4GITA

Crystal structure of alpha sub-domain of lon protease from brevibacillus thermoruber
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
GYTELEKLHIMRDYLLPKQMEEHGLGRDKLQMNEEAMLKVIRQYTREAGVRNLNREAANICRKAARLIVSGEKKRVVVTPKTVESLLGKPRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Lon protease
publication title Structural basis for DNA-mediated allosteric regulation facilitated by the AAA(+) module of Lon protease.
pubmed doi rcsb
source organism Brevibacillus thermoruber
total genus 33
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2012-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gitA00
3M0EA 5EQTA 4LJ7A 1NSFA 1XXHB 1G3IA 3CF2A 1SXJB 5EXSA 2XSZD 1IXSB 1OFHA 2XSZA 4ZPXA 3GLFB 1IY1A 2VIIA 5FTNA 1E32A 3SYLA 2DZOB 5JI3E 4QNRA 5FTJA 1DO0A 4FCVA 3U61B 4I4LA 1FNNA 3KW6A 2DVWB 1UM8A 4FD2A 2QENA 5JI2E 5EXTA 1S3SA 5EXXA 3CF0A 1HQYE 1IN7A 3H4MA 2C9CA 2R65A 1IXRC 2BJWA 4KODA 1C1KA 2HCBA 3WHKA 5EXPA 3GLGA 3GLHA 5C1BA 2CHVA 2QPAA 5FTLA 2QZ4A 2RKOA 3ZH9B 1OJLA 4LJ5A 4LY6A 5DYGA 4LRTA 3GLIB 2V1UA 1W5SA 4KLNA 2CEAA 2R62A 4L16A 4A3VB 1NJFA 4D81A 1SXJE 4FW9A 3PXGA 1NY6A 4LJAA 4EIWA 4LJ8A 4GITA 4I81A 1KSFX 1IQPA 1XXHA 2CHGA 2KRKA 3HWSA 4FWGA 4Z8XA 1NY5A 4QHSA 3GLFA 3BOSA 2DWZB 2C99A 2CE7A 1HT2E 1QVRA 3B9PA 3HU3A 4D82A 3K1JA 2QP9X 1XWIA 4QOSA 1D2NA 2BJVA 1J7KA 1JR3D 1JR3A 1OFIA 2C98A 4FWHA 2CHQA 4FCTA 1L8QA 1IN5A 3UK6A 2DHRA 3DZDA 3VFDA 1HQCA 1IN6A 1X37A 2QBYB 3GLHB 1W5TA 5FTKA 1NVMA 2ZANA 1IN8A 4LJ6A 5C18A 1JQJC 4KO8A 4LCBA 3EIEA 4LRSA 1G41A 3EIHA 1IM2A 4QHTA 4LGMA 2V6ZM 3KDSE 4LJ4A 1SXJD 2ZAMA 1SXJA 2Z4RA 5EP1A 4FCWA 4L4UA 4LJ9A 4JN6A 1E94E 5EP3A 3R8FA 1R6BX 1DO2A 5DYIA 1KYIA 2C9OA 2Z4SA 2ZAOA 4FWDA 1IXZA 3D8BA 5EP2A 3PFIA 5EP4A 3AJIB 1LV7A 1QZMA 3SYKA 4QNMA 4D80A 3GLGB 1NJGA 4LZZA 2X8AA 3HU1A 3U5ZB 3MHVC 1R7RA 2FNAA 1G4AE 3WHLA 1IY2A 2C96A 3PVSA 1HT1E 3VLFB 4WW0A 3HU2A 3M6AA 3SC3A 3GLIA 1IY0A 2DZNB 4L15A 3U60B 5FTMA 2QBYA 1IN4A 1SXJC
chains in the Genus database with same CATH superfamily
1Z59A 5EQTA 4LJ7A 1NSFA 3SAVA 1G3IA 1GKIA 2JY7A 1SXJB 3I4VA 4Z6YA 2XSZD 3GLFB 2L6OA 1DGFA 4JI4M 2ZTCA 5FTNA 1E32A 3JAMS 3U6DA 3BBZA 4MGYE 2EUCA 3VK8A 4XBOA 4GHLA 2RGOA 4X64M 4OW0A 5FLXS 4FCVA 1TF0B 4DV3M 4G4OA 3U61B 4I4LA 1GLNA 1FNNA 2WZJA 3HKPA 4DR6M 2FOIC 1T3TA 1NHGC 2R6FA 1VQ1A 2DXIA 1V92A 1NV9A 5EJCA 4B7HA 3GRUA 3U6QA 5EXXA 1WGNA 2CRUA 1HQYE 3SMSA 5KQ8A 2Y20A 1E9SA 2GNOA 1Z5BA 3C3DA 4M9SA 3UZUA 1PJQA 3GLGA 1H6UA 4RNAA 4WURA 3FTFA 2W82A 2UXDM 1QAMA 2X49A 4GEWA 2CV2A 2KZSA 2QPAA 3GPPA 5ITRA 1BVSA 1QZEA 2RKOA 3LVWA 1OJLA 1QUTA 4LJ5A 4IIWA 2F5QA 2JZ0A 1WGLA 2WSFF 4KLNA 5DNYA 4BBAA 2R62A 4L16A 4X66M 2D7GA 4F2LA 4D81A 1L1TA 1SXJE 1GJSA 3GLFE 1YE9A 1NY6A 1N34M 3VKGA 1IQPA 1N33M 1D0MA 2KNZA 3UJNA 2R18A 2FFJA 1IXSA 3BOSA 3HU3A 2K6BA 2WSCF 3F92A 1HNWM 4IBGA 1V34A 1Q3BA 2Z8YM 1AIPC 4TUWA 3W0FA 3KVWA 4M0WA 3LW5F 1NO1A 1VDLA 1LTMA 2KA6B 1VEJA 1P3QQ 3RGPA 4LF4M 2F4VM 2UXBM 3LMMA 4Y28F 1L2CA 1G8PA 3UK6A 1YSYA 4G4NA 2EKKA 3IG8A 3DZDA 3Q8GA 3J7BA 3AFHA 4MGIE 4LFAM 5LMUM 5IT9S 1X37A 3FUXA 1GJTA 4PCZA 1W5TA 2B3TA 2VDBB 2ZANA 4NC6A 4XK8F 4DV2M 1OAOC 3T38A 2F5OA 2P5TA 4LF7M 4LGMA 2JNHA 3J81S 4LJ4A 2DENA 3HJ8A 5EP1A 4MH0E 4L4UA 5ITYA 1PJSA 2OO9A 5EP3A 3R8FA 1TR8A 5H37D 1IBMM 2DWMA 3A45A 1DO2A 1R2ZA 4LF5M 5DYIA 4Q7JA 3L29A 2ZAOA 4YHHM 3J80S 4YY3M 3UMMA 3SARA 2Y0TA 4LF8M 1OIPA 3VDUA 3FUVA 3D8BA 3FE3A 4HLQA 4M0DA 3JR4A 4PDGA 4R71A 4AKGA 3HJSA 4PT5A 4DR2M 2L4EA 3AOEC 4LZZA 2XFTA 3HU1A 3MHVC 2FNAA 3TWKA 3AOGA 2KRUA 3KP1E 4RKUF 1G4AE 4DV0M 1Q02A 3K9PA 2VF7A 4P17A 2H1RA 2DNAA 2JXNA 2C96A 4GRIA 1N78A 1GL6A 1XNQM 3A42A 2MJ5B 3FTEA 3PNYA 1IY0A 5KPRA 3PNVA 3GLIA 3U60B 1GVNA 5FTMA 2QBYA 4AI6A 3QYEA 3J7AS 1SXJC 1HJPA 3DA1A 3M0EA 5GKNA 1I94M 2YNMD 4OU7A 4PD2A 4PDIA 1IY1A 1WHCA 5KQDA 2QCUA 1JB0F 3GQ5A 4G4QA 1OQYA 4AKHA 4X62M 2DZOB 3KS8A 2UXCM 2OQ4A 1V33A 5JI3E 5FTJA 4WP2A 4L78A 2KNVA 1L1ZA 2DAEA 2EJSA 5A2QS 3KW6A 4B3TM 2DVWB 4B3MM 1UM8A 2DWLA 4RF1A 4FD2A 2QENA 