4GITA

Crystal structure of alpha sub-domain of lon protease from brevibacillus thermoruber
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
GYTELEKLHIMRDYLLPKQMEEHGLGRDKLQMNEEAMLKVIRQYTREAGVRNLNREAANICRKAARLIVSGEKKRVVVTPKTVESLLGKPRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for DNA-mediated allosteric regulation facilitated by the AAA(+) module of Lon protease.
pubmed doi rcsb
source organism Brevibacillus thermoruber
molecule tags Hydrolase
molecule keywords Lon protease
total genus 33
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2012-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gitA00
1IN4A 2C9CA 5C1BA 4QNRA 4QHTA 2RKOA 2HCBA 4FWGA 4D81A 4EIWA 1E94E 2C9OA 1HQCA 3R8FA 4L16A 2XSZD 1KSFX 5JI3E 2XSZA 2QPAA 3H4MA 1NSFA 4LJ9A 4KODA 4LJ5A 5JI2E 1OFIA 1IN8A 3M0EA 1IQPA 1SXJB 1QZMA 2QZ4A 1NVMA 2CHQA 3KW6A 2X8AA 4LJ4A 1IN7A 3HWSA 3GLHB 4QNMA 3U60B 2ZAOA 3GLIA 4Z8XA 5EXPA 1NJGA 1W5TA 4LRTA 2Z4SA 3VLFB 2DZNB 1IN5A 2DHRA 2CHVA 2R65A 2VIIA 1IXRC 1QVRA 1NY6A 2V1UA 2C98A 1UM8A 1IM2A 4LJ8A 3VFDA 3GLGB 1OJLA 3WHKA 4FCTA 4KO8A 4LGMA 2DZOB 1XXHA 2ZAMA 2DVWB 1X37A 1J7KA 3EIHA 3M6AA 4LCBA 5DYGA 2BJVA 1G3IA 3GLFA 2BJWA 2QBYB 2FNAA 1SXJA 1SXJC 3GLHA 4FCWA 4LJAA 1SXJD 5EXSA 1JR3A 1JQJC 4L15A 1XWIA 4LY6A 1LV7A 5FTLA 4LZZA 2R62A 5DYIA 2Z4RA 3GLFB 5EQTA 5C18A 5EXXA 4WW0A 4I4LA 1SXJE 2CE7A 4LJ6A 3HU3A 1G41A 3UK6A 2C96A 4L4UA 4FWHA 2C99A 1IY0A 3PVSA 1C1KA 1HT1E 2DWZB 1G4AE 1FNNA 3KDSE 4FWDA 5FTJA 3EIEA 3GLIB 4GITA 4QHSA 5EP3A 3D8BA 1HQYE 1W5SA 5FTKA 3SYKA 1R7RA 4FCVA 3ZH9B 4FD2A 5EP4A 3CF2A 4I81A 2CHGA 1DO0A 2ZANA 3WHLA 3U5ZB 5EP2A 1NJFA 3AJIB 2QBYA 3PXGA 5FTMA 1NY5A 4ZPXA 1E32A 1IY2A 3PFIA 3B9PA 2V6ZM 5EP1A 5FTNA 3DZDA 1S3SA 3SYLA 4QOSA 4D82A 4KLNA 4LJ7A 4D80A 1IXZA 3HU2A 2QENA 3BOSA 2KRKA 3HU1A 3K1JA 5EXTA 3SC3A 1R6BX 2CEAA 3U61B 1IN6A 3CF0A 3MHVC 1OFHA 4JN6A 1IY1A 1JR3D 1HT2E 2QP9X 4A3VB 1XXHB 1D2NA 4LRSA 1KYIA 1DO2A 1IXSB 3GLGA 1L8QA 4FW9A
chains in the Genus database with same CATH superfamily
1IN4A 3HHYA 4LF7M 5A2QS 2RKOA 3KP0E 3LCUA 2VDBB 2XSZD 3U6QA 2B3TA 1E9RA 1T43A 1N77A 3B7QA 3GPUA 3H4MA 5JI2E 4LJ5A 2FOIC 4S12A 3C58A 2XZUA 4DR5M 4B3RM 1WGLA 1A5TA 3J27B 3HKPA 1L1ZA 4JI2M 1NHGC 1ZV1A 4RKUF 4HLQA 2DXIA 2UUAM 2R18A 3ILKA 1MU5A 2ZAOA 4IJFA 3FD9A 4DV5M 1J5EM 2X4AA 3GPPA 2BWEA 2R44A 1I4WA 5ITTA 1Q3CA 4OU7A 3ZCBB 2DI0A 3U60A 2LVAA 4CHTB 4LZJA 1IM2A 2LNHC 3HGIA 2I7PA 1OJLA 4DR7M 3VDPA 1GABA 4YY3M 5IWAM 4OVZB 4IBGA 3GQ4A 2DVWB 3W67A 1J7KA 3GLGE 3GO8A 1L2CA 3IECA 1DGHA 4QOZC 4BB9A 2MR9A 3FTCA 2H5XA 2J7NA 1WIVA 4IBKA 2XF3A 4PDIA 1EIJA 4LJAA 4P16A 1HNXM 4B3MM 4NRVA 3KOWE 4IIWA 5LMUM 3D8LA 3U5ZA 4GC9A 2L4FA 1JQJC 4NRWA 3NBIA 2F5QA 4AQYM 4GKKM 1VQ1A 1VDDA 1PJTA 1Q39A 3ZC7B 4MGHA 2FH0A 4ITQA 4CIZA 3GLFB 3T1YM 2Q2EB 5C18A 4IBCA 3U6LA 1AIPC 1TF0B 2D7HA 4IBEA 2F4VM 1OQYA 2G5GX 1F4IA 1WXQA 4NXMM 1C1KA 1HNWM 2DWZB 3GLHE 1G4AE 3TQSA 4L78A 3Q8XA 3LCVB 4GITA 4QHSA 5E6JA 5EP3A 4G4NA 1MJGM 4IJEA 1YUBA 4XGIA 4GIPA 3SHGB 3U6PA 3HJSA 1DGFA 1N75A 4NSOB 3Q8GA 3L25A 1CUKA 4I81A 2RGHA 4AG5A 3SAWA 5EP2A 3AJIB 4DUZM 2UXBM 4WP2A 3PXGA 1OKSA 3AKZA 5ITYA 4ZPXA 4Z6YA 4TUWA 3A98B 1IY2A 1P3QQ 2MH8A 3I01M 2V6ZM 4Q7JA 2GQFA 4X65M 3SYLA 1K3WA 3L27A 2R45A 3MK6A 1D0KA 2DAKA 1UFZA 1TGUA 2CFOA 3HU2A 2QENA 2DENA 2KHHA 2KRKA 2BWBA 3BOSA 3SC3A 2R6FA 1HNZM 2CEAA 1GJSA 2DKLA 1IFYA 1IN6A 2WSCF 3CF0A 1XMQM 3QAUA 3MHVC 3W0FA 4JN6A 1HT2E 5ITRA 2UU9M 3FUVA 2KNAA 1D2NA 1E9SA 5FLXS 5KQ8A 1KYIA 3GRRA 1D0LA 4NSRA 1IXSB 1L8QA 2QHOB 5KPTA 3PNVA 2ZBKB 4NC6A 1EE8A 1V34A 2JY6B 3AL0C 5KPRA 1N78A 4QHTA 2HCBA 3SAUA 4CGYB 1XB2B 2I7NA 4D81A 1E94E 2CV1A 2C9OA 3OTOM 3R8FA 4GC5A 1OTRA 3NWLA 4AKIA 1KSFX 5IT9S 3E9SA 3LMMA 1NSFA 4KODA 4R3DA 3C3EA 1OFIA 1IN8A 3M0EA 2LHGA 2CHQA 3AV0A 4HEOA 3V76A 4DR1M 3VK8A 4B3TM 1IN7A 3K2LA 4II7A 1IXSA 4QNMA 1KFVA 1XHBA 3GLIA 2FFJA 5F3WA 1NJGA 2UXCM 2M60A 4CJ6A 1V92A 2QCUA 2Z4SA 3GRUA 3VLFB 2F5OA 4GRIA 3FYCA 3UJNA 2LVOC 1QAMA 3I4VA 1T3TA 1UM8A 2Y0TA 