9PA 4KFDA 5KP1A 3U6CA 3IQAA 4HM2B 5AIIA 3Q82A 1SXJB 4FCFA 1UUVB 1PI4A 1IQXA 1DVDA 3FG3A 4LF9M 4PM9A 2XH9A 3DGMA 2Z6BA 4TUWA 1IT8A 3HU2A 1VM1A 3K1JA 1GY6A 4EV4A 3AL0C 4JKTA 5F3WA 4LSOA 3S5CA 3WS4A 1VQ63 5CEBA 2QIYA 5CK6A 1KVMA 5IREB 3WOFB 1SIIA 4B7GA 3UJNA 2ZQ9A 3ZVWA