2XGNA 4NOOB 2UUAM 5EXTA 1S3SA 3HX3A 1XMQM 2R65A 3FRIA 5IZ7D 2LVOC 1IXRC 2DI0A 2BJWA 2LVPC 4KODA 4LF6M 4IBIA 2MROB 2HCBA 4M9ZA 3WHKA 4LFCM 3T15A 1N75A 5C1BA 3B74A 4IBKA 3GO8A 1WR1B 1D0KA 2QZ4A 3E4RA 3IG5A 3KOXE 3W67A 1CUKA 2L4FA 3GLIB 2V1UA 3GQ3A 5ITXA 1W5SA 1F4IA 2DAMA 4JI5M 2CEAA 4A3VB 3HHZA 4ANRA 3TL4X 3LQQA 3W68A 1Z5CA 2LHGA 3IECA 3NBXX 5E6JA 4CJ6A 1L2DA 2HKJA 4M9XA 3TE6A 1FJGM 1G59A 5E26A 1KSFX 2GQFA 3RFWA 1XXHA 4DR3M 2CHGA 2O25A 4OVZB 1NY5A 1HNZM 2CP8A 3KOYE 1TTEA 4BB9A 2I7NA 2C99A 2CE7A 3A98B 1QVRA 4D82A 3J27B 4NRWA 1QANA 2O5RA 2K0BX 1NHWC 4AG5A 4GKJM 1JR3A 2M5ZA 2C98A 4FWHA 3FRHA 3SMPA 3TQSA 2R44A 2DHRA 3CF6E 1HQCA 1Q3CA 3FUUA 5L8RF 3B89A 2VQFM 3I04M 4DV7M 3L27A 3J2PB 1PRBA 4S12A 5ITQA 2DHYA 4LCBA 3U6SA 2D7HA 5IREB 3GP1A 3RE8A 3GLIE 4G4RA 2ZM6M 4LRSA 3GPXA 3EIHA 4QHTA 3FYDA 4GH9A 1VG5A 2ERCA 2O01F 1Q39A 5DFLA 3U6MA 1SXJD 3LQRA 2Z4RA 3CTWB 4KHPM 2FE8A 4B7FA 1ZAEA 3SATA 4REZA 2Z7JA 1KYIA 2VQEM 1QDRA 2Z4SA 4R7GA 4GHAA 4CHTB 2KDLA 2LTUA 3QYBA 3FYCA 3PFIA 5EP4A 4X65M 4JI3M 4BLCA 3SFZA 2A5YB 3SYKA 3T1YM 4D80A 3GLGB 2JA2A 3H4JA 2ZTDA 2R46A 3GPUA 2CV0A 3GQ4A 4LG2A 1R7RA 3K8ZA 3E21A 1XMOM 3SASA 2G3QA 1E9RA 1IY2A 4DR4M 2LVQD 4AG6A 3KXEC 3SHFA 4LGYA 1XHBA 1MN3A 4GMQA 2WSEF 4JI2M 3QWLA 2XLJA 2UUBM 4DR5M 1DGHA 5ITXE 1IN4A 2BWBA 2APLA 1ZMUA 5F3WA 3RGSA 4NXNM 1IXSB 1OFHA 2XSZA 2VIIA 3V76A 2JUJA 3SYLA 2XFSA 4JXJA 4QNRA 3W0LB 5BR8M 3U6CA 3THGA 3FD9A 3SHGB 1GABA 4B08A 3GLGE 2DAGA 4UN2B 2HL7A 3K2LA 3KOZE 2C9CA 2LVNC 2R0IA 4JYAM 2LVAA 3KOWE 4JI7M 1C1KA 3FTCA 4B3SM 3MMPA 3HY5A 1RU3A 4DUYM 2F5PA 4KT0F 1GL7A 2CHVA 3U5ZA 1QYRA 4GIPA 5FTLA 4G3OA 3L25A 4K0KM 2VF8A 3ZH9B 2J7NA 1TH3A 3FTDA 1QUSA 1AUAA 3I4YA 4NSOB 4GC5A 3ILKA 1TH4A 3R9XB 1YLAA 2QSFX 3PXGA 1TGUA 4LJAA 4EIWA 4ITQA 4JI6M 1EE8A 2DWNA 1YUBA 2KRKA 2G8LA 2BNKA 3UGJA 4QHSA 3AKZA 2KW0A 3GLFA 1J09A 1ZV1A 4B7GA 2LBCA 1HT2E 2K47A 3B9PA 2C5RA 2Y21A 1D2NA 4AKIA 5ITTA 1J7KA 2EO2A 2F5NA 1NV8A 2V1CA 1EIJA 3GPYA 3T6PA 2CHQA 1L8QA 3C58A 2QQ8A 3B7QA 3VFDA 3VDPA 1L2BA 2XF3A 1QQWA 2QBYB 3HJQA 3JR5A 3U6EA 1NVMA 3L2AA 5C18A 1JQJC 4CISA 4I5SA 1HR0M 3OTOM 4GKKM 3EIEA 3FUTA 3GRRA 2R45A 2V6ZM 3KDSE 3SAWA 1Y8GA 2BWEA 2ZAMA 4II7A 2L7IA 4IJEA 1IBKM 2J5YA 3HZJA 1OKSA 1PM5A 1MJGM 4JN6A 4AZFA 2CWBA 1R6BX 2XH9A 3L28A 3HHYA 2C9OA 4L6V6 2QHOB 2AHMA 1HNXM 2JY8A 1K3WA 4FWDA 2LHCA 1IXZA 3U6OA 2L09A 4JI1M 3AJIB 2X4AA 3E46A 3T1HM 2D7EA 4NSRA 1LV7A 1D0LA 1OIZA 4QNMA 2X8AA 4G6ZA 3ZCBB 2R4EA 1ZMVA 3KSJA 2Z3XA 2JWSA 2DAIA 3L26A 4AQYM 4DV6M 2FH0A 4MGHA 3C3EA 3DOAA 3U6PA 2QNJA 3PVSA 4DV1M 1HT1E 2Q2EB 3HU2A 1XB2B 3KFUG 1PGYA 3M6AA 3SC3A 1PJJA 2DZNB 1NNUC 4LF9M 3CF0A 3KSXA 3A46A 2RGHA 4JI8M 4DUZM 4IBJA 1XXHB 1QAQA 3CF2A 3LCVB 5EXSA 2JZ1A 1IFYA 4ZPXA 3HHWA 1ZMWA 2MH8A 2XZFA 3K92A 3LCUA 4HL4A 4NL4H 3B7ZA 4W5WA 1C7YA 4JI0M 2FS1A 1DGGA 1DO0A 3E9SA 2XZUA 1SG9A 3TWLA 2N35A 1DV0A 1VEKA 1TDHA 3I51A 4F1IA 2KEBA 5ITUA 2JY5A 4GC9A 1TDZA 5JI2E 2E5LM 5LMNM 1IN7A 1PJTA 1R5LA 3H4MA 4DV5M 3SBJA 2F5SA 1EFUB 2K9DA 5KPZA 1XNRM 2LXEA 1Z5AA 5EXPA 3GLHA 3LVVA 1T43A 2CFOA 4FVMA 3DFZA 3NWLA 4MGKE 3U6LA 1IBLM 2JY6B 4NXMM 2HAKA 4LY6A 5DYGA 4LRTA 3VKHA 2MR9A 4P16A 1R2YA 3B7NA 3I01M 1XXHE 4LZJA 1NJFA 4LFBM 1A5TA 4FW9A 2DZLA 1ZQ9A 4MB7A 4CGYB 1WIVA 3U60A 1WXQA 2L7HA 1VDDA 4DR7M 2I7PA 1OTRA 4GITA 4I81A 4LJ8A 3MK6A 2EA0A 2Y0QA 3Q8XA 4FWGA 4Z8XA 3HWSA 3IHPA 3QAUA 4CIZA 4I8OA 4MGZE 3TPZA 2DWZB 1JR3E 4B3RM 7CATA 3GRYA 3VK7A 2LH0A 2CUZA 2QP9X 3K1JA 4IBEA 4QOZC 4IJFA 1XWIA 2RRUA 4QOSA 3ZQJA 1N36M 4RF0A 5KPTA 2BJVA 2L2DA 3TWMA 1T6OA 1JR3D 1QAOA 3ZC7B 1OFIA 1R4GA 2JP7A 2LWXA 2YR0A 3AOEA 4FCTA 3C9PA 1ORYB 1IN5A 1MU5A 1IN6A 4DV4M 3GRVA 4MM3B 2HHHM 4XGIA 4OX9M 1DGHB 1J5EM 3GLHB 2XEPA 2OPFA 4IBFA 1K3XA 5FTKA 1NNJA 4IBCA 1IN8A 4LJ6A 3KS4A 3K9OA 4KO8A 8CATA 2UUCM 1N77A 2KXEA 1G41A 1IM2A 4DR1M 2OOBA 1KFVA 1XC8A 1VEGA 2LNHC 4IBDA 1SXJA 3HGIA 5KO3A 4JV5M 4FCWA 2H5XA 2YFQA 4LJ9A 2DKLA 1E94E 1MX0A 4DBGB 2CV1A 3M7GA 3CGWA 1DGBA 2M60A 4L8RC 1GO5A 2KZUA 2UU9M 3U61A 1TH2A 2OOAA 1PJIA 1OAIA 1QDTA 5EP2A 4IBBA 4AW4A 3AL0C 4OVZA 1QZMA 2NQ8C 1I4WA 2YQZA 2MGWA 1K82A 1NJGA 3HHXA 1WJ7A 3U5ZB 3KP0E 3BXWA 3NBIA 3MJ5A 2HWJA 4R3DA 2DAKA 1UFZA 3WHLA 5FSWA 3FUWA 2KNAA 3GLHE 2R4JA 3SAUA 3FKEA 3AV0A 3VLFB 5IWAM 4WW0A 2G5GX 2J7OA 2ZBKB 4NRVA 2KHHA 4HEOA 1Z6TA 1G71A 4L15A 3D8LA 2EKFA 1N32M 5BPVA
