4GITA

Crystal structure of alpha sub-domain of lon protease from brevibacillus thermoruber
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
GYTELEKLHIMRDYLLPKQMEEHGLGRDKLQMNEEAMLKVIRQYTREAGVRNLNREAANICRKAARLIVSGEKKRVVVTPKTVESLLGKPRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lon protease
publication title Structural basis for DNA-mediated allosteric regulation facilitated by the AAA(+) module of Lon protease.
pubmed doi rcsb
source organism Brevibacillus thermoruber
molecule tags Hydrolase
total genus 33
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2012-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gitA00
3PXGA 1IY1A 1FNNA 1G41A 4FD2A 2CHQA 1R6BX 4FW9A 2CHVA 2QPAA 1JR3D 1HT1E 5EP2A 3GLIB 5EP1A 3WHLA 5EXSA 1SXJD 4LRSA 2X8AA 2QZ4A 2VIIA 3UK6A 4KODA 4LJ7A 3HWSA 4FCTA 3AJIB 2CHGA 1DO0A 1IY2A 3U61B 1IXRC 1IQPA 3SYLA 4LGMA 3PFIA 4EIWA 2ZAMA 4D81A 5JI3E 3R8FA 1QVRA 2DZNB 1C1KA 2QBYA 2HCBA 3EIEA 2XSZD 2C9OA 3ZH9B 2V6ZM 4LJ4A 2BJVA 2C9CA 1NVMA 1IN7A 4LZZA 4D80A 1IXSB 1DO2A 1LV7A 2R62A 1IN4A 4D82A 5EXTA 3MHVC 4FCWA 4I4LA 5EP4A 2QENA 5FTJA 3VFDA 3H4MA 1XWIA 4FWDA 1X37A 4FWGA 1JQJC 1JR3A 3GLFA 3HU1A 1OFIA 4QOSA 5C18A 1OJLA 4L16A 4ZPXA 1SXJA 1QZMA 3KW6A 4LJ9A 4QNRA 1NY5A 1IXZA 2KRKA 3GLHA 4FWHA 4I81A 2BJWA 2C96A 3CF2A 3GLGA 3M0EA 5FTNA 1HQCA 5EQTA 1NJFA 4QHTA 1NSFA 4L15A 5EXPA 1E32A 2QP9X 1XXHB 4L4UA 1HQYE 3HU3A 4WW0A 5EP3A 1L8QA 2QBYB 1IY0A 1W5SA 5DYGA 3U60B 4Z8XA 3WHKA 2Z4SA 2XSZA 4LJAA 2C99A 4LJ8A 2CEAA 3DZDA 2V1UA 4FCVA 1HT2E 4QHSA 4GITA 1G4AE 1UM8A 4LRTA 1S3SA 4LJ5A 3CF0A 1NJGA 3GLFB 3SC3A 1G3IA 2FNAA 4JN6A 1NY6A 1SXJB 1W5TA 3M6AA 5EXXA 3VLFB 2CE7A 3GLHB 3U5ZB 2C98A 3EIHA 4LY6A 3GLGB 3D8BA 4LJ6A 5FTLA 1IM2A 1IN6A 5FTMA 1KYIA 3GLIA 5JI2E 1R7RA 2ZAOA 2ZANA 1E94E 4LCBA 4A3VB 1J7KA 2RKOA 3B9PA 3HU2A 3BOSA 3SYKA 1SXJC 1IN5A 2DVWB 5C1BA 1D2NA 1KSFX 2DHRA 2Z4RA 2DWZB 2DZOB 4KLNA 4KO8A 3K1JA 1OFHA 5DYIA 3KDSE 1IN8A 2R65A 1XXHA 3PVSA 5FTKA 4QNMA 1SXJE
chains in the Genus database with same CATH superfamily
4Z6YA 4GMQA 4JI5M 3PXGA 2EO2A 4L8RC 4KHPM 2K6BA 3TQSA 2CHQA 3GPPA 1EE8A 1NO1A 1R6BX 1YSYA 4RKUF 4R71A 2DWMA 1N78A 4PD2A 4X62M 3GRUA 2VF7A 2CHVA 2KHHA 5EP2A 3GLIB 5EXSA 5IZ7D 1QAOA 2X8AA 3UK6A 4LJ7A 1YUBA 1IBKM 1HNZM 2EKKA 2H1RA 3I04M 4JI2M 2FH0A 4LG2A 2CFOA 1DO0A 2F5PA 1Z59A 3IG5A 1IQPA 3SYLA 4DR5M 1AUAA 3PFIA 4MGKE 2ZAMA 5LMNM 3T38A 4G4RA 1QVRA 2JY8A 2JY5A 1G59A 2QBYA 3FD9A 1NNUC 1PJTA 4IJEA 1ZMUA 3GLHE 4UN2B 2H5XA 3KOWE 1D0LA 2DZLA 2V6ZM 3ZH9B 2CV1A 2CV0A 4LZZA 5DNYA 1LV7A 1TH3A 2Z8YM 3MHVC 1ZAEA 1MJGM 3FYDA 4IBKA 4JI6M 4RF0A 1MU5A 1K82A 2R4EA 3GLFA 4DV3M 3HU1A 2UXDM 2A5YB 4ZPXA 3GRRA 1XNQM 1QZMA 4QNRA 2KEBA 4LJ9A 8CATA 3HGIA 1IXZA 3KOXE 3L26A 4FWHA 2P5TA 4FVMA 2X49A 2LH0A 4Q7JA 5EQTA 4ANRA 1NSFA 2ZBKB 3L25A 3FRIA 2D7GA 2R46A 3FYCA 3ILKA 5E6JA 1XMQM 4IBCA 4L4UA 2D7HA 2UU9M 3BBZA 3K8ZA 7CATA 3J7AS 4XK8F 2UXBM 4JI8M 2KDLA 3FUUA 2QBYB 2XZUA 1W5SA 5DYGA 2WZJA 5ITUA 4XBOA 3L27A 4MGYE 3J81S 2VQEM 4X64M 4GC9A 4LF7M 1DGGA 3GLIE 2CRUA 3E4RA 2QQ8A 4NXMM 3K92A 2DHYA 1L1TA 3H4JA 2CWBA 2MH8A 2L09A 3SASA 4GITA 1QZEA 2Z7JA 3IHPA 4DR4M 1G4AE 2F5NA 1QANA 3LVWA 5FLXS 5ITQA 3GLFB 3V76A 3FUWA 2X4AA 4IBIA 4JN6A 4DR2M 1XMOM 2CE7A 2JA2A 4NL4H 4BBAA 2M5ZA 4LY6A 3U6PA 4K0KM 2LVOC 1IM2A 4F1IA 4LGYA 4OW0A 3I4YA 4W5WA 4DV5M 1EFUB 1D0KA 2R4JA 2ZANA 4IBDA 1J7KA 2RKOA 3B89A 1NV8A 1XNRM 1XHBA 2DAKA 1G71A 1TH2A 2KW0A 4II7A 3SHGB 4GHLA 1G8PA 1R4GA 2KRUA 1SXJC 1IFYA 4G6ZA 1IN5A 2DAGA 1Q3BA 3U61A 3A42A 1N36M 4JI0M 3UJNA 4KO8A 5DYIA 4KT0F 3U6EA 3KDSE 1TH4A 3T1YM 2R65A 3B74A 3SMPA 1EIJA 3PVSA 1NNJA 2R45A 4X66M 5LMUM 5FTKA 3SAVA 3GPXA 5F3WA 4AI6A 1WGNA 4P16A 4GRIA 1I4WA 4BB9A 2J7OA 3HHYA 1PJQA 2KNZA 1N33M 1JB0F 4GKKM 4FW9A 2QNJA 1PGYA 2DAMA 2KA6B 