4GITA

Crystal structure of alpha sub-domain of lon protease from brevibacillus thermoruber
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
GYTELEKLHIMRDYLLPKQMEEHGLGRDKLQMNEEAMLKVIRQYTREAGVRNLNREAANICRKAARLIVSGEKKRVVVTPKTVESLLGKPRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lon protease
publication title Structural basis for DNA-mediated allosteric regulation facilitated by the AAA(+) module of Lon protease.
pubmed doi rcsb
source organism Brevibacillus thermoruber
molecule tags Hydrolase
total genus 33
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2012-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gitA00
3R8FA 4GITA 5EXXA 1HT1E 5FTNA 2BJVA 3CF0A 4JN6A 1NVMA 1IXZA 1NJFA 1R6BX 2C98A 2X8AA 4QOSA 3HU3A 4LJ6A 2DHRA 1UM8A 3VFDA 3B9PA 1W5SA 4LY6A 1NSFA 3GLFB 4Z8XA 1NY6A 3M0EA 4WW0A 1IY0A 5EP1A 3GLIA 1XXHA 2BJWA 2CHQA 2V1UA 5EXSA 2CHVA 5DYIA 5FTMA 1OFIA 4FCWA 2Z4SA 4A3VB 5EP3A 1W5TA 4KLNA 4FWGA 4QNMA 1E94E 4ZPXA 2KRKA 1IN7A 4LRTA 2R65A 1HT2E 4LJ4A 3U5ZB 2HCBA 4FD2A 1IN6A 1S3SA 3AJIB 3WHKA 1R7RA 3UK6A 1IXRC 1L8QA 2C9OA 4FCVA 1IQPA 5DYGA 2ZANA 5EP2A 4LCBA 1JR3D 2QP9X 4I81A 1SXJE 1JQJC 2CHGA 4QHSA 5JI2E 3SYKA 2FNAA 5EP4A 3GLFA 2QENA 3PFIA 2C99A 3D8BA 5FTJA 3GLGB 1NY5A 1DO0A 3EIEA 1G41A 1X37A 3U61B 2VIIA 1XWIA 4L4UA 1C1KA 3KW6A 4FWDA 4LRSA 3PXGA 1IM2A 3KDSE 1D2NA 1JR3A 2DWZB 3U60B 2DZNB 1G3IA 5EXPA 1FNNA 5EXTA 4FW9A 1G4AE 3HU2A 3SC3A 1SXJB 2DZOB 1SXJA 1HQCA 2CE7A 4D80A 4LJAA 2QZ4A 1LV7A 1QVRA 3H4MA 3MHVC 3GLGA 1HQYE 3SYLA 2C96A 4LJ5A 4QHTA 4D81A 1DO2A 1SXJD 5FTLA 2XSZA 1NJGA 1QZMA 2CEAA 4LJ9A 2V6ZM 3VLFB 3WHLA 1J7KA 1OJLA 1KSFX 2QPAA 3BOSA 4KO8A 4LGMA 2C9CA 3HU1A 3K1JA 4L16A 5C18A 4FCTA 4LJ8A 2XSZD 3EIHA 3GLHB 3GLHA 3HWSA 5FTKA 4EIWA 4D82A 1OFHA 3CF2A 1IY1A 5C1BA 1IN8A 4LZZA 2R62A 2Z4RA 3GLIB 1XXHB 4KODA 1IXSB 4FWHA 2QBYB 1SXJC 2ZAMA 1E32A 2RKOA 2QBYA 2DVWB 4LJ7A 5JI3E 1IY2A 1KYIA 4L15A 1IN4A 5EQTA 3DZDA 4I4LA 2ZAOA 3M6AA 3PVSA 4QNRA 3ZH9B 1IN5A
chains in the Genus database with same CATH superfamily
2FOIC 2FE8A 2R44A 3K8ZA 4GHLA 4NSOB 5FTNA 2EJSA 3U6LA 4JN6A 1EE8A 1VDDA 4NRVA 1IXZA 2KHHA 4LZJA 4IBIA 4CIZA 1N32M 2Y0QA 3C3DA 3CF6E 4DR6M 1MU5A 3B89A 1AUAA 2FH0A 3ILKA 1NSFA 3GLFB 3M0EA 4LG2A 3GLIA 5ITQA 2BJWA 3FYCA 2FS1A 1YLAA 2UXBM 5FSWA 4DR7M 1WHCA 4X66M 2UXCM 4A3VB 4CGYB 3PNYA 3NBIA 3SHGB 3GRYA 2C5RA 3KFUG 4FWGA 4QNMA 4DV3M 4ZPXA 5LMNM 2XEPA 3MJ5A 3FRHA 2A5YB 2DENA 2R65A 1HT2E 1Z6TA 1N77A 1A5TA 5A2QS 1S3SA 1R7RA 2XGNA 3UK6A 1UFZA 2Y20A 2C9OA 2DAIA 4ITQA 5ITXA 1G71A 1JR3D 4AKGA 1JQJC 2H5XA 2L09A 2L7IA 4QHSA 3U6SA 3K9PA 3M7GA 4Q7JA 5EP4A 3SAVA 3SAWA 2YQZA 5FTJA 3GLGB 4PT5A 4R7GA 1N78A 2R18A 1TH3A 4YY3M 4JI0M 4NL4H 1X37A 3U61B 4PDIA 2F5OA 4L4UA 1PJTA 4DV7M 4GC9A 2BWBA 4S12A 1HNXM 1D2NA 1NHGC 4PCZA 1JR3A 1XHBA 1AIPC 2OOAA 2ZM6M 1NNUC 2VDBB 3GLHE 2N35A 3RE8A 1RU3A 1VEJA 3HHXA 3FTFA 2DHYA 1DGBA 1FNNA 1G4AE 3KP0E 3SC3A 4W5WA 5F3WA 2DZOB 3SFZA 3GP1A 1HQCA 3TWKA 1PGYA 4D80A 1JB0F 3MHVC 3FRIA 2E5LM 2LBCA 3SYLA 2C96A 3HX3A 4D81A 1DO2A 3L28A 5DFLA 1HR0M 3HJ8A 2OOBA 2XSZA 1NJGA 3GPXA 2XFTA 2CEAA 3WHLA 2V6ZM 1DV0A 2VQFM 4DV2M 3E9SA 4M0WA 1LTMA 2QPAA 1NV9A 1GJTA 4LGMA 4M9SA 5C18A 4OU7A 2KRUA 4LF5M 3QAUA 4Z6YA 4M9XA 3C58A 1OFHA 4CISA 2MGWA 1R2YA 3GLFE 4LFCM 4LZZA 2R62A 4X65M 3LCVB 4XBOA 4KODA 5L8RF 1VEKA 2RKOA 3L2AA 1N36M 2I7PA 3HJSA 2LVQD 4LJ7A 4DV1M 4B3TM 3GQ5A 4OVZB 3KVWA 5JI3E 3FTDA 1DGFA 4MH0E 1VQ1A 1TGUA 2DWMA 2EO2A 4GH9A 4L15A 1PJJA 1NV8A 1Y8GA 5EQTA 2JY6B 3T1HM 4AKHA 5ITYA 4I4LA 3M6AA 3PVSA 2L4FA 5ITTA 2JA2A 3R8FA 3HGIA 4LF6M 3LVVA 2MROB 4B08A 1OAOC 2LNHC 3AOEA 2L6OA 4BB9A 5ITXE 1EFUB 3HU3A 4LJ6A 3LQQA 3VFDA 3FUUA 1QYRA 3GQ3A 3Q8XA 4LFAM 4HEOA 1WR1B 1NY6A 3GLGE 8CATA 4OX9M 2R4EA 3LW5F 4I5SA 2V1UA 2R45A 4GKJM 2ZTCA 5DYIA 5FTMA 2F5PA 1GO5A 2Z4SA 1XNRM 2KEBA 1I94M 2DAEA 2YNMD 5EP3A 1J09A 2XF3A 1W5TA 3T6PA 3B7ZA 1QDTA 1E9SA 1HJPA 4KLNA 3U6QA 2K0BX 4KHPM 1GL7A 1IN7A 4LF4M 4LRTA 3GRUA 3TE6A 2KNZA 2HCBA 3FUVA 3IG8A 4G6ZA 