chains in the Genus database with same CATH topology
1Z59A 5EQTA 4LJ7A 1NSFA 3SAVA 1G3IA 1GKIA 1SXJB 3I4VA 4Z6YA 2XSZD 3GLFB 2L6OA 1DGFA 4JI4M 5FTNA 1E32A 3JAMS 3U6DA 4MGYE 4GHLA 2EUCA 3VK8A 4XBOA 2RGOA 4X64M 4OW0A 5FLXS 4FCVA 4DV3M 4G4OA 3U61B 4I4LA 1GLNA 1FNNA 3HKPA 4DR6M 2FOIC 1T3TA 1NHGC 2DXIA 5EJCA 4B7HA 3GRUA 3U6QA 5EXXA 3SMSA 1HQYE 5KQ8A 2Y20A 1E9SA 1Z5BA 3UZUA 4M9SA 3GLGA 1H6UA 4RNAA 4WURA 3FTFA 2W82A 2UXDM 1QAMA 2X49A 2CV2A 2KZSA 2QPAA 3GPPA 5ITRA 2RKOA 3LVWA 1OJLA 4LJ5A 4IIWA 2F5QA 4KLNA 5DNYA 4BBAA 2R62A 4L16A 4X66M 2D7GA 4D81A 1L1TA 1SXJE 1YE9A 1NY6A 1N34M 3VKGA 1IQPA 1N33M 3UJNA 2R18A 2FFJA 3BOSA 3HU3A 1HNWM 4IBGA 1Q3BA 4TUWA 3W0FA 3KVWA 4M0WA 4LF4M 2KA6B 3RGPA 2F4VM 2UXBM 3LMMA 1L2CA 1G8PA 3UK6A 1YSYA 4G4NA 3IG8A 3DZDA 3J7BA 3AFHA 4MGIE 4LFAM 5LMUM 5IT9S 1X37A 3FUXA 4PCZA 1W5TA 2ZANA 4DV2M 3T38A 2F5OA 2P5TA 4LF7M 4LGMA 3J81S 4LJ4A 3HJ8A 5EP1A 4MH0E 4L4UA 5ITYA 2DWMA 5EP3A 3R8FA 5H37D 1IBMM 3A45A 1DO2A 1R2ZA 4LF5M 5DYIA 3L29A 2ZAOA 4YHHM 3J80S 4YY3M 3UMMA 3SARA 2Y0TA 4LF8M 3VDUA 3FUVA 3D8BA 4HLQA 4M0DA 3JR4A 4PDGA 4AKGA 3HJSA 4PT5A 4DR2M 3AOEC 4LZZA 2XFTA 3HU1A 3MHVC 2FNAA 3TWKA 3AOGA 2KRUA 3KP1E 1G4AE 4DV0M 2H1RA 4GRIA 2C96A 1N78A 1GL6A 1XNQM 3A42A 3FTEA 3PNYA 1IY0A 5KPRA 3PNVA 3GLIA 3U60B 1GVNA 5FTMA 2QBYA 4AI6A 3J7AS 1SXJC 3DA1A 3M0EA 5GKNA 1I94M 2YNMD 4OU7A 4PD2A 4PDIA 1IY1A 5KQDA 3GQ5A 2QCUA 4G4QA 4AKHA 4X62M 2DZOB 3KS8A 2UXCM 2OQ4A 5JI3E 5FTJA 4L78A 1L1ZA 5A2QS 3KW6A 4B3TM 2DVWB 4B3MM 1UM8A 2DWLA 4RF1A 4FD2A 2QENA 2XGNA 4NOOB 2UUAM 5EXTA 1S3SA 1XMQM 2R65A 5IZ7D 1IXRC 4LF6M 2BJWA 4KODA 4IBIA 2HCBA 4M9ZA 3WHKA 4LFCM 3T15A 1N75A 5C1BA 4IBKA 3GO8A 2QZ4A 3E4RA 3IG5A 3KOXE 3GLIB 2V1UA 3GQ3A 5ITXA 1W5SA 4JI5M 2CEAA 4A3VB 3HHZA 3TL4X 3LQQA 1Z5CA 5E6JA 1L2DA 2HKJA 4M9XA 3TE6A 1FJGM 1G59A 5E26A 1KSFX 3RFWA 4DR3M 1XXHA 2CHGA 1HNZM 4OVZB 1NY5A 3KOYE 4BB9A 2I7NA 2C99A 2CE7A 3A98B 1QVRA 4D82A 3J27B 4NRWA 1QANA 2O5RA 1NHWC 4AG5A 4GKJM 1JR3A 2M5ZA 2C98A 4FWHA 3SMPA 3TQSA 2DHRA 3CF6E 1HQCA 1Q3CA 3FUUA 2VQFM 4DV7M 3L27A 3J2PB 4S12A 5ITQA 4LCBA 3U6SA 2D7HA 5IREB 3GP1A 3RE8A 4G4RA 2ZM6M 4LRSA 3GPXA 3EIHA 4QHTA 3FYDA 4GH9A 2ERCA 1Q39A 3U6MA 1SXJD 3LQRA 2Z4RA 3CTWB 4KHPM 2FE8A 4B7FA 1ZAEA 3SATA 4REZA 2Z7JA 1KYIA 2VQEM 2Z4SA 4R7GA 4GHAA 4CHTB 3FYCA 3PFIA 5EP4A 4X65M 4JI3M 4BLCA 3SFZA 2A5YB 3SYKA 3T1YM 4D80A 3GLGB 2JA2A 3GPUA 2R46A 2CV0A 4LG2A 3GQ4A 1R7RA 3K8ZA 1XMOM 3SASA 1E9RA 1IY2A 4DR4M 4AG6A 3KXEC 3SHFA 4LGYA 1XHBA 4GMQA 4JI2M 3QWLA 2XLJA 2UUBM 4DR5M 1DGHA 5ITXE 1IN4A 5F3WA 3RGSA 4NXNM 1IXSB 1OFHA 2XSZA 2VIIA 3SYLA 2XFSA 4JXJA 4QNRA 3W0LB 5BR8M 3U6CA 3THGA 3FD9A 3SHGB 4B08A 2HL7A 3K2LA 3KOZE 2C9CA 4JYAM 3KOWE 4JI7M 1C1KA 3FTCA 4B3SM 4DUYM 2F5PA 1GL7A 2CHVA 3U5ZA 1QYRA 4GIPA 5FTLA 4K0KM 3L25A 3ZH9B 2J7NA 1TH3A 3FTDA 3I4YA 4NSOB 4GC5A 3ILKA 1TH4A 3R9XB 3PXGA 1TGUA 4LJAA 4EIWA 4ITQA 4JI6M 1EE8A 2DWNA 1YUBA 2KRKA 2G8LA 2BNKA 3UGJA 4QHSA 3AKZA 2KW0A 3GLFA 1J09A 4B7GA 3B9PA 1HT2E 2K47A 2C5RA 2Y21A 1D2NA 4AKIA 5ITTA 1J7KA 2EO2A 2F5NA 2V1CA 3GPYA 2CHQA 1L8QA 3C58A 3VFDA 3VDPA 1L2BA 2XF3A 1QQWA 2QBYB 3HJQA 3JR5A 3U6EA 1NVMA 3L2AA 5C18A 1JQJC 4CISA 4I5SA 1HR0M 3OTOM 4GKKM 3EIEA 3FUTA 3GRRA 2R45A 2V6ZM 3KDSE 3SAWA 4II7A 2ZAMA 2L7IA 4IJEA 1IBKM 1PM5A 4JN6A 4AZFA 1R6BX 2XH9A 3L28A 3HHYA 2C9OA 2AHMA 1HNXM 1K3WA 4FWDA 1IXZA 3U6OA 2L09A 4JI1M 3AJIB 2X4AA 3T1HM 2D7EA 4NSRA 1LV7A 4QNMA 2X8AA 4G6ZA 3ZCBB 2R4EA 3KSJA 2Z3XA 3L26A 4AQYM 4DV6M 4MGHA 3DOAA 3U6PA 3PVSA 4DV1M 1HT1E 2Q2EB 3HU2A 3KFUG 3M6AA 3SC3A 1PJJA 2DZNB 1NNUC 4LF9M 3CF0A 3KSXA 3A46A 2RGHA 4JI8M 4DUZM 4IBJA 1XXHB 1QAQA 3CF2A 5EXSA 4ZPXA 3HHWA 2XZFA 3K92A 4HL4A 4NL4H 4W5WA 