1WGNA 4X64M 4AKGA 3GLGB 1WHCA 3JR5A 2XZFA 4LGMA 1T6OA 4MGYE 3IG8A 4IBFA 3VDUA 1NNJA 1L2DA 4LF5M 1ORYB 3FTFA 1OAOC 4JV5M 3LW5F 2ZAMA 1NHWC 4AZFA 1X37A 4PCZA 4DV0M 1ZMWA 3EIHA 1R2ZA 2A5YB 2BJVA 5DYGA 4X62M 4M0DA 3GLFA 4GKJM 2YQZA 3KS4A 2QBYB 2LVNC 4FCWA 1ZMUA 4MGIE 4GMQA 2DWMA 3C3DA 1V33A 4B08A 3SHFA 2NQ8C 1DGGA 2CWBA 1GKIA 1XWIA 2WSFF 1C7YA 2LHCA 3FRHA 2G8LA 4LZZA 2EKKA 5DYIA 2Y20A 2Z4RA 1JR3E 2KNVA 4WURA 4DR2M 1Z5CA 1QUSA 1MN3A 2CE7A 3W0LB 3CGWA 3HU3A 3T6PA 3LQQA 3RGPA 2DWNA 2C96A 2JA2A 1R2YA 4LF6M 2LXEA 1HT1E 4JI0M 1FNNA 4FWDA 3GLIB 5KPZA 1N34M 2LH0A 2KXEA 4MB7A 2QSFX 3JR4A 4DR3M 2HKJA 1HQYE 1W5SA 2KA6B 1WR1B 2J7OA 5FTKA 2JY8A 3BXWA 4FCVA 1K3XA 1DGHB 3HHXA 2P5TA 2JP7A 2CV0A 1Z5AA 3CF2A 2CHGA 1DO0A 3GPXA 1VG5A 2ZANA 1QANA 3SATA 5FTMA 1NY5A 3VKHA 2O5RA 3T15A 3GLIE 1Z5BA 4F1IA 1H6UA 1Q3BA 3GRVA 1S3SA 1GVNA 2ERCA 4QOSA 4JYAM 4DV7M 2O25A 2K47A 3L2AA 4Y28F 4DUYM 4D80A 1I94M 3B74A 1WJ7A 1RU3A 4I5SA 3HU1A 2YR0A 2WSEF 1R6BX 2KDLA 4JI3M 3TWKA 4RF0A 2DHYA 3HX3A 3TL4X 1IY1A 1JR3D 4XBOA 3DA1A 4JI7M 1SG9A 1PJSA 3HJQA 4LRSA 3J7BA 4G6ZA 4KHPM 1DO2A 2LTUA 3TWLA 3GLGA 4B7FA 2RGOA 4L8RC 4FW9A 3SAVA 2C9CA 2MGWA 5C1BA 4G4QA 4QNRA 4L6V6 4M9XA 4FWGA 1N33M 2LBCA 1HQCA 4B7GA 2JY5A 5IZ7D 2XSZA 2JZ0A 5KQDA 2DAGA 2YFQA 3T1HM 1SXJB 2QZ4A 4MGKE 4LFAM 3M7GA 3FYDA 2WZJA 2X8AA 2QQ8A 3MMPA 4IBDA 1G8PA 4LJ4A 3RGSA 4PT5A 2R0IA 4PD2A 4M0WA 4YHHM 4LF4M 4OX9M 3GLHB 4ANRA 3U60B 2H1RA 4M9SA 2JXNA 2VF7A 4Z8XA 5E26A 5EXPA 2FE8A 1L1TA 1W5TA 4GEWA 4B3SM 5ITXE 1DGBA 3SARA 3CF6E 4LF8M 2CHVA 2HHHM 2JY7A 2R65A 4AG6A 3QWLA 1GJTA 3VFDA 3HHWA 3NBXX 3GQ5A 1Y8GA 2QNJA 3WHKA 2HL7A 4FCTA 4BLCA 2VQFM 3KFUG 3RE8A 2OOBA 3UMMA 1XXHA 2ZM6M 1G71A 1Z6TA 2DAIA 2OPFA 2F5PA 2Y0QA 2KNZA 1TH3A 2OO9A 1BVSA 1YLAA 3KSJA 3M6AA 3LVVA 4LCBA 2F5NA 1QAQA 1D0MA 2M5ZA 3UGJA 3U6MA 2JNHA 1TDHA 3J2PB 3ZQJA 3HHZA 3THGA 1SXJD 4G4RA 4IBIA 4AW4A 4DV1M 2E5LM 3FTEA 5EXSA 1JR3A 5H37D 3KOXE 4L15A 1GL7A 5EJCA 2MROB 2ZTCA 4LY6A 3J81S 2Z3XA 4CISA 2CP8A 2V1CA 3MJ5A 2R62A 3FUXA 1VEKA 3AOGA 3CTWB 4DV2M 3K9OA 5EQTA 4F2LA 5EXXA 3GPYA 3KOYE 4WW0A 3K9PA 4I4LA 4LF9M 3U6OA 4LJ6A 3FTDA 1G41A 3UK6A 4OVZA 4L4UA 4FWHA 1QUTA 3AOEA 3GLFE 2C99A 1IY0A 3PVSA 3SFZA 2L2DA 4DV3M 3TWMA 2CUZA 3U6CA 3EIEA 2XEPA 1IBMM 4GHLA 4UN2B 3D8BA 3U61A 2RRUA 2DNAA 3SYKA 1R7RA 1NV9A 2EJSA 2GNOA 1TR8A 3ZH9B 2L09A 4GH9A 3VKGA 1AUAA 2Y21A 2DWLA 3UZUA 4LFBM 3R9XB 2KZUA 3W68A 2UUBM 2G3QA 1TH2A 1NJFA 2BNKA 2D7GA 3GQ3A 4GHAA 5IREB 3LQRA 2EA0A 5LMNM 3C9PA 4JI1M 1E32A 3H4JA 3I04M 3U6SA 1NNUC 4AKHA 3FUTA 3SBJA 5ITUA 3FRIA 4LGYA 5FSWA 2J5YA 2JWSA 3J7AS 3T38A 4M9ZA 4AI6A 2EO2A 2Z7JA 2DAEA 4D82A 2OQ4A 4JI5M 1VDLA 4RF1A 1YE9A 4JI6M 4XK8F 4LJ7A 4MGZE 2CRUA 4DV4M 3FUUA 3U61B 4DR4M 2K9DA 1Z59A 3AOEC 2HWJA 2QP9X 2DZLA 3SMPA 5L8RF 4A3VB 1MX0A 3U6EA 1TTEA 2DAMA 3B7ZA 2KZSA 4LFCM 3K8ZA 1VEJA 4JI4M 3JAMS 3QYBA 2UXDM 3SASA 1JB0F 4EIWA 1PRBA 3KOZE 5GKNA 1DV0A 1LTMA 1PJQA 5DFLA 5KO3A 4L16A 3A42A 4OW0A 2C5RA 5JI3E 3A46A 1L2BA 1TH4A 2QPAA 3HJ8A 2Z8YM 1GL6A 4I8OA 2L4EA 2O01F 4LJ9A 3KS8A 1IQPA 1ZQ9A 1QZMA 3KW6A 1NVMA 2JUJA 1FJGM 4B7HA 1HJPA 3L29A 4NXNM 3BBZA 1G59A 3HWSA 5ITQA 3E46A 2YNMD 3FE3A 1YSYA 3KVWA 2K0BX 3KXEC 3HZJA 3B89A 1VEGA 3I4YA 4LRTA 4G4OA 2DZNB 1NV8A 1IN5A 3HY5A 3PNYA 2DHRA 1HR0M 1EFUB 1GLNA 3K92A 2VIIA 1IXRC 1QVRA 1NY6A 2V1UA 2C98A 4LJ8A 4K0KM 2N35A 4W5WA 4P17A 4KO8A 2DZOB 1IBLM 1N36M 2AHMA 3DFZA 8CATA 1PM5A 3DOAA 1Q02A 1IBKM 2MJ5B 4RNAA 1R4GA 5ITXA 2L7HA 3L28A 4PDGA 2HAKA 1G3IA 2BJWA 3RFWA 4R71A 1XNQM 2FNAA 1SXJA 1SXJC 4DBGB 7CATA 1R5LA 1XC8A 1J09A 3SMSA 3KSXA 2XH9A 1PJJA 1XNRM 2L6OA 1NO1A 4JXJA 1LV7A 1QAOA 1ZAEA 1OAIA 5FTLA 1K82A 2UUCM 2R46A 2XLJA 1XXHE 2X49A 2L7IA 1SXJE 2VF8A 2F5SA 2LWXA 4LG2A 4MM3B 2KEBA 2LVPC 1ZMVA 2ZTDA 3E21A 3FUWA 4DV6M 4JI8M 2D7EA 3B7NA 5BR8M 2LVQD 2OOAA 3KDSE 4NOOB 5FTJA 2XGNA 4NL4H 2APLA 1QYRA 1OIPA 2K6BA 3QYEA 3J80S 1GO5A 3FKEA 1QQWA 3A45A 1PJIA 4FD2A 2EUCA 4R7GA 1QDRA 4X66M 3IHPA 5EP4A 2XFTA 4KT0F 3L26A 2R4JA 3GP1A 3WHLA 3U5ZB 2QBYA 2W82A 5DNYA 1QZEA 3I51A 3PFIA 4IBBA 2CV2A 1N32M 3B9PA 5BPVA 3KP1E 4IBJA 5EP1A 1QDTA 5FTNA 3DZDA 3IG5A 4KLNA 4G3OA 3E4RA 1IXZA 2KRUA 5EXTA 3K1JA 1PGYA 2EKFA 4MH0E 3TE6A 2VQEM 3VK7A 4REZA 1OFHA 4DR6M 2FS1A 2KW0A 2R4EA 3TPZA 4FVMA 1TDZA 1XXHB 4BBAA 1OIZA 3U6DA 4HL4A 3AFHA 3GLHA 3F92A 2JZ1A 1XMOM 3GRYA 2XFSA 3LVWA