1NHGC 1XC8A 1VQ1A 4LRSA 4RNAA 2QZ4A 2VIIA 2OO9A 3HWSA 3HY5A 4FCTA 1IBMM 3HHXA 4BLCA 3CF6E 3J80S 1YE9A 4M0DA 3HX3A 3ZQJA 1MX0A 2O25A 3SBJA 1L2DA 4LF9M 3U61B 3GPYA 2UUBM 4Y28F 4D81A 2W82A 5JI3E 2N35A 4GH9A 1WIVA 4G4QA 2BWBA 4JXJA 4PDGA 2EKFA 3NWLA 2JWSA 2O5RA 1V34A 2KXEA 2I7PA 3Q8GA 2QSFX 3EIEA 2XSZD 2F5SA 1A5TA 4LJ4A 1VDLA 1NVMA 1IN7A 2DKLA 3J7BA 3KSJA 1Z5CA 4MM3B 1VG5A 3K9PA 5EP4A 4RF1A 5FTJA 2YFQA 1OAIA 1XWIA 1RU3A 4HEOA 3TWMA 4PCZA 2RGHA 3KXEC 4LF8M 2WSCF 4L16A 4G3OA 3PNVA 2OQ4A 2FFJA 3C3DA 2KRKA 3U6CA 3SAUA 2L6OA 1D0MA 2C96A 3SHFA 4LFCM 1NJFA 2Q2EB 1E32A 5EXPA 2QP9X 2Y21A 2R6FA 1HQYE 2UXCM 2R0IA 2HAKA 4DV4M 2OOAA 3DA1A 4WW0A 1L8QA 2DAEA 3MK6A 2K0BX 4L78A 3LQQA 2DNAA 3UMMA 4IBGA 2Z4SA 1R5LA 2XSZA 2O01F 2CEAA 1QAQA 3AOEA 3DZDA 4NRVA 2V1UA 4FCVA 1HT2E 2ZTDA 1UFZA 4F2LA 4QHSA 4DV0M 1UM8A 1ZMWA 2C5RA 1S3SA 1WHCA 1WR1B 1N75A 1GJTA 2DI0A 2QCUA 3QYBA 4L6V6 4M9XA 3FE3A 2R44A 1HR0M 4P17A 1ZQ9A 2UUCM 4PT5A 1L2CA 2FNAA 2EJSA 4DV1M 2CP8A 2BNKA 2C98A 2M60A 3D8BA 3QYEA 2L7IA 3PNYA 5FTLA 2JXNA 5FTMA 1IBLM 3J27B 4M9SA 2DENA 5JI2E 2ZAOA 3CTWB 3KFUG 1E94E 2ERCA 3HU2A 1Z5BA 3BOSA 4B08A 1OIPA 1QDTA 4PDIA 2K47A 3K9OA 4B7GA 2DVWB 3FUTA 1BVSA 4NOOB 3B7NA 5C1BA 1D2NA 2YR0A 2DHRA 3RGSA 3VK8A 2JP7A 2Z4RA 3AKZA 4JV5M 2DWZB 1N77A 2XLJA 3GQ5A 1VEJA 1OFHA 2GNOA 2DWLA 1IN8A 3K2LA 1XXHA 4IIWA 4B7HA 1PRBA 2EUCA 3SYKA 4GEWA 4QNMA 1LTMA 1CUKA 2MGWA 3HJQA 4JYAM 1OKSA 1FNNA 1T43A 4AW4A 1Z5AA 4AKHA 1PJJA 2HL7A 1VEKA 2LXEA 4IBFA 2APLA 1SG9A 3IG8A 3RFWA 4G4NA 4I8OA 4AQYM 1K3XA 5EP1A 1VDDA 1DGBA 2F4VM 2XFSA 4LFBM 3W67A 3GP1A 2OPFA 3AJIB 2CHGA 1V92A 3SATA 2LVQD 4JI7M 4DV2M 3U5ZA 2G5GX 4MGZE 3OTOM 4LGMA 1I94M 3SFZA 4EIWA 2L7HA 3U6QA 3MMPA 1T3TA 1ZMVA 5KPTA 3T1HM 4QOZC 2VQFM 4IBJA 1QDRA 4ITQA 1DGFA 2G3QA 3LMMA 3U60A 2HCBA 1E9RA 1TTEA 2KNAA 3E21A 2E5LM 2C9OA 1GVNA 4NSOB 1L2BA 2FE8A 5KPRA 2F5QA 1J5EM 4D80A 2R62A 1IN4A 3FTCA 2BWEA 3C9PA 3NBIA 5EXTA 4I4LA 3MJ5A 4MB7A 4DUYM 3M7GA 2JY7A 1AIPC 3RE8A 1NV9A 1JQJC 3VKGA 5C18A 1OFIA 3NBXX 2LTUA 2D7EA 3SARA 3KW6A 3KOYE 4YY3M 4OX9M 2RRUA 5IREB 1C7YA 3A98B 3CF2A 3HJSA 2DXIA 5ITYA 2HWJA 4MGIE 2WSFF 2L4FA 4QHTA 2K9DA 4L15A 3TPZA 5L8RF 1QUTA 3GO8A 3HU3A 1OTRA 4CISA 2JZ0A 3R9XB 3W0FA 3GQ4A 1Q02A 3U60B 4CJ6A 1Z6TA 2Y0QA 3L2AA 3U6LA 2AHMA 3WHKA 1QUSA 4LJAA 2LHGA 4LJ8A 1HNXM 3E46A 3JAMS 2GQFA 2R18A 4DV7M 1PJIA 4GHAA 4DR7M 2QHOB 5ITXA 1R2YA 4LF5M 4M0WA 4X65M 4JI1M 3KVWA 5FSWA 3CF0A 3L29A 3ZCBB 1WGLA 4HLQA 3HZJA 2HHHM 1G3IA 3VLFB 5EXXA 1NY6A 3HJ8A 3M6AA 5BPVA 4DR1M 2J5YA 3B7QA 4CGYB 4B3SM 2EA0A 1N34M 2XFTA 4R7GA 2L2DA 1XXHE 1IN6A 3U6OA 1KYIA 1TF0B 5E26A 4NXNM 2LVPC 2ZTCA 3I4VA 4LCBA 4A3VB 3B9PA 4B3TM 4TUWA 3A45A 2XEPA 4JI3M 4NC6A 3W0LB 1GKIA 3FKEA 3KP0E 4I5SA 2UUAM 2XGNA 3A46A 2JUJA 2Y20A 5DFLA 1V33A 1YLAA 4G4OA 1WJ7A 3FTFA 3C58A 1TGUA 4OVZA 1JR3E 5GKNA 1GO5A 4CHTB 3L28A 2JNHA 1SXJE 3KOZE 4XGIA 3ZC7B 3QAUA 1IY1A 2L4EA 3UZUA 1OIZA 3JR5A 3GLGE 1G41A 1GJSA 4FD2A 3THGA 1IXSA 3FTDA 1DV0A 3LW5F 3RGPA 4AG6A 2DWNA 2F5OA 2LWXA 3AOEC 3T15A 3D8LA 2QPAA 2KNVA 1JR3D 1HT1E 3I01M 3LQRA 3WHLA 1FJGM 3LVVA 4MH0E 1SXJD 2DAIA 5EJCA 3KP1E 3TE6A 1Q39A 4MGHA 3VDPA 3FUXA 1QYRA 3GRVA 2YQZA 4KODA 2XF3A 1Y8GA 4WP2A 3TWKA 3KSXA 2HKJA 2VF8A 3AV0A 2MJ5B 4IBEA 4NSRA 1R2ZA 4AKIA 1IY2A 4IBBA 1IXRC 3J2PB 1NHWC 3JR4A 4M9ZA 4IJFA 2I7NA 1KFVA 2LNHC 3R8FA 2J7NA 1OQYA 3HHZA 4GIPA 4OVZB 4AZFA 2DZNB 1C1KA 5A2QS 1PJSA 2ZM6M 4JI4M 4NRWA 3SMSA 4LFAM 1MN3A 3DFZA 2BJVA 2C9CA 3F92A 1IXSB 1DO2A 2CUZA 4WURA 3U6SA 4D82A 5ITTA 2KZSA 4FCWA 2QENA 3VFDA 3H4MA 1TDZA 2FOIC 3BXWA 4AKGA 3FRHA 4FWDA 1X37A 2YNMD 4FWGA 1QQWA 3KS8A 1HJPA 1F4IA 2LVAA 2MR9A 1JR3A 3Q8XA 3UGJA 4QOSA 2LHCA 1XB2B 1OJLA 1SXJA 3QWLA 1ORYB 4CIZA 1NY5A 3KS4A 3GLHA 3W68A 3HKPA 2BJWA 4I81A 2Y0TA 3GLGA 4DUZM 3M0EA 2VDBB 5ITXE 