4JI0M 1DGGA 1DO0A 3E9SA 2XZUA 3TWLA 3I51A 1TDHA 2KEBA 5ITUA 1TDZA 4GC9A 5JI2E 2E5LM 5LMNM 1IN7A 3H4MA 4DV5M 3SBJA 2F5SA 5KPZA 1XNRM 2LXEA 1Z5AA 5EXPA 3GLHA 3LVVA 4MGKE 2CFOA 4FVMA 3DFZA 3NWLA 3U6LA 1IBLM 4NXMM 4LY6A 5DYGA 4LRTA 3VKHA 4P16A 1R2YA 4LZJA 1NJFA 4LFBM 4FW9A 4MB7A 1ZQ9A 4CGYB 3U60A 1WXQA 2L7HA 1VDDA 4DR7M 2I7PA 4LJ8A 4GITA 4I81A 3MK6A 2EA0A 2Y0QA 3Q8XA 4FWGA 4Z8XA 3HWSA 3QAUA 4I8OA 4MGZE 3TPZA 2DWZB 4B3RM 7CATA 3GRYA 3VK7A 2LH0A 2CUZA 2QP9X 3K1JA 4IBEA 4QOZC 4IJFA 1XWIA 4QOSA 1N36M 4RF0A 5KPTA 2BJVA 3TWMA 1JR3D 1QAOA 3ZC7B 1OFIA 2LWXA 2YR0A 3AOEA 4FCTA 1ORYB 1IN5A 1MU5A 1IN6A 4DV4M 3GRVA 4MM3B 2HHHM 4XGIA 4OX9M 1DGHB 1J5EM 3GLHB 2XEPA 2OPFA 4IBFA 1K3XA 5FTKA 1NNJA 4IBCA 1IN8A 4LJ6A 3KS4A 4KO8A 8CATA 2UUCM 1N77A 2KXEA 1G41A 1IM2A 4DR1M 1KFVA 1XC8A 2LNHC 4IBDA 1SXJA 3HGIA 5KO3A 4JV5M 4FCWA 2YFQA 4LJ9A 1E94E 1MX0A 2CV1A 3M7GA 1DGBA 2M60A 4L8RC 2KZUA 2UU9M 3U61A 1TH2A 1PJIA 5EP2A 4IBBA 4AW4A 3AL0C 4OVZA 1QZMA 2NQ8C 1I4WA 2YQZA 1K82A 1NJGA 3HHXA 3U5ZB 3KP0E 3NBIA 3MJ5A 4R3DA 3WHLA 5FSWA 3FUWA 2R4JA 3SAUA 3FKEA 3AV0A 3VLFB 5IWAM 4WW0A 2G5GX 2J7OA 2ZBKB 4NRVA 1Z6TA 4L15A 3D8LA 1N32M 5BPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0E A;  5EQT A;  4LJ7 A;  1NSF A;  1XXH B;  1G3I A;  3CF2 A;  1SXJ B;  5EXS A;  2XSZ D;  1IXS B;  1OFH A;  2XSZ A;  4ZPX A;  3GLF B;  1IY1 A;  2VII A;  5FTN A;  1E32 A;  3SYL A;  2DZO B;  5JI3 E;  4QNR A;  5FTJ A;  1DO0 A;  4FCV A;  3U61 B;  4I4L A;  1FNN A;  3KW6 A;  2DVW B;  1UM8 A;  4FD2 A;  2QEN A;  5JI2 E;  5EXT A;  1S3S A;  5EXX A;  3CF0 A;  1HQY E;  1IN7 A;  3H4M A;  2C9C A;  2R65 A;  1IXR C;  2BJW A;  4KOD A;  1C1K A;  2HCB A;  3WHK A;  5EXP A;  3GLG A;  3GLH A;  5C1B A;  2CHV A;  2QPA A;  5FTL A;  2QZ4 A;  2RKO A;  3ZH9 B;  1OJL A;  4LJ5 A;  4LY6 A;  5DYG A;  4LRT A;  3GLI B;  2V1U A;  1W5S A;  4KLN A;  2CEA A;  2R62 A;  4L16 A;  4A3V B;  1NJF A;  4D81 A;  1SXJ E;  4FW9 A;  3PXG A;  1NY6 A;  4LJA A;  4EIW A;  4LJ8 A;  4GIT A;  4I81 A;  1KSF X;  1IQP A;  1XXH A;  2CHG A;  2KRK A;  3HWS A;  4FWG A;  4Z8X A;  1NY5 A;  4QHS A;  3GLF A;  3BOS A;  2DWZ B;  2C99 A;  2CE7 A;  1HT2 E;  1QVR A;  3B9P A;  3HU3 A;  4D82 A;  3K1J A;  2QP9 X;  1XWI A;  4QOS A;  1D2N A;  2BJV A;  1J7K A;  1JR3 D;  1JR3 A;  1OFI A;  2C98 A;  4FWH A;  2CHQ A;  4FCT A;  1L8Q A;  1IN5 A;  3UK6 A;  2DHR A;  3DZD A;  3VFD A;  1HQC A;  1IN6 A;  1X37 A;  2QBY B;  3GLH B;  1W5T A;  5FTK A;  1NVM A;  2ZAN A;  1IN8 A;  4LJ6 A;  5C18 A;  1JQJ C;  4KO8 A;  4LCB A;  3EIE A;  4LRS A;  1G41 A;  3EIH A;  1IM2 A;  4QHT A;  4LGM A;  2V6Z M;  3KDS E;  4LJ4 A;  1SXJ D;  2ZAM A;  1SXJ A;  2Z4R A;  5EP1 A;  4FCW A;  4L4U A;  4LJ9 A;  4JN6 A;  1E94 E;  5EP3 A;  3R8F A;  1R6B X;  1DO2 A;  5DYI A;  1KYI A;  2C9O A;  2Z4S A;  2ZAO A;  4FWD A;  1IXZ A;  3D8B A;  5EP2 A;  3PFI A;  5EP4 A;  3AJI B;  1LV7 A;  1QZM A;  3SYK A;  4QNM A;  4D80 A;  3GLG B;  1NJG A;  4LZZ A;  2X8A A;  3HU1 A;  3U5Z B;  3MHV C;  1R7R A;  2FNA A;  1G4A E;  3WHL A;  1IY2 A;  2C96 A;  3PVS A;  1HT1 E;  3VLF B;  4WW0 A;  3HU2 A;  3M6A A;  3SC3 A;  3GLI A;  1IY0 A;  2DZN B;  4L15 A;  3U60 B;  5FTM A;  2QBY A;  1IN4 A;  1SXJ C; 
#chains in the Genus database with same CATH topology
 1Z59 A;  5EQT A;  4LJ7 A;  1NSF A;  3SAV A;  1G3I A;  1GKI A;  2JY7 A;  1SXJ B;  3I4V A;  4Z6Y A;  2XSZ D;  3GLF B;  2L6O A;  1DGF A;  4JI4 M;  2ZTC A;  5FTN A;  1E32 A;  3JAM S;  3U6D A;  3BBZ A;  4MGY E;  2EUC A;  3VK8 A;  4XBO A;  4GHL A;  2RGO A;  4X64 M;  4OW0 A;  5FLX S;  4FCV A;  1TF0 B;  4DV3 M;  4G4O A;  3U61 B;  4I4L A;  1GLN A;  1FNN A;  2WZJ A;  3HKP A;  4DR6 M;  2FOI C;  1T3T A;  1NHG C;  2R6F A;  1VQ1 A;  2DXI A;  1V92 A;  1NV9 A;  5EJC A;  4B7H A;  3GRU A;  3U6Q A;  5EXX A;  1WGN A;  2CRU A;  1HQY E;  3SMS A;  5KQ8 A;  2Y20 A;  1E9S A;  2GNO A;  1Z5B A;  3C3D A;  4M9S A;  3UZU A;  1PJQ A;  3GLG A;  1H6U A;  4RNA A;  4WUR A;  3FTF A;  2W82 A;  2UXD M;  1QAM A;  2X49 A;  