4GITA

Crystal structure of alpha sub-domain of lon protease from brevibacillus thermoruber
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
b'GYTELEKLHIMRDYLLPKQMEEHGLGRDKLQMNEEAMLKVIRQYTREAGVRNLNREAANICRKAARLIVSGEKKRVVVTPKTVESLLGKPRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lon protease
publication title Structural basis for DNA-mediated allosteric regulation facilitated by the AAA(+) module of Lon protease.
pubmed doi rcsb
source organism Brevibacillus thermoruber
molecule tags Hydrolase
total genus 33
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2012-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gitA00
1IQPA 2CHGA 5EP1A 3HWSA 3R8FA 3PFIA 2R62A 1E32A 2QP9X 2RKOA 4QHSA 3D8BA 3ZH9B 4I81A 2Z4RA 2ZANA 5EP4A 1QZMA 1JR3A 2ZAOA 4FW9A 4QNMA 1G4AE 5FTJA 4EIWA 1DO0A 3SYKA 1IY2A 3K1JA 4LGMA 1C1KA 2FNAA 1G41A 3CF0A 1NVMA 4GITA 1SXJD 4L16A 2KRKA 1IN5A 5C1BA 2CHQA 1NJGA 4I4LA 1E94E 4ZPXA 3GLHA 4LZZA 4LY6A 2V1UA 1HQCA 1NJFA 3KDSE 2DZNB 3AJIB 1X37A 1XWIA 5JI3E 3BOSA 3HU1A 4QHTA 1SXJC 3GLGB 4LJ8A 3M0EA 1NY5A 4L15A 1OFIA 1XXHB 3M6AA 2QZ4A 5EQTA 1G3IA 2DWZB 2Z4SA 2XSZD 1SXJB 3GLFB 5EP3A 1IY0A 3DZDA 5EXTA 2QPAA 3UK6A 3VLFB 1KSFX 3GLHB 1QVRA 3CF2A 1OJLA 4D81A 1IXZA 2DVWB 1D2NA 2V6ZM 1IN8A 3B9PA 5EXPA 3U61B 2C98A 3U5ZB 2QBYB 4LJ9A 3WHKA 4QNRA 4LRSA 2BJWA 1IXRC 1JR3D 4LJ7A 3GLGA 1IM2A 4LRTA 5FTNA 4KO8A 4A3VB 1XXHA 5JI2E 3PXGA 4LJAA 1R6BX 3EIEA 4KODA 1DO2A 4D82A 1UM8A 2DZOB 2CE7A 3KW6A 3WHLA 3EIHA 2X8AA 3GLIB 3PVSA 1W5TA 5C18A 1SXJA 3MHVC 3GLFA 1IXSB 4JN6A 2R65A 5EP2A 2BJVA 1J7KA 4FCTA 3VFDA 5EXXA 1R7RA 4LJ6A 4FWDA 3H4MA 4QOSA 4FCVA 5DYIA 1IN6A 2DHRA 4WW0A 4FD2A 3U60B 5DYGA 2C9CA 2QENA 4KLNA 2QBYA 1S3SA 1L8QA 2C9OA 1KYIA 4FCWA 5FTLA 1IN7A 4FWGA 2ZAMA 1LV7A 3SYLA 2CHVA 3SC3A 3HU2A 4LCBA 1NY6A 4Z8XA 1SXJE 5FTKA 1HQYE 2HCBA 1W5SA 4L4UA 4D80A 1NSFA 4LJ4A 5FTMA 1HT2E 2C99A 2XSZA 5EXSA 3GLIA 1IN4A 1HT1E 3HU3A 1IY1A 2C96A 2VIIA 4FWHA 2CEAA 1FNNA 1JQJC 4LJ5A 1OFHA
chains in the Genus database with same CATH superfamily
1IQPA 1XB2B 1NHGC 3LVWA 4MM3B 2OPFA 2R62A 1GKIA 3K9OA 5KQDA 4YY3M 5ITRA 3ZH9B 3GO8A 1RU3A 3GRUA 5IWAM 2Z4RA 3L2AA 3GPYA 4R3DA 5EP4A 4B3RM 4AW4A 2MROB 2EKKA 5L8RF 4DR5M 1EFUB 3JR5A 4G4NA 4EIWA 4UN2B 5ITXA 1R2ZA 1Q39A 3GLIE 3C9PA 3T1YM 3U6QA 4LGMA 2LH0A 4GEWA 4GITA 1R4GA 2CFOA 1NO1A 1QDTA 5C1BA 4CJ6A 3KVWA 1XMOM 1N33M 3RGSA 5DFLA 1XNRM 1TH2A 3KSXA 3HHXA 4ZPXA 4DV4M 2FFJA 3J81S 1IFYA 1EE8A 3AJIB 3VKGA 4JYAM 1K82A 3HU1A 2APLA 3VDUA 3JR4A 4LJ8A 4G4RA 4B3TM 3AV0A 5ITXE 2VF7A 1OFIA 1PJIA 2LNHC 2Z7JA 2R46A 4JI0M 4M9SA 1PJSA 3Q8GA 5EQTA 3FTEA 1G3IA 4CIZA 2Z4SA 2L6OA 4DV1M 1PJJA 1C7YA 4LF6M 2X49A 2Y21A 3DZDA 1ZMWA 2OO9A 4OU7A 3GP1A 2DXIA 3GPPA 2DZLA 3CF2A 1OJLA 2EJSA 2EA0A 1J5EM 1KFVA 5ITQA 4AG6A 2R6FA 4DBGB 2J5YA 2WZJA 2K9DA 1XC8A 3U5ZB 2EO2A 4LJ9A 4LFBM 1AUAA 4QNRA 2BJWA 1IXRC 4LJ7A 3GLGA 1HNZM 2QNJA 2Y0TA 1N78A 1TTEA 4KO8A 3W67A 1NHWC 4S12A 5E6JA 1XHBA 1R6BX 3AFHA 4L8RC 3J80S 4HL4A 4D82A 1UM8A 3KW6A 4PT5A 1LTMA 3SAVA 3SMSA 1W5TA 1SXJA 5EP2A 3HGIA 3HHWA 3AOGA 4MGIE 3CTWB 2BJVA 3T15A 4M9XA 1J7KA 3VFDA 1TR8A 2MJ5B 3I51A 5EXXA 3UJNA 3QYBA 5ITUA 4FWDA 1OAIA 3U6DA 2DI0A 1ZAEA 3J2PB 4PDGA 4FCVA 2LBCA 4NSOB 3HJQA 3SAWA 4WW0A 4GC5A 4IBFA 4MGZE 1DGHB 1D0LA 2L7HA 3L29A 1WR1B 4X66M 3GLGE 3TPZA 1OKSA 2C9CA 2JY5A 5FLXS 4DV6M 2UU9M 2UXCM 2KXEA 2CP8A 1QANA 2LVAA 1Z59A 4IBCA 3FRHA 3PNVA 5FTLA 3FRIA 2M5ZA 4GIPA 3HHYA 1GJSA 2KDLA 1NNJA 1Z5BA 1Z6TA 2CHVA 2GQFA 4DR6M 1NY6A 1MN3A 1QAMA 1SXJE 3FTCA 3FUWA 1W5SA 3TE6A 3ZQJA 4DV5M 1QUTA 1Q02A 1VQ1A 2KW0A 5FTMA 4DR3M 3SBJA 2OOBA 4P16A 1N77A 1IN4A 1WGNA 4ANRA 4X65M 4KHPM 4NL4H 3QAUA 2UXDM 3HJ8A 3SHGB 2CV1A 1WXQA 1WJ7A 3GLHB 1IXZA 4LJ5A 3IHPA 3HWSA 4HLQA 3PFIA 2JUJA 2KZSA 1K3XA 4X62M 2RKOA 3U60A 3K8ZA 3HKPA 3E9SA 3KS8A 4I81A 1PGYA 3K9PA 4P17A 1XMQM 3KOXE 1IBLM 1XXHE 3T38A 1OIPA 4RNAA 5H37D 1HNXM 5FTJA 1QUSA 2W82A 3M7GA 3LVVA 3GRVA 3NWLA 4LF9M 4LF8M 3IECA 4DR4M 1DO0A 3AOEC 1N36M 4OW0A 1QAOA 