4GKJM 2MROB 2B3TA 5FTNA 3VDUA 1HQCA 5IWAM 2Z3XA 1K3WA 2KZUA 4LF6M 1XXHB 4S12A 3GQ3A 1DGHA 1H6UA 3AFHA 4LZJA 5EP3A 1E9SA 1IY0A 1T6OA 5KPZA 5BR8M 5KQDA 4Z8XA 3U6DA 3C3EA 2LVNC 4DR6M 4DR3M 2C99A 3AOGA 2V1CA 3B7ZA 5ITRA 3HHWA 1TDHA 1P3QQ 3U6MA 5H37D 4AG5A 1GL7A 4LRTA 1L1ZA 3VKHA 3FUVA 3CGWA 4LJ5A 1J09A 1NJGA 1VEGA 3LCUA 3SC3A 5KO3A 4DV6M 1SXJB 5KQ8A 1W5TA 3I51A 3LCVB 3SAWA 2JZ1A 1N32M 3GLHB 3U5ZB 1WXQA 3EIHA 3GLGB 4LJ6A 3T6PA 3VK7A 4LF4M 3GLIA 3TWLA 3GRYA 4R3DA 1R7RA 4B3RM 5IT9S 2WSEF 1DGHB 4OU7A 2NQ8C 4B3MM 1OAOC 4YHHM 4B7FA 4REZA 2OOBA 1PM5A 1HNWM 1GL6A 3AL0C 1GLNA 1KSFX 2JY6B 3FTEA 4GC5A 4HL4A 1ZV1A 2G8LA 3IECA 2DZOB 1QAMA 3TL4X 4KLNA 1Q3CA 3K1JA 3E9SA 2CV2A 3DOAA 2LBCA 2RGOA 2XH9A 2FS1A 3GLFE 3GPUA 1GABA 1TR8A 4DBGB 2XZFA
chains in the Genus database with same CATH topology
4Z6YA 4GMQA 4JI5M 3PXGA 2EO2A 4L8RC 4KHPM 3TQSA 2CHQA 3GPPA 1EE8A 1R6BX 1YSYA 2DWMA 1N78A 4PD2A 4X62M 3GRUA 2CHVA 5EP2A 3GLIB 5EXSA 5IZ7D 1QAOA 2X8AA 3UK6A 4LJ7A 1YUBA 1IBKM 1HNZM 2H1RA 4JI2M 4LG2A 2CFOA 1DO0A 2F5PA 1Z59A 3IG5A 1IQPA 3SYLA 4DR5M 4MGKE 3PFIA 2ZAMA 5LMNM 3T38A 4G4RA 1QVRA 1G59A 2QBYA 3FD9A 1NNUC 4IJEA 3KOWE 3ZH9B 2V6ZM 2CV1A 2CV0A 4LZZA 5DNYA 1LV7A 1TH3A 3MHVC 1ZAEA 3FYDA 4IBKA 4JI6M 4RF0A 1MU5A 1K82A 2R4EA 3GLFA 4DV3M 3HU1A 2UXDM 2A5YB 4ZPXA 3GRRA 1XNQM 1QZMA 4QNRA 2KEBA 4LJ9A 8CATA 3HGIA 1IXZA 3KOXE 3L26A 4FWHA 2P5TA 4FVMA 2X49A 2LH0A 5EQTA 1NSFA 2ZBKB 3L25A 3FYCA 2D7GA 2R46A 3ILKA 1XMQM 5E6JA 2UU9M 4IBCA 4L4UA 2D7HA 3K8ZA 7CATA 2UXBM 4JI8M 3FUUA 2QBYB 2XZUA 1W5SA 5DYGA 5ITUA 4XBOA 3L27A 4MGYE 3J81S 2VQEM 4X64M 4GC9A 4LF7M 1DGGA 3E4RA 4NXMM 3K92A 1L1TA 2L09A 3SASA 4GITA 4DR4M 2Z7JA 1G4AE 2F5NA 1QANA 3LVWA 5FLXS 5ITQA 3GLFB 3FUWA 2X4AA 4IBIA 4JN6A 4DR2M 1XMOM 2CE7A 2JA2A 4NL4H 4BBAA 2M5ZA 4LY6A 3U6PA 4K0KM 1IM2A 4LGYA 4OW0A 3I4YA 4W5WA 4DV5M 2R4JA 2ZANA 4IBDA 1J7KA 2RKOA 1XNRM 1XHBA 1TH2A 3SHGB 2KW0A 4II7A 4GHLA 1G8PA 2KRUA 1SXJC 4G6ZA 1IN5A 3U61A 1Q3BA 3A42A 1N36M 4JI0M 3UJNA 4KO8A 5DYIA 3U6EA 3T1YM 3KDSE 1TH4A 2R65A 3SMPA 3PVSA 1NNJA 2R45A 4X66M 5LMUM 5FTKA 3SAVA 3GPXA 5F3WA 4AI6A 4P16A 4GRIA 1I4WA 4BB9A 2J7OA 3HHYA 1N33M 4GKKM 4FW9A 2KA6B 1NHGC 1XC8A 4LRSA 4RNAA 2QZ4A 2VIIA 3HWSA 4FCTA 1IBMM 3HHXA 4BLCA 3CF6E 3J80S 1YE9A 4M0DA 3SBJA 1MX0A 1L2DA 4LF9M 3U61B 3GPYA 2UUBM 4D81A 2W82A 5JI3E 4GH9A 4G4QA 4JXJA 4PDGA 3NWLA 2O5RA 2KXEA 2I7PA 3EIEA 2XSZD 2F5SA 4LJ4A 1NVMA 1IN7A 3J7BA 3KSJA 1Z5CA 4MM3B 5EP4A 4RF1A 5FTJA 2YFQA 1XWIA 3TWMA 4PCZA 2RGHA 3KXEC 4LF8M 4L16A 3PNVA 2OQ4A 2FFJA 3SAUA 2KRKA 3U6CA 2L6OA 2C96A 3SHFA 4LFCM 1NJFA 2Q2EB 1E32A 5EXPA 2QP9X 2Y21A 1HQYE 2UXCM 4DV4M 3DA1A 4WW0A 1L8QA 3MK6A 4L78A 3LQQA 3UMMA 4IBGA 2Z4SA 2XSZA 2CEAA 1QAQA 3AOEA 3DZDA 4NRVA 2V1UA 4FCVA 1HT2E 4DV0M 4QHSA 1UM8A 2C5RA 1S3SA 1N75A 2QCUA 1HR0M 4M9XA 1ZQ9A 2UUCM 4PT5A 1L2CA 2FNAA 4DV1M 2BNKA 2C98A 2M60A 3D8BA 2L7IA 3PNYA 5FTLA 5FTMA 1IBLM 3J27B 4M9SA 5JI2E 2ZAOA 3CTWB 3KFUG 1E94E 2ERCA 3HU2A 1Z5BA 3BOSA 4B08A 4PDIA 2K47A 4B7GA 2DVWB 3FUTA 4NOOB 5C1BA 3VK8A 1D2NA 2YR0A 2DHRA 3RGSA 2Z4RA 3AKZA 4JV5M 2DWZB 1N77A 2XLJA 3GQ5A 1OFHA 2DWLA 1IN8A 3K2LA 1XXHA 4IIWA 4B7HA 2EUCA 3SYKA 4QNMA 3HJQA 4JYAM 1FNNA 4AW4A 1Z5AA 4AKHA 1PJJA 2HL7A 2LXEA 4IBFA 3IG8A 3RFWA 4G4NA 4I8OA 4AQYM 1K3XA 5EP1A 1VDDA 1DGBA 2F4VM 2XFSA 4LFBM 3GP1A 2OPFA 3AJIB 2CHGA 3SATA 4JI7M 4DV2M 3U5ZA 2G5GX 4MGZE 3OTOM 4LGMA 1I94M 3SFZA 4EIWA 2L7HA 3U6QA 1T3TA 5KPTA 3T1HM 4QOZC 2VQFM 4IBJA 4ITQA 1DGFA 3LMMA 3U60A 2HCBA 1E9RA 2E5LM 2C9OA 1GVNA 4NSOB 1L2BA 2FE8A 5KPRA 2F5QA 1J5EM 4D80A 2R62A 1IN4A 3FTCA 3NBIA 5EXTA 4I4LA 3MJ5A 4MB7A 4DUYM 3M7GA 3RE8A 1JQJC 3VKGA 5C18A 1OFIA 2D7EA 3SARA 3KW6A 3KOYE 4YY3M 4OX9M 5IREB 3A98B 3CF2A 3HJSA 2DXIA 5ITYA 4MGIE 4QHTA 4L15A 3TPZA 3GO8A 3HU3A 4CISA 3R9XB 3W0FA 3GQ4A 3U60B 