chains in the Genus database with same CATH topology
1IN4A 3HHYA 4LF7M 5A2QS 2RKOA 3KP0E 2XSZD 3U6QA 1E9RA 1N77A 3GPUA 3H4MA 5JI2E 4LJ5A 2FOIC 4S12A 3C58A 2XZUA 4DR5M 4B3RM 3J27B 3HKPA 1L1ZA 4JI2M 1NHGC 4HLQA 2DXIA 2UUAM 2R18A 3ILKA 1MU5A 2ZAOA 4IJFA 3FD9A 4DV5M 1J5EM 2X4AA 3GPPA 1I4WA 5ITTA 1Q3CA 4OU7A 3ZCBB 3U60A 4CHTB 4LZJA 1IM2A 2LNHC 3HGIA 2I7PA 1OJLA 4DR7M 3VDPA 4YY3M 5IWAM 4OVZB 4IBGA 3GQ4A 2DVWB 1J7KA 3GO8A 1L2CA 1DGHA 4QOZC 4BB9A 3FTCA 2J7NA 4IBKA 2XF3A 4PDIA 4LJAA 4P16A 1HNXM 4B3MM 4NRVA 3KOWE 4IIWA 5LMUM 3D8LA 3U5ZA 4GC9A 1JQJC 4NRWA 3NBIA 2F5QA 4AQYM 4GKKM 1VDDA 1Q39A 3ZC7B 4MGHA 4ITQA 3GLFB 3T1YM 2Q2EB 5C18A 4IBCA 3U6LA 2D7HA 4IBEA 2F4VM 2G5GX 1WXQA 4NXMM 1C1KA 1HNWM 2DWZB 3TQSA 1G4AE 4L78A 3Q8XA 4GITA 4G4NA 4QHSA 5E6JA 5EP3A 4IJEA 1YUBA 4XGIA 4GIPA 3SHGB 3U6PA 3HJSA 1DGFA 1N75A 4NSOB 3L25A 4I81A 2RGHA 4AG5A 3SAWA 5EP2A 3AJIB 4DUZM 2UXBM 3PXGA 3AKZA 4TUWA 5ITYA 4ZPXA 4Z6YA 3A98B 1IY2A 2V6ZM 4X65M 3SYLA 1K3WA 3L27A 2R45A 3MK6A 1TGUA 2CFOA 3HU2A 2QENA 3BOSA 2KRKA 3SC3A 1HNZM 2CEAA 1IN6A 1XMQM 3CF0A 3QAUA 3MHVC 3W0FA 4JN6A 1HT2E 5ITRA 2UU9M 3FUVA 1D2NA 1E9SA 5FLXS 5KQ8A 1KYIA 3GRRA 4NSRA 1IXSB 1L8QA 5KPTA 3PNVA 2ZBKB 1EE8A 3AL0C 5KPRA 1N78A 4QHTA 2HCBA 3SAUA 4CGYB 2I7NA 4D81A 1E94E 2CV1A 2C9OA 3OTOM 3R8FA 4GC5A 3NWLA 4AKIA 1KSFX 5IT9S 3E9SA 3LMMA 1NSFA 4KODA 4R3DA 1OFIA 1IN8A 3M0EA 2CHQA 3AV0A 4B3TM 4DR1M 3VK8A 1IN7A 3K2LA 4II7A 4QNMA 1KFVA 1XHBA 3GLIA 2FFJA 5F3WA 1NJGA 2UXCM 2M60A 2F5OA 2Z4SA 2QCUA 3GRUA 3VLFB 4GRIA 3FYCA 3UJNA 1QAMA 3I4VA 1T3TA 1UM8A 2Y0TA 4X64M 4AKGA 3GLGB 3JR5A 2XZFA 4LGMA 4MGYE 3IG8A 4IBFA 3VDUA 1NNJA 1L2DA 4LF5M 1ORYB 3FTFA 4JV5M 2ZAMA 1NHWC 4AZFA 1X37A 4PCZA 4DV0M 3EIHA 1R2ZA 2A5YB 2BJVA 5DYGA 4X62M 4M0DA 3GLFA 4GKJM 2YQZA 3KS4A 2QBYB 4FCWA 4MGIE 4GMQA 2DWMA 4B08A 3SHFA 2NQ8C 1DGGA 1GKIA 1XWIA 2G8LA 4LZZA 5DYIA 2Y20A 2Z4RA 4WURA 4DR2M 1Z5CA 2CE7A 3W0LB 3HU3A 3LQQA 3RGPA 2DWNA 2C96A 2JA2A 1R2YA 4LF6M 2LXEA 1HT1E 4JI0M 1FNNA 4FWDA 3GLIB 5KPZA 1N34M 2LH0A 2KXEA 4MB7A 3JR4A 4DR3M 2HKJA 1HQYE 1W5SA 2KA6B 2J7OA 5FTKA 4FCVA 1K3XA 1DGHB 3HHXA 2P5TA 2CV0A 1Z5AA 3CF2A 2CHGA 1DO0A 3GPXA 2ZANA 1QANA 3SATA 5FTMA 1NY5A 3VKHA 2O5RA 3T15A 1Z5BA 1H6UA 1Q3BA 3GRVA 1S3SA 1GVNA 2ERCA 4QOSA 4JYAM 4DV7M 2K47A 3L2AA 4DUYM 4D80A 1I94M 4I5SA 3HU1A 2YR0A 1R6BX 3TWKA 4JI3M 4RF0A 3TL4X 1IY1A 1JR3D 4XBOA 3DA1A 4JI7M 3HJQA 4LRSA 3J7BA 4G6ZA 4KHPM 1DO2A 3TWLA 4L8RC 3GLGA 4B7FA 2RGOA 4FW9A 3SAVA 2C9CA 5C1BA 4G4QA 4QNRA 4M9XA 4FWGA 1N33M 1HQCA 4B7GA 5IZ7D 2XSZA 5KQDA 2YFQA 3T1HM 1SXJB 2QZ4A 4MGKE 4LFAM 3M7GA 3FYDA 2X8AA 3RGSA 4LJ4A 4YHHM 4IBDA 1G8PA 4PD2A 4PT5A 4LF4M 4M0WA 4OX9M 3GLHB 3U60B 2H1RA 4M9SA 4Z8XA 5E26A 5EXPA 1L1TA 2FE8A 1W5TA 4B3SM 5ITXE 1DGBA 3SARA 3CF6E 4LF8M 2CHVA 2HHHM 2R65A 4AG6A 3QWLA 3VFDA 3HHWA 3GQ5A 3KFUG 3WHKA 2HL7A 4FCTA 4BLCA 2VQFM 3RE8A 3UMMA 1XXHA 2ZM6M 2OPFA 1Z6TA 2F5PA 2Y0QA 1TH3A 3KSJA 3M6AA 3LVVA 4LCBA 2F5NA 1QAQA 2M5ZA 3UGJA 3U6MA 1TDHA 3J2PB 3HHZA 3THGA 1SXJD 4G4RA 4IBIA 4AW4A 4DV1M 2E5LM 3FTEA 5EXSA 1JR3A 5H37D 3KOXE 4L15A 1GL7A 5EJCA 4LY6A 3J81S 2Z3XA 4CISA 2V1CA 3MJ5A 2R62A 3FUXA 3AOGA 3CTWB 4DV2M 5EQTA 5EXXA 3GPYA 3KOYE 4WW0A 4I4LA 3U6OA 4LJ6A 3FTDA 1G41A 3UK6A 4OVZA 4L4UA 4FWHA 4DV3M 3AOEA 2C99A 1IY0A 3PVSA 3SFZA 3TWMA 3U6CA 2CUZA 3EIEA 2XEPA 1IBMM 4GHLA 3D8BA 3U61A 3SYKA 1R7RA 3ZH9B 2L09A 4GH9A 3VKGA 2Y21A 2DWLA 3UZUA 4LFBM 3R9XB 2KZUA 2UUBM 1TH2A 1NJFA 2BNKA 2D7GA 3GQ3A 4GHAA 5IREB 3LQRA 2EA0A 5LMNM 4JI1M 4LF9M 1E32A 3U6SA 4AKHA 1NNUC 3FUTA 3SBJA 5ITUA 4LGYA 5FSWA 3J7AS 4AI6A 3T38A 4M9ZA 2EO2A 2Z7JA 4D82A 2OQ4A 4JI5M 4JI6M 4RF1A 1YE9A 4LJ7A 4MGZE 4DV4M 3FUUA 3U61B 4DR4M 