3TL4X 2XH9A 3E21A 3U6OA 2NQ8C 2O01F 2Y21A 4FCVA 4IBGA 5DYGA 4GKKM 3MMPA 4GC5A 2AHMA 3THGA 2RGHA 3FTCA 2R46A 5KPTA 4I81A 1GL6A 1YSYA 1L2DA 5JI2E 2H1RA 3SYKA 2FNAA 3SMPA 3CGWA 3GLFA 4RKUF 2X4AA 2HL7A 3KOWE 2GQFA 2LHGA 2J7OA 1D0LA 1H6UA 2L2DA 4P17A 1XWIA 2KDLA 4DBGB 4PD2A 3I04M 4G4QA 1PJQA 1QZEA 1IM2A 3KDSE 3GO8A 3GPPA 4JV5M 2DWZB 2LVAA 2M5ZA 3DOAA 4IBFA 2DAMA 2DZNB 2LTUA 3KSJA 3GPYA 5KQ8A 1G3IA 4DUYM 1OIPA 2WSCF 2R6FA 2CRUA 4F1IA 5FLXS 3UZUA 3HU2A 3ZQJA 5ITRA 3TWMA 2DKLA 1WGLA 2Q2EB 2V1CA 4IBDA 2KXEA 1OQYA 3B7NA 2CE7A 4MGZE 1Q39A 4LJAA 2QZ4A 1LV7A 3FTEA 2LWXA 4XK8F 1F4IA 3GLGA 4NXMM 4REZA 3QYBA 3SMSA 4DR3M 1R2ZA 1QAQA 3U61A 1VDLA 4LJ9A 3VLFB 4JI8M 2EA0A 1KSFX 1NHWC 3KSXA 3J80S 1GLNA 3K1JA 4NSRA 4L8RC 1TF0B 2XSZD 3HWSA 1Z59A 4D82A 1WIVA 5H37D 3Q8GA 1IBKM 3AKZA 4LFBM 1IY1A 2Z8YM 1IN8A 1PRBA 1Z5BA 2Z4RA 4X64M 1XXHB 4DR1M 1IXSB 1IXSA 1SXJC 2ZAMA 1E32A 4B7FA 3SASA 2QHOB 3DA1A 4RF1A 4B7GA 3FKEA 5BPVA 4G4OA 1N34M 2HHHM 1IBLM 2DAKA 1KYIA 3F92A 1SG9A 2ZBKB 4RNAA 4LGYA 3JAMS 2KNVA 4NRWA 1IN4A 3U6CA 2BNKA 3AV0A 3DZDA 2VF7A 4IIWA 5ITUA 4LF7M 2CP8A 1KFVA 1D0MA 3A45A 4QNRA 1PM5A 1IN5A 2MJ5B 4LF8M 4GITA 1OKSA 5EXXA 1HT1E 2VF8A 3KXEC 4GIPA 2KNAA 3CF0A 3NWLA 3SARA 4FVMA 1R6BX 2C98A 3E46A 3KOYE 4QOSA 4AG6A 1UM8A 3VKHA 3B9PA 3BBZA 5BR8M 1W5SA 1IBMM 4JI2M 1K82A 2WZJA 1TH2A 1IY0A 1TH4A 4JI5M 3FUXA 4HL4A 4JI3M 3UGJA 5LMUM 3VDUA 1WJ7A 3GPUA 1OFIA 1HNZM 4FCWA 4OVZA 4B7HA 4M9ZA 2EUCA 2F5SA 3KS8A 2DWNA 2KA6B 4WP2A 3GQ4A 4MM3B 3UMMA 1QQWA 1E94E 3RFWA 1XMOM 2KRKA 2RGOA 3GRRA 1N33M 4PDGA 3U5ZB 4DUZM 3C9PA 2QSFX 1IN6A 4FD2A 4L6V6 3TQSA 3RGPA 3WHKA 3C3EA 1IXRC 3I4VA 3SBJA 2K9DA 3J81S 4YHHM 1L2BA 1IQPA 5EP2A 7CATA 1NO1A 1T3TA 4LCBA 2QP9X 4RF0A 2F5NA 2RRUA 2Y0TA 2APLA 4AI6A 2CFOA 2QENA 2C99A 2HKJA 2P5TA 2M60A 3B7QA 3D8BA 2O5RA 3HHZA 2FFJA 3E4RA 4NC6A 2MH8A 2LH0A 2DAGA 1GKIA 2OO9A 2VIIA 3V76A 4DV0M 4IBCA 1N75A 2JY7A 3KW6A 2G5GX 4FWDA 4CHTB 2LVPC 1XC8A 1IFYA 2HWJA 1NNJA 2MR9A 3LQRA 4BLCA 2VQEM 3U60B 2J5YA 4DV6M 3U60A 4DV5M 1V34A 3OTOM 5EXPA 4R3DA 4IBBA 2B3TA 3TPZA 2KZUA 3K2LA 1VEGA 3HHWA 4M0DA 2DNAA 1XXHE 2XZUA 1SXJB 3QWLA 1SXJA 3AL0C 3PNVA 1DGHB 1PJSA 2W82A 4DR2M 3U6EA 1ZV1A 2Z7JA 1FJGM 3VKGA 1HQYE 4JI6M 4B3SM 1OTRA 1R4GA 5FTLA 5KPZA 2CV1A 2KW0A 1WXQA 3J7AS 1MN3A 5E6JA 5KQDA 2HAKA 3AOGA 3NBXX 2ZTDA 2WSFF 3BOSA 2EKFA 2ERCA 4KO8A 1HNWM 4MGHA 3FUTA 3GRVA 4FCTA 3FE3A 1PJIA 3BXWA 3EIHA 2CV0A 5FTKA 3K92A 4G3OA 2X49A 3IECA 2OQ4A 3U6DA 3GLIB 1T43A 2JUJA 3VK8A 3SAUA 2UU9M 4FWHA 3VK7A 4JYAM 4CJ6A 2DVWB 4WURA 4JI4M 4G4RA 1TR8A 4UN2B 4AW4A 4B3RM 1Q3BA 2K47A 2K6BA 1TDHA 3J7BA 1L1ZA 1T6OA 1YUBA 2CUZA 2QQ8A 2BJVA 3HHYA 2OPFA 1ZMVA 4MGYE 1NVMA 2JWSA 3RGSA 1NJFA 3AOEC 4JXJA 2JZ1A 4DR4M 4QOZC 2UXDM 5IWAM 2X8AA 2Z3XA 3FYDA 2DHRA 1I4WA 4I8OA 4XGIA 4AZFA 4LY6A 1XNQM 3I01M 4OW0A 3ZC7B 4Z8XA 3B74A 4WW0A 3LCUA 5EP1A 3T1YM 1XXHA 4IJFA 2CHQA 4JI1M 1R5LA 3D8LA 3CTWB 2JNHA 5EXSA 2CV2A 2CHVA 4AG5A 4LF9M 2XFSA 4IBKA 4G4NA 1YE9A 4HLQA 3W68A 3HJQA 3FUWA 1QANA 4GMQA 3A46A 3K9OA 2D7GA 1ZMWA 3IHPA 2YR0A 3JR4A 3J27B 2F4VM 4L78A 4LJ4A 4K0KM 2CWBA 1XB2B 1OAIA 4IBJA 1VG5A 3AJIB 3UJNA 3KS4A 3HZJA 1L8QA 2BWEA 2JP7A 3SATA 1Z5AA 2DI0A 2ZANA 3KOZE 1MJGM 1K3WA 1GJSA 1SXJE 3FD9A 4TUWA 4ANRA 2CHGA 2DZLA 3I51A 4IJEA 2O25A 1D0KA 3DFZA 2XLJA 3L25A 1EIJA 3PFIA 3QYEA 2GNOA 1OIZA 4AQYM 1NY5A 1QUTA 5IT9S 4NXNM 1DO0A 2G3QA 1WGNA 3EIEA 1G41A 5IREB 2F5QA 4JI7M 1C1KA 1V92A 2UUCM 2R4JA 4LRSA 3PXGA 2JZ0A 3L27A 2LHCA 3A42A 4II7A 5DNYA 3L26A 2L4EA 4DV4M 3W67A 1QUSA 3U5ZA 4IBEA 3HY5A 2DWLA 1QDRA 4B3MM 1P3QQ 2LVOC 4FW9A 5EXTA 3GLIE 2L7HA 4Y28F 1Q02A 3HKPA 1QAMA 2YFQA 3H4JA 4GEWA 3SHFA 1ZQ9A 1Q3CA 1QVRA 3H4MA 1DGGA 2WSEF 5IZ7D 3ZCBB 4R71A 1TDZA 4LJ5A 4QHTA 3T38A 2UUAM 1E9RA 1V33A 3A98B 1J5EM 4GHAA 1SXJD 1Z5CA 1G8PA 1QZMA 4DR5M 1ORYB 3AFHA 3T15A 3LVWA 3W0FA 4F2LA 1J7KA 1OJLA 2D7EA 4GRIA 1XMQM 1ZMUA 2G8LA 3R9XB 3TWLA 3MK6A 1TTEA 4NOOB 1L1TA 4AKIA 2R0IA 5KO3A 2C9CA 3HU1A 4L16A 5EJCA 3L29A 3JR5A 4LJ8A 3KOXE 3GLHB 4EIWA 5KPRA 3GLHA 4MGKE 2UUBM 1CUKA 2QNJA 3CF2A 2JY8A 4X62M 1GVNA 5C1BA 2I7NA 3J2PB 2D7HA 3VDPA 1GABA 2QCUA 4P16A 4MGIE 3U6MA 1C7YA 2QBYB 2LVNC 3W0LB 2QBYA 1G59A 2XZFA 1DGHA 2J7NA 3IG5A 4KT0F 1ZAEA 2LXEA 2DXIA 4BBAA 2JXNA 1IY2A 2JY5A 2EKKA 2KZSA 1QAOA 3I4YA 4MB7A 1BVSA 5E26A 1K3XA 3LMMA 1L2CA 1MX0A 5GKNA 3U6PA 1JR3E 2ZAOA 3KP1E 3ZH9B