1Z6TA 2Y0QA 3L2AA 3U6LA 2AHMA 3WHKA 4LJAA 4LJ8A 1HNXM 3JAMS 2R18A 4DV7M 1PJIA 4GHAA 4DR7M 5ITXA 1R2YA 4LF5M 4M0WA 4X65M 4JI1M 3KVWA 5FSWA 3CF0A 3L29A 3ZCBB 4HLQA 2HHHM 1G3IA 3VLFB 5EXXA 1NY6A 3HJ8A 3M6AA 5BPVA 4DR1M 4CGYB 4B3SM 2EA0A 1N34M 2XFTA 4R7GA 1IN6A 3U6OA 1KYIA 5E26A 4NXNM 3I4VA 4LCBA 4A3VB 3B9PA 4B3TM 4TUWA 3A45A 2XEPA 4JI3M 3W0LB 1GKIA 3FKEA 3KP0E 4I5SA 2UUAM 2XGNA 3A46A 2Y20A 4G4OA 3FTFA 3C58A 1TGUA 4OVZA 5GKNA 4CHTB 3L28A 1SXJE 3KOZE 4XGIA 3ZC7B 3QAUA 1IY1A 3UZUA 3JR5A 1G41A 4FD2A 3THGA 3FTDA 3RGPA 4AG6A 2DWNA 2F5OA 2LWXA 3AOEC 3T15A 3D8LA 2QPAA 1JR3D 1HT1E 3LQRA 3WHLA 1FJGM 3LVVA 4MH0E 1SXJD 5EJCA 3TE6A 3KP1E 3VDPA 1Q39A 4MGHA 3FUXA 1QYRA 3GRVA 2YQZA 4KODA 2XF3A 3TWKA 3KSXA 2HKJA 3AV0A 4IBEA 4NSRA 1R2ZA 4AKIA 1IY2A 4IBBA 1IXRC 3J2PB 1NHWC 3JR4A 4M9ZA 4IJFA 2I7NA 1KFVA 2LNHC 3R8FA 2J7NA 3HHZA 4GIPA 4OVZB 4AZFA 2DZNB 1C1KA 5A2QS 2ZM6M 4JI4M 4NRWA 3SMSA 4LFAM 3DFZA 2BJVA 2C9CA 1IXSB 1DO2A 2CUZA 4WURA 3U6SA 4D82A 5ITTA 2KZSA 4FCWA 2QENA 3VFDA 3H4MA 1TDZA 2FOIC 4AKGA 4FWDA 1X37A 2YNMD 4FWGA 1QQWA 3KS8A 3Q8XA 1JR3A 3UGJA 4QOSA 1OJLA 1SXJA 3QWLA 1ORYB 3KS4A 1NY5A 3GLHA 3HKPA 2BJWA 4I81A 2Y0TA 3GLGA 4DUZM 3M0EA 4GKJM 5ITXE 5FTNA 3VDUA 2Z3XA 1HQCA 5IWAM 1K3WA 2KZUA 4LF6M 1XXHB 4S12A 3GQ3A 1DGHA 1H6UA 3AFHA 4LZJA 5EP3A 1E9SA 1IY0A 5KPZA 5BR8M 5KQDA 4Z8XA 3U6DA 4DR6M 4DR3M 2C99A 3AOGA 2V1CA 5ITRA 3HHWA 1TDHA 3U6MA 5H37D 4AG5A 1GL7A 4LRTA 1L1ZA 3VKHA 3FUVA 4LJ5A 1J09A 1NJGA 3SC3A 5KO3A 4DV6M 1SXJB 5KQ8A 1W5TA 3I51A 3SAWA 1N32M 3GLHB 3U5ZB 1WXQA 3EIHA 3GLGB 4LJ6A 3VK7A 4LF4M 3GLIA 3TWLA 3GRYA 4R3DA 1R7RA 4B3RM 5IT9S 4OU7A 1DGHB 2NQ8C 4B3MM 4YHHM 4B7FA 4REZA 1PM5A 1HNWM 1GL6A 3AL0C 1GLNA 1KSFX 3FTEA 4GC5A 4HL4A 2G8LA 2DZOB 1QAMA 3TL4X 4KLNA 1Q3CA 3K1JA 3E9SA 2CV2A 3DOAA 2XH9A 2RGOA 3GPUA 3J7AS 2XZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXG A;  1IY1 A;  1FNN A;  1G41 A;  4FD2 A;  2CHQ A;  1R6B X;  4FW9 A;  2CHV A;  2QPA A;  1JR3 D;  1HT1 E;  5EP2 A;  3GLI B;  5EP1 A;  3WHL A;  5EXS A;  1SXJ D;  4LRS A;  2X8A A;  2QZ4 A;  2VII A;  3UK6 A;  4KOD A;  4LJ7 A;  3HWS A;  4FCT A;  3AJI B;  2CHG A;  1DO0 A;  1IY2 A;  3U61 B;  1IXR C;  1IQP A;  3SYL A;  4LGM A;  3PFI A;  4EIW A;  2ZAM A;  4D81 A;  5JI3 E;  3R8F A;  1QVR A;  2DZN B;  1C1K A;  2QBY A;  2HCB A;  3EIE A;  2XSZ D;  2C9O A;  3ZH9 B;  2V6Z M;  4LJ4 A;  2BJV A;  2C9C A;  1NVM A;  1IN7 A;  4LZZ A;  4D80 A;  1IXS B;  1DO2 A;  1LV7 A;  2R62 A;  1IN4 A;  4D82 A;  5EXT A;  3MHV C;  4FCW A;  4I4L A;  5EP4 A;  2QEN A;  5FTJ A;  3VFD A;  3H4M A;  1XWI A;  4FWD A;  1X37 A;  4FWG A;  1JQJ C;  1JR3 A;  3GLF A;  3HU1 A;  1OFI A;  4QOS A;  5C18 A;  1OJL A;  4L16 A;  4ZPX A;  1SXJ A;  1QZM A;  3KW6 A;  4LJ9 A;  4QNR A;  1NY5 A;  1IXZ A;  2KRK A;  3GLH A;  4FWH A;  4I81 A;  2BJW A;  2C96 A;  3CF2 A;  3GLG A;  3M0E A;  5FTN A;  1HQC A;  5EQT A;  1NJF A;  4QHT A;  1NSF A;  4L15 A;  5EXP A;  1E32 A;  2QP9 X;  1XXH B;  4L4U A;  1HQY E;  3HU3 A;  4WW0 A;  5EP3 A;  1L8Q A;  2QBY B;  1IY0 A;  1W5S A;  5DYG A;  3U60 B;  4Z8X A;  3WHK A;  2Z4S A;  2XSZ A;  4LJA A;  2C99 A;  4LJ8 A;  2CEA A;  3DZD A;  2V1U A;  4FCV A;  1HT2 E;  4QHS A;  4GIT A;  1G4A E;  1UM8 A;  4LRT A;  1S3S A;  4LJ5 A;  3CF0 A;  1NJG A;  3GLF B;  3SC3 A;  1G3I A;  2FNA A;  4JN6 A;  1NY6 A;  1SXJ B;  1W5T A;  3M6A A;  5EXX A;  3VLF B;  2CE7 A;  3GLH B;  3U5Z B;  2C98 A;  3EIH A;  4LY6 A;  3GLG B;  3D8B A;  4LJ6 A;  5FTL A;  1IM2 A;  1IN6 A;  5FTM A;  1KYI A;  3GLI A;  5JI2 E;  1R7R A;  2ZAO A;  2ZAN A;  1E94 E;  4LCB A;  4A3V B;  1J7K A;  2RKO A;  3B9P A;  3HU2 A;  3BOS A;  3SYK A;  1SXJ C;  1IN5 A;  2DVW B;  5C1B A;  1D2N A;  1KSF X;  2DHR A;  2Z4R A;  2DWZ B;  2DZO B;  4KLN A;  4KO8 A;  3K1J A;  1OFH A;  5DYI A;  3KDS E;  1IN8 A;  2R65 A;  1XXH A;  3PVS A;  5FTK A;  4QNM A;  1SXJ E; 