4R7GA 3F92A 4GC9A 4YHHM 4TUWA 3GLFE 4RF1A 1C1KA 2FNAA 3CF0A 2DNAA 4L16A 1P3QQ 4NSRA 3U6EA 1IN5A 2LVPC 2KNVA 4DR7M 2JWSA 1VDLA 4LZZA 1N75A 3FUVA 2CRUA 4OX9M 1IBKM 2RGHA 2Z3XA 1N34M 2P5TA 2QHOB 2DZNB 1HJPA 1T3TA 2UUCM 4QHTA 4MB7A 2QQ8A 1VG5A 4NXNM 5FSWA 1R2YA 1QQWA 2YFQA 4DR2M 2UXBM 3JAMS 1XXHB 4B3MM 2JY8A 4DUYM 2QZ4A 4DV7M 4GHLA 3MK6A 2VQEM 2LVNC 1I94M 1IBMM 4DV2M 5IT9S 2KZUA 1FJGM 3GLFB 1IY0A 5BPVA 4RF0A 2RRUA 1I4WA 3IG8A 4JI2M 2QPAA 2G5GX 2K0BX 3VLFB 1GVNA 2XFTA 3W0FA 2LHCA 1QVRA 1PRBA 2Y0QA 2ZBKB 4LZJA 1OAOC 3E21A 1QDRA 4DV0M 4Z6YA 3RGPA 2XGNA 5EXPA 3FUUA 3SARA 4IBKA 4B3SM 2BWBA 3TWKA 1TH3A 4L78A 3B7ZA 4G4QA 1QZEA 4PDIA 1IM2A 2WSFF 3GQ3A 4A3VB 4JI1M 4LJAA 3VK8A 4JV5M 3KOWE 3U6PA 2XLJA 3GPXA 1UFZA 1T43A 2LVOC 1H6UA 3GLIB 3HX3A 2O01F 2R65A 3J27B 3FTFA 4FCTA 2JP7A 1DGGA 3CGWA 1N32M 2EKFA 1IN6A 1GJTA 3MJ5A 1TDHA 2AHMA 4K0KM 1ORYB 3LQRA 1ZMUA 5DYGA 4AG5A 1A5TA 1Z5CA 3U61A 4REZA 2QBYA 2N35A 3KP0E 2F5QA 3FYDA 7CATA 4AQYM 1IN7A 4FWGA 2ZAMA 1LV7A 3SFZA 3SAUA 4XBOA 3TWMA 3SC3A 3HU2A 2CWBA 5LMNM 4B7FA 3KOYE 5IREB 2DAMA 1HQYE 2H5XA 2HCBA 2MGWA 3QWLA 2LTUA 2CUZA 2L4FA 4CISA 3C58A 2XSZA 1HT1E 3L26A 3AKZA 1L2CA 3R9XB 1IY1A 2E5LM 2Y20A 4LF4M 3KS4A 3L27A 2LWXA 2WSCF 4IBGA 4OVZA 5EJCA 3D8LA 1PJTA 3W0LB 3R8FA 3HY5A 3VDPA 4JI3M 3TQSA 4LGYA 3D8BA 1ZMVA 4IIWA 1TDZA 1D0KA 2R4EA 2XF3A 4MGKE 5F3WA 2ZANA 4KT0F 3B89A 3VKHA 2BNKA 4GHAA 1JR3A 3B7NA 2NQ8C 4FW9A 2YNMD 1JB0F 4LF7M 4NRWA 2QCUA 1PM5A 4MGYE 1DGFA 2DHYA 3FUTA 1Q3BA 3SYKA 1IY2A 3K1JA 4CGYB 2I7PA 4B08A 1QAQA 2JZ1A 4GMQA 3SHFA 3UZUA 1V33A 1NVMA 1SXJD 2RGOA 2KRKA 1VEGA 3MMPA 4DV3M 1OQYA 3KP1E 1NJGA 3J7BA 4HEOA 4I4LA 2JY7A 1IXSA 4MGHA 4JI8M 4AKHA 4I5SA 1G59A 2V1UA 1HQCA 2D7EA 2G3QA 3E4RA 3KDSE 3THGA 4B7HA 1JR3E 5JI3E 1OTRA 3BOSA 2K47A 3KXEC 3ZCBB 1GLNA 5A2QS 3GLGB 2L7IA 1R5LA 2O25A 4B7GA 1V92A 4F2LA 3M0EA 5KPZA 1YSYA 1NY5A 4L15A 2F4VM 2DAKA 1WHCA 2VQFM 3M6AA 4AI6A 4JI7M 4GKKM 5GKNA 1T6OA 2XZUA 2VF8A 2DWNA 3NBIA 1L2BA 3KFUG 3LW5F 1YUBA 2FH0A 4XK8F 2GNOA 8CATA 3W68A 4GKJM 1SXJB 1VEKA 3VK7A 2XEPA 3UK6A 2I7NA 1KSFX 2JA2A 4LG2A 3AOEA 3E46A 1YLAA 4D81A 3U6OA 2F5OA 1Y8GA 1D2NA 2OOAA 2XH9A 2V6ZM 2KRUA 1IN8A 3C3DA 3B9PA 3GRYA 3RFWA 4BLCA 1MU5A 2C98A 3U6SA 3ILKA 3TL4X 4IBJA 4LFCM 2HHHM 1L1TA 5LMUM 4JI4M 4LRTA 3UMMA 4JI6M 3PXGA 4R71A 5KO3A 3GRRA 2J7NA 2MR9A 2DAIA 3QYEA 1V34A 2CE7A 2DZOB 3BBZA 4L6V6 4NC6A 3WHLA 5KPTA 1HNWM 3MHVC 5DNYA 2F5SA 1IXSB 4MH0E 3FTDA 3T6PA 4FVMA 2XFSA 1BVSA 1R7RA 3H4MA 5ITTA 3H4JA 4W5WA 1WIVA 2LVQD 4FD2A 2QSFX 3U60B 3B7QA 4XGIA 2QENA 3U5ZA 1TGUA 3AL0C 1S3SA 2UUAM 4M0DA 2EUCA 2KHHA 1GL6A 3SASA 2JXNA 2L09A 3FUXA 3SYLA 1G8PA 1WGLA 3K2LA 4Y28F 2H1RA 4LCBA 4Z8XA 4DR1M 4D80A 4L4UA 3SMPA 2UUBM 1NSFA 4AZFA 1HT2E 2X4AA 2C99A 5EXSA 4BB9A 3U6CA 3UGJA 3RE8A 2D7GA 4G4OA 2VIIA 2M60A 1FNNA 2CHGA 5EP1A 3DA1A 3L25A 1VDDA 2JNHA 2HAKA 3OTOM 2YR0A 3A46A 1E32A 4RKUF 1PJQA 2QP9X 1D0MA 1QYRA 3HJSA 4QHSA 1DGHA 4LF5M 2ERCA 3DOAA 3LCVB 3GPUA 4LFAM 1QZMA 2ZAOA 3FYCA 4QNMA 1G4AE 4BBAA 1J09A 1E9SA 2DAGA 2WSEF 3KOZE 3LQQA 2HL7A 1G71A 3I4YA 2VDBB 2XZFA 1G41A 2O5RA 3GQ4A 1Q3CA 2MH8A 3LCUA 4WP2A 3A98B 4GRIA 4CHTB 2CHQA 2KNZA 1E94E 4IJEA 3HHZA 2R44A 3GLHA 1ZQ9A 4LY6A 2CV2A 4PD2A 2A5YB 1NJFA 2JY6B 1X37A 1XWIA 2J7OA 2B3TA 3BXWA 1L1ZA 1SXJC 3LMMA 2D7HA 3HZJA 3PNYA 3Q8XA 2FS1A 3K92A 4WURA 2DWMA 2R45A 2L2DA 2V1CA 2ZM6M 3FE3A 3I01M 1AIPC 2JZ0A 1HR0M 1GL7A 2DWZB 3U6MA 4QOZC 4IBEA 2XSZD 3U6LA 1CUKA 5EP3A 1NNUC 3FKEA 3GLHE 1VEJA 2DWLA 4NXMM 4ITQA 5EXTA 4NOOB 1L2DA 3TWLA 2L4EA 1TH4A 1YE9A 2R4JA 4DUZM 2DVWB 4IBIA 5E26A 4AKIA 1OIZA 2R0IA 4X64M 3U61B 5KQ8A 2R18A 4IJFA 2QBYB 3WHKA 2LXEA 4JXJA 4LRSA 2F5PA 1JR3D 2DAEA 3FD9A 4IBBA 5FTNA 5KPRA 2HWJA 3B74A 4NRVA 5JI2E 2YQZA 1XXHA 3V76A 4G3OA 1K3WA 3EIEA 4KODA 4F1IA 4PCZA 2OQ4A 1DO2A 1MJGM 3EIHA 4M9ZA 2X8AA 2BWEA 1NV8A 3I04M 3KSJA 3PVSA 1DV0A 5C18A 4Q7JA 4AKGA 3GLFA 4JN6A 1XNQM 2KNAA 3GQ5A 2FOIC 3CF6E 3L28A 4OVZB 3A45A 4LJ6A 3C3EA 4GH9A 1SG9A 4II7A 4QOSA 2DKLA 3J7AS 5DYIA 2DHRA 2ZTCA 1TF0B 2LHGA 4JI5M 1GO5A 5BR8M 2KEBA 4G6ZA 2HKJA 4KLNA 2CV0A 1NV9A 3ZC7B 1L8QA 2C9OA 3DFZA 1KYIA 1EIJA 4I8OA 4FCWA 1Z5AA 2C5RA 1ZV1A 2K6BA 2KA6B 3I4VA 1MX0A 2G8LA 2Z8YM 2Q2EB 3IG5A 2FE8A 5FTKA 2ZTDA 5IZ7D 1F4IA 3SATA 4LJ4A 3T1HM 1DGBA 3NBXX 3GLIA 4M0WA 2F5NA 4IBDA 3HU3A 1GABA 2C96A 4FWHA 1E9RA 5ITYA 2CEAA 2DENA 3A42A 1JQJC 1OFHA