chains in the Genus database with same CATH topology
2FOIC 2FE8A 3K8ZA 4GHLA 4NSOB 5FTNA 3U6LA 4JN6A 1EE8A 1VDDA 4NRVA 1IXZA 4LZJA 4IBIA 1N32M 2Y0QA 3CF6E 4DR6M 1MU5A 3ILKA 1NSFA 3GLFB 3M0EA 4LG2A 3GLIA 5ITQA 2BJWA 3FYCA 2UXBM 5FSWA 4DR7M 4X66M 2UXCM 4A3VB 4CGYB 3PNYA 3NBIA 3SHGB 3GRYA 2C5RA 3KFUG 4FWGA 4QNMA 4DV3M 4ZPXA 5LMNM 2XEPA 3MJ5A 2A5YB 2R65A 1HT2E 1Z6TA 1N77A 5A2QS 1S3SA 1R7RA 2XGNA 3UK6A 2Y20A 2C9OA 4ITQA 5ITXA 1JR3D 4AKGA 1JQJC 2L7IA 2L09A 4QHSA 3U6SA 3M7GA 3SAVA 5EP4A 3SAWA 2YQZA 5FTJA 3GLGB 4PT5A 4R7GA 1N78A 2R18A 1TH3A 4YY3M 4JI0M 4NL4H 1X37A 3U61B 4PDIA 2F5OA 4L4UA 4DV7M 4GC9A 4S12A 1HNXM 1D2NA 1NHGC 4PCZA 1JR3A 1XHBA 2ZM6M 1NNUC 3RE8A 3HHXA 3FTFA 1DGBA 1FNNA 1G4AE 3KP0E 3SC3A 4W5WA 5F3WA 2DZOB 3SFZA 3GP1A 1HQCA 3TWKA 4D80A 3MHVC 2E5LM 3SYLA 2C96A 4D81A 1DO2A 3L28A 1HR0M 3HJ8A 2XSZA 1NJGA 3GPXA 2XFTA 2CEAA 3WHLA 2V6ZM 2VQFM 4DV2M 3E9SA 4M0WA 2QPAA 4LGMA 4M9SA 5C18A 4OU7A 2KRUA 4LF5M 3QAUA 4Z6YA 4M9XA 3C58A 1OFHA 4CISA 1R2YA 4LFCM 4LZZA 2R62A 4X65M 4XBOA 4KODA 2RKOA 3L2AA 1N36M 2I7PA 3HJSA 4LJ7A 4DV1M 4B3TM 3GQ5A 4OVZB 3KVWA 5JI3E 3FTDA 1DGFA 4MH0E 1TGUA 2DWMA 2EO2A 4GH9A 4L15A 1PJJA 5EQTA 3T1HM 4AKHA 5ITYA 4I4LA 3M6AA 3PVSA 5ITTA 2JA2A 3R8FA 3HGIA 4LF6M 3LVVA 4B08A 2LNHC 3AOEA 2L6OA 4BB9A 5ITXE 3HU3A 4LJ6A 3LQQA 3VFDA 3FUUA 1QYRA 3GQ3A 3Q8XA 4LFAM 1NY6A 8CATA 4OX9M 2R4EA 4GKJM 4I5SA 2V1UA 2R45A 5FTMA 5DYIA 2F5PA 2Z4SA 1XNRM 2KEBA 1I94M 2YNMD 5EP3A 1J09A 2XF3A 1W5TA 1E9SA 4KLNA 3U6QA 4KHPM 1GL7A 1IN7A 4LF4M 4LRTA 3GRUA 3TE6A 2HCBA 3FUVA 3IG8A 4G6ZA 3TL4X 2XH9A 3U6OA 2NQ8C 2Y21A 4FCVA 4IBGA 5DYGA 4GKKM 4GC5A 2AHMA 3THGA 2RGHA 3FTCA 2R46A 5KPTA 4I81A 1GL6A 1YSYA 1L2DA 5JI2E 2H1RA 3SYKA 2FNAA 3SMPA 3GLFA 2X4AA 2HL7A 3KOWE 2J7OA 1H6UA 1XWIA 4PD2A 4G4QA 1IM2A 3KDSE 3GO8A 3GPPA 4JV5M 2DWZB 3DOAA 2M5ZA 4IBFA 3GPYA 2DZNB 3KSJA 4DUYM 5KQ8A 1G3IA 5FLXS 3UZUA 3HU2A 5ITRA 3TWMA 4IBDA 2Q2EB 2V1CA 2KXEA 4MGZE 2CE7A 1Q39A 4LJAA 2QZ4A 1LV7A 3FTEA 2LWXA 3GLGA 4NXMM 4REZA 3SMSA 4DR3M 1R2ZA 1QAQA 3U61A 4LJ9A 3VLFB 4JI8M 2EA0A 1KSFX 1NHWC 3KSXA 3J80S 1GLNA 3K1JA 4NSRA 4L8RC 2XSZD 3HWSA 1Z59A 4D82A 5H37D 1IBKM 3AKZA 4LFBM 1IY1A 1IN8A 1Z5BA 4X64M 2Z4RA 1XXHB 4DR1M 1IXSB 1SXJC 2ZAMA 1E32A 4B7FA 3SASA 3DA1A 4RF1A 5BPVA 4B7GA 3FKEA 4G4OA 1N34M 2HHHM 1IBLM 1KYIA 4RNAA 2ZBKB 4LGYA 3JAMS 4NRWA 1IN4A 3U6CA 2BNKA 3AV0A 3DZDA 4IIWA 5ITUA 4LF7M 1KFVA 3A45A 4QNRA 1PM5A 1IN5A 4LF8M 4GITA 5EXXA 1HT1E 3KXEC 4GIPA 3CF0A 3NWLA 3SARA 4FVMA 1R6BX 2C98A 3KOYE 4QOSA 4AG6A 1UM8A 3VKHA 3B9PA 5BR8M 1W5SA 1IBMM 4JI2M 1K82A 1TH2A 1IY0A 1TH4A 4JI5M 3FUXA 4HL4A 4JI3M 3UGJA 5LMUM 3VDUA 3GPUA 1OFIA 1HNZM 4FCWA 4OVZA 4B7HA 4M9ZA 2EUCA 2F5SA 3KS8A 2DWNA 2KA6B 3GQ4A 4MM3B 3UMMA 1QQWA 1E94E 3RFWA 1XMOM 2KRKA 2RGOA 3GRRA 1N33M 4PDGA 3U5ZB 4DUZM 4FD2A 1IN6A 3TQSA 3WHKA 3RGPA 1IXRC 3I4VA 3SBJA 3J81S 1L2BA 4YHHM 1IQPA 5EP2A 7CATA 1T3TA 4LCBA 2QP9X 4RF0A 2F5NA 2Y0TA 4AI6A 2CFOA 2QENA 2C99A 2HKJA 2P5TA 2M60A 3D8BA 2O5RA 3HHZA 2FFJA 3E4RA 2LH0A 1GKIA 2VIIA 4DV0M 4IBCA 1N75A 4CHTB 3KW6A 2G5GX 4FWDA 1XC8A 1NNJA 3LQRA 4BLCA 2VQEM 3U60B 4DV6M 3U60A 4DV5M 3OTOM 5EXPA 4R3DA 4IBBA 3TPZA 2KZUA 3K2LA 3HHWA 4M0DA 2XZUA 1SXJB 3QWLA 1SXJA 3AL0C 3PNVA 1DGHB 2W82A 4DR2M 3U6EA 1FJGM 2Z7JA 3VKGA 1HQYE 4JI6M 4B3SM 5FTLA 2CV1A 3J7AS 5KPZA 2KW0A 1WXQA 5E6JA 5KQDA 3AOGA 3BOSA 2ERCA 4KO8A 1HNWM 4MGHA 3FUTA 3GRVA 4FCTA 2CV0A 1PJIA 3EIHA 5FTKA 3K92A 2X49A 2OQ4A 3U6DA 3GLIB 3VK8A 2UU9M 3SAUA 4JYAM 4FWHA 3VK7A 2DVWB 4WURA 4JI4M 4G4RA 4AW4A 4B3RM 1Q3BA 2K47A 3J7BA 1TDHA 1L1ZA 1YUBA 2CUZA 2BJVA 3HHYA 2OPFA 4MGYE 3RGSA 1NVMA 4QOZC 4DR4M 1NJFA 3AOEC 4JXJA 2UXDM 5IWAM 2X8AA 2Z3XA 