#chains in the Genus database with same CATH topology
 4Z6Y A;  4GMQ A;  4JI5 M;  3PXG A;  2EO2 A;  4L8R C;  4KHP M;  2K6B A;  3TQS A;  2CHQ A;  3GPP A;  1EE8 A;  1NO1 A;  1R6B X;  1YSY A;  4RKU F;  4R71 A;  2DWM A;  1N78 A;  4PD2 A;  4X62 M;  3GRU A;  2VF7 A;  2CHV A;  2KHH A;  5EP2 A;  3GLI B;  5EXS A;  5IZ7 D;  1QAO A;  2X8A A;  3UK6 A;  4LJ7 A;  1YUB A;  1IBK M;  1HNZ M;  2EKK A;  2H1R A;  3I04 M;  4JI2 M;  2FH0 A;  4LG2 A;  2CFO A;  1DO0 A;  2F5P A;  1Z59 A;  3IG5 A;  1IQP A;  3SYL A;  4DR5 M;  1AUA A;  3PFI A;  4MGK E;  2ZAM A;  5LMN M;  3T38 A;  4G4R A;  1QVR A;  2JY8 A;  2JY5 A;  1G59 A;  2QBY A;  3FD9 A;  1NNU C;  1PJT A;  4IJE A;  1ZMU A;  3GLH E;  4UN2 B;  2H5X A;  3KOW E;  1D0L A;  2DZL A;  2V6Z M;  3ZH9 B;  2CV1 A;  2CV0 A;  4LZZ A;  5DNY A;  1LV7 A;  1TH3 A;  2Z8Y M;  3MHV C;  1ZAE A;  1MJG M;  3FYD A;  4IBK A;  4JI6 M;  4RF0 A;  1MU5 A;  1K82 A;  2R4E A;  3GLF A;  4DV3 M;  3HU1 A;  2UXD M;  2A5Y B;  4ZPX A;  3GRR A;  1XNQ M;  1QZM A;  4QNR A;  2KEB A;  4LJ9 A;  8CAT A;  3HGI A;  1IXZ A;  3KOX E;  3L26 A;  4FWH A;  2P5T A;  4FVM A;  2X49 A;  2LH0 A;  4Q7J A;  5EQT A;  4ANR A;  1NSF A;  2ZBK B;  3L25 A;  3FRI A;  2D7G A;  2R46 A;  3FYC A;  3ILK A;  5E6J A;  1XMQ M;  4IBC A;  4L4U A;  2D7H A;  2UU9 M;  3BBZ A;  3K8Z A;  7CAT A;  3J7A S;  4XK8 F;  2UXB M;  4JI8 M;  2KDL A;  3FUU A;  2QBY B;  2XZU A;  1W5S A;  5DYG A;  2WZJ A;  5ITU A;  4XBO A;  3L27 A;  4MGY E;  3J81 S;  2VQE M;  4X64 M;  4GC9 A;  4LF7 M;  1DGG A;  3GLI E;  2CRU A;  3E4R A;  2QQ8 A;  4NXM M;  3K92 A;  2DHY A;  1L1T A;  3H4J A;  2CWB A;  2MH8 A;  2L09 A;  3SAS A;  4GIT A;  1QZE A;  2Z7J A;  3IHP A;  4DR4 M;  1G4A E;  2F5N A;  1QAN A;  3LVW A;  5FLX S;  5ITQ A;  3GLF B;  3V76 A;  3FUW A;  2X4A A;  4IBI A;  4JN6 A;  4DR2 M;  1XMO M;  2CE7 A;  2JA2 A;  4NL4 H;  4BBA A;  2M5Z A;  4LY6 A;  3U6P A;  4K0K M;  2LVO C;  1IM2 A;  4F1I A;  4LGY A;  4OW0 A;  3I4Y A;  4W5W A;  4DV5 M;  1EFU B;  1D0K A;  2R4J A;  2ZAN A;  4IBD A;  1J7K A;  2RKO A;  3B89 A;  1NV8 A;  1XNR M;  1XHB A;  2DAK A;  1G71 A;  1TH2 A;  2KW0 A;  4II7 A;  3SHG B;  4GHL A;  1G8P A;  1R4G A;  2KRU A;  1SXJ C;  1IFY A;  4G6Z A;  1IN5 A;  2DAG A;  1Q3B A;  3U61 A;  3A42 A;  1N36 M;  4JI0 M;  3UJN A;  4KO8 A;  5DYI A;  4KT0 F;  3U6E A;  3KDS E;  1TH4 A;  3T1Y M;  2R65 A;  3B74 A;  3SMP A;  1EIJ A;  3PVS A;  1NNJ A;  2R45 A;  4X66 M;  5LMU M;  5FTK A;  3SAV A;  3GPX A;  5F3W A;  4AI6 A;  1WGN A;  4P16 A;  4GRI A;  1I4W A;  4BB9 A;  2J7O A;  3HHY A;  1PJQ A;  2KNZ A;  1N33 M;  1JB0 F;  4GKK M;  4FW9 A;  2QNJ A;  1PGY A;  2DAM A;  2KA6 B;  1NHG C;  1XC8 A;  1VQ1 A;  4LRS A;  4RNA A;  2QZ4 A;  2VII A;  2OO9 A;  3HWS A;  3HY5 A;  4FCT A;  1IBM M;  3HHX A;  4BLC A;  3CF6 E;  3J80 S;  1YE9 A;  4M0D A;  3HX3 A;  3ZQJ A;  1MX0 A;  2O25 A;  3SBJ A;  1L2D A;  4LF9 M;  3U61 B;  3GPY A;  2UUB M;  4Y28 F;  4D81 A;  2W82 A;  5JI3 E;  2N35 A;  4GH9 A;  1WIV A;  4G4Q A;  2BWB A;  4JXJ A;  4PDG A;  2EKF A;  3NWL A;  2JWS A;  2O5R A;  1V34 A;  2KXE A;  2I7P A;  3Q8G A;  2QSF X;  3EIE A;  2XSZ D;  2F5S A;  1A5T A;  4LJ4 A;  1VDL A;  1NVM A;  1IN7 A;  2DKL A;  3J7B A;  3KSJ A;  1Z5C A;  4MM3 B;  1VG5 A;  3K9P A;  5EP4 A;  4RF1 A;  5FTJ A;  2YFQ A;  1OAI A;  1XWI A;  1RU3 A;  4HEO A;  3TWM A;  4PCZ A;  2RGH A;  3KXE C;  4LF8 M;  2WSC F;  4L16 A;  4G3O A;  3PNV A;  2OQ4 A;  2FFJ A;  3C3D A;  2KRK A;  3U6C A;  3SAU A;  2L6O A;  1D0M A;  2C96 A;  3SHF A;  4LFC M;  1NJF A;  2Q2E B;  1E32 A;  5EXP A;  2QP9 X;  2Y21 A;  2R6F A;  1HQY E;  2UXC M;  2R0I A;  2HAK A;  4DV4 M;  2OOA A;  3DA1 A;  4WW0 A;  1L8Q A;  2DAE A;  3MK6 A;  2K0B X;  4L78 A;  3LQQ A;  2DNA