chains in the Genus database with same CATH topology
1IQPA 1NHGC 3LVWA 4MM3B 2OPFA 2R62A 1GKIA 5KQDA 4YY3M 5ITRA 3ZH9B 3GO8A 3GRUA 5IWAM 2Z4RA 3L2AA 3GPYA 4R3DA 5EP4A 4B3RM 4AW4A 4DR5M 3JR5A 4G4NA 4EIWA 5ITXA 1R2ZA 1Q39A 3T1YM 3U6QA 4LGMA 2LH0A 4GITA 2CFOA 1N33M 5C1BA 3KVWA 1XMOM 3RGSA 1XNRM 1TH2A 3KSXA 3HHXA 4ZPXA 4DV4M 2FFJA 3J81S 1EE8A 3AJIB 3VKGA 4JYAM 1K82A 3HU1A 3VDUA 3JR4A 4LJ8A 4G4RA 4B3TM 3AV0A 5ITXE 1OFIA 1PJIA 2LNHC 2Z7JA 2R46A 4JI0M 4M9SA 3FTEA 5EQTA 1G3IA 2Z4SA 2L6OA 4DV1M 1PJJA 4LF6M 2X49A 2Y21A 3DZDA 4OU7A 3GP1A 2DXIA 3GPPA 3CF2A 1OJLA 2EA0A 1J5EM 1KFVA 5ITQA 4AG6A 1XC8A 3U5ZB 2EO2A 4LJ9A 4LFBM 4QNRA 2BJWA 1IXRC 4LJ7A 3GLGA 1HNZM 2Y0TA 1N78A 4KO8A 1NHWC 4S12A 5E6JA 1XHBA 1R6BX 3AFHA 4L8RC 3J80S 4HL4A 4D82A 1UM8A 3KW6A 4PT5A 3SAVA 3SMSA 1W5TA 1SXJA 5EP2A 3HGIA 3HHWA 3AOGA 4MGIE 3CTWB 2BJVA 3T15A 4M9XA 1J7KA 3VFDA 3UJNA 3I51A 5EXXA 4YHHM 5ITUA 4FWDA 3U6DA 1ZAEA 3J2PB 4PDGA 4FCVA 4NSOB 3HJQA 3SAWA 4WW0A 4GC5A 4IBFA 4MGZE 1DGHB 2L7HA 3L29A 4X66M 3TPZA 2C9CA 5FLXS 4DV6M 2UXCM 2UU9M 2KXEA 1QANA 1Z59A 4IBCA 5FTLA 3PNVA 2M5ZA 4GIPA 3HHYA 1NNJA 1Z5BA 1Z6TA 2CHVA 4DR6M 1NY6A 3FTCA 1QAMA 1SXJE 3FUWA 3TE6A 1W5SA 4DV5M 4DR3M 3SBJA 2KW0A 5FTMA 4P16A 1N77A 1IN4A 4KHPM 4X65M 2UXDM 4NL4H 3QAUA 3HJ8A 3SHGB 2CV1A 1WXQA 3GLHB 4LJ5A 1IXZA 3HWSA 4HLQA 3PFIA 2KZSA 1K3XA 4X62M 2RKOA 3U60A 3K8ZA 3HKPA 3E9SA 3KS8A 4I81A 1XMQM 3KOXE 1IBLM 3T38A 4RNAA 5H37D 1HNXM 5FTJA 3LVVA 2W82A 3M7GA 4LF9M 3GRVA 3NWLA 4LF8M 4DR4M 1DO0A 3AOEC 1N36M 4OW0A 1QAOA 4R7GA 4GC9A 4RF1A 1C1KA 2FNAA 3CF0A 4L16A 4NSRA 3U6EA 1IN5A 4DR7M 4LZZA 1N75A 3FUVA 4OX9M 1IBKM 2RGHA 2Z3XA 1N34M 2P5TA 2DZNB 1T3TA 2UUCM 4QHTA 4MB7A 5FSWA 4NXNM 1R2YA 1QQWA 2YFQA 4DR2M 2UXBM 3JAMS 1XXHB 4B3MM 4DUYM 2QZ4A 4DV7M 4GHLA 3MK6A 2VQEM 1I94M 1IBMM 4DV2M 5IT9S 2KZUA 1FJGM 3GLFB 1IY0A 5BPVA 4RF0A 1I4WA 3IG8A 4JI2M 2QPAA 2G5GX 3VLFB 1GVNA 2XFTA 3W0FA 1QVRA 4LZJA 2Y0QA 2ZBKB 4DV0M 4Z6YA 3RGPA 2XGNA 5EXPA 3FUUA 3SARA 4IBKA 4B3SM 3TWKA 1TH3A 4L78A 4G4QA 4PDIA 1IM2A 3GQ3A 4A3VB 4JI1M 4LJAA 3VK8A 4JV5M 3KOWE 3U6PA 2XLJA 3GPXA 1H6UA 3GLIB 2R65A 3J27B 3FTFA 4FCTA 1DGGA 1N32M 1IN6A 3MJ5A 1TDHA 2AHMA 4K0KM 1ORYB 3LQRA 5DYGA 4AG5A 1Z5CA 3U61A 4REZA 2QBYA 3KP0E 2F5QA 3FYDA 7CATA 4AQYM 1IN7A 4FWGA 2ZAMA 1LV7A 3SFZA 3SAUA 4XBOA 3TWMA 3SC3A 3HU2A 5LMNM 4B7FA 3KOYE 5IREB 1HQYE 2HCBA 3QWLA 2CUZA 4CISA 3C58A 2XSZA 1HT1E 3L26A 3AKZA 1L2CA 3R9XB 1IY1A 2E5LM 2Y20A 4LF4M 3KS4A 3L27A 2LWXA 4IBGA 4OVZA 5EJCA 3D8LA 3W0LB 3R8FA 3VDPA 4JI3M 3TQSA 4LGYA 3D8BA 4IIWA 1TDZA 2XF3A 2R4EA 4MGKE 5F3WA 2ZANA 3VKHA 2BNKA 4GHAA 1JR3A 2NQ8C 4FW9A 2YNMD 4LF7M 4NRWA 2QCUA 1PM5A 4MGYE 1DGFA 3FUTA 1Q3BA 3SYKA 1IY2A 3K1JA 4CGYB 2I7PA 4B08A 1QAQA 4GMQA 3UZUA 3SHFA 1NVMA 1SXJD 2RGOA 2KRKA 4DV3M 3KP1E 4I4LA 1NJGA 3J7BA 4TUWA 4MGHA 4JI8M 4AKHA 4I5SA 1G59A 2V1UA 1HQCA 2D7EA 3E4RA 3KDSE 3THGA 4B7HA 5JI3E 3BOSA 2K47A 3KXEC 3ZCBB 1GLNA 5A2QS 3GLGB 2L7IA 4B7GA 2F4VM 3M0EA 5KPZA 1YSYA 1NY5A 4L15A 2VQFM 3M6AA 4AI6A 4JI7M 4GKKM 5GKNA 2XZUA 2DWNA 3NBIA 1L2BA 3KFUG 1YUBA 8CATA 4GKJM 1SXJB 3VK7A 2XEPA 3UK6A 2I7NA 1KSFX 2JA2A 4LG2A 3AOEA 3U6OA 2F5OA 4D81A 1D2NA 2XH9A 2V6ZM 2KRUA 1IN8A 3GRYA 3B9PA 3RFWA 4BLCA 1MU5A 2C98A 3U6SA 3ILKA 3TL4X 4IBJA 4LFCM 2HHHM 1L1TA 5LMUM 4JI4M 4LRTA 3UMMA 4JI6M 3PXGA 5KO3A 3GRRA 2J7NA 2DZOB 2CE7A 3WHLA 1HNWM 5KPTA 3MHVC 5DNYA 2F5SA 1IXSB 4MH0E 3FTDA 4FVMA 2XFSA 1R7RA 3H4MA 5ITTA 4W5WA 4FD2A 3U60B 4XGIA 3AL0C 2QENA 3U5ZA 1TGUA 1S3SA 2UUAM 4M0DA 2EUCA 1GL6A 3SASA 2L09A 3FUXA 3SYLA 1G8PA 3K2LA 2H1RA 4LCBA 4Z8XA 4DR1M 4D80A 4L4UA 3SMPA 2UUBM 1NSFA 4AZFA 1HT2E 2X4AA 2C99A 5EXSA 4BB9A 3U6CA 3UGJA 