1Z59A 3AOEC 2QP9X 3SMPA 4A3VB 1MX0A 3U6EA 4LFCM 2KZSA 3K8ZA 4JI4M 3JAMS 2UXDM 3SASA 4EIWA 3KOZE 5GKNA 5KO3A 4L16A 3A42A 4OW0A 2C5RA 5JI3E 3A46A 1L2BA 1TH4A 2QPAA 3HJ8A 4LJ9A 1GL6A 4I8OA 3KS8A 1IQPA 1ZQ9A 1QZMA 3KW6A 1NVMA 1FJGM 4B7HA 3L29A 4NXNM 1G59A 3HWSA 5ITQA 2YNMD 1YSYA 3KVWA 3KXEC 3I4YA 4LRTA 4G4OA 2DZNB 1IN5A 3PNYA 1HR0M 2DHRA 1GLNA 3K92A 2VIIA 1IXRC 1QVRA 1NY6A 2V1UA 2C98A 4LJ8A 4K0KM 4W5WA 4KO8A 2DZOB 1IBLM 1N36M 2AHMA 3DFZA 8CATA 1PM5A 3DOAA 1IBKM 4RNAA 5ITXA 2L7HA 3L28A 4PDGA 1G3IA 2BJWA 3RFWA 1XNQM 2FNAA 1SXJA 1SXJC 7CATA 1XC8A 1J09A 3SMSA 3KSXA 2XH9A 1PJJA 1XNRM 2L6OA 4JXJA 1LV7A 1QAOA 1ZAEA 5FTLA 1K82A 2UUCM 2R46A 2XLJA 2X49A 2L7IA 1SXJE 2F5SA 2LWXA 4LG2A 4MM3B 2KEBA 3FUWA 4DV6M 4JI8M 2D7EA 5BR8M 3KDSE 4NOOB 5FTJA 2XGNA 4NL4H 1QYRA 3J80S 3FKEA 1QQWA 3A45A 1PJIA 4FD2A 2EUCA 4R7GA 4X66M 5EP4A 2XFTA 3L26A 2R4JA 3GP1A 3WHLA 3U5ZB 2QBYA 2W82A 5DNYA 3I51A 3PFIA 4IBBA 2CV2A 1N32M 3B9PA 5BPVA 3KP1E 4IBJA 5EP1A 5FTNA 3DZDA 3IG5A 4KLNA 3E4RA 1IXZA 2KRUA 5EXTA 3K1JA 4MH0E 3TE6A 2VQEM 3VK7A 4REZA 1OFHA 4DR6M 2KW0A 2R4EA 3TPZA 4FVMA 1TDZA 1XXHB 4BBAA 3U6DA 4HL4A 3AFHA 3GLHA 1XMOM 3GRYA 2XFSA 3LVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IN4 A;  2C9C A;  5C1B A;  4QNR A;  4QHT A;  2RKO A;  2HCB A;  4FWG A;  4D81 A;  4EIW A;  1E94 E;  2C9O A;  1HQC A;  3R8F A;  4L16 A;  2XSZ D;  1KSF X;  5JI3 E;  2XSZ A;  2QPA A;  3H4M A;  1NSF A;  4LJ9 A;  4KOD A;  4LJ5 A;  5JI2 E;  1OFI A;  1IN8 A;  3M0E A;  1IQP A;  1SXJ B;  1QZM A;  2QZ4 A;  1NVM A;  2CHQ A;  3KW6 A;  2X8A A;  4LJ4 A;  1IN7 A;  3HWS A;  3GLH B;  4QNM A;  3U60 B;  2ZAO A;  3GLI A;  4Z8X A;  5EXP A;  1NJG A;  1W5T A;  4LRT A;  2Z4S A;  3VLF B;  2DZN B;  1IN5 A;  2DHR A;  2CHV A;  2R65 A;  2VII A;  1IXR C;  1QVR A;  1NY6 A;  2V1U A;  2C98 A;  1UM8 A;  1IM2 A;  4LJ8 A;  3VFD A;  3GLG B;  1OJL A;  3WHK A;  4FCT A;  4KO8 A;  4LGM A;  2DZO B;  1XXH A;  2ZAM A;  2DVW B;  1X37 A;  1J7K A;  3EIH A;  3M6A A;  4LCB A;  5DYG A;  2BJV A;  1G3I A;  3GLF A;  2BJW A;  2QBY B;  2FNA A;  1SXJ A;  1SXJ C;  3GLH A;  4FCW A;  4LJA A;  1SXJ D;  5EXS A;  1JR3 A;  1JQJ C;  4L15 A;  1XWI A;  4LY6 A;  1LV7 A;  5FTL A;  4LZZ A;  2R62 A;  5DYI A;  2Z4R A;  3GLF B;  5EQT A;  5C18 A;  5EXX A;  4WW0 A;  4I4L A;  1SXJ E;  2CE7 A;  4LJ6 A;  3HU3 A;  1G41 A;  3UK6 A;  2C96 A;  4L4U A;  4FWH A;  2C99 A;  1IY0 A;  3PVS A;  1C1K A;  1HT1 E;  2DWZ B;  1G4A E;  1FNN A;  3KDS E;  4FWD A;  5FTJ A;  3EIE A;  3GLI B;  4GIT A;  4QHS A;  5EP3 A;  3D8B A;  1HQY E;  1W5S A;  5FTK A;  3SYK A;  1R7R A;  4FCV A;  3ZH9 B;  4FD2 A;  5EP4 A;  3CF2 A;  4I81 A;  2CHG A;  1DO0 A;  2ZAN A;  3WHL A;  3U5Z B;  5EP2 A;  1NJF A;  3AJI B;  2QBY A;  3PXG A;  5FTM A;  1NY5 A;  4ZPX A;  1E32 A;  1IY2 A;  3PFI A;  3B9P A;  2V6Z M;  5EP1 A;  5FTN A;  3DZD A;  1S3S A;  3SYL A;  4QOS A;  4D82 A;  4KLN A;  4LJ7 A;  4D80 A;  1IXZ A;  3HU2 A;  2QEN A;  3BOS A;  2KRK A;  3HU1 A;  3K1J A;  5EXT A;  3SC3 A;  1R6B X;  2CEA A;  3U61 B;  1IN6 A;  3CF0 A;  3MHV C;  1OFH A;  4JN6 A;  1IY1 A;  1JR3 D;  1HT2 E;  2QP9 X;  4A3V B;  1XXH B;  1D2N A;  4LRS A;  1KYI A;  1DO2 A;  1IXS B;  3GLG A;  1L8Q A;  4FW9 A; 
#chains in the Genus database with same CATH topology
 1IN4 A;  3HHY A;  4LF7 M;  5A2Q S;  2RKO A;  3KP0 E;  3LCU A;  2VDB B;  2XSZ D;  3U6Q A;  2B3T A;  1E9R A;  1T43 A;  1N77 A;  3B7Q A;  3GPU A;  3H4M A;  5JI2 E;  4LJ5 A;  2FOI C;  4S12 A;  3C58 A;  2XZU A;  4DR5 M;  4B3R M;  1WGL A;  1A5T A;  3J27 B;  3HKP A;  1L1Z A;  4JI2 M;  1NHG C;  1ZV1 A;  4RKU F;  4HLQ A;  2DXI A;  2UUA M;  2R18 A;  3ILK A;  1MU5 A;  2ZAO A;  4IJF A;  3FD9 A;  4DV5 M;  1J5E M;  2X4A A;  3GPP A;  2BWE A;  2R44 A;  1I4W A;  5ITT A;  1Q3C A;  4OU7 A;  3ZCB B;  2DI0 A;  3U60 A;  2LVA A;  4CHT B;  4LZJ A;  1IM2 A;  2LNH C;  3HGI A;  2I7P A;  1OJL A;  4DR7 M;  3VDP A;  1GAB A;  4YY3 M;  5IWA M;  4OVZ B;  4IBG A;  3GQ4 A;  2DVW B;  3W67 A;  1J7K A;  3GLG E;  3GO8 