3FYDA 2DHRA 1I4WA 4I8OA 4XGIA 4AZFA 4LY6A 1XNQM 4OW0A 3ZC7B 4Z8XA 4WW0A 5EP1A 3T1YM 1XXHA 4IJFA 2CHQA 4JI1M 3D8LA 3CTWB 5EXSA 2CV2A 2CHVA 4AG5A 4LF9M 2XFSA 4IBKA 4G4NA 1YE9A 4HLQA 3HJQA 3FUWA 1QANA 4GMQA 3A46A 2D7GA 2YR0A 3JR4A 3J27B 2F4VM 4L78A 4LJ4A 4K0KM 4IBJA 3AJIB 3UJNA 3KS4A 1L8QA 3SATA 1Z5AA 2ZANA 3KOZE 1K3WA 1SXJE 3FD9A 4TUWA 2CHGA 3I51A 4IJEA 3DFZA 2XLJA 3L25A 3PFIA 4AQYM 1NY5A 5IT9S 4NXNM 1DO0A 3EIEA 1G41A 5IREB 2F5QA 4JI7M 1C1KA 2UUCM 2R4JA 4LRSA 3PXGA 3L27A 4II7A 3A42A 5DNYA 3L26A 4DV4M 3U5ZA 4IBEA 2DWLA 4B3MM 5EXTA 4FW9A 2L7HA 3HKPA 1QAMA 2YFQA 3SHFA 1ZQ9A 1Q3CA 1QVRA 3H4MA 1DGGA 5IZ7D 3ZCBB 1TDZA 4LJ5A 4QHTA 3T38A 2UUAM 1E9RA 3A98B 1J5EM 4GHAA 1SXJD 1Z5CA 1G8PA 1QZMA 4DR5M 1ORYB 3AFHA 3T15A 3LVWA 3W0FA 1J7KA 1OJLA 2D7EA 4GRIA 1XMQM 3R9XB 2G8LA 3TWLA 3MK6A 4NOOB 1L1TA 4AKIA 5KO3A 2C9CA 3HU1A 4L16A 5EJCA 3L29A 3JR5A 4LJ8A 3KOXE 3GLHB 4EIWA 5KPRA 3GLHA 4MGKE 2UUBM 3CF2A 4X62M 1GVNA 5C1BA 2I7NA 3J2PB 2D7HA 3VDPA 2QCUA 4P16A 4MGIE 3U6MA 2QBYB 3W0LB 2QBYA 1G59A 2XZFA 1DGHA 2J7NA 3IG5A 1ZAEA 2LXEA 2DXIA 4BBAA 1IY2A 2KZSA 1QAOA 3I4YA 4MB7A 1K3XA 5E26A 3LMMA 1L2CA 1MX0A 5GKNA 3U6PA 2ZAOA 3KP1E 3ZH9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R8F A;  4GIT A;  5EXX A;  1HT1 E;  5FTN A;  2BJV A;  3CF0 A;  4JN6 A;  1NVM A;  1IXZ A;  1NJF A;  1R6B X;  2C98 A;  2X8A A;  4QOS A;  3HU3 A;  4LJ6 A;  2DHR A;  1UM8 A;  3VFD A;  3B9P A;  1W5S A;  4LY6 A;  1NSF A;  3GLF B;  4Z8X A;  1NY6 A;  3M0E A;  4WW0 A;  1IY0 A;  5EP1 A;  3GLI A;  1XXH A;  2BJW A;  2CHQ A;  2V1U A;  5EXS A;  2CHV A;  5DYI A;  5FTM A;  1OFI A;  4FCW A;  2Z4S A;  4A3V B;  5EP3 A;  1W5T A;  4KLN A;  4FWG A;  4QNM A;  1E94 E;  4ZPX A;  2KRK A;  1IN7 A;  4LRT A;  2R65 A;  1HT2 E;  4LJ4 A;  3U5Z B;  2HCB A;  4FD2 A;  1IN6 A;  1S3S A;  3AJI B;  3WHK A;  1R7R A;  3UK6 A;  1IXR C;  1L8Q A;  2C9O A;  4FCV A;  1IQP A;  5DYG A;  2ZAN A;  5EP2 A;  4LCB A;  1JR3 D;  2QP9 X;  4I81 A;  1SXJ E;  1JQJ C;  2CHG A;  4QHS A;  5JI2 E;  3SYK A;  2FNA A;  5EP4 A;  3GLF A;  2QEN A;  3PFI A;  2C99 A;  3D8B A;  5FTJ A;  3GLG B;  1NY5 A;  1DO0 A;  3EIE A;  1G41 A;  1X37 A;  3U61 B;  2VII A;  1XWI A;  4L4U A;  1C1K A;  3KW6 A;  4FWD A;  4LRS A;  3PXG A;  1IM2 A;  3KDS E;  1D2N A;  1JR3 A;  2DWZ B;  3U60 B;  2DZN B;  1G3I A;  5EXP A;  1FNN A;  5EXT A;  4FW9 A;  1G4A E;  3HU2 A;  3SC3 A;  1SXJ B;  2DZO B;  1SXJ A;  1HQC A;  2CE7 A;  4D80 A;  4LJA A;  2QZ4 A;  1LV7 A;  1QVR A;  3H4M A;  3MHV C;  3GLG A;  1HQY E;  3SYL A;  2C96 A;  4LJ5 A;  4QHT A;  4D81 A;  1DO2 A;  1SXJ D;  5FTL A;  2XSZ A;  1NJG A;  1QZM A;  2CEA A;  4LJ9 A;  2V6Z M;  3VLF B;  3WHL A;  1J7K A;  1OJL A;  1KSF X;  2QPA A;  3BOS A;  4KO8 A;  4LGM A;  2C9C A;  3HU1 A;  3K1J A;  4L16 A;  5C18 A;  4FCT A;  4LJ8 A;  2XSZ D;  3EIH A;  3GLH B;  3GLH A;  3HWS A;  5FTK A;  4EIW A;  4D82 A;  1OFH A;  3CF2 A;  1IY1 A;  5C1B A;  1IN8 A;  4LZZ A;  2R62 A;  2Z4R A;  3GLI B;  1XXH B;  4KOD A;  1IXS B;  4FWH A;  2QBY B;  1SXJ C;  2ZAM A;  1E32 A;  2RKO A;  2QBY A;  2DVW B;  4LJ7 A;  5JI3 E;  1IY2 A;  1KYI A;  4L15 A;  1IN4 A;  5EQT A;  3DZD A;  4I4L A;  2ZAO A;  3M6A A;  3PVS A;  4QNR A;  3ZH9 B;  1IN5 A; 
#chains in the Genus database with same CATH topology
 2FOI C;  2FE8 A;  2R44 A;  3K8Z A;  4GHL A;  4NSO B;  5FTN A;  2EJS A;  3U6L A;  4JN6 A;  1EE8 A;  1VDD A;  4NRV A;  1IXZ A;  2KHH A;  4LZJ A;  4IBI A;  4CIZ A;  1N32 M;  2Y0Q A;  3C3D A;  3CF6 E;  4DR6 M;  1MU5 A;  3B89 A;  1AUA A;  2FH0 A;  3ILK A;  1NSF A;  3GLF B;  3M0E A;  4LG2 A;  3GLI A;  5ITQ A;  2BJW A;  3FYC A;  2FS1 A;  1YLA A;  2UXB M;  5FSW A;  4DR7 M;  1WHC A;  4X66 M;  2UXC M;  4A3V B;  4CGY B;  3PNY A;  3NBI A;  3SHG B;  3GRY A;  2C5R A;  3KFU G;  4FWG A;  4QNM A;  4DV3 M;  4ZPX A;  5LMN M;  2XEP A;  3MJ5 A;  3FRH A;  2A5Y B;  2DEN A;  2R65 A;  1HT2 E;  1Z6T A;  1N77 A;  1A5T A;  5A2Q S;  1S3S A;  1R7R A;  2XGN A;  3UK6 A;  1UFZ A;  2Y20 A;  2C9O A;  2DAI