4GEW A;  2CV2 A;  2KZS A;  2QPA A;  3GPP A;  5ITR A;  1BVS A;  1QZE A;  2RKO A;  3LVW A;  1OJL A;  1QUT A;  4LJ5 A;  4IIW A;  2F5Q A;  2JZ0 A;  1WGL A;  2WSF F;  4KLN A;  5DNY A;  4BBA A;  2R62 A;  4L16 A;  4X66 M;  2D7G A;  4F2L A;  4D81 A;  1L1T A;  1SXJ E;  1GJS A;  3GLF E;  1YE9 A;  1NY6 A;  1N34 M;  3VKG A;  1IQP A;  1N33 M;  1D0M A;  2KNZ A;  3UJN A;  2R18 A;  2FFJ A;  1IXS A;  3BOS A;  3HU3 A;  2K6B A;  2WSC F;  3F92 A;  1HNW M;  4IBG A;  1V34 A;  1Q3B A;  2Z8Y M;  1AIP C;  4TUW A;  3W0F A;  3KVW A;  4M0W A;  3LW5 F;  1NO1 A;  1VDL A;  1LTM A;  2KA6 B;  1VEJ A;  1P3Q Q;  3RGP A;  4LF4 M;  2F4V M;  2UXB M;  3LMM A;  4Y28 F;  1L2C A;  1G8P A;  3UK6 A;  1YSY A;  4G4N A;  2EKK A;  3IG8 A;  3DZD A;  3Q8G A;  3J7B A;  3AFH A;  4MGI E;  4LFA M;  5LMU M;  5IT9 S;  1X37 A;  3FUX A;  1GJT A;  4PCZ A;  1W5T A;  2B3T A;  2VDB B;  2ZAN A;  4NC6 A;  4XK8 F;  4DV2 M;  1OAO C;  3T38 A;  2F5O A;  2P5T A;  4LF7 M;  4LGM A;  2JNH A;  3J81 S;  4LJ4 A;  2DEN A;  3HJ8 A;  5EP1 A;  4MH0 E;  4L4U A;  5ITY A;  1PJS A;  2OO9 A;  5EP3 A;  3R8F A;  1TR8 A;  5H37 D;  1IBM M;  2DWM A;  3A45 A;  1DO2 A;  1R2Z A;  4LF5 M;  5DYI A;  4Q7J A;  3L29 A;  2ZAO A;  4YHH M;  3J80 S;  4YY3 M;  3UMM A;  3SAR A;  2Y0T A;  4LF8 M;  1OIP A;  3VDU A;  3FUV A;  3D8B A;  3FE3 A;  4HLQ A;  4M0D A;  3JR4 A;  4PDG A;  4R71 A;  4AKG A;  3HJS A;  4PT5 A;  4DR2 M;  2L4E A;  3AOE C;  4LZZ A;  2XFT A;  3HU1 A;  3MHV C;  2FNA A;  3TWK A;  3AOG A;  2KRU A;  3KP1 E;  4RKU F;  1G4A E;  4DV0 M;  1Q02 A;  3K9P A;  2VF7 A;  4P17 A;  2H1R A;  2DNA A;  2JXN A;  2C96 A;  4GRI A;  1N78 A;  1GL6 A;  1XNQ M;  3A42 A;  2MJ5 B;  3FTE A;  3PNY A;  1IY0 A;  5KPR A;  3PNV A;  3GLI A;  3U60 B;  1GVN A;  5FTM A;  2QBY A;  4AI6 A;  3QYE A;  3J7A S;  1SXJ C;  1HJP A;  3DA1 A;  3M0E A;  5GKN A;  1I94 M;  2YNM D;  4OU7 A;  4PD2 A;  4PDI A;  1IY1 A;  1WHC A;  5KQD A;  2QCU A;  1JB0 F;  3GQ5 A;  4G4Q A;  1OQY A;  4AKH A;  4X62 M;  2DZO B;  3KS8 A;  2UXC M;  2OQ4 A;  1V33 A;  5JI3 E;  5FTJ A;  4WP2 A;  4L78 A;  2KNV A;  1L1Z A;  2DAE A;  2EJS A;  5A2Q S;  3KW6 A;  4B3T M;  2DVW B;  4B3M M;  1UM8 A;  2DWL A;  4RF1 A;  4FD2 A;  2QEN A;  2XGN A;  4NOO B;  2UUA M;  5EXT A;  1S3S A;  3HX3 A;  1XMQ M;  2R65 A;  3FRI A;  5IZ7 D;  2LVO C;  1IXR C;  2DI0 A;  2BJW A;  2LVP C;  4KOD A;  4LF6 M;  4IBI A;  2MRO B;  2HCB A;  4M9Z A;  3WHK A;  4LFC M;  3T15 A;  1N75 A;  5C1B A;  3B74 A;  4IBK A;  3GO8 A;  1WR1 B;  1D0K A;  2QZ4 A;  3E4R A;  3IG5 A;  3KOX E;  3W67 A;  1CUK A;  2L4F A;  3GLI B;  2V1U A;  3GQ3 A;  5ITX A;  1W5S A;  1F4I A;  2DAM A;  4JI5 M;  2CEA A;  4A3V B;  3HHZ A;  4ANR A;  3TL4 X;  3LQQ A;  3W68 A;  1Z5C A;  2LHG A;  3IEC A;  3NBX X;  5E6J A;  4CJ6 A;  1L2D A;  2HKJ A;  4M9X A;  3TE6 A;  1FJG M;  1G59 A;  5E26 A;  1KSF X;  2GQF A;  3RFW A;  1XXH A;  4DR3 M;  2CHG A;  2O25 A;  4OVZ B;  1NY5 A;  1HNZ M;  2CP8 A;  3KOY E;  1TTE A;  4BB9 A;  2I7N A;  2C99 A;  2CE7 A;  3A98 B;  1QVR A;  4D82 A;  3J27 B;  4NRW A;  1QAN A;  2O5R A;  2K0B X;  1NHW C;  4AG5 A;  4GKJ M;  1JR3 A;  2M5Z A;  2C98 A;  4FWH A;  3FRH A;  3SMP A;  3TQS A;  2R44 A;  2DHR A;  3CF6 E;  1HQC A;  1Q3C A;  3FUU A;  5L8R F;  3B89 A;  2VQF M;  3I04 M;  4DV7 M;  3L27 A;  3J2P B;  1PRB A;  4S12 A;  5ITQ A;  2DHY A;  4LCB A;  3U6S A;  2D7H A;  5IRE B;  3GP1 A;  3RE8 A;  3GLI E;  4G4R A;  2ZM6 M;  4LRS A;  3GPX A;  3EIH A;  4QHT A;  3FYD A;  4GH9 A;  1VG5 A;  2ERC A;  2O01 F;  1Q39 A;  5DFL A;  3U6M A;  1SXJ D;  3LQR A;  2Z4R A;  3CTW B;  4KHP M;  2FE8 A;  4B7F A;  1ZAE A;  3SAT A;  4REZ A;  2Z7J A;  1KYI A;  2VQE M;  1QDR A;  2Z4S A;  4R7G A;  4GHA A;  4CHT B;  2KDL A;  2LTU A;  3QYB A;  3FYC A;  3PFI A;  5EP4 A;  4X65 M;  4JI3 M;  4BLC A;  3SFZ A;  2A5Y B;  3SYK A;  3T1Y M;  4D80 A;  3GLG B;  2JA2 A;  3H4J A;  2ZTD A;  2R46 A;  3GPU A;  2CV0 A;  3GQ4 A;  4LG2 A;  1R7R A;  3K8Z A;  3E21 A;  1XMO M;  3SAS A;  2G3Q A;  1E9R A;  1IY2 A;  