A;  1L2C A;  3IEC A;  1DGH A;  4QOZ C;  4BB9 A;  2MR9 A;  3FTC A;  2H5X A;  2J7N A;  1WIV A;  4IBK A;  2XF3 A;  4PDI A;  1EIJ A;  4LJA A;  4P16 A;  1HNX M;  4B3M M;  4NRV A;  3KOW E;  4IIW A;  5LMU M;  3D8L A;  3U5Z A;  4GC9 A;  2L4F A;  1JQJ C;  4NRW A;  3NBI A;  2F5Q A;  4AQY M;  4GKK M;  1VQ1 A;  1VDD A;  1PJT A;  1Q39 A;  3ZC7 B;  4MGH A;  2FH0 A;  4ITQ A;  4CIZ A;  3GLF B;  3T1Y M;  2Q2E B;  5C18 A;  4IBC A;  3U6L A;  1AIP C;  1TF0 B;  2D7H A;  4IBE A;  2F4V M;  1OQY A;  2G5G X;  1F4I A;  1WXQ A;  4NXM M;  1C1K A;  1HNW M;  2DWZ B;  3GLH E;  1G4A E;  3TQS A;  4L78 A;  3Q8X A;  3LCV B;  4GIT A;  4QHS A;  5E6J A;  5EP3 A;  4G4N A;  1MJG M;  4IJE A;  1YUB A;  4XGI A;  4GIP A;  3SHG B;  3U6P A;  3HJS A;  1DGF A;  1N75 A;  4NSO B;  3Q8G A;  3L25 A;  1CUK A;  4I81 A;  2RGH A;  4AG5 A;  3SAW A;  5EP2 A;  3AJI B;  4DUZ M;  2UXB M;  4WP2 A;  3PXG A;  1OKS A;  3AKZ A;  5ITY A;  4ZPX A;  4Z6Y A;  4TUW A;  3A98 B;  1IY2 A;  1P3Q Q;  2MH8 A;  3I01 M;  2V6Z M;  4Q7J A;  2GQF A;  4X65 M;  3SYL A;  1K3W A;  3L27 A;  2R45 A;  3MK6 A;  1D0K A;  2DAK A;  1UFZ A;  1TGU A;  2CFO A;  3HU2 A;  2QEN A;  2DEN A;  2KHH A;  2KRK A;  2BWB A;  3BOS A;  3SC3 A;  2R6F A;  1HNZ M;  2CEA A;  1GJS A;  2DKL A;  1IFY A;  1IN6 A;  2WSC F;  3CF0 A;  1XMQ M;  3QAU A;  3MHV C;  3W0F A;  4JN6 A;  1HT2 E;  5ITR A;  2UU9 M;  3FUV A;  2KNA A;  1D2N A;  1E9S A;  5FLX S;  5KQ8 A;  1KYI A;  3GRR A;  1D0L A;  4NSR A;  1IXS B;  1L8Q A;  2QHO B;  5KPT A;  3PNV A;  2ZBK B;  4NC6 A;  1EE8 A;  1V34 A;  2JY6 B;  3AL0 C;  5KPR A;  1N78 A;  4QHT A;  2HCB A;  3SAU A;  4CGY B;  1XB2 B;  2I7N A;  4D81 A;  1E94 E;  2CV1 A;  2C9O A;  3OTO M;  3R8F A;  4GC5 A;  1OTR A;  3NWL A;  4AKI A;  1KSF X;  5IT9 S;  3E9S A;  3LMM A;  1NSF A;  4KOD A;  4R3D A;  3C3E A;  1OFI A;  1IN8 A;  3M0E A;  2LHG A;  2CHQ A;  3AV0 A;  4HEO A;  3V76 A;  4DR1 M;  3VK8 A;  4B3T M;  1IN7 A;  3K2L A;  4II7 A;  1IXS A;  4QNM A;  1KFV A;  1XHB A;  3GLI A;  2FFJ A;  5F3W A;  1NJG A;  2UXC M;  2M60 A;  4CJ6 A;  1V92 A;  2QCU A;  2Z4S A;  3GRU A;  3VLF B;  2F5O A;  4GRI A;  3FYC A;  3UJN A;  2LVO C;  1QAM A;  3I4V A;  1T3T A;  1UM8 A;  2Y0T A;  1WGN A;  4X64 M;  4AKG A;  3GLG B;  1WHC A;  3JR5 A;  2XZF A;  4LGM A;  1T6O A;  4MGY E;  3IG8 A;  4IBF A;  3VDU A;  1NNJ A;  1L2D A;  4LF5 M;  1ORY B;  3FTF A;  1OAO C;  4JV5 M;  3LW5 F;  2ZAM A;  1NHW C;  4AZF A;  1X37 A;  4PCZ A;  4DV0 M;  1ZMW A;  3EIH A;  1R2Z A;  2A5Y B;  2BJV A;  5DYG A;  4X62 M;  4M0D A;  3GLF A;  4GKJ M;  2YQZ A;  3KS4 A;  2QBY B;  2LVN C;  4FCW A;  1ZMU A;  4MGI E;  4GMQ A;  2DWM A;  3C3D A;  1V33 A;  4B08 A;  3SHF A;  2NQ8 C;  1DGG A;  2CWB A;  1GKI A;  1XWI A;  2WSF F;  1C7Y A;  2LHC A;  3FRH A;  2G8L A;  4LZZ A;  2EKK A;  5DYI A;  2Y20 A;  2Z4R A;  1JR3 E;  2KNV A;  4WUR A;  4DR2 M;  1Z5C A;  1QUS A;  1MN3 A;  2CE7 A;  3W0L B;  3CGW A;  3HU3 A;  3T6P A;  3LQQ A;  3RGP A;  2DWN A;  2C96 A;  2JA2 A;  1R2Y A;  4LF6 M;  2LXE A;  1HT1 E;  4JI0 M;  1FNN A;  4FWD A;  3GLI B;  5KPZ A;  1N34 M;  2LH0 A;  2KXE A;  4MB7 A;  2QSF X;  3JR4 A;  4DR3 M;  2HKJ A;  1HQY E;  1W5S A;  2KA6 B;  1WR1 B;  2J7O A;  5FTK A;  2JY8 A;  3BXW A;  4FCV A;  1K3X A;  1DGH B;  3HHX A;  2P5T A;  2JP7 A;  2CV0 A;  1Z5A A;  3CF2 A;  2CHG A;  1DO0 A;  3GPX A;  1VG5 A;  2ZAN A;  1QAN A;  3SAT A;  5FTM A;  1NY5 A;  3VKH A;  2O5R A;  3T15 A;  3GLI E;  1Z5B A;  4F1I A;  1H6U A;  1Q3B A;  3GRV A;  1S3S A;  1GVN A;  2ERC A;  4QOS A;  4JYA M;  4DV7 M;  2O25 A;  2K47 A;  3L2A A;  4Y28 F;  4DUY M;  4D80 A;  1I94 M;  3B74 A;  1WJ7 A;  1RU3 A;  4I5S A;  3HU1 A;  2YR0 A;  2WSE F;  1R6B X;  2KDL A;  4JI3 M;  3TWK A;  4RF0 A;  2DHY A;  3HX3 A;  3TL4 X;  1IY1 A;  1JR3 D;  4XBO A;  3DA1 A;  4JI7 M;  1SG9 A;  1PJS A;  3HJQ A;  4LRS A;  3J7B A;  4G6Z A;  4KHP M;  1DO2 A;  2LTU A;  3TWL A;  3GLG A;  4B7F A;  2RGO A;  4L8R C;  4FW9 A;  3SAV A;  2C9C A;  2MGW A;  5C1B A;  4G4Q A;  4QNR A;  4L6V 