A;  4ITQ A;  5ITX A;  1G71 A;  1JR3 D;  4AKG A;  1JQJ C;  2H5X A;  2L09 A;  2L7I A;  4QHS A;  3U6S A;  3K9P A;  3M7G A;  4Q7J A;  5EP4 A;  3SAV A;  3SAW A;  2YQZ A;  5FTJ A;  3GLG B;  4PT5 A;  4R7G A;  1N78 A;  2R18 A;  1TH3 A;  4YY3 M;  4JI0 M;  4NL4 H;  1X37 A;  3U61 B;  4PDI A;  2F5O A;  4L4U A;  1PJT A;  4DV7 M;  4GC9 A;  2BWB A;  4S12 A;  1HNX M;  1D2N A;  1NHG C;  4PCZ A;  1JR3 A;  1XHB A;  1AIP C;  2OOA A;  2ZM6 M;  1NNU C;  2VDB B;  3GLH E;  2N35 A;  3RE8 A;  1RU3 A;  1VEJ A;  3HHX A;  3FTF A;  2DHY A;  1DGB A;  1FNN A;  1G4A E;  3KP0 E;  3SC3 A;  4W5W A;  5F3W A;  2DZO B;  3SFZ A;  3GP1 A;  1HQC A;  3TWK A;  1PGY A;  4D80 A;  1JB0 F;  3MHV C;  3FRI A;  2E5L M;  2LBC A;  3SYL A;  2C96 A;  3HX3 A;  4D81 A;  1DO2 A;  3L28 A;  5DFL A;  1HR0 M;  3HJ8 A;  2OOB A;  2XSZ A;  1NJG A;  3GPX A;  2XFT A;  2CEA A;  3WHL A;  2V6Z M;  1DV0 A;  2VQF M;  4DV2 M;  3E9S A;  4M0W A;  1LTM A;  2QPA A;  1NV9 A;  1GJT A;  4LGM A;  4M9S A;  5C18 A;  4OU7 A;  2KRU A;  4LF5 M;  3QAU A;  4Z6Y A;  4M9X A;  3C58 A;  1OFH A;  4CIS A;  2MGW A;  1R2Y A;  3GLF E;  4LFC M;  4LZZ A;  2R62 A;  4X65 M;  3LCV B;  4XBO A;  4KOD A;  5L8R F;  1VEK A;  2RKO A;  3L2A A;  1N36 M;  2I7P A;  3HJS A;  2LVQ D;  4LJ7 A;  4DV1 M;  4B3T M;  3GQ5 A;  4OVZ B;  3KVW A;  5JI3 E;  3FTD A;  1DGF A;  4MH0 E;  1VQ1 A;  1TGU A;  2DWM A;  2EO2 A;  4GH9 A;  4L15 A;  1PJJ A;  1NV8 A;  1Y8G A;  5EQT A;  2JY6 B;  3T1H M;  4AKH A;  5ITY A;  4I4L A;  3M6A A;  3PVS A;  2L4F A;  5ITT A;  2JA2 A;  3R8F A;  3HGI A;  4LF6 M;  3LVV A;  2MRO B;  4B08 A;  1OAO C;  2LNH C;  3AOE A;  2L6O A;  4BB9 A;  5ITX E;  1EFU B;  3HU3 A;  4LJ6 A;  3LQQ A;  3VFD A;  3FUU A;  1QYR A;  3GQ3 A;  3Q8X A;  4LFA M;  4HEO A;  1WR1 B;  1NY6 A;  3GLG E;  8CAT A;  4OX9 M;  2R4E A;  3LW5 F;  4I5S A;  2V1U A;  2R45 A;  4GKJ M;  2ZTC A;  5DYI A;  5FTM A;  2F5P A;  1GO5 A;  2Z4S A;  1XNR M;  2KEB A;  1I94 M;  2DAE A;  2YNM D;  5EP3 A;  1J09 A;  2XF3 A;  1W5T A;  3T6P A;  3B7Z A;  1QDT A;  1E9S A;  1HJP A;  4KLN A;  3U6Q A;  2K0B X;  4KHP M;  1GL7 A;  1IN7 A;  4LF4 M;  4LRT A;  3GRU A;  3TE6 A;  2KNZ A;  2HCB A;  3FUV A;  3IG8 A;  4G6Z A;  3TL4 X;  2XH9 A;  3E21 A;  3U6O A;  2NQ8 C;  2O01 F;  2Y21 A;  4FCV A;  4IBG A;  5DYG A;  4GKK M;  3MMP A;  4GC5 A;  2AHM A;  3THG A;  2RGH A;  3FTC A;  2R46 A;  5KPT A;  4I81 A;  1GL6 A;  1YSY A;  1L2D A;  5JI2 E;  2H1R A;  3SYK A;  2FNA A;  3SMP A;  3CGW A;  3GLF A;  4RKU F;  2X4A A;  2HL7 A;  3KOW E;  2GQF A;  2LHG A;  2J7O A;  1D0L A;  1H6U A;  2L2D A;  4P17 A;  1XWI A;  2KDL A;  4DBG B;  4PD2 A;  3I04 M;  4G4Q A;  1PJQ A;  1QZE A;  1IM2 A;  3KDS E;  3GO8 A;  3GPP A;  4JV5 M;  2DWZ B;  2LVA A;  2M5Z A;  3DOA A;  4IBF A;  2DAM A;  2DZN B;  2LTU A;  3KSJ A;  3GPY A;  5KQ8 A;  1G3I A;  4DUY M;  1OIP A;  2WSC F;  2R6F A;  2CRU A;  4F1I A;  5FLX S;  3UZU A;  3HU2 A;  3ZQJ A;  5ITR A;  3TWM A;  2DKL A;  1WGL A;  2Q2E B;  2V1C A;  4IBD A;  2KXE A;  1OQY A;  3B7N A;  2CE7 A;  4MGZ E;  1Q39 A;  4LJA A;  2QZ4 A;  1LV7 A;  3FTE A;  2LWX A;  4XK8 F;  1F4I A;  3GLG A;  4NXM M;  4REZ A;  3QYB A;  3SMS A;  4DR3 M;  1R2Z A;  1QAQ A;  3U61 A;  1VDL A;  4LJ9 A;  3VLF B;  4JI8 M;  2EA0 A;  1KSF X;  1NHW C;  3KSX A;  3J80 S;  1GLN A;  3K1J A;  4NSR A;  4L8R C;  1TF0 B;  2XSZ D;  3HWS A;  1Z59 A;  4D82 A;  1WIV A;  5H37 D;  3Q8G A;  1IBK M;  3AKZ A;  4LFB M;  1IY1 A;  2Z8Y M;  1IN8 A;  1PRB A;  1Z5B A;  2Z4R A;  4X64 M;  1XXH B;  4DR1 M;  1IXS B;  1IXS A;  1SXJ C;  2ZAM A;  1E32 A;  4B7F A;  3SAS A;  2QHO B;  3DA1 A;  4RF1 A;  4B7G A;  3FKE A;  5BPV A;  4G4O A;  1N34 M;  2HHH M;  1IBL M;  2DAK A;  1KYI A;  3F92 A;  1SG9 A;  2ZBK B;  4RNA A;  4LGY A;  3JAM S;  2KNV A;  4NRW A;  1IN4 A;  3U6C A;  2BNK A;  3AV0 A;  3DZD A;  2VF7 A;  4IIW A;  5ITU A;  4LF7 M;  2CP8 A;  1KFV A;  1D0M A;  3A45 A;  4QNR A;  1PM5 A;  1IN5 A;  2MJ5 B;  4LF8 M;  4GIT A;  1OKS A;  5EXX A;  1HT1 E;  2VF8 A;  3KXE C;  4GIP A;  