4DR4 M;  2LVQ D;  4AG6 A;  3KXE C;  3SHF A;  4LGY A;  1XHB A;  1MN3 A;  4GMQ A;  2WSE F;  4JI2 M;  3QWL A;  2XLJ A;  2UUB M;  4DR5 M;  1DGH A;  5ITX E;  1IN4 A;  2BWB A;  2APL A;  1ZMU A;  5F3W A;  3RGS A;  4NXN M;  1IXS B;  1OFH A;  2XSZ A;  2VII A;  3V76 A;  2JUJ A;  3SYL A;  2XFS A;  4JXJ A;  4QNR A;  3W0L B;  5BR8 M;  3U6C A;  3THG A;  3FD9 A;  3SHG B;  1GAB A;  4B08 A;  3GLG E;  2DAG A;  4UN2 B;  2HL7 A;  3K2L A;  3KOZ E;  2C9C A;  2LVN C;  2R0I A;  4JYA M;  2LVA A;  3KOW E;  4JI7 M;  1C1K A;  3FTC A;  4B3S M;  3MMP A;  3HY5 A;  1RU3 A;  4DUY M;  2F5P A;  4KT0 F;  1GL7 A;  2CHV A;  3U5Z A;  1QYR A;  4GIP A;  5FTL A;  4G3O A;  3L25 A;  4K0K M;  2VF8 A;  3ZH9 B;  2J7N A;  1TH3 A;  3FTD A;  1QUS A;  1AUA A;  3I4Y A;  4NSO B;  4GC5 A;  3ILK A;  1TH4 A;  3R9X B;  1YLA A;  2QSF X;  3PXG A;  1TGU A;  4LJA A;  4EIW A;  4ITQ A;  4JI6 M;  1EE8 A;  2DWN A;  1YUB A;  2KRK A;  2G8L A;  2BNK A;  3UGJ A;  4QHS A;  3AKZ A;  2KW0 A;  3GLF A;  1J09 A;  1ZV1 A;  4B7G A;  2LBC A;  1HT2 E;  2K47 A;  3B9P A;  2C5R A;  2Y21 A;  1D2N A;  4AKI A;  5ITT A;  1J7K A;  2EO2 A;  2F5N A;  1NV8 A;  2V1C A;  1EIJ A;  3GPY A;  3T6P A;  2CHQ A;  1L8Q A;  3C58 A;  2QQ8 A;  3B7Q A;  3VFD A;  3VDP A;  1L2B A;  2XF3 A;  1QQW A;  2QBY B;  3HJQ A;  3JR5 A;  3U6E A;  1NVM A;  3L2A A;  5C18 A;  1JQJ C;  4CIS A;  4I5S A;  1HR0 M;  3OTO M;  4GKK M;  3EIE A;  3FUT A;  3GRR A;  2R45 A;  2V6Z M;  3KDS E;  3SAW A;  1Y8G A;  2BWE A;  2ZAM A;  4II7 A;  2L7I A;  4IJE A;  1IBK M;  2J5Y A;  3HZJ A;  1OKS A;  1PM5 A;  1MJG M;  4JN6 A;  4AZF A;  2CWB A;  1R6B X;  2XH9 A;  3L28 A;  3HHY A;  2C9O A;  4L6V 6;  2QHO B;  2AHM A;  1HNX M;  2JY8 A;  1K3W A;  4FWD A;  2LHC A;  1IXZ A;  3U6O A;  2L09 A;  4JI1 M;  3AJI B;  2X4A A;  3E46 A;  3T1H M;  2D7E A;  4NSR A;  1LV7 A;  1D0L A;  1OIZ A;  4QNM A;  2X8A A;  4G6Z A;  3ZCB B;  2R4E A;  1ZMV A;  3KSJ A;  2Z3X A;  2JWS A;  2DAI A;  3L26 A;  4AQY M;  4DV6 M;  2FH0 A;  4MGH A;  3C3E A;  3DOA A;  3U6P A;  2QNJ A;  3PVS A;  4DV1 M;  1HT1 E;  2Q2E B;  3HU2 A;  1XB2 B;  3KFU G;  1PGY A;  3M6A A;  3SC3 A;  1PJJ A;  2DZN B;  1NNU C;  4LF9 M;  3CF0 A;  3KSX A;  3A46 A;  2RGH A;  4JI8 M;  4DUZ M;  4IBJ A;  1XXH B;  1QAQ A;  3CF2 A;  3LCV B;  5EXS A;  2JZ1 A;  1IFY A;  4ZPX A;  3HHW A;  1ZMW A;  2MH8 A;  2XZF A;  3K92 A;  3LCU A;  4HL4 A;  4NL4 H;  3B7Z A;  4W5W A;  1C7Y A;  4JI0 M;  2FS1 A;  1DGG A;  1DO0 A;  3E9S A;  2XZU A;  1SG9 A;  3TWL A;  2N35 A;  1DV0 A;  1VEK A;  1TDH A;  3I51 A;  4F1I A;  2KEB A;  5ITU A;  2JY5 A;  4GC9 A;  1TDZ A;  5JI2 E;  2E5L M;  5LMN M;  1IN7 A;  1PJT A;  1R5L A;  3H4M A;  4DV5 M;  3SBJ A;  2F5S A;  1EFU B;  2K9D A;  5KPZ A;  1XNR M;  2LXE A;  1Z5A A;  5EXP A;  3GLH A;  3LVV A;  1T43 A;  2CFO A;  4FVM A;  3DFZ A;  3NWL A;  4MGK E;  3U6L A;  1IBL M;  2JY6 B;  4NXM M;  2HAK A;  4LY6 A;  5DYG A;  4LRT A;  3VKH A;  2MR9 A;  4P16 A;  1R2Y A;  3B7N A;  3I01 M;  1XXH E;  4LZJ A;  1NJF A;  4LFB M;  1A5T A;  4FW9 A;  2DZL A;  1ZQ9 A;  4MB7 A;  4CGY B;  1WIV A;  3U60 A;  1WXQ A;  2L7H A;  1VDD A;  4DR7 M;  2I7P A;  1OTR A;  4GIT A;  4I81 A;  4LJ8 A;  3MK6 A;  2EA0 A;  2Y0Q A;  3Q8X A;  4FWG A;  4Z8X A;  3HWS A;  3IHP A;  3QAU A;  4CIZ A;  4I8O A;  4MGZ E;  3TPZ A;  2DWZ B;  1JR3 E;  4B3R M;  7CAT A;  3GRY A;  3VK7 A;  2LH0 A;  2CUZ A;  2QP9 X;  3K1J A;  4IBE A;  4QOZ C;  4IJF A;  1XWI A;  2RRU A;  4QOS A;  3ZQJ A;  1N36 M;  4RF0 A;  5KPT A;  2BJV A;  2L2D A;  3TWM A;  1T6O A;  1JR3 D;  1QAO A;  3ZC7 B;  1OFI A;  1R4G A;  2JP7 A;  2LWX A;  2YR0 A;  3AOE A;  4FCT A;  3C9P A;  1ORY B;  1IN5 A;  1MU5 A;  1IN6 A;  4DV4 M;  3GRV A;  4MM3 B;  2HHH M;  4XGI A;  4OX9 M;  1DGH B;  1J5E M;  3GLH B;  2XEP A;  2OPF A;  4IBF A;  1K3X A;  5FTK A;  1NNJ A;  4IBC A;  1IN8 A;  4LJ6 A;  3KS4 A;  3K9O A;  4KO8 A;  8CAT A;  2UUC M;  1N77 A;  2KXE A;  1G41 A;  1IM2 A;  4DR1 M;  2OOB A;  1KFV A;  1XC8 A;  1VEG A;  2LNH C;  4IBD A;  1SXJ A;  