6;  4M9X A;  4FWG A;  1N33 M;  2LBC A;  1HQC A;  4B7G A;  2JY5 A;  5IZ7 D;  2XSZ A;  2JZ0 A;  5KQD A;  2DAG A;  2YFQ A;  3T1H M;  1SXJ B;  2QZ4 A;  4MGK E;  4LFA M;  3M7G A;  3FYD A;  2WZJ A;  2X8A A;  2QQ8 A;  3MMP A;  4IBD A;  1G8P A;  4LJ4 A;  3RGS A;  4PT5 A;  2R0I A;  4PD2 A;  4M0W A;  4YHH M;  4LF4 M;  4OX9 M;  3GLH B;  4ANR A;  3U60 B;  2H1R A;  4M9S A;  2JXN A;  2VF7 A;  4Z8X A;  5E26 A;  5EXP A;  2FE8 A;  1L1T A;  1W5T A;  4GEW A;  4B3S M;  5ITX E;  1DGB A;  3SAR A;  3CF6 E;  4LF8 M;  2CHV A;  2HHH M;  2JY7 A;  2R65 A;  4AG6 A;  3QWL A;  1GJT A;  3VFD A;  3HHW A;  3NBX X;  3GQ5 A;  1Y8G A;  2QNJ A;  3WHK A;  2HL7 A;  4FCT A;  4BLC A;  2VQF M;  3KFU G;  3RE8 A;  2OOB A;  3UMM A;  1XXH A;  2ZM6 M;  1G71 A;  1Z6T A;  2DAI A;  2OPF A;  2F5P A;  2Y0Q A;  2KNZ A;  1TH3 A;  2OO9 A;  1BVS A;  1YLA A;  3KSJ A;  3M6A A;  3LVV A;  4LCB A;  2F5N A;  1QAQ A;  1D0M A;  2M5Z A;  3UGJ A;  3U6M A;  2JNH A;  1TDH A;  3J2P B;  3ZQJ A;  3HHZ A;  3THG A;  1SXJ D;  4G4R A;  4IBI A;  4AW4 A;  4DV1 M;  2E5L M;  3FTE A;  5EXS A;  1JR3 A;  5H37 D;  3KOX E;  4L15 A;  1GL7 A;  5EJC A;  2MRO B;  2ZTC A;  4LY6 A;  3J81 S;  2Z3X A;  4CIS A;  2CP8 A;  2V1C A;  3MJ5 A;  2R62 A;  3FUX A;  1VEK A;  3AOG A;  3CTW B;  4DV2 M;  3K9O A;  5EQT A;  4F2L A;  5EXX A;  3GPY A;  3KOY E;  4WW0 A;  3K9P A;  4I4L A;  4LF9 M;  3U6O A;  4LJ6 A;  3FTD A;  1G41 A;  3UK6 A;  4OVZ A;  4L4U A;  4FWH A;  1QUT A;  3AOE A;  3GLF E;  2C99 A;  1IY0 A;  3PVS A;  3SFZ A;  2L2D A;  4DV3 M;  3TWM A;  2CUZ A;  3U6C A;  3EIE A;  2XEP A;  1IBM M;  4GHL A;  4UN2 B;  3D8B A;  3U61 A;  2RRU A;  2DNA A;  3SYK A;  1R7R A;  1NV9 A;  2EJS A;  2GNO A;  1TR8 A;  3ZH9 B;  2L09 A;  4GH9 A;  3VKG A;  1AUA A;  2Y21 A;  2DWL A;  3UZU A;  4LFB M;  3R9X B;  2KZU A;  3W68 A;  2UUB M;  2G3Q A;  1TH2 A;  1NJF A;  2BNK A;  2D7G A;  3GQ3 A;  4GHA A;  5IRE B;  3LQR A;  2EA0 A;  5LMN M;  3C9P A;  4JI1 M;  1E32 A;  3H4J A;  3I04 M;  3U6S A;  1NNU C;  4AKH A;  3FUT A;  3SBJ A;  5ITU A;  3FRI A;  4LGY A;  5FSW A;  2J5Y A;  2JWS A;  3J7A S;  3T38 A;  4M9Z A;  4AI6 A;  2EO2 A;  2Z7J A;  2DAE A;  4D82 A;  2OQ4 A;  4JI5 M;  1VDL A;  4RF1 A;  1YE9 A;  4JI6 M;  4XK8 F;  4LJ7 A;  4MGZ E;  2CRU A;  4DV4 M;  3FUU A;  3U61 B;  4DR4 M;  2K9D A;  1Z59 A;  3AOE C;  2HWJ A;  2QP9 X;  2DZL A;  3SMP A;  5L8R F;  4A3V B;  1MX0 A;  3U6E A;  1TTE A;  2DAM A;  3B7Z A;  2KZS A;  4LFC M;  3K8Z A;  1VEJ A;  4JI4 M;  3JAM S;  3QYB A;  2UXD M;  3SAS A;  1JB0 F;  4EIW A;  1PRB A;  3KOZ E;  5GKN A;  1DV0 A;  1LTM A;  1PJQ A;  5DFL A;  5KO3 A;  4L16 A;  3A42 A;  4OW0 A;  2C5R A;  5JI3 E;  3A46 A;  1L2B A;  1TH4 A;  2QPA A;  3HJ8 A;  2Z8Y M;  1GL6 A;  4I8O A;  2L4E A;  2O01 F;  4LJ9 A;  3KS8 A;  1IQP A;  1ZQ9 A;  1QZM A;  3KW6 A;  1NVM A;  2JUJ A;  1FJG M;  4B7H A;  1HJP A;  3L29 A;  4NXN M;  3BBZ A;  1G59 A;  3HWS A;  5ITQ A;  3E46 A;  2YNM D;  3FE3 A;  1YSY A;  3KVW A;  2K0B X;  3KXE C;  3HZJ A;  3B89 A;  1VEG A;  3I4Y A;  4LRT A;  4G4O A;  2DZN B;  1NV8 A;  1IN5 A;  3HY5 A;  3PNY A;  2DHR A;  1HR0 M;  1EFU B;  1GLN A;  3K92 A;  2VII A;  1IXR C;  1QVR A;  1NY6 A;  2V1U A;  2C98 A;  4LJ8 A;  4K0K M;  2N35 A;  4W5W A;  4P17 A;  4KO8 A;  2DZO B;  1IBL M;  1N36 M;  2AHM A;  3DFZ A;  8CAT A;  1PM5 A;  3DOA A;  1Q02 A;  1IBK M;  2MJ5 B;  4RNA A;  1R4G A;  5ITX A;  2L7H A;  3L28 A;  4PDG A;  2HAK A;  1G3I A;  2BJW A;  3RFW A;  4R71 A;  1XNQ M;  2FNA A;  1SXJ A;  1SXJ C;  4DBG B;  7CAT A;  1R5L A;  1XC8 A;  1J09 A;  3SMS A;  3KSX A;  2XH9 A;  1PJJ A;  1XNR M;  2L6O A;  1NO1 A;  4JXJ A;  1LV7 A;  1QAO A;  1ZAE A;  1OAI A;  5FTL A;  1K82 A;  2UUC M;  2R46 A;  2XLJ A;  1XXH E;  2X49 A;  2L7I A;  1SXJ E;  2VF8 A;  2F5S A;  2LWX A;  4LG2 A;  4MM3 B;  2KEB A;  2LVP C;  1ZMV A;  2ZTD A;  3E21 A;  3FUW A;  4DV6 M;  4JI8 M;  2D7E A;  3B7N A;  5BR8 M;  2LVQ D;  2OOA A;  3KDS E;  4NOO B;  5FTJ A;  2XGN A;  4NL4 H;  2APL A;  1QYR A;  1OIP A;  2K6B