2KNA A;  3CF0 A;  3NWL A;  3SAR A;  4FVM A;  1R6B X;  2C98 A;  3E46 A;  3KOY E;  4QOS A;  4AG6 A;  1UM8 A;  3VKH A;  3B9P A;  3BBZ A;  5BR8 M;  1W5S A;  1IBM M;  4JI2 M;  1K82 A;  2WZJ A;  1TH2 A;  1IY0 A;  1TH4 A;  4JI5 M;  3FUX A;  4HL4 A;  4JI3 M;  3UGJ A;  5LMU M;  3VDU A;  1WJ7 A;  3GPU A;  1OFI A;  1HNZ M;  4FCW A;  4OVZ A;  4B7H A;  4M9Z A;  2EUC A;  2F5S A;  3KS8 A;  2DWN A;  2KA6 B;  4WP2 A;  3GQ4 A;  4MM3 B;  3UMM A;  1QQW A;  1E94 E;  3RFW A;  1XMO M;  2KRK A;  2RGO A;  3GRR A;  1N33 M;  4PDG A;  3U5Z B;  4DUZ M;  3C9P A;  2QSF X;  1IN6 A;  4FD2 A;  4L6V 6;  3TQS A;  3RGP A;  3WHK A;  3C3E A;  1IXR C;  3I4V A;  3SBJ A;  2K9D A;  3J81 S;  4YHH M;  1L2B A;  1IQP A;  5EP2 A;  7CAT A;  1NO1 A;  1T3T A;  4LCB A;  2QP9 X;  4RF0 A;  2F5N A;  2RRU A;  2Y0T A;  2APL A;  4AI6 A;  2CFO A;  2QEN A;  2C99 A;  2HKJ A;  2P5T A;  2M60 A;  3B7Q A;  3D8B A;  2O5R A;  3HHZ A;  2FFJ A;  3E4R A;  4NC6 A;  2MH8 A;  2LH0 A;  2DAG A;  1GKI A;  2OO9 A;  2VII A;  3V76 A;  4DV0 M;  4IBC A;  1N75 A;  2JY7 A;  3KW6 A;  2G5G X;  4FWD A;  4CHT B;  2LVP C;  1XC8 A;  1IFY A;  2HWJ A;  1NNJ A;  2MR9 A;  3LQR A;  4BLC A;  2VQE M;  3U60 B;  2J5Y A;  4DV6 M;  3U60 A;  4DV5 M;  1V34 A;  3OTO M;  5EXP A;  4R3D A;  4IBB A;  2B3T A;  3TPZ A;  2KZU A;  3K2L A;  1VEG A;  3HHW A;  4M0D A;  2DNA A;  1XXH E;  2XZU A;  1SXJ B;  3QWL A;  1SXJ A;  3AL0 C;  3PNV A;  1DGH B;  1PJS A;  2W82 A;  4DR2 M;  3U6E A;  1ZV1 A;  2Z7J A;  1FJG M;  3VKG A;  1HQY E;  4JI6 M;  4B3S M;  1OTR A;  1R4G A;  5FTL A;  5KPZ A;  2CV1 A;  2KW0 A;  1WXQ A;  3J7A S;  1MN3 A;  5E6J A;  5KQD A;  2HAK A;  3AOG A;  3NBX X;  2ZTD A;  2WSF F;  3BOS A;  2EKF A;  2ERC A;  4KO8 A;  1HNW M;  4MGH A;  3FUT A;  3GRV A;  4FCT A;  3FE3 A;  1PJI A;  3BXW A;  3EIH A;  2CV0 A;  5FTK A;  3K92 A;  4G3O A;  2X49 A;  3IEC A;  2OQ4 A;  3U6D A;  3GLI B;  1T43 A;  2JUJ A;  3VK8 A;  3SAU A;  2UU9 M;  4FWH A;  3VK7 A;  4JYA M;  4CJ6 A;  2DVW B;  4WUR A;  4JI4 M;  4G4R A;  1TR8 A;  4UN2 B;  4AW4 A;  4B3R M;  1Q3B A;  2K47 A;  2K6B A;  1TDH A;  3J7B A;  1L1Z A;  1T6O A;  1YUB A;  2CUZ A;  2QQ8 A;  2BJV A;  3HHY A;  2OPF A;  1ZMV A;  4MGY E;  1NVM A;  2JWS A;  3RGS A;  1NJF A;  3AOE C;  4JXJ A;  2JZ1 A;  4DR4 M;  4QOZ C;  2UXD M;  5IWA M;  2X8A A;  2Z3X A;  3FYD A;  2DHR A;  1I4W A;  4I8O A;  4XGI A;  4AZF A;  4LY6 A;  1XNQ M;  3I01 M;  4OW0 A;  3ZC7 B;  4Z8X A;  3B74 A;  4WW0 A;  3LCU A;  5EP1 A;  3T1Y M;  1XXH A;  4IJF A;  2CHQ A;  4JI1 M;  1R5L A;  3D8L A;  3CTW B;  2JNH A;  5EXS A;  2CV2 A;  2CHV A;  4AG5 A;  4LF9 M;  2XFS A;  4IBK A;  4G4N A;  1YE9 A;  4HLQ A;  3W68 A;  3HJQ A;  3FUW A;  1QAN A;  4GMQ A;  3A46 A;  3K9O A;  2D7G A;  1ZMW A;  3IHP A;  2YR0 A;  3JR4 A;  3J27 B;  2F4V M;  4L78 A;  4LJ4 A;  4K0K M;  2CWB A;  1XB2 B;  1OAI A;  4IBJ A;  1VG5 A;  3AJI B;  3UJN A;  3KS4 A;  3HZJ A;  1L8Q A;  2BWE A;  2JP7 A;  3SAT A;  1Z5A A;  2DI0 A;  2ZAN A;  3KOZ E;  1MJG M;  1K3W A;  1GJS A;  1SXJ E;  3FD9 A;  4TUW A;  4ANR A;  2CHG A;  2DZL A;  3I51 A;  4IJE A;  2O25 A;  1D0K A;  3DFZ A;  2XLJ A;  3L25 A;  1EIJ A;  3PFI A;  3QYE A;  2GNO A;  1OIZ A;  4AQY M;  1NY5 A;  1QUT A;  5IT9 S;  4NXN M;  1DO0 A;  2G3Q A;  1WGN A;  3EIE A;  1G41 A;  5IRE B;  2F5Q A;  4JI7 M;  1C1K A;  1V92 A;  2UUC M;  2R4J A;  4LRS A;  3PXG A;  2JZ0 A;  3L27 A;  2LHC A;  3A42 A;  4II7 A;  5DNY A;  3L26 A;  2L4E A;  4DV4 M;  3W67 A;  1QUS A;  3U5Z A;  4IBE A;  3HY5 A;  2DWL A;  1QDR A;  4B3M M;  1P3Q Q;  2LVO C;  4FW9 A;  5EXT A;  3GLI E;  2L7H A;  4Y28 F;  1Q02 A;  3HKP A;  1QAM A;  2YFQ A;  3H4J A;  4GEW A;  3SHF A;  1ZQ9 A;  1Q3C A;  1QVR A;  3H4M A;  1DGG A;  2WSE F;  5IZ7 D;  3ZCB B;  4R71 A;  1TDZ A;  4LJ5 A;  4QHT A;  3T38 A;  2UUA M;  1E9R A;  1V33 A;  3A98 B;  1J5E M;  4GHA A;  1SXJ D;  1Z5C A;  1G8P A;  1QZM A;  4DR5 M;  1ORY B;  3AFH A;  3T15 A;  3LVW A;  3W0F A;  4F2L A;  1J7K A;  1OJL A;  2D7E A;  4GRI A;  1XMQ M;  1ZMU A;  