3HGI A;  5KO3 A;  4JV5 M;  4FCW A;  2H5X A;  2YFQ A;  4LJ9 A;  2DKL A;  1E94 E;  1MX0 A;  4DBG B;  2CV1 A;  3M7G A;  3CGW A;  1DGB A;  2M60 A;  4L8R C;  1GO5 A;  2KZU A;  2UU9 M;  3U61 A;  1TH2 A;  2OOA A;  1PJI A;  1OAI A;  1QDT A;  5EP2 A;  4IBB A;  4AW4 A;  3AL0 C;  4OVZ A;  1QZM A;  2NQ8 C;  1I4W A;  2YQZ A;  2MGW A;  1K82 A;  1NJG A;  3HHX A;  1WJ7 A;  3U5Z B;  3KP0 E;  3BXW A;  3NBI A;  3MJ5 A;  2HWJ A;  4R3D A;  2DAK A;  1UFZ A;  3WHL A;  5FSW A;  3FUW A;  2KNA A;  3GLH E;  2R4J A;  3SAU A;  3FKE A;  3AV0 A;  3VLF B;  5IWA M;  4WW0 A;  2G5G X;  2J7O A;  2ZBK B;  4NRV A;  2KHH A;  4HEO A;  1Z6T A;  1G71 A;  4L15 A;  3D8L A;  2EKF A;  1N32 M;  5BPV A; 
#chains in the Genus database with same CATH homology
 1Z59 A;  5EQT A;  4LJ7 A;  1NSF A;  3SAV A;  1G3I A;  1GKI A;  1SXJ B;  3I4V A;  4Z6Y A;  2XSZ D;  3GLF B;  2L6O A;  1DGF A;  4JI4 M;  5FTN A;  1E32 A;  3JAM S;  3U6D A;  4MGY E;  4GHL A;  2EUC A;  3VK8 A;  4XBO A;  2RGO A;  4X64 M;  4OW0 A;  5FLX S;  4FCV A;  4DV3 M;  4G4O A;  3U61 B;  4I4L A;  1GLN A;  1FNN A;  3HKP A;  4DR6 M;  2FOI C;  1T3T A;  1NHG C;  2DXI A;  5EJC A;  4B7H A;  3GRU A;  3U6Q A;  5EXX A;  3SMS A;  1HQY E;  5KQ8 A;  2Y20 A;  1E9S A;  1Z5B A;  3UZU A;  4M9S A;  3GLG A;  1H6U A;  4RNA A;  4WUR A;  3FTF A;  2W82 A;  2UXD M;  1QAM A;  2X49 A;  2CV2 A;  2KZS A;  2QPA A;  3GPP A;  5ITR A;  2RKO A;  3LVW A;  1OJL A;  4LJ5 A;  4IIW A;  2F5Q A;  4KLN A;  5DNY A;  4BBA A;  2R62 A;  4L16 A;  4X66 M;  2D7G A;  4D81 A;  1L1T A;  1SXJ E;  1YE9 A;  1NY6 A;  1N34 M;  3VKG A;  1IQP A;  1N33 M;  3UJN A;  2R18 A;  2FFJ A;  3BOS A;  3HU3 A;  1HNW M;  4IBG A;  1Q3B A;  4TUW A;  3W0F A;  3KVW A;  4M0W A;  4LF4 M;  2KA6 B;  3RGP A;  2F4V M;  2UXB M;  3LMM A;  1L2C A;  1G8P A;  3UK6 A;  1YSY A;  4G4N A;  3IG8 A;  3DZD A;  3J7B A;  3AFH A;  4MGI E;  4LFA M;  5LMU M;  5IT9 S;  1X37 A;  3FUX A;  4PCZ A;  1W5T A;  2ZAN A;  4DV2 M;  3T38 A;  2F5O A;  2P5T A;  4LF7 M;  4LGM A;  3J81 S;  4LJ4 A;  3HJ8 A;  5EP1 A;  4MH0 E;  4L4U A;  5ITY A;  2DWM A;  5EP3 A;  3R8F A;  5H37 D;  1IBM M;  3A45 A;  1DO2 A;  1R2Z A;  4LF5 M;  5DYI A;  3L29 A;  2ZAO A;  4YHH M;  3J80 S;  4YY3 M;  3UMM A;  3SAR A;  2Y0T A;  4LF8 M;  3VDU A;  3FUV A;  3D8B A;  4HLQ A;  4M0D A;  3JR4 A;  4PDG A;  4AKG A;  3HJS A;  4PT5 A;  4DR2 M;  3AOE C;  4LZZ A;  2XFT A;  3HU1 A;  3MHV C;  2FNA A;  3TWK A;  3AOG A;  2KRU A;  3KP1 E;  1G4A E;  4DV0 M;  2H1R A;  4GRI A;  2C96 A;  1N78 A;  1GL6 A;  1XNQ M;  3A42 A;  3FTE A;  3PNY A;  1IY0 A;  5KPR A;  3PNV A;  3GLI A;  3U60 B;  1GVN A;  5FTM A;  2QBY A;  4AI6 A;  3J7A S;  1SXJ C;  3DA1 A;  3M0E A;  5GKN A;  1I94 M;  2YNM D;  4OU7 A;  4PD2 A;  4PDI A;  1IY1 A;  5KQD A;  3GQ5 A;  2QCU A;  4G4Q A;  4AKH A;  4X62 M;  2DZO B;  3KS8 A;  2UXC M;  2OQ4 A;  5JI3 E;  5FTJ A;  4L78 A;  1L1Z A;  5A2Q S;  3KW6 A;  4B3T M;  2DVW B;  4B3M M;  1UM8 A;  2DWL A;  4RF1 A;  4FD2 A;  2QEN A;  2XGN A;  4NOO B;  2UUA M;  5EXT A;  1S3S A;  1XMQ M;  2R65 A;  5IZ7 D;  1IXR C;  4LF6 M;  2BJW A;  4KOD A;  4IBI A;  2HCB A;  4M9Z A;  3WHK A;  4LFC M;  3T15 A;  1N75 A;  5C1B A;  4IBK A;  3GO8 A;  2QZ4 A;  3E4R A;  3IG5 A;  3KOX E;  3GLI B;  2V1U A;  3GQ3 A;  5ITX A;  1W5S A;  4JI5 M;  2CEA A;  4A3V B;  3HHZ A;  3TL4 X;  3LQQ A;  1Z5C A;  5E6J A;  1L2D A;  2HKJ A;  4M9X A;  3TE6 A;  1FJG M;  1G59 A;  5E26 A;  1KSF X;  3RFW A;  4DR3 M;  1XXH A;  2CHG A;  1HNZ M;  4OVZ B;  1NY5 A;  3KOY E;  4BB9 A;  2I7N A;  2C99 A;  2CE7 A;  3A98 B;  1QVR A;  4D82 A;  3J27 B;  4NRW A;  1QAN A;  2O5R A;  1NHW C;  4AG5 A;  4GKJ M;  1JR3 A;  2M5Z A;  2C98 A;  4FWH A;  3SMP A;  3TQS A;  2DHR A;  3CF6 E;  1HQC A;  1Q3C A;  3FUU A;  2VQF M;  4DV7 M;  3L27 A;  3J2P B;  4S12 A;  5ITQ A;  4LCB A;  3U6S A;  2D7H A;  5IRE B;  3GP1 A;  3RE8 A;  4G4R A;  2ZM6 M;  4LRS A;  3GPX A;  3EIH A;  4QHT A;  3FYD A;  4GH9 A;  2ERC A;  1Q39 A;  3U6M A;  1SXJ D;  3LQR A;  2Z4R A;  3CTW