A;  3QYE A;  3J80 S;  1GO5 A;  3FKE A;  1QQW A;  3A45 A;  1PJI A;  4FD2 A;  2EUC A;  4R7G A;  1QDR A;  4X66 M;  3IHP A;  5EP4 A;  2XFT A;  4KT0 F;  3L26 A;  2R4J A;  3GP1 A;  3WHL A;  3U5Z B;  2QBY A;  2W82 A;  5DNY A;  1QZE A;  3I51 A;  3PFI A;  4IBB A;  2CV2 A;  1N32 M;  3B9P A;  5BPV A;  3KP1 E;  4IBJ A;  5EP1 A;  1QDT A;  5FTN A;  3DZD A;  3IG5 A;  4KLN A;  4G3O A;  3E4R A;  1IXZ A;  2KRU A;  5EXT A;  3K1J A;  1PGY A;  2EKF A;  4MH0 E;  3TE6 A;  2VQE M;  3VK7 A;  4REZ A;  1OFH A;  4DR6 M;  2FS1 A;  2KW0 A;  2R4E A;  3TPZ A;  4FVM A;  1TDZ A;  1XXH B;  4BBA A;  1OIZ A;  3U6D A;  4HL4 A;  3AFH A;  3GLH A;  3F92 A;  2JZ1 A;  1XMO M;  3GRY A;  2XFS A;  3LVW A; 
#chains in the Genus database with same CATH homology
 1IN4 A;  3HHY A;  4LF7 M;  5A2Q S;  2RKO A;  3KP0 E;  2XSZ D;  3U6Q A;  1E9R A;  1N77 A;  3GPU A;  3H4M A;  5JI2 E;  4LJ5 A;  2FOI C;  4S12 A;  3C58 A;  2XZU A;  4DR5 M;  4B3R M;  3J27 B;  3HKP A;  1L1Z A;  4JI2 M;  1NHG C;  4HLQ A;  2DXI A;  2UUA M;  2R18 A;  3ILK A;  1MU5 A;  2ZAO A;  4IJF A;  3FD9 A;  4DV5 M;  1J5E M;  2X4A A;  3GPP A;  1I4W A;  5ITT A;  1Q3C A;  4OU7 A;  3ZCB B;  3U60 A;  4CHT B;  4LZJ A;  1IM2 A;  2LNH C;  3HGI A;  2I7P A;  1OJL A;  4DR7 M;  3VDP A;  4YY3 M;  5IWA M;  4OVZ B;  4IBG A;  3GQ4 A;  2DVW B;  1J7K A;  3GO8 A;  1L2C A;  1DGH A;  4QOZ C;  4BB9 A;  3FTC A;  2J7N A;  4IBK A;  2XF3 A;  4PDI A;  4LJA A;  4P16 A;  1HNX M;  4B3M M;  4NRV A;  3KOW E;  4IIW A;  5LMU M;  3D8L A;  3U5Z A;  4GC9 A;  1JQJ C;  4NRW A;  3NBI A;  2F5Q A;  4AQY M;  4GKK M;  1VDD A;  1Q39 A;  3ZC7 B;  4MGH A;  4ITQ A;  3GLF B;  3T1Y M;  2Q2E B;  5C18 A;  4IBC A;  3U6L A;  2D7H A;  4IBE A;  2F4V M;  2G5G X;  1WXQ A;  4NXM M;  1C1K A;  1HNW M;  2DWZ B;  3TQS A;  1G4A E;  4L78 A;  3Q8X A;  4GIT A;  4G4N A;  4QHS A;  5E6J A;  5EP3 A;  4IJE A;  1YUB A;  4XGI A;  4GIP A;  3SHG B;  3U6P A;  3HJS A;  1DGF A;  1N75 A;  4NSO B;  3L25 A;  4I81 A;  2RGH A;  4AG5 A;  3SAW A;  5EP2 A;  3AJI B;  4DUZ M;  2UXB M;  3PXG A;  3AKZ A;  4TUW A;  5ITY A;  4ZPX A;  4Z6Y A;  3A98 B;  1IY2 A;  2V6Z M;  4X65 M;  3SYL A;  1K3W A;  3L27 A;  2R45 A;  3MK6 A;  1TGU A;  2CFO A;  3HU2 A;  2QEN A;  3BOS A;  2KRK A;  3SC3 A;  1HNZ M;  2CEA A;  1IN6 A;  1XMQ M;  3CF0 A;  3QAU A;  3MHV C;  3W0F A;  4JN6 A;  1HT2 E;  5ITR A;  2UU9 M;  3FUV A;  1D2N A;  1E9S A;  5FLX S;  5KQ8 A;  1KYI A;  3GRR A;  4NSR A;  1IXS B;  1L8Q A;  5KPT A;  3PNV A;  2ZBK B;  1EE8 A;  3AL0 C;  5KPR A;  1N78 A;  4QHT A;  2HCB A;  3SAU A;  4CGY B;  2I7N A;  4D81 A;  1E94 E;  2CV1 A;  2C9O A;  3OTO M;  3R8F A;  4GC5 A;  3NWL A;  4AKI A;  1KSF X;  5IT9 S;  3E9S A;  3LMM A;  1NSF A;  4KOD A;  4R3D A;  1OFI A;  1IN8 A;  3M0E A;  2CHQ A;  3AV0 A;  4B3T M;  4DR1 M;  3VK8 A;  1IN7 A;  3K2L A;  4II7 A;  4QNM A;  1KFV A;  1XHB A;  3GLI A;  2FFJ A;  5F3W A;  1NJG A;  2UXC M;  2M60 A;  2F5O A;  2Z4S A;  2QCU A;  3GRU A;  3VLF B;  4GRI A;  3FYC A;  3UJN A;  1QAM A;  3I4V A;  1T3T A;  1UM8 A;  2Y0T A;  4X64 M;  4AKG A;  3GLG B;  3JR5 A;  2XZF A;  4LGM A;  4MGY E;  3IG8 A;  4IBF A;  3VDU A;  1NNJ A;  1L2D A;  4LF5 M;  1ORY B;  3FTF A;  4JV5 M;  2ZAM A;  1NHW C;  4AZF A;  1X37 A;  4PCZ A;  4DV0 M;  3EIH A;  1R2Z A;  2A5Y B;  2BJV A;  5DYG A;  4X62 M;  4M0D A;  3GLF A;  4GKJ M;  2YQZ A;  3KS4 A;  2QBY B;  4FCW A;  4MGI E;  4GMQ A;  2DWM A;  4B08 A;  3SHF A;  2NQ8 C;  1DGG A;  1GKI A;  1XWI A;  2G8L A;  4LZZ A;  5DYI A;  2Y20 A;  2Z4R A;  4WUR A;  4DR2 M;  1Z5C A;  2CE7 A;  3W0L B;  3HU3 A;  3LQQ A;  3RGP A;  2DWN A;  2C96 A;  2JA2 A;  1R2Y A;  4LF6 M;  2LXE A;  1HT1 E;  4JI0 M;  1FNN A;  4FWD A;  3GLI B;  5KPZ A;  1N34 M;  2LH0 A;  2KXE A;  4MB7 A;  3JR4 A;  4DR3 M;  2HKJ A;  1HQY E;  1W5S A;  2KA6 B;  2J7O A;  5FTK A;  4FCV A;  1K3X A;  1DGH B;  3HHX A;  2P5T A;  2CV0 A;  1Z5A A;  3CF2 A;  2CHG A;  1DO0 A;  3GPX A;  2ZAN A;  1QAN A;  3SAT A;  5FTM A;  1NY5 A;  3VKH A;  2O5R A;  3T15 A;  1Z5B