A;  3UMM A;  4IBG A;  2Z4S A;  1R5L A;  2XSZ A;  2O01 F;  2CEA A;  1QAQ A;  3AOE A;  3DZD A;  4NRV A;  2V1U A;  4FCV A;  1HT2 E;  2ZTD A;  1UFZ A;  4F2L A;  4QHS A;  4DV0 M;  1UM8 A;  1ZMW A;  2C5R A;  1S3S A;  1WHC A;  1WR1 B;  1N75 A;  1GJT A;  2DI0 A;  2QCU A;  3QYB A;  4L6V 6;  4M9X A;  3FE3 A;  2R44 A;  1HR0 M;  4P17 A;  1ZQ9 A;  2UUC M;  4PT5 A;  1L2C A;  2FNA A;  2EJS A;  4DV1 M;  2CP8 A;  2BNK A;  2C98 A;  2M60 A;  3D8B A;  3QYE A;  2L7I A;  3PNY A;  5FTL A;  2JXN A;  5FTM A;  1IBL M;  3J27 B;  4M9S A;  2DEN A;  5JI2 E;  2ZAO A;  3CTW B;  3KFU G;  1E94 E;  2ERC A;  3HU2 A;  1Z5B A;  3BOS A;  4B08 A;  1OIP A;  1QDT A;  4PDI A;  2K47 A;  3K9O A;  4B7G A;  2DVW B;  3FUT A;  1BVS A;  4NOO B;  3B7N A;  5C1B A;  1D2N A;  2YR0 A;  2DHR A;  3RGS A;  3VK8 A;  2JP7 A;  2Z4R A;  3AKZ A;  4JV5 M;  2DWZ B;  1N77 A;  2XLJ A;  3GQ5 A;  1VEJ A;  1OFH A;  2GNO A;  2DWL A;  1IN8 A;  3K2L A;  1XXH A;  4IIW A;  4B7H A;  1PRB A;  2EUC A;  3SYK A;  4GEW A;  4QNM A;  1LTM A;  1CUK A;  2MGW A;  3HJQ A;  4JYA M;  1OKS A;  1FNN A;  1T43 A;  4AW4 A;  1Z5A A;  4AKH A;  1PJJ A;  2HL7 A;  1VEK A;  2LXE A;  4IBF A;  2APL A;  1SG9 A;  3IG8 A;  3RFW A;  4G4N A;  4I8O A;  4AQY M;  1K3X A;  5EP1 A;  1VDD A;  1DGB A;  2F4V M;  2XFS A;  4LFB M;  3W67 A;  3GP1 A;  2OPF A;  3AJI B;  2CHG A;  1V92 A;  3SAT A;  2LVQ D;  4JI7 M;  4DV2 M;  3U5Z A;  2G5G X;  4MGZ E;  3OTO M;  4LGM A;  1I94 M;  3SFZ A;  4EIW A;  2L7H A;  3U6Q A;  3MMP A;  1T3T A;  1ZMV A;  5KPT A;  3T1H M;  4QOZ C;  2VQF M;  4IBJ A;  1QDR A;  4ITQ A;  1DGF A;  2G3Q A;  3LMM A;  3U60 A;  2HCB A;  1E9R A;  1TTE A;  2KNA A;  3E21 A;  2E5L M;  2C9O A;  1GVN A;  4NSO B;  1L2B A;  2FE8 A;  5KPR A;  2F5Q A;  1J5E M;  4D80 A;  2R62 A;  1IN4 A;  3FTC A;  2BWE A;  3C9P A;  3NBI A;  5EXT A;  4I4L A;  3MJ5 A;  4MB7 A;  4DUY M;  3M7G A;  2JY7 A;  1AIP C;  3RE8 A;  1NV9 A;  1JQJ C;  3VKG A;  5C18 A;  1OFI A;  3NBX X;  2LTU A;  2D7E A;  3SAR A;  3KW6 A;  3KOY E;  4YY3 M;  4OX9 M;  2RRU A;  5IRE B;  1C7Y A;  3A98 B;  3CF2 A;  3HJS A;  2DXI A;  5ITY A;  2HWJ A;  4MGI E;  2WSF F;  2L4F A;  4QHT A;  2K9D A;  4L15 A;  3TPZ A;  5L8R F;  1QUT A;  3GO8 A;  3HU3 A;  1OTR A;  4CIS A;  2JZ0 A;  3R9X B;  3W0F A;  3GQ4 A;  1Q02 A;  3U60 B;  4CJ6 A;  1Z6T A;  2Y0Q A;  3L2A A;  3U6L A;  2AHM A;  3WHK A;  1QUS A;  4LJA A;  2LHG A;  4LJ8 A;  1HNX M;  3E46 A;  3JAM S;  2GQF A;  2R18 A;  4DV7 M;  1PJI A;  4GHA A;  4DR7 M;  2QHO B;  5ITX A;  1R2Y A;  4LF5 M;  4M0W A;  4X65 M;  4JI1 M;  3KVW A;  5FSW A;  3CF0 A;  3L29 A;  3ZCB B;  1WGL A;  4HLQ A;  3HZJ A;  2HHH M;  1G3I A;  3VLF B;  5EXX A;  1NY6 A;  3HJ8 A;  3M6A A;  5BPV A;  4DR1 M;  2J5Y A;  3B7Q A;  4CGY B;  4B3S M;  2EA0 A;  1N34 M;  2XFT A;  4R7G A;  2L2D A;  1XXH E;  1IN6 A;  3U6O A;  1KYI A;  1TF0 B;  5E26 A;  4NXN M;  2LVP C;  2ZTC A;  3I4V A;  4LCB A;  4A3V B;  3B9P A;  4B3T M;  4TUW A;  3A45 A;  2XEP A;  4JI3 M;  4NC6 A;  3W0L B;  1GKI A;  3FKE A;  3KP0 E;  4I5S A;  2UUA M;  2XGN A;  3A46 A;  2JUJ A;  2Y20 A;  5DFL A;  1V33 A;  1YLA A;  4G4O A;  1WJ7 A;  3FTF A;  3C58 A;  1TGU A;  4OVZ A;  1JR3 E;  5GKN A;  1GO5 A;  4CHT B;  3L28 A;  2JNH A;  1SXJ E;  3KOZ E;  4XGI A;  3ZC7 B;  3QAU A;  1IY1 A;  2L4E A;  3UZU A;  1OIZ A;  3JR5 A;  3GLG E;  1G41 A;  1GJS A;  4FD2 A;  3THG A;  1IXS A;  3FTD A;  1DV0 A;  3LW5 F;  3RGP A;  4AG6 A;  2DWN A;  2F5O A;  2LWX A;  3AOE C;  3T15 A;  3D8L A;  2QPA A;  2KNV A;  1JR3 D;  1HT1 E;  3I01 M;  3LQR A;  3WHL A;  1FJG M;  3LVV A;  4MH0 E;  1SXJ D;  2DAI A;  5EJC A;  3KP1 E;  3TE6 A;  1Q39 A;  4MGH A;  3VDP A;  3FUX A;  1QYR A;  3GRV A;  2YQZ A;  4KOD A;  2XF3 A;  1Y8G A;  4WP2 A;  3TWK A;  3KSX A;  2HKJ A;  2VF8 A;  3AV0 A;  2MJ5 B;  4IBE