3RE8A 2D7GA 4G4OA 2VIIA 2M60A 1FNNA 2CHGA 5EP1A 3DA1A 3L25A 1VDDA 3OTOM 2YR0A 3A46A 1E32A 2QP9X 3HJSA 4QHSA 1QYRA 1DGHA 4LF5M 2ERCA 3DOAA 3GPUA 4LFAM 1QZMA 2ZAOA 3FYCA 4QNMA 1G4AE 4BBAA 1J09A 1E9SA 3KOZE 3LQQA 2HL7A 3I4YA 2XZFA 1G41A 2O5RA 3GQ4A 1Q3CA 3A98B 4GRIA 4CHTB 2CHQA 1E94E 4IJEA 3HHZA 3GLHA 1ZQ9A 4LY6A 2CV2A 4PD2A 2A5YB 1NJFA 1X37A 1XWIA 2J7OA 1L1ZA 1SXJC 3LMMA 2D7HA 3PNYA 3Q8XA 3K92A 4WURA 2DWMA 2R45A 2ZM6M 2V1CA 1HR0M 1GL7A 2DWZB 3U6MA 4QOZC 4IBEA 2XSZD 3U6LA 5EP3A 2DWLA 1NNUC 3FKEA 4NXMM 4ITQA 5EXTA 4NOOB 1L2DA 3TWLA 1TH4A 1YE9A 2R4JA 4DUZM 2DVWB 4IBIA 5E26A 4AKIA 4X64M 3U61B 5KQ8A 2R18A 4IJFA 2QBYB 3WHKA 2LXEA 4JXJA 4LRSA 2F5PA 1JR3D 3FD9A 4IBBA 5KPRA 5FTNA 4NRVA 5JI2E 2YQZA 1XXHA 1K3WA 3EIEA 4KODA 4PCZA 2OQ4A 1DO2A 3EIHA 4M9ZA 2X8AA 3KSJA 3PVSA 5C18A 4AKGA 3GLFA 4JN6A 1XNQM 3GQ5A 2FOIC 3CF6E 3L28A 4OVZB 3A45A 4LJ6A 4GH9A 4II7A 4QOSA 3J7AS 5DYIA 2DHRA 4JI5M 5BR8M 2KEBA 4G6ZA 2HKJA 4KLNA 2CV0A 3ZC7B 1L8QA 2C9OA 3DFZA 1KYIA 4I8OA 4FCWA 1Z5AA 2C5RA 2KA6B 3I4VA 1MX0A 2G8LA 3IG5A 2Q2EB 2FE8A 5FTKA 5IZ7D 3SATA 4LJ4A 3T1HM 1DGBA 3GLIA 4M0WA 2F5NA 4IBDA 3HU3A 2C96A 4FWHA 1E9RA 5ITYA 2CEAA 3A42A 1JQJC 1OFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQP A;  2CHG A;  5EP1 A;  3HWS A;  3R8F A;  3PFI A;  2R62 A;  1E32 A;  2QP9 X;  2RKO A;  4QHS A;  3D8B A;  3ZH9 B;  4I81 A;  2Z4R A;  2ZAN A;  5EP4 A;  1QZM A;  1JR3 A;  2ZAO A;  4FW9 A;  4QNM A;  1G4A E;  5FTJ A;  4EIW A;  1DO0 A;  3SYK A;  1IY2 A;  3K1J A;  4LGM A;  1C1K A;  2FNA A;  1G41 A;  3CF0 A;  1NVM A;  4GIT A;  1SXJ D;  4L16 A;  2KRK A;  1IN5 A;  5C1B A;  2CHQ A;  1NJG A;  4I4L A;  1E94 E;  4ZPX A;  3GLH A;  4LZZ A;  4LY6 A;  2V1U A;  1HQC A;  1NJF A;  3KDS E;  2DZN B;  3AJI B;  1X37 A;  1XWI A;  5JI3 E;  3BOS A;  3HU1 A;  4QHT A;  1SXJ C;  3GLG B;  4LJ8 A;  3M0E A;  1NY5 A;  4L15 A;  1OFI A;  1XXH B;  3M6A A;  2QZ4 A;  5EQT A;  1G3I A;  2DWZ B;  2Z4S A;  2XSZ D;  1SXJ B;  3GLF B;  5EP3 A;  1IY0 A;  3DZD A;  5EXT A;  2QPA A;  3UK6 A;  3VLF B;  1KSF X;  3GLH B;  1QVR A;  3CF2 A;  1OJL A;  4D81 A;  1IXZ A;  2DVW B;  1D2N A;  2V6Z M;  1IN8 A;  3B9P A;  5EXP A;  3U61 B;  2C98 A;  3U5Z B;  2QBY B;  4LJ9 A;  3WHK A;  4QNR A;  4LRS A;  2BJW A;  1IXR C;  1JR3 D;  4LJ7 A;  3GLG A;  1IM2 A;  4LRT A;  5FTN A;  4KO8 A;  4A3V B;  1XXH A;  5JI2 E;  3PXG A;  4LJA A;  1R6B X;  3EIE A;  4KOD A;  1DO2 A;  4D82 A;  1UM8 A;  2DZO B;  2CE7 A;  3KW6 A;  3WHL A;  3EIH A;  2X8A A;  3GLI B;  3PVS A;  1W5T A;  5C18 A;  1SXJ A;  3MHV C;  3GLF A;  1IXS B;  4JN6 A;  2R65 A;  5EP2 A;  2BJV A;  1J7K A;  4FCT A;  3VFD A;  5EXX A;  1R7R A;  4LJ6 A;  4FWD A;  3H4M A;  4QOS A;  4FCV A;  5DYI A;  1IN6 A;  2DHR A;  4WW0 A;  4FD2 A;  3U60 B;  5DYG A;  2C9C A;  2QEN A;  4KLN A;  2QBY A;  1S3S A;  1L8Q A;  2C9O A;  1KYI A;  4FCW A;  5FTL A;  1IN7 A;  4FWG A;  2ZAM A;  1LV7 A;  3SYL A;  2CHV A;  3SC3 A;  3HU2 A;  4LCB A;  1NY6 A;  4Z8X A;  1SXJ E;  5FTK A;  1HQY E;  2HCB A;  1W5S A;  4L4U A;  4D80 A;  1NSF A;  4LJ4 A;  5FTM A;  1HT2 E;  2C99 A;  2XSZ A;  5EXS A;  3GLI A;  1IN4 A;  1HT1 E;  3HU3 A;  1IY1 A;  2C96 A;  2VII A;  4FWH A;  2CEA A;  1FNN A;  1JQJ C;  4LJ5 A;  1OFH A; 
#chains in the Genus database with same CATH topology
 1IQP A;  1XB2 B;  1NHG C;  3LVW A;  4MM3 B;  2OPF A;  2R62 A;  1GKI A;  3K9O A;  5KQD A;  4YY3 M;  5ITR A;  3ZH9 B;  3GO8 A;  1RU3 A;  3GRU A;  5IWA M;  2Z4R A;  3L2A A;  3GPY A;  4R3D A;  5EP4 A;  4B3R M;  4AW4 A;  2MRO B;  2EKK A;  5L8R F;  4DR5 M;  1EFU B;  3JR5 A;  4G4N A;  4EIW A;  4UN2 B;  5ITX A;  1R2Z A;  1Q39 A;  3GLI E;  3C9P A;  3T1Y M;  3U6Q A;  4LGM A;  2LH0 A;  4GEW A;  4GIT A;  1R4G A;  2CFO A;  1NO1 A;  1QDT A;  5C1B A;  4CJ6 A;  3KVW A;  1XMO M;  1N33 M;  3RGS A;  5DFL A;  1XNR M;  1TH2 A;  3KSX A;  3HHX A;  4ZPX A;  4DV4 M;  2FFJ A;  3J81 S;  1IFY A;  1EE8 A;  3AJI B;  3VKG A;  4JYA M;  1K82 A;  3HU1 A;  2APL A;  3VDU A;  3JR4 A;  4LJ8 A;  4G4R A;  4B3T