A;  1H6U A;  1Q3B A;  3GRV A;  1S3S A;  1GVN A;  2ERC A;  4QOS A;  4JYA M;  4DV7 M;  2K47 A;  3L2A A;  4DUY M;  4D80 A;  1I94 M;  4I5S A;  3HU1 A;  2YR0 A;  1R6B X;  3TWK A;  4JI3 M;  4RF0 A;  3TL4 X;  1IY1 A;  1JR3 D;  4XBO A;  3DA1 A;  4JI7 M;  3HJQ A;  4LRS A;  3J7B A;  4G6Z A;  4KHP M;  1DO2 A;  3TWL A;  4L8R C;  3GLG A;  4B7F A;  2RGO A;  4FW9 A;  3SAV A;  2C9C A;  5C1B A;  4G4Q A;  4QNR A;  4M9X A;  4FWG A;  1N33 M;  1HQC A;  4B7G A;  5IZ7 D;  2XSZ A;  5KQD A;  2YFQ A;  3T1H M;  1SXJ B;  2QZ4 A;  4MGK E;  4LFA M;  3M7G A;  3FYD A;  2X8A A;  3RGS A;  4LJ4 A;  4YHH M;  4IBD A;  1G8P A;  4PD2 A;  4PT5 A;  4LF4 M;  4M0W A;  4OX9 M;  3GLH B;  3U60 B;  2H1R A;  4M9S A;  4Z8X A;  5E26 A;  5EXP A;  1L1T A;  2FE8 A;  1W5T A;  4B3S M;  5ITX E;  1DGB A;  3SAR A;  3CF6 E;  4LF8 M;  2CHV A;  2HHH M;  2R65 A;  4AG6 A;  3QWL A;  3VFD A;  3HHW A;  3GQ5 A;  3KFU G;  3WHK A;  2HL7 A;  4FCT A;  4BLC A;  2VQF M;  3RE8 A;  3UMM A;  1XXH A;  2ZM6 M;  2OPF A;  1Z6T A;  2F5P A;  2Y0Q A;  1TH3 A;  3KSJ A;  3M6A A;  3LVV A;  4LCB A;  2F5N A;  1QAQ A;  2M5Z A;  3UGJ A;  3U6M A;  1TDH A;  3J2P B;  3HHZ A;  3THG A;  1SXJ D;  4G4R A;  4IBI A;  4AW4 A;  4DV1 M;  2E5L M;  3FTE A;  5EXS A;  1JR3 A;  5H37 D;  3KOX E;  4L15 A;  1GL7 A;  5EJC A;  4LY6 A;  3J81 S;  2Z3X A;  4CIS A;  2V1C A;  3MJ5 A;  2R62 A;  3FUX A;  3AOG A;  3CTW B;  4DV2 M;  5EQT A;  5EXX A;  3GPY A;  3KOY E;  4WW0 A;  4I4L A;  3U6O A;  4LJ6 A;  3FTD A;  1G41 A;  3UK6 A;  4OVZ A;  4L4U A;  4FWH A;  4DV3 M;  3AOE A;  2C99 A;  1IY0 A;  3PVS A;  3SFZ A;  3TWM A;  3U6C A;  2CUZ A;  3EIE A;  2XEP A;  1IBM M;  4GHL A;  3D8B A;  3U61 A;  3SYK A;  1R7R A;  3ZH9 B;  2L09 A;  4GH9 A;  3VKG A;  2Y21 A;  2DWL A;  3UZU A;  4LFB M;  3R9X B;  2KZU A;  2UUB M;  1TH2 A;  1NJF A;  2BNK A;  2D7G A;  3GQ3 A;  4GHA A;  5IRE B;  3LQR A;  2EA0 A;  5LMN M;  4JI1 M;  4LF9 M;  1E32 A;  3U6S A;  4AKH A;  1NNU C;  3FUT A;  3SBJ A;  5ITU A;  4LGY A;  5FSW A;  3J7A S;  4AI6 A;  3T38 A;  4M9Z A;  2EO2 A;  2Z7J A;  4D82 A;  2OQ4 A;  4JI5 M;  4JI6 M;  4RF1 A;  1YE9 A;  4LJ7 A;  4MGZ E;  4DV4 M;  3FUU A;  3U61 B;  4DR4 M;  1Z59 A;  3AOE C;  2QP9 X;  3SMP A;  4A3V B;  1MX0 A;  3U6E A;  4LFC M;  2KZS A;  3K8Z A;  4JI4 M;  3JAM S;  2UXD M;  3SAS A;  4EIW A;  3KOZ E;  5GKN A;  5KO3 A;  4L16 A;  3A42 A;  4OW0 A;  2C5R A;  5JI3 E;  3A46 A;  1L2B A;  1TH4 A;  2QPA A;  3HJ8 A;  4LJ9 A;  1GL6 A;  4I8O A;  3KS8 A;  1IQP A;  1ZQ9 A;  1QZM A;  3KW6 A;  1NVM A;  1FJG M;  4B7H A;  3L29 A;  4NXN M;  1G59 A;  3HWS A;  5ITQ A;  2YNM D;  1YSY A;  3KVW A;  3KXE C;  3I4Y A;  4LRT A;  4G4O A;  2DZN B;  1IN5 A;  3PNY A;  1HR0 M;  2DHR A;  1GLN A;  3K92 A;  2VII A;  1IXR C;  1QVR A;  1NY6 A;  2V1U A;  2C98 A;  4LJ8 A;  4K0K M;  4W5W A;  4KO8 A;  2DZO B;  1IBL M;  1N36 M;  2AHM A;  3DFZ A;  8CAT A;  1PM5 A;  3DOA A;  1IBK M;  4RNA A;  5ITX A;  2L7H A;  3L28 A;  4PDG A;  1G3I A;  2BJW A;  3RFW A;  1XNQ M;  2FNA A;  1SXJ A;  1SXJ C;  7CAT A;  1XC8 A;  1J09 A;  3SMS A;  3KSX A;  2XH9 A;  1PJJ A;  1XNR M;  2L6O A;  4JXJ A;  1LV7 A;  1QAO A;  1ZAE A;  5FTL A;  1K82 A;  2UUC M;  2R46 A;  2XLJ A;  2X49 A;  2L7I A;  1SXJ E;  2F5S A;  2LWX A;  4LG2 A;  4MM3 B;  2KEB A;  3FUW A;  4DV6 M;  4JI8 M;  2D7E A;  5BR8 M;  3KDS E;  4NOO B;  5FTJ A;  2XGN A;  4NL4 H;  1QYR A;  3J80 S;  3FKE A;  1QQW A;  3A45 A;  1PJI A;  4FD2 A;  2EUC A;  4R7G A;  4X66 M;  5EP4 A;  2XFT A;  3L26 A;  2R4J A;  3GP1 A;  3WHL A;  3U5Z B;  2QBY A;  2W82 A;  5DNY A;  3I51 A;  3PFI A;  4IBB A;  2CV2 A;  1N32 M;  3B9P A;  5BPV A;  3KP1 E;  4IBJ A;  5EP1 A;  5FTN A;  3DZD A;  3IG5 A;  4KLN A;  3E4R A;  1IXZ A;  2KRU A;  5EXT A;  3K1J A;  4MH0 E;  3TE6 A;  2VQE M;  3VK7 A;  4REZ A;  1OFH A;  4DR6 M;  2KW0 A;  2R4E A;  3TPZ A;  4FVM A;  1TDZ A;  1XXH B;  4BBA A;  3U6D A;  4HL4 A;  3AFH A;  3GLH A;  1XMO M;  3GRY A;  2XFS A;  3LVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...