A;  4NSR A;  1R2Z A;  4AKI A;  1IY2 A;  4IBB A;  1IXR C;  3J2P B;  1NHW C;  3JR4 A;  4M9Z A;  4IJF A;  2I7N A;  1KFV A;  2LNH C;  3R8F A;  2J7N A;  1OQY A;  3HHZ A;  4GIP A;  4OVZ B;  4AZF A;  2DZN B;  1C1K A;  5A2Q S;  1PJS A;  2ZM6 M;  4JI4 M;  4NRW A;  3SMS A;  4LFA M;  1MN3 A;  3DFZ A;  2BJV A;  2C9C A;  3F92 A;  1IXS B;  1DO2 A;  2CUZ A;  4WUR A;  3U6S A;  4D82 A;  5ITT A;  2KZS A;  4FCW A;  2QEN A;  3VFD A;  3H4M A;  1TDZ A;  2FOI C;  3BXW A;  4AKG A;  3FRH A;  4FWD A;  1X37 A;  2YNM D;  4FWG A;  1QQW A;  3KS8 A;  1HJP A;  1F4I A;  2LVA A;  2MR9 A;  1JR3 A;  3Q8X A;  3UGJ A;  4QOS A;  2LHC A;  1XB2 B;  1OJL A;  1SXJ A;  3QWL A;  1ORY B;  4CIZ A;  1NY5 A;  3KS4 A;  3GLH A;  3W68 A;  3HKP A;  2BJW A;  4I81 A;  2Y0T A;  3GLG A;  4DUZ M;  3M0E A;  2VDB B;  5ITX E;  4GKJ M;  2MRO B;  2B3T A;  5FTN A;  3VDU A;  1HQC A;  5IWA M;  2Z3X A;  1K3W A;  2KZU A;  4LF6 M;  1XXH B;  4S12 A;  3GQ3 A;  1DGH A;  1H6U A;  3AFH A;  4LZJ A;  5EP3 A;  1E9S A;  1IY0 A;  1T6O A;  5KPZ A;  5BR8 M;  5KQD A;  4Z8X A;  3U6D A;  3C3E A;  2LVN C;  4DR6 M;  4DR3 M;  2C99 A;  3AOG A;  2V1C A;  3B7Z A;  5ITR A;  3HHW A;  1TDH A;  1P3Q Q;  3U6M A;  5H37 D;  4AG5 A;  1GL7 A;  4LRT A;  1L1Z A;  3VKH A;  3FUV A;  3CGW A;  4LJ5 A;  1J09 A;  1NJG A;  1VEG A;  3LCU A;  3SC3 A;  5KO3 A;  4DV6 M;  1SXJ B;  5KQ8 A;  1W5T A;  3I51 A;  3LCV B;  3SAW A;  2JZ1 A;  1N32 M;  3GLH B;  3U5Z B;  1WXQ A;  3EIH A;  3GLG B;  4LJ6 A;  3T6P A;  3VK7 A;  4LF4 M;  3GLI A;  3TWL A;  3GRY A;  4R3D A;  1R7R A;  4B3R M;  5IT9 S;  2WSE F;  1DGH B;  4OU7 A;  2NQ8 C;  4B3M M;  1OAO C;  4YHH M;  4B7F A;  4REZ A;  2OOB A;  1PM5 A;  1HNW M;  1GL6 A;  3AL0 C;  1GLN A;  1KSF X;  2JY6 B;  3FTE A;  4GC5 A;  4HL4 A;  1ZV1 A;  2G8L A;  3IEC A;  2DZO B;  1QAM A;  3TL4 X;  4KLN A;  1Q3C A;  3K1J A;  3E9S A;  2CV2 A;  3DOA A;  2LBC A;  2RGO A;  2XH9 A;  2FS1 A;  3GLF E;  3GPU A;  1GAB A;  1TR8 A;  4DBG B;  2XZF A; 
#chains in the Genus database with same CATH homology
 4Z6Y A;  4GMQ A;  4JI5 M;  3PXG A;  2EO2 A;  4L8R C;  4KHP M;  3TQS A;  2CHQ A;  3GPP A;  1EE8 A;  1R6B X;  1YSY A;  2DWM A;  1N78 A;  4PD2 A;  4X62 M;  3GRU A;  2CHV A;  5EP2 A;  3GLI B;  5EXS A;  5IZ7 D;  1QAO A;  2X8A A;  3UK6 A;  4LJ7 A;  1YUB A;  1IBK M;  1HNZ M;  2H1R A;  4JI2 M;  4LG2 A;  2CFO A;  1DO0 A;  2F5P A;  1Z59 A;  3IG5 A;  1IQP A;  3SYL A;  4DR5 M;  4MGK E;  3PFI A;  2ZAM A;  5LMN M;  3T38 A;  4G4R A;  1QVR A;  1G59 A;  2QBY A;  3FD9 A;  1NNU C;  4IJE A;  3KOW E;  3ZH9 B;  2V6Z M;  2CV1 A;  2CV0 A;  4LZZ A;  5DNY A;  1LV7 A;  1TH3 A;  3MHV C;  1ZAE A;  3FYD A;  4IBK A;  4JI6 M;  4RF0 A;  1MU5 A;  1K82 A;  2R4E A;  3GLF A;  4DV3 M;  3HU1 A;  2UXD M;  2A5Y B;  4ZPX A;  3GRR A;  1XNQ M;  1QZM A;  4QNR A;  2KEB A;  4LJ9 A;  8CAT A;  3HGI A;  1IXZ A;  3KOX E;  3L26 A;  4FWH A;  2P5T A;  4FVM A;  2X49 A;  2LH0 A;  5EQT A;  1NSF A;  2ZBK B;  3L25 A;  3FYC A;  2D7G A;  2R46 A;  3ILK A;  1XMQ M;  5E6J A;  2UU9 M;  4IBC A;  4L4U A;  2D7H A;  3K8Z A;  7CAT A;  2UXB M;  4JI8 M;  3FUU A;  2QBY B;  2XZU A;  1W5S A;  5DYG A;  5ITU A;  4XBO A;  3L27 A;  4MGY E;  3J81 S;  2VQE M;  4X64 M;  4GC9 A;  4LF7 M;  1DGG A;  3E4R A;  4NXM M;  3K92 A;  1L1T A;  2L09 A;  3SAS A;  4GIT A;  4DR4 M;  2Z7J A;  1G4A E;  2F5N A;  1QAN A;  3LVW A;  5FLX S;  5ITQ A;  3GLF B;  3FUW A;  2X4A A;  4IBI A;  4JN6 A;  4DR2 M;  1XMO M;  2CE7 A;  2JA2 A;  4NL4 H;  4BBA A;  2M5Z A;  4LY6 A;  3U6P A;  4K0K M;  1IM2 A;  4LGY A;  4OW0 A;  3I4Y A;  4W5W A;  4DV5 M;  2R4J A;  2ZAN A;  4IBD A;  1J7K A;  2RKO A;  1XNR M;  1XHB A;  1TH2 A;  3SHG B;  2KW0 A;  4II7 A;  4GHL A;  1G8P A;  2KRU A;  1SXJ C;  4G6Z A;  1IN5 A;  3U61 A;  1Q3B A;  3A42 A;  1N36 M;  4JI0 M;  