M;  3AV0 A;  5ITX E;  2VF7 A;  1OFI A;  1PJI A;  2LNH C;  2Z7J A;  2R46 A;  4JI0 M;  4M9S A;  1PJS A;  3Q8G A;  5EQT A;  3FTE A;  1G3I A;  4CIZ A;  2Z4S A;  2L6O A;  4DV1 M;  1PJJ A;  1C7Y A;  4LF6 M;  2X49 A;  2Y21 A;  3DZD A;  1ZMW A;  2OO9 A;  4OU7 A;  3GP1 A;  2DXI A;  3GPP A;  2DZL A;  3CF2 A;  1OJL A;  2EJS A;  2EA0 A;  1J5E M;  1KFV A;  5ITQ A;  4AG6 A;  2R6F A;  4DBG B;  2J5Y A;  2WZJ A;  2K9D A;  1XC8 A;  3U5Z B;  2EO2 A;  4LJ9 A;  4LFB M;  1AUA A;  4QNR A;  2BJW A;  1IXR C;  4LJ7 A;  3GLG A;  1HNZ M;  2QNJ A;  2Y0T A;  1N78 A;  1TTE A;  4KO8 A;  3W67 A;  1NHW C;  4S12 A;  5E6J A;  1XHB A;  1R6B X;  3AFH A;  4L8R C;  3J80 S;  4HL4 A;  4D82 A;  1UM8 A;  3KW6 A;  4PT5 A;  1LTM A;  3SAV A;  3SMS A;  1W5T A;  1SXJ A;  5EP2 A;  3HGI A;  3HHW A;  3AOG A;  4MGI E;  3CTW B;  2BJV A;  3T15 A;  4M9X A;  1J7K A;  3VFD A;  1TR8 A;  2MJ5 B;  3I51 A;  5EXX A;  3UJN A;  3QYB A;  5ITU A;  4FWD A;  1OAI A;  3U6D A;  2DI0 A;  1ZAE A;  3J2P B;  4PDG A;  4FCV A;  2LBC A;  4NSO B;  3HJQ A;  3SAW A;  4WW0 A;  4GC5 A;  4IBF A;  4MGZ E;  1DGH B;  1D0L A;  2L7H A;  3L29 A;  1WR1 B;  4X66 M;  3GLG E;  3TPZ A;  1OKS A;  2C9C A;  2JY5 A;  5FLX S;  4DV6 M;  2UU9 M;  2UXC M;  2KXE A;  2CP8 A;  1QAN A;  2LVA A;  1Z59 A;  4IBC A;  3FRH A;  3PNV A;  5FTL A;  3FRI A;  2M5Z A;  4GIP A;  3HHY A;  1GJS A;  2KDL A;  1NNJ A;  1Z5B A;  1Z6T A;  2CHV A;  2GQF A;  4DR6 M;  1NY6 A;  1MN3 A;  1QAM A;  1SXJ E;  3FTC A;  3FUW A;  1W5S A;  3TE6 A;  3ZQJ A;  4DV5 M;  1QUT A;  1Q02 A;  1VQ1 A;  2KW0 A;  5FTM A;  4DR3 M;  3SBJ A;  2OOB A;  4P16 A;  1N77 A;  1IN4 A;  1WGN A;  4ANR A;  4X65 M;  4KHP M;  4NL4 H;  3QAU A;  2UXD M;  3HJ8 A;  3SHG B;  2CV1 A;  1WXQ A;  1WJ7 A;  3GLH B;  1IXZ A;  4LJ5 A;  3IHP A;  3HWS A;  4HLQ A;  3PFI A;  2JUJ A;  2KZS A;  1K3X A;  4X62 M;  2RKO A;  3U60 A;  3K8Z A;  3HKP A;  3E9S A;  3KS8 A;  4I81 A;  1PGY A;  3K9P A;  4P17 A;  1XMQ M;  3KOX E;  1IBL M;  1XXH E;  3T38 A;  1OIP A;  4RNA A;  5H37 D;  1HNX M;  5FTJ A;  1QUS A;  2W82 A;  3M7G A;  3LVV A;  3GRV A;  3NWL A;  4LF9 M;  4LF8 M;  3IEC A;  4DR4 M;  1DO0 A;  3AOE C;  1N36 M;  4OW0 A;  1QAO A;  4R7G A;  3F92 A;  4GC9 A;  4YHH M;  4TUW A;  3GLF E;  4RF1 A;  1C1K A;  2FNA A;  3CF0 A;  2DNA A;  4L16 A;  1P3Q Q;  4NSR A;  3U6E A;  1IN5 A;  2LVP C;  2KNV A;  4DR7 M;  2JWS A;  1VDL A;  4LZZ A;  1N75 A;  3FUV A;  2CRU A;  4OX9 M;  1IBK M;  2RGH A;  2Z3X A;  1N34 M;  2P5T A;  2QHO B;  2DZN B;  1HJP A;  1T3T A;  2UUC M;  4QHT A;  4MB7 A;  2QQ8 A;  1VG5 A;  4NXN M;  5FSW A;  1R2Y A;  1QQW A;  2YFQ A;  4DR2 M;  2UXB M;  3JAM S;  1XXH B;  4B3M M;  2JY8 A;  4DUY M;  2QZ4 A;  4DV7 M;  4GHL A;  3MK6 A;  2VQE M;  2LVN C;  1I94 M;  1IBM M;  4DV2 M;  5IT9 S;  2KZU A;  1FJG M;  3GLF B;  1IY0 A;  5BPV A;  4RF0 A;  2RRU A;  1I4W A;  3IG8 A;  4JI2 M;  2QPA A;  2G5G X;  2K0B X;  3VLF B;  1GVN A;  2XFT A;  3W0F A;  2LHC A;  1QVR A;  1PRB A;  2Y0Q A;  2ZBK B;  4LZJ A;  1OAO C;  3E21 A;  1QDR A;  4DV0 M;  4Z6Y A;  3RGP A;  2XGN A;  5EXP A;  3FUU A;  3SAR A;  4IBK A;  4B3S M;  2BWB A;  3TWK A;  1TH3 A;  4L78 A;  3B7Z A;  4G4Q A;  1QZE A;  4PDI A;  1IM2 A;  2WSF F;  3GQ3 A;  4A3V B;  4JI1 M;  4LJA A;  3VK8 A;  4JV5 M;  3KOW E;  3U6P A;  2XLJ A;  3GPX A;  1UFZ A;  1T43 A;  2LVO C;  1H6U A;  3GLI B;  3HX3 A;  2O01 F;  2R65 A;  3J27 B;  3FTF A;  4FCT A;  2JP7 A;  1DGG A;  3CGW A;  1N32 M;  2EKF A;  1IN6 A;  1GJT A;  3MJ5 A;  1TDH A;  2AHM A;  4K0K M;  1ORY B;  3LQR A;  1ZMU A;  5DYG A;  4AG5 A;  1A5T A;  1Z5C A;  3U61 A;  4REZ A;  2QBY A;  2N35 A;  3KP0 E;  2F5Q A;  3FYD A;  7CAT A;  4AQY M;  1IN7 A;  4FWG A;  2ZAM A;  1LV7 A;  3SFZ A;  3SAU A;  4XBO A;  3TWM A;  3SC3 A;  3HU2 A;  2CWB A;  5LMN M;  4B7F A;  3KOY E;  5IRE B;  2DAM A;  1HQY E;  2H5X A;  2HCB A;  2MGW A;  3QWL A;  2LTU A;  2CUZ A;  2L4F A;  4CIS A;  3C58 A;  2XSZ A;  1HT1 E;  3L26 A;  3AKZ A;  1L2C A;  3R9X B;  1IY1 A;  2E5L M;  2Y20 A;  4LF4 M;  