B;  4KHP M;  2FE8 A;  4B7F A;  1ZAE A;  3SAT A;  4REZ A;  2Z7J A;  1KYI A;  2VQE M;  2Z4S A;  4R7G A;  4GHA A;  4CHT B;  3FYC A;  3PFI A;  5EP4 A;  4X65 M;  4JI3 M;  4BLC A;  3SFZ A;  2A5Y B;  3SYK A;  3T1Y M;  4D80 A;  3GLG B;  2JA2 A;  3GPU A;  2R46 A;  2CV0 A;  4LG2 A;  3GQ4 A;  1R7R A;  3K8Z A;  1XMO M;  3SAS A;  1E9R A;  1IY2 A;  4DR4 M;  4AG6 A;  3KXE C;  3SHF A;  4LGY A;  1XHB A;  4GMQ A;  4JI2 M;  3QWL A;  2XLJ A;  2UUB M;  4DR5 M;  1DGH A;  5ITX E;  1IN4 A;  5F3W A;  3RGS A;  4NXN M;  1IXS B;  1OFH A;  2XSZ A;  2VII A;  3SYL A;  2XFS A;  4JXJ A;  4QNR A;  3W0L B;  5BR8 M;  3U6C A;  3THG A;  3FD9 A;  3SHG B;  4B08 A;  2HL7 A;  3K2L A;  3KOZ E;  2C9C A;  4JYA M;  3KOW E;  4JI7 M;  1C1K A;  3FTC A;  4B3S M;  4DUY M;  2F5P A;  1GL7 A;  2CHV A;  3U5Z A;  1QYR A;  4GIP A;  5FTL A;  4K0K M;  3L25 A;  3ZH9 B;  2J7N A;  1TH3 A;  3FTD A;  3I4Y A;  4NSO B;  4GC5 A;  3ILK A;  1TH4 A;  3R9X B;  3PXG A;  1TGU A;  4LJA A;  4EIW A;  4ITQ A;  4JI6 M;  1EE8 A;  2DWN A;  1YUB A;  2KRK A;  2G8L A;  2BNK A;  3UGJ A;  4QHS A;  3AKZ A;  2KW0 A;  3GLF A;  1J09 A;  4B7G A;  3B9P A;  1HT2 E;  2K47 A;  2C5R A;  2Y21 A;  1D2N A;  4AKI A;  5ITT A;  1J7K A;  2EO2 A;  2F5N A;  2V1C A;  3GPY A;  2CHQ A;  1L8Q A;  3C58 A;  3VFD A;  3VDP A;  1L2B A;  2XF3 A;  1QQW A;  2QBY B;  3HJQ A;  3JR5 A;  3U6E A;  1NVM A;  3L2A A;  5C18 A;  1JQJ C;  4CIS A;  4I5S A;  1HR0 M;  3OTO M;  4GKK M;  3EIE A;  3FUT A;  3GRR A;  2R45 A;  2V6Z M;  3KDS E;  3SAW A;  4II7 A;  2ZAM A;  2L7I A;  4IJE A;  1IBK M;  1PM5 A;  4JN6 A;  4AZF A;  1R6B X;  2XH9 A;  3L28 A;  3HHY A;  2C9O A;  2AHM A;  1HNX M;  1K3W A;  4FWD A;  1IXZ A;  3U6O A;  2L09 A;  4JI1 M;  3AJI B;  2X4A A;  3T1H M;  2D7E A;  4NSR A;  1LV7 A;  4QNM A;  2X8A A;  4G6Z A;  3ZCB B;  2R4E A;  3KSJ A;  2Z3X A;  3L26 A;  4AQY M;  4DV6 M;  4MGH A;  3DOA A;  3U6P A;  3PVS A;  4DV1 M;  1HT1 E;  2Q2E B;  3HU2 A;  3KFU G;  3M6A A;  3SC3 A;  1PJJ A;  2DZN B;  1NNU C;  4LF9 M;  3CF0 A;  3KSX A;  3A46 A;  2RGH A;  4JI8 M;  4DUZ M;  4IBJ A;  1XXH B;  1QAQ A;  3CF2 A;  5EXS A;  4ZPX A;  3HHW A;  2XZF A;  3K92 A;  4HL4 A;  4NL4 H;  4W5W A;  4JI0 M;  1DGG A;  1DO0 A;  3E9S A;  2XZU A;  3TWL A;  3I51 A;  1TDH A;  2KEB A;  5ITU A;  1TDZ A;  4GC9 A;  5JI2 E;  2E5L M;  5LMN M;  1IN7 A;  3H4M A;  4DV5 M;  3SBJ A;  2F5S A;  5KPZ A;  1XNR M;  2LXE A;  1Z5A A;  5EXP A;  3GLH A;  3LVV A;  4MGK E;  2CFO A;  4FVM A;  3DFZ A;  3NWL A;  3U6L A;  1IBL M;  4NXM M;  4LY6 A;  5DYG A;  4LRT A;  3VKH A;  4P16 A;  1R2Y A;  4LZJ A;  1NJF A;  4LFB M;  4FW9 A;  4MB7 A;  1ZQ9 A;  4CGY B;  3U60 A;  1WXQ A;  2L7H A;  1VDD A;  4DR7 M;  2I7P A;  4LJ8 A;  4GIT A;  4I81 A;  3MK6 A;  2EA0 A;  2Y0Q A;  3Q8X A;  4FWG A;  4Z8X A;  3HWS A;  3QAU A;  4I8O A;  4MGZ E;  3TPZ A;  2DWZ B;  4B3R M;  7CAT A;  3GRY A;  3VK7 A;  2LH0 A;  2CUZ A;  2QP9 X;  3K1J A;  4IBE A;  4QOZ C;  4IJF A;  1XWI A;  4QOS A;  1N36 M;  4RF0 A;  5KPT A;  2BJV A;  3TWM A;  1JR3 D;  1QAO A;  3ZC7 B;  1OFI A;  2LWX A;  2YR0 A;  3AOE A;  4FCT A;  1ORY B;  1IN5 A;  1MU5 A;  1IN6 A;  4DV4 M;  3GRV A;  4MM3 B;  2HHH M;  4XGI A;  4OX9 M;  1DGH B;  1J5E M;  3GLH B;  2XEP A;  2OPF A;  4IBF A;  1K3X A;  5FTK A;  1NNJ A;  4IBC A;  1IN8 A;  4LJ6 A;  3KS4 A;  4KO8 A;  8CAT A;  2UUC M;  1N77 A;  2KXE A;  1G41 A;  1IM2 A;  4DR1 M;  1KFV A;  1XC8 A;  2LNH C;  4IBD A;  1SXJ A;  3HGI A;  5KO3 A;  4JV5 M;  4FCW A;  2YFQ A;  4LJ9 A;  1E94 E;  1MX0 A;  2CV1 A;  3M7G A;  1DGB A;  2M60 A;  4L8R C;  2KZU A;  2UU9 M;  3U61 A;  1TH2 A;  1PJI A;  5EP2 A;  4IBB A;  4AW4 A;  3AL0 C;  4OVZ A;  1QZM A;  2NQ8 C;  1I4W A;  2YQZ A;  1K82 A;  1NJG A;  3HHX A;  3U5Z B;  3KP0 E;  3NBI A;  3MJ5 A;  4R3D A;  3WHL A;  5FSW A;  3FUW A;  2R4J A;  3SAU A;  3FKE A;  3AV0 A;  3VLF B;  5IWA M;  4WW0 A;  2G5G X;  2J7O A;  2ZBK B;  4NRV A;  1Z6T A;  4L15 A;  3D8L A;  1N32 M;  5BPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...