2G8L A;  3R9X B;  3TWL A;  3MK6 A;  1TTE A;  4NOO B;  1L1T A;  4AKI A;  2R0I A;  5KO3 A;  2C9C A;  3HU1 A;  4L16 A;  5EJC A;  3L29 A;  3JR5 A;  4LJ8 A;  3KOX E;  3GLH B;  4EIW A;  5KPR A;  3GLH A;  4MGK E;  2UUB M;  1CUK A;  2QNJ A;  3CF2 A;  2JY8 A;  4X62 M;  1GVN A;  5C1B A;  2I7N A;  3J2P B;  2D7H A;  3VDP A;  1GAB A;  2QCU A;  4P16 A;  4MGI E;  3U6M A;  1C7Y A;  2QBY B;  2LVN C;  3W0L B;  2QBY A;  1G59 A;  2XZF A;  1DGH A;  2J7N A;  3IG5 A;  4KT0 F;  1ZAE A;  2LXE A;  2DXI A;  4BBA A;  2JXN A;  1IY2 A;  2JY5 A;  2EKK A;  2KZS A;  1QAO A;  3I4Y A;  4MB7 A;  1BVS A;  5E26 A;  1K3X A;  3LMM A;  1L2C A;  1MX0 A;  5GKN A;  3U6P A;  1JR3 E;  2ZAO A;  3KP1 E;  3ZH9 B; 
#chains in the Genus database with same CATH homology
 2FOI C;  2FE8 A;  3K8Z A;  4GHL A;  4NSO B;  5FTN A;  3U6L A;  4JN6 A;  1EE8 A;  1VDD A;  4NRV A;  1IXZ A;  4LZJ A;  4IBI A;  1N32 M;  2Y0Q A;  3CF6 E;  4DR6 M;  1MU5 A;  3ILK A;  1NSF A;  3GLF B;  3M0E A;  4LG2 A;  3GLI A;  5ITQ A;  2BJW A;  3FYC A;  2UXB M;  5FSW A;  4DR7 M;  4X66 M;  2UXC M;  4A3V B;  4CGY B;  3PNY A;  3NBI A;  3SHG B;  3GRY A;  2C5R A;  3KFU G;  4FWG A;  4QNM A;  4DV3 M;  4ZPX A;  5LMN M;  2XEP A;  3MJ5 A;  2A5Y B;  2R65 A;  1HT2 E;  1Z6T A;  1N77 A;  5A2Q S;  1S3S A;  1R7R A;  2XGN A;  3UK6 A;  2Y20 A;  2C9O A;  4ITQ A;  5ITX A;  1JR3 D;  4AKG A;  1JQJ C;  2L7I A;  2L09 A;  4QHS A;  3U6S A;  3M7G A;  3SAV A;  5EP4 A;  3SAW A;  2YQZ A;  5FTJ A;  3GLG B;  4PT5 A;  4R7G A;  1N78 A;  2R18 A;  1TH3 A;  4YY3 M;  4JI0 M;  4NL4 H;  1X37 A;  3U61 B;  4PDI A;  2F5O A;  4L4U A;  4DV7 M;  4GC9 A;  4S12 A;  1HNX M;  1D2N A;  1NHG C;  4PCZ A;  1JR3 A;  1XHB A;  2ZM6 M;  1NNU C;  3RE8 A;  3HHX A;  3FTF A;  1DGB A;  1FNN A;  1G4A E;  3KP0 E;  3SC3 A;  4W5W A;  5F3W A;  2DZO B;  3SFZ A;  3GP1 A;  1HQC A;  3TWK A;  4D80 A;  3MHV C;  2E5L M;  3SYL A;  2C96 A;  4D81 A;  1DO2 A;  3L28 A;  1HR0 M;  3HJ8 A;  2XSZ A;  1NJG A;  3GPX A;  2XFT A;  2CEA A;  3WHL A;  2V6Z M;  2VQF M;  4DV2 M;  3E9S A;  4M0W A;  2QPA A;  4LGM A;  4M9S A;  5C18 A;  4OU7 A;  2KRU A;  4LF5 M;  3QAU A;  4Z6Y A;  4M9X A;  3C58 A;  1OFH A;  4CIS A;  1R2Y A;  4LFC M;  4LZZ A;  2R62 A;  4X65 M;  4XBO A;  4KOD A;  2RKO A;  3L2A A;  1N36 M;  2I7P A;  3HJS A;  4LJ7 A;  4DV1 M;  4B3T M;  3GQ5 A;  4OVZ B;  3KVW A;  5JI3 E;  3FTD A;  1DGF A;  4MH0 E;  1TGU A;  2DWM A;  2EO2 A;  4GH9 A;  4L15 A;  1PJJ A;  5EQT A;  3T1H M;  4AKH A;  5ITY A;  4I4L A;  3M6A A;  3PVS A;  5ITT A;  2JA2 A;  3R8F A;  3HGI A;  4LF6 M;  3LVV A;  4B08 A;  2LNH C;  3AOE A;  2L6O A;  4BB9 A;  5ITX E;  3HU3 A;  4LJ6 A;  3LQQ A;  3VFD A;  3FUU A;  1QYR A;  3GQ3 A;  3Q8X A;  4LFA M;  1NY6 A;  8CAT A;  4OX9 M;  2R4E A;  4GKJ M;  4I5S A;  2V1U A;  2R45 A;  5FTM A;  5DYI A;  2F5P A;  2Z4S A;  1XNR M;  2KEB A;  1I94 M;  2YNM D;  5EP3 A;  1J09 A;  2XF3 A;  1W5T A;  1E9S A;  4KLN A;  3U6Q A;  4KHP M;  1GL7 A;  1IN7 A;  4LF4 M;  4LRT A;  3GRU A;  3TE6 A;  2HCB A;  3FUV A;  3IG8 A;  4G6Z A;  3TL4 X;  2XH9 A;  3U6O A;  2NQ8 C;  2Y21 A;  4FCV A;  4IBG A;  5DYG A;  4GKK M;  4GC5 A;  2AHM A;  3THG A;  2RGH A;  3FTC A;  2R46 A;  5KPT A;  4I81 A;  1GL6 A;  1YSY A;  1L2D A;  5JI2 E;  2H1R A;  3SYK A;  2FNA A;  3SMP A;  3GLF A;  2X4A A;  2HL7 A;  3KOW E;  2J7O A;  1H6U A;  1XWI A;  4PD2 A;  4G4Q A;  1IM2 A;  3KDS E;  3GO8 A;  3GPP A;  4JV5 M;  2DWZ B;  3DOA A;  2M5Z A;  4IBF A;  3GPY A;  2DZN B;  3KSJ A;  4DUY M;  5KQ8 A;  1G3I A;  5FLX S;  3UZU A;  3HU2 A;  5ITR A;  3TWM A;  4IBD A;  2Q2E B;  2V1C A;  2KXE A;  4MGZ E;  2CE7 A;  1Q39 A;  4LJA A;  2QZ4 A;  1LV7 A;  3FTE A;  2LWX A;  3GLG A;  4NXM M;  4REZ A;  3SMS A;  4DR3 M;  1R2Z A;  1QAQ A;  3U61 A;  4LJ9 A;  3VLF B;  4JI8 M;  2EA0 A;  1KSF X;  1NHW C;  3KSX A;  3J80 S;  1GLN A;  3K1J A;  4NSR A;  4L8R C;  2XSZ D;  3HWS A;  1Z59 A;  4D82 A;  5H37 D;  1IBK M;  3AKZ A;  4LFB M;  1IY1 A;  1IN8 A;  1Z5B A;  4X64 M;  2Z4R A;  1XXH B;  4DR1 M;  1IXS