3KS4 A;  3L27 A;  2LWX A;  2WSC F;  4IBG A;  4OVZ A;  5EJC A;  3D8L A;  1PJT A;  3W0L B;  3R8F A;  3HY5 A;  3VDP A;  4JI3 M;  3TQS A;  4LGY A;  3D8B A;  1ZMV A;  4IIW A;  1TDZ A;  1D0K A;  2R4E A;  2XF3 A;  4MGK E;  5F3W A;  2ZAN A;  4KT0 F;  3B89 A;  3VKH A;  2BNK A;  4GHA A;  1JR3 A;  3B7N A;  2NQ8 C;  4FW9 A;  2YNM D;  1JB0 F;  4LF7 M;  4NRW A;  2QCU A;  1PM5 A;  4MGY E;  1DGF A;  2DHY A;  3FUT A;  1Q3B A;  3SYK A;  1IY2 A;  3K1J A;  4CGY B;  2I7P A;  4B08 A;  1QAQ A;  2JZ1 A;  4GMQ A;  3SHF A;  3UZU A;  1V33 A;  1NVM A;  1SXJ D;  2RGO A;  2KRK A;  1VEG A;  3MMP A;  4DV3 M;  1OQY A;  3KP1 E;  1NJG A;  3J7B A;  4HEO A;  4I4L A;  2JY7 A;  1IXS A;  4MGH A;  4JI8 M;  4AKH A;  4I5S A;  1G59 A;  2V1U A;  1HQC A;  2D7E A;  2G3Q A;  3E4R A;  3KDS E;  3THG A;  4B7H A;  1JR3 E;  5JI3 E;  1OTR A;  3BOS A;  2K47 A;  3KXE C;  3ZCB B;  1GLN A;  5A2Q S;  3GLG B;  2L7I A;  1R5L A;  2O25 A;  4B7G A;  1V92 A;  4F2L A;  3M0E A;  5KPZ A;  1YSY A;  1NY5 A;  4L15 A;  2F4V M;  2DAK A;  1WHC A;  2VQF M;  3M6A A;  4AI6 A;  4JI7 M;  4GKK M;  5GKN A;  1T6O A;  2XZU A;  2VF8 A;  2DWN A;  3NBI A;  1L2B A;  3KFU G;  3LW5 F;  1YUB A;  2FH0 A;  4XK8 F;  2GNO A;  8CAT A;  3W68 A;  4GKJ M;  1SXJ B;  1VEK A;  3VK7 A;  2XEP A;  3UK6 A;  2I7N A;  1KSF X;  2JA2 A;  4LG2 A;  3AOE A;  3E46 A;  1YLA A;  4D81 A;  3U6O A;  2F5O A;  1Y8G A;  1D2N A;  2OOA A;  2XH9 A;  2V6Z M;  2KRU A;  1IN8 A;  3C3D A;  3B9P A;  3GRY A;  3RFW A;  4BLC A;  1MU5 A;  2C98 A;  3U6S A;  3ILK A;  3TL4 X;  4IBJ A;  4LFC M;  2HHH M;  1L1T A;  5LMU M;  4JI4 M;  4LRT A;  3UMM A;  4JI6 M;  3PXG A;  4R71 A;  5KO3 A;  3GRR A;  2J7N A;  2MR9 A;  2DAI A;  3QYE A;  1V34 A;  2CE7 A;  2DZO B;  3BBZ A;  4L6V 6;  4NC6 A;  3WHL A;  5KPT A;  1HNW M;  3MHV C;  5DNY A;  2F5S A;  1IXS B;  4MH0 E;  3FTD A;  3T6P A;  4FVM A;  2XFS A;  1BVS A;  1R7R A;  3H4M A;  5ITT A;  3H4J A;  4W5W A;  1WIV A;  2LVQ D;  4FD2 A;  2QSF X;  3U60 B;  3B7Q A;  4XGI A;  2QEN A;  3U5Z A;  1TGU A;  3AL0 C;  1S3S A;  2UUA M;  4M0D A;  2EUC A;  2KHH A;  1GL6 A;  3SAS A;  2JXN A;  2L09 A;  3FUX A;  3SYL A;  1G8P A;  1WGL A;  3K2L A;  4Y28 F;  2H1R A;  4LCB A;  4Z8X A;  4DR1 M;  4D80 A;  4L4U A;  3SMP A;  2UUB M;  1NSF A;  4AZF A;  1HT2 E;  2X4A A;  2C99 A;  5EXS A;  4BB9 A;  3U6C A;  3UGJ A;  3RE8 A;  2D7G A;  4G4O A;  2VII A;  2M60 A;  1FNN A;  2CHG A;  5EP1 A;  3DA1 A;  3L25 A;  1VDD A;  2JNH A;  2HAK A;  3OTO M;  2YR0 A;  3A46 A;  1E32 A;  4RKU F;  1PJQ A;  2QP9 X;  1D0M A;  1QYR A;  3HJS A;  4QHS A;  1DGH A;  4LF5 M;  2ERC A;  3DOA A;  3LCV B;  3GPU A;  4LFA M;  1QZM A;  2ZAO A;  3FYC A;  4QNM A;  1G4A E;  4BBA A;  1J09 A;  1E9S A;  2DAG A;  2WSE F;  3KOZ E;  3LQQ A;  2HL7 A;  1G71 A;  3I4Y A;  2VDB B;  2XZF A;  1G41 A;  2O5R A;  3GQ4 A;  1Q3C A;  2MH8 A;  3LCU A;  4WP2 A;  3A98 B;  4GRI A;  4CHT B;  2CHQ A;  2KNZ A;  1E94 E;  4IJE A;  3HHZ A;  2R44 A;  3GLH A;  1ZQ9 A;  4LY6 A;  2CV2 A;  4PD2 A;  2A5Y B;  1NJF A;  2JY6 B;  1X37 A;  1XWI A;  2J7O A;  2B3T A;  3BXW A;  1L1Z A;  1SXJ C;  3LMM A;  2D7H A;  3HZJ A;  3PNY A;  3Q8X A;  2FS1 A;  3K92 A;  4WUR A;  2DWM A;  2R45 A;  2L2D A;  2V1C A;  2ZM6 M;  3FE3 A;  3I01 M;  1AIP C;  2JZ0 A;  1HR0 M;  1GL7 A;  2DWZ B;  3U6M A;  4QOZ C;  4IBE A;  2XSZ D;  3U6L A;  1CUK A;  5EP3 A;  1NNU C;  3FKE A;  3GLH E;  1VEJ A;  2DWL A;  4NXM M;  4ITQ A;  5EXT A;  4NOO B;  1L2D A;  3TWL A;  2L4E A;  1TH4 A;  1YE9 A;  2R4J A;  4DUZ M;  2DVW B;  4IBI A;  5E26 A;  4AKI A;  1OIZ A;  2R0I A;  4X64 M;  3U61 B;  5KQ8 A;  2R18 A;  4IJF A;  2QBY B;  3WHK A;  2LXE A;  4JXJ A;  4LRS A;  2F5P A;  1JR3 D;  2DAE A;  3FD9 A;  4IBB A;  5FTN A;  5KPR A;  2HWJ A;  3B74 A;  4NRV A;  5JI2 E;  2YQZ A;  1XXH A;  3V76 A;  4G3O A;  1K3W A;  3EIE A;  4KOD A;  4F1I A;  4PCZ A;  2OQ4 A;  1DO2 A;  1MJG M;  3EIH A;  4M9Z A;  2X8A A;  2BWE A;  1NV8 A;  3I04 M;  3KSJ A;  3PVS A;  1DV0 A;  5C18 A;  4Q7J A;  4AKG A;  3GLF A;  