B;  1SXJ C;  2ZAM A;  1E32 A;  4B7F A;  3SAS A;  3DA1 A;  4RF1 A;  5BPV A;  4B7G A;  3FKE A;  4G4O A;  1N34 M;  2HHH M;  1IBL M;  1KYI A;  4RNA A;  2ZBK B;  4LGY A;  3JAM S;  4NRW A;  1IN4 A;  3U6C A;  2BNK A;  3AV0 A;  3DZD A;  4IIW A;  5ITU A;  4LF7 M;  1KFV A;  3A45 A;  4QNR A;  1PM5 A;  1IN5 A;  4LF8 M;  4GIT A;  5EXX A;  1HT1 E;  3KXE C;  4GIP A;  3CF0 A;  3NWL A;  3SAR A;  4FVM A;  1R6B X;  2C98 A;  3KOY E;  4QOS A;  4AG6 A;  1UM8 A;  3VKH A;  3B9P A;  5BR8 M;  1W5S A;  1IBM M;  4JI2 M;  1K82 A;  1TH2 A;  1IY0 A;  1TH4 A;  4JI5 M;  3FUX A;  4HL4 A;  4JI3 M;  3UGJ A;  5LMU M;  3VDU A;  3GPU A;  1OFI A;  1HNZ M;  4FCW A;  4OVZ A;  4B7H A;  4M9Z A;  2EUC A;  2F5S A;  3KS8 A;  2DWN A;  2KA6 B;  3GQ4 A;  4MM3 B;  3UMM A;  1QQW A;  1E94 E;  3RFW A;  1XMO M;  2KRK A;  2RGO A;  3GRR A;  1N33 M;  4PDG A;  3U5Z B;  4DUZ M;  4FD2 A;  1IN6 A;  3TQS A;  3WHK A;  3RGP A;  1IXR C;  3I4V A;  3SBJ A;  3J81 S;  1L2B A;  4YHH M;  1IQP A;  5EP2 A;  7CAT A;  1T3T A;  4LCB A;  2QP9 X;  4RF0 A;  2F5N A;  2Y0T A;  4AI6 A;  2CFO A;  2QEN A;  2C99 A;  2HKJ A;  2P5T A;  2M60 A;  3D8B A;  2O5R A;  3HHZ A;  2FFJ A;  3E4R A;  2LH0 A;  1GKI A;  2VII A;  4DV0 M;  4IBC A;  1N75 A;  4CHT B;  3KW6 A;  2G5G X;  4FWD A;  1XC8 A;  1NNJ A;  3LQR A;  4BLC A;  2VQE M;  3U60 B;  4DV6 M;  3U60 A;  4DV5 M;  3OTO M;  5EXP A;  4R3D A;  4IBB A;  3TPZ A;  2KZU A;  3K2L A;  3HHW A;  4M0D A;  2XZU A;  1SXJ B;  3QWL A;  1SXJ A;  3AL0 C;  3PNV A;  1DGH B;  2W82 A;  4DR2 M;  3U6E A;  1FJG M;  2Z7J A;  3VKG A;  1HQY E;  4JI6 M;  4B3S M;  5FTL A;  2CV1 A;  3J7A S;  5KPZ A;  2KW0 A;  1WXQ A;  5E6J A;  5KQD A;  3AOG A;  3BOS A;  2ERC A;  4KO8 A;  1HNW M;  4MGH A;  3FUT A;  3GRV A;  4FCT A;  2CV0 A;  1PJI A;  3EIH A;  5FTK A;  3K92 A;  2X49 A;  2OQ4 A;  3U6D A;  3GLI B;  3VK8 A;  2UU9 M;  3SAU A;  4JYA M;  4FWH A;  3VK7 A;  2DVW B;  4WUR A;  4JI4 M;  4G4R A;  4AW4 A;  4B3R M;  1Q3B A;  2K47 A;  3J7B A;  1TDH A;  1L1Z A;  1YUB A;  2CUZ A;  2BJV A;  3HHY A;  2OPF A;  4MGY E;  3RGS A;  1NVM A;  4QOZ C;  4DR4 M;  1NJF A;  3AOE C;  4JXJ A;  2UXD M;  5IWA M;  2X8A A;  2Z3X A;  3FYD A;  2DHR A;  1I4W A;  4I8O A;  4XGI A;  4AZF A;  4LY6 A;  1XNQ M;  4OW0 A;  3ZC7 B;  4Z8X A;  4WW0 A;  5EP1 A;  3T1Y M;  1XXH A;  4IJF A;  2CHQ A;  4JI1 M;  3D8L A;  3CTW B;  5EXS A;  2CV2 A;  2CHV A;  4AG5 A;  4LF9 M;  2XFS A;  4IBK A;  4G4N A;  1YE9 A;  4HLQ A;  3HJQ A;  3FUW A;  1QAN A;  4GMQ A;  3A46 A;  2D7G A;  2YR0 A;  3JR4 A;  3J27 B;  2F4V M;  4L78 A;  4LJ4 A;  4K0K M;  4IBJ A;  3AJI B;  3UJN A;  3KS4 A;  1L8Q A;  3SAT A;  1Z5A A;  2ZAN A;  3KOZ E;  1K3W A;  1SXJ E;  3FD9 A;  4TUW A;  2CHG A;  3I51 A;  4IJE A;  3DFZ A;  2XLJ A;  3L25 A;  3PFI A;  4AQY M;  1NY5 A;  5IT9 S;  4NXN M;  1DO0 A;  3EIE A;  1G41 A;  5IRE B;  2F5Q A;  4JI7 M;  1C1K A;  2UUC M;  2R4J A;  4LRS A;  3PXG A;  3L27 A;  4II7 A;  3A42 A;  5DNY A;  3L26 A;  4DV4 M;  3U5Z A;  4IBE A;  2DWL A;  4B3M M;  5EXT A;  4FW9 A;  2L7H A;  3HKP A;  1QAM A;  2YFQ A;  3SHF A;  1ZQ9 A;  1Q3C A;  1QVR A;  3H4M A;  1DGG A;  5IZ7 D;  3ZCB B;  1TDZ A;  4LJ5 A;  4QHT A;  3T38 A;  2UUA M;  1E9R A;  3A98 B;  1J5E M;  4GHA A;  1SXJ D;  1Z5C A;  1G8P A;  1QZM A;  4DR5 M;  1ORY B;  3AFH A;  3T15 A;  3LVW A;  3W0F A;  1J7K A;  1OJL A;  2D7E A;  4GRI A;  1XMQ M;  3R9X B;  2G8L A;  3TWL A;  3MK6 A;  4NOO B;  1L1T A;  4AKI A;  5KO3 A;  2C9C A;  3HU1 A;  4L16 A;  5EJC A;  3L29 A;  3JR5 A;  4LJ8 A;  3KOX E;  3GLH B;  4EIW A;  5KPR A;  3GLH A;  4MGK E;  2UUB M;  3CF2 A;  4X62 M;  1GVN A;  5C1B A;  2I7N A;  3J2P B;  2D7H A;  3VDP A;  2QCU A;  4P16 A;  4MGI E;  3U6M A;  2QBY B;  3W0L B;  2QBY A;  1G59 A;  2XZF A;  1DGH A;  2J7N A;  3IG5 A;  1ZAE A;  2LXE A;  2DXI A;  4BBA A;  1IY2 A;  2KZS A;  1QAO A;  3I4Y A;  4MB7 A;  1K3X A;  5E26 A;  3LMM A;  1L2C A;  1MX0 A;  5GKN A;  3U6P A;  2ZAO A;  3KP1 E;  3ZH9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...