4JN6 A;  1XNQ M;  2KNA A;  3GQ5 A;  2FOI C;  3CF6 E;  3L28 A;  4OVZ B;  3A45 A;  4LJ6 A;  3C3E A;  4GH9 A;  1SG9 A;  4II7 A;  4QOS A;  2DKL A;  3J7A S;  5DYI A;  2DHR A;  2ZTC A;  1TF0 B;  2LHG A;  4JI5 M;  1GO5 A;  5BR8 M;  2KEB A;  4G6Z A;  2HKJ A;  4KLN A;  2CV0 A;  1NV9 A;  3ZC7 B;  1L8Q A;  2C9O A;  3DFZ A;  1KYI A;  1EIJ A;  4I8O A;  4FCW A;  1Z5A A;  2C5R A;  1ZV1 A;  2K6B A;  2KA6 B;  3I4V A;  1MX0 A;  2G8L A;  2Z8Y M;  2Q2E B;  3IG5 A;  2FE8 A;  5FTK A;  2ZTD A;  5IZ7 D;  1F4I A;  3SAT A;  4LJ4 A;  3T1H M;  1DGB A;  3NBX X;  3GLI A;  4M0W A;  2F5N A;  4IBD A;  3HU3 A;  1GAB A;  2C96 A;  4FWH A;  1E9R A;  5ITY A;  2CEA A;  2DEN A;  3A42 A;  1JQJ C;  1OFH A; 
#chains in the Genus database with same CATH homology
 1IQP A;  1NHG C;  3LVW A;  4MM3 B;  2OPF A;  2R62 A;  1GKI A;  5KQD A;  4YY3 M;  5ITR A;  3ZH9 B;  3GO8 A;  3GRU A;  5IWA M;  2Z4R A;  3L2A A;  3GPY A;  4R3D A;  5EP4 A;  4B3R M;  4AW4 A;  4DR5 M;  3JR5 A;  4G4N A;  4EIW A;  5ITX A;  1R2Z A;  1Q39 A;  3T1Y M;  3U6Q A;  4LGM A;  2LH0 A;  4GIT A;  2CFO A;  1N33 M;  5C1B A;  3KVW A;  1XMO M;  3RGS A;  1XNR M;  1TH2 A;  3KSX A;  3HHX A;  4ZPX A;  4DV4 M;  2FFJ A;  3J81 S;  1EE8 A;  3AJI B;  3VKG A;  4JYA M;  1K82 A;  3HU1 A;  3VDU A;  3JR4 A;  4LJ8 A;  4G4R A;  4B3T M;  3AV0 A;  5ITX E;  1OFI A;  1PJI A;  2LNH C;  2Z7J A;  2R46 A;  4JI0 M;  4M9S A;  3FTE A;  5EQT A;  1G3I A;  2Z4S A;  2L6O A;  4DV1 M;  1PJJ A;  4LF6 M;  2X49 A;  2Y21 A;  3DZD A;  4OU7 A;  3GP1 A;  2DXI A;  3GPP A;  3CF2 A;  1OJL A;  2EA0 A;  1J5E M;  1KFV A;  5ITQ A;  4AG6 A;  1XC8 A;  3U5Z B;  2EO2 A;  4LJ9 A;  4LFB M;  4QNR A;  2BJW A;  1IXR C;  4LJ7 A;  3GLG A;  1HNZ M;  2Y0T A;  1N78 A;  4KO8 A;  1NHW C;  4S12 A;  5E6J A;  1XHB A;  1R6B X;  3AFH A;  4L8R C;  3J80 S;  4HL4 A;  4D82 A;  1UM8 A;  3KW6 A;  4PT5 A;  3SAV A;  3SMS A;  1W5T A;  1SXJ A;  5EP2 A;  3HGI A;  3HHW A;  3AOG A;  4MGI E;  3CTW B;  2BJV A;  3T15 A;  4M9X A;  1J7K A;  3VFD A;  3UJN A;  3I51 A;  5EXX A;  4YHH M;  5ITU A;  4FWD A;  3U6D A;  1ZAE A;  3J2P B;  4PDG A;  4FCV A;  4NSO B;  3HJQ A;  3SAW A;  4WW0 A;  4GC5 A;  4IBF A;  4MGZ E;  1DGH B;  2L7H A;  3L29 A;  4X66 M;  3TPZ A;  2C9C A;  5FLX S;  4DV6 M;  2UXC M;  2UU9 M;  2KXE A;  1QAN A;  1Z59 A;  4IBC A;  5FTL A;  3PNV A;  2M5Z A;  4GIP A;  3HHY A;  1NNJ A;  1Z5B A;  1Z6T A;  2CHV A;  4DR6 M;  1NY6 A;  3FTC A;  1QAM A;  1SXJ E;  3FUW A;  3TE6 A;  1W5S A;  4DV5 M;  4DR3 M;  3SBJ A;  2KW0 A;  5FTM A;  4P16 A;  1N77 A;  1IN4 A;  4KHP M;  4X65 M;  2UXD M;  4NL4 H;  3QAU A;  3HJ8 A;  3SHG B;  2CV1 A;  1WXQ A;  3GLH B;  4LJ5 A;  1IXZ A;  3HWS A;  4HLQ A;  3PFI A;  2KZS A;  1K3X A;  4X62 M;  2RKO A;  3U60 A;  3K8Z A;  3HKP A;  3E9S A;  3KS8 A;  4I81 A;  1XMQ M;  3KOX E;  1IBL M;  3T38 A;  4RNA A;  5H37 D;  1HNX M;  5FTJ A;  3LVV A;  2W82 A;  3M7G A;  4LF9 M;  3GRV A;  3NWL A;  4LF8 M;  4DR4 M;  1DO0 A;  3AOE C;  1N36 M;  4OW0 A;  1QAO A;  4R7G A;  4GC9 A;  4RF1 A;  1C1K A;  2FNA A;  3CF0 A;  4L16 A;  4NSR A;  3U6E A;  1IN5 A;  4DR7 M;  4LZZ A;  1N75 A;  3FUV A;  4OX9 M;  1IBK M;  2RGH A;  2Z3X A;  1N34 M;  2P5T A;  2DZN B;  1T3T A;  2UUC M;  4QHT A;  4MB7 A;  5FSW A;  4NXN M;  1R2Y A;  1QQW A;  2YFQ A;  4DR2 M;  2UXB M;  3JAM S;  1XXH B;  4B3M M;  4DUY M;  2QZ4 A;  4DV7 M;  4GHL A;  3MK6 A;  2VQE M;  1I94 M;  1IBM M;  4DV2 M;  5IT9 S;  2KZU A;  1FJG M;  3GLF B;  1IY0 A;  5BPV A;  4RF0 A;  1I4W A;  3IG8 A;  4JI2 M;  2QPA A;  2G5G X;  3VLF B;  1GVN A;  2XFT A;  3W0F A;  1QVR A;  4LZJ A;  2Y0Q A;  2ZBK B;  4DV0 M;  4Z6Y A;  3RGP A;  2XGN A;  5EXP A;  3FUU A;  3SAR A;  4IBK A;  4B3S M;  3TWK A;  1TH3 A;  4L78 A;  4G4Q A;  4PDI A;  1IM2 A;  3GQ3 A;  4A3V B;  4JI1 M;  4LJA A;  3VK8 A;  4JV5 M;  3KOW E;  3U6P A;  2XLJ A;  3GPX A;  1H6U A;  3GLI B;  2R65 A;  3J27 B;  3FTF A;  4FCT A;  1DGG A;  1N32 M;  1IN6 A;  3MJ5 A;  1TDH A;  2AHM A;  4K0K M;  1ORY B;  3LQR A;  5DYG A;  4AG5 A;  1Z5C A;  3U61 A;  4REZ A;  2QBY A;  3KP0 E;  2F5Q A;  3FYD A;  7CAT A;  4AQY M;  1IN7 A;  4FWG A;  2ZAM A;  1LV7 A;  3SFZ A;  3SAU A;  4XBO A;  3TWM A;  3SC3 A;  3HU2 A;  5LMN M;  4B7F A;  3KOY E;  5IRE B;  1HQY E;  2HCB A;  3QWL A;  2CUZ A;  4CIS A;  3C58 A;  2XSZ A;  1HT1 E;  3L26 A;  3AKZ A;  1L2C A;  3R9X B;  1IY1 A;  2E5L M;  2Y20 A;  4LF4 M;  3KS4 A;  3L27 A;  2LWX A;  4IBG A;  4OVZ A;  5EJC A;  3D8L A;  3W0L B;  3R8F A;  3VDP A;  4JI3 M;  3TQS A;  4LGY A;  3D8B A;  4IIW A;  1TDZ A;  2XF3 A;  2R4E A;  4MGK E;  5F3W A;  2ZAN A;  3VKH A;  2BNK A;  4GHA A;  1JR3 A;  2NQ8 C;  4FW9 A;  2YNM D;  4LF7 M;  4NRW A;  2QCU A;  1PM5 A;  4MGY E;  1DGF A;  3FUT A;  1Q3B A;  3SYK A;  1IY2 A;  3K1J A;  4CGY B;  2I7P A;  4B08 A;  1QAQ A;  4GMQ A;  3UZU A;  3SHF A;  1NVM A;  1SXJ D;  2RGO A;  2KRK A;  4DV3 M;  3KP1 E;  4I4L A;  1NJG A;  3J7B A;  4TUW A;  4MGH A;  4JI8 M;  4AKH A;  4I5S A;  1G59 A;  2V1U A;  1HQC A;  2D7E A;  3E4R A;  3KDS E;  3THG A;  4B7H A;  5JI3 E;  3BOS A;  2K47 A;  3KXE C;  3ZCB B;  1GLN A;  5A2Q S;  3GLG B;  2L7I A;  4B7G A;  2F4V M;  3M0E A;  5KPZ A;  1YSY A;  1NY5 A;  4L15 A;  2VQF M;  3M6A A;  4AI6 A;  4JI7 M;  4GKK M;  5GKN A;  2XZU A;  2DWN A;  3NBI A;  1L2B A;  3KFU G;  1YUB A;  8CAT A;  4GKJ M;  1SXJ B;  3VK7 A;  2XEP A;  3UK6 A;  2I7N A;  1KSF X;  2JA2 A;  4LG2 A;  3AOE A;  3U6O A;  2F5O A;  4D81 A;  1D2N A;  2XH9 A;  2V6Z M;  2KRU A;  1IN8 A;  3GRY A;  3B9P A;  3RFW A;  4BLC A;  1MU5 A;  2C98 A;  3U6S A;  3ILK A;  3TL4 X;  4IBJ A;  4LFC M;  2HHH M;  1L1T A;  5LMU M;  4JI4 M;  4LRT A;  3UMM A;  4JI6 M;  3PXG A;  5KO3 A;  3GRR A;  2J7N A;  2DZO B;  2CE7 A;  3WHL A;  1HNW M;  5KPT A;  3MHV C;  5DNY A;  2F5S A;  1IXS B;  4MH0 E;  3FTD A;  4FVM A;  2XFS A;  1R7R A;  3H4M A;  5ITT A;  4W5W A;  4FD2 A;  3U60 B;  4XGI A;  3AL0 C;  2QEN A;  3U5Z A;  1TGU A;  1S3S A;  2UUA M;  4M0D A;  2EUC A;  1GL6 A;  3SAS A;  2L09 A;  3FUX A;  3SYL A;  1G8P A;  3K2L A;  2H1R A;  4LCB A;  4Z8X A;  4DR1 M;  4D80 A;  4L4U A;  3SMP A;  2UUB M;  1NSF A;  4AZF A;  1HT2 E;  2X4A A;  2C99 A;  5EXS A;  4BB9 A;  3U6C A;  3UGJ A;  3RE8 A;  2D7G A;  4G4O A;  2VII A;  2M60 A;  1FNN A;  2CHG A;  5EP1 A;  3DA1 A;  3L25 A;  1VDD A;  3OTO M;  2YR0 A;  3A46 A;  1E32 A;  2QP9 X;  3HJS A;  4QHS A;  1QYR A;  1DGH A;  4LF5 M;  2ERC A;  3DOA A;  3GPU A;  4LFA M;  1QZM A;  2ZAO A;  3FYC A;  4QNM A;  1G4A E;  4BBA A;  1J09 A;  1E9S A;  3KOZ E;  3LQQ A;  2HL7 A;  3I4Y A;  2XZF A;  1G41 A;  2O5R A;  3GQ4 A;  1Q3C A;  3A98 B;  4GRI A;  4CHT B;  2CHQ A;  1E94 E;  4IJE A;  3HHZ A;  3GLH A;  1ZQ9 A;  4LY6 A;  2CV2 A;  4PD2 A;  2A5Y B;  1NJF A;  1X37 A;  1XWI A;  2J7O A;  1L1Z A;  1SXJ C;  3LMM A;  2D7H A;  3PNY A;  3Q8X A;  3K92 A;  4WUR A;  2DWM A;  2R45 A;  2ZM6 M;  2V1C A;  1HR0 M;  1GL7 A;  2DWZ B;  3U6M A;  4QOZ C;  4IBE A;  2XSZ D;  3U6L A;  5EP3 A;  2DWL A;  1NNU C;  3FKE A;  4NXM M;  4ITQ A;  5EXT A;  4NOO B;  1L2D A;  3TWL A;  1TH4 A;  1YE9 A;  2R4J A;  4DUZ M;  2DVW B;  4IBI A;  5E26 A;  4AKI A;  4X64 M;  3U61 B;  5KQ8 A;  2R18 A;  4IJF A;  2QBY B;  3WHK A;  2LXE A;  4JXJ A;  4LRS A;  2F5P A;  1JR3 D;  3FD9 A;  4IBB A;  5KPR A;  5FTN A;  4NRV A;  5JI2 E;  2YQZ A;  1XXH A;  1K3W A;  3EIE A;  4KOD A;  4PCZ A;  2OQ4 A;  1DO2 A;  3EIH A;  4M9Z A;  2X8A A;  3KSJ A;  3PVS A;  5C18 A;  4AKG A;  3GLF A;  4JN6 A;  1XNQ M;  3GQ5 A;  2FOI C;  3CF6 E;  3L28 A;  4OVZ B;  3A45 A;  4LJ6 A;  4GH9 A;  4II7 A;  4QOS A;  3J7A S;  5DYI A;  2DHR A;  4JI5 M;  5BR8 M;  2KEB A;  4G6Z A;  2HKJ A;  4KLN A;  2CV0 A;  3ZC7 B;  1L8Q A;  2C9O A;  3DFZ A;  1KYI A;  4I8O A;  4FCW A;  1Z5A A;  2C5R A;  2KA6 B;  3I4V A;  1MX0 A;  2G8L A;  3IG5 A;  2Q2E B;  2FE8 A;  5FTK A;  5IZ7 D;  3SAT A;  4LJ4 A;  3T1H M;  1DGB A;  3GLI A;  4M0W A;  2F5N A;  4IBD A;  3HU3 A;  2C96 A;  4FWH A;  1E9R A;  5ITY A;  2CEA A;  3A42 A;  1JQJ C;  1OFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...