3UJN A;  4KO8 A;  5DYI A;  3U6E A;  3T1Y M;  3KDS E;  1TH4 A;  2R65 A;  3SMP A;  3PVS A;  1NNJ A;  2R45 A;  4X66 M;  5LMU M;  5FTK A;  3SAV A;  3GPX A;  5F3W A;  4AI6 A;  4P16 A;  4GRI A;  1I4W A;  4BB9 A;  2J7O A;  3HHY A;  1N33 M;  4GKK M;  4FW9 A;  2KA6 B;  1NHG C;  1XC8 A;  4LRS A;  4RNA A;  2QZ4 A;  2VII A;  3HWS A;  4FCT A;  1IBM M;  3HHX A;  4BLC A;  3CF6 E;  3J80 S;  1YE9 A;  4M0D A;  3SBJ A;  1MX0 A;  1L2D A;  4LF9 M;  3U61 B;  3GPY A;  2UUB M;  4D81 A;  2W82 A;  5JI3 E;  4GH9 A;  4G4Q A;  4JXJ A;  4PDG A;  3NWL A;  2O5R A;  2KXE A;  2I7P A;  3EIE A;  2XSZ D;  2F5S A;  4LJ4 A;  1NVM A;  1IN7 A;  3J7B A;  3KSJ A;  1Z5C A;  4MM3 B;  5EP4 A;  4RF1 A;  5FTJ A;  2YFQ A;  1XWI A;  3TWM A;  4PCZ A;  2RGH A;  3KXE C;  4LF8 M;  4L16 A;  3PNV A;  2OQ4 A;  2FFJ A;  3SAU A;  2KRK A;  3U6C A;  2L6O A;  2C96 A;  3SHF A;  4LFC M;  1NJF A;  2Q2E B;  1E32 A;  5EXP A;  2QP9 X;  2Y21 A;  1HQY E;  2UXC M;  4DV4 M;  3DA1 A;  4WW0 A;  1L8Q A;  3MK6 A;  4L78 A;  3LQQ A;  3UMM A;  4IBG A;  2Z4S A;  2XSZ A;  2CEA A;  1QAQ A;  3AOE A;  3DZD A;  4NRV A;  2V1U A;  4FCV A;  1HT2 E;  4DV0 M;  4QHS A;  1UM8 A;  2C5R A;  1S3S A;  1N75 A;  2QCU A;  1HR0 M;  4M9X A;  1ZQ9 A;  2UUC M;  4PT5 A;  1L2C A;  2FNA A;  4DV1 M;  2BNK A;  2C98 A;  2M60 A;  3D8B A;  2L7I A;  3PNY A;  5FTL A;  5FTM A;  1IBL M;  3J27 B;  4M9S A;  5JI2 E;  2ZAO A;  3CTW B;  3KFU G;  1E94 E;  2ERC A;  3HU2 A;  1Z5B A;  3BOS A;  4B08 A;  4PDI A;  2K47 A;  4B7G A;  2DVW B;  3FUT A;  4NOO B;  5C1B A;  3VK8 A;  1D2N A;  2YR0 A;  2DHR A;  3RGS A;  2Z4R A;  3AKZ A;  4JV5 M;  2DWZ B;  1N77 A;  2XLJ A;  3GQ5 A;  1OFH A;  2DWL A;  1IN8 A;  3K2L A;  1XXH A;  4IIW A;  4B7H A;  2EUC A;  3SYK A;  4QNM A;  3HJQ A;  4JYA M;  1FNN A;  4AW4 A;  1Z5A A;  4AKH A;  1PJJ A;  2HL7 A;  2LXE A;  4IBF A;  3IG8 A;  3RFW A;  4G4N A;  4I8O A;  4AQY M;  1K3X A;  5EP1 A;  1VDD A;  1DGB A;  2F4V M;  2XFS A;  4LFB M;  3GP1 A;  2OPF A;  3AJI B;  2CHG A;  3SAT A;  4JI7 M;  4DV2 M;  3U5Z A;  2G5G X;  4MGZ E;  3OTO M;  4LGM A;  1I94 M;  3SFZ A;  4EIW A;  2L7H A;  3U6Q A;  1T3T A;  5KPT A;  3T1H M;  4QOZ C;  2VQF M;  4IBJ A;  4ITQ A;  1DGF A;  3LMM A;  3U60 A;  2HCB A;  1E9R A;  2E5L M;  2C9O A;  1GVN A;  4NSO B;  1L2B A;  2FE8 A;  5KPR A;  2F5Q A;  1J5E M;  4D80 A;  2R62 A;  1IN4 A;  3FTC A;  3NBI A;  5EXT A;  4I4L A;  3MJ5 A;  4MB7 A;  4DUY M;  3M7G A;  3RE8 A;  1JQJ C;  3VKG A;  5C18 A;  1OFI A;  2D7E A;  3SAR A;  3KW6 A;  3KOY E;  4YY3 M;  4OX9 M;  5IRE B;  3A98 B;  3CF2 A;  3HJS A;  2DXI A;  5ITY A;  4MGI E;  4QHT A;  4L15 A;  3TPZ A;  3GO8 A;  3HU3 A;  4CIS A;  3R9X B;  3W0F A;  3GQ4 A;  3U60 B;  1Z6T A;  2Y0Q A;  3L2A A;  3U6L A;  2AHM A;  3WHK A;  4LJA A;  4LJ8 A;  1HNX M;  3JAM S;  2R18 A;  4DV7 M;  1PJI A;  4GHA A;  4DR7 M;  5ITX A;  1R2Y A;  4LF5 M;  4M0W A;  4X65 M;  4JI1 M;  3KVW A;  5FSW A;  3CF0 A;  3L29 A;  3ZCB B;  4HLQ A;  2HHH M;  1G3I A;  3VLF B;  5EXX A;  1NY6 A;  3HJ8 A;  3M6A A;  5BPV A;  4DR1 M;  4CGY B;  4B3S M;  2EA0 A;  1N34 M;  2XFT A;  4R7G A;  1IN6 A;  3U6O A;  1KYI A;  5E26 A;  4NXN M;  3I4V A;  4LCB A;  4A3V B;  3B9P A;  4B3T M;  4TUW A;  3A45 A;  2XEP A;  4JI3 M;  3W0L B;  1GKI A;  3FKE A;  3KP0 E;  4I5S A;  2UUA M;  2XGN A;  3A46 A;  2Y20 A;  4G4O A;  3FTF A;  3C58 A;  1TGU A;  4OVZ A;  5GKN A;  4CHT B;  3L28 A;  1SXJ E;  3KOZ E;  4XGI A;  3ZC7 B;  3QAU A;  1IY1 A;  3UZU A;  3JR5 A;  1G41 A;  4FD2 A;  3THG A;  3FTD A;  3RGP A;  4AG6 A;  2DWN A;  2F5O A;  2LWX A;  3AOE C;  3T15 A;  3D8L A;  2QPA A;  1JR3 D;  1HT1 E;  3LQR A;  3WHL A;  1FJG M;  3LVV A;  4MH0 E;  1SXJ D;  5EJC A;  3TE6 A;  3KP1 E;  3VDP A;  1Q39 A;  4MGH A;  3FUX A;  1QYR A;  3GRV A;  2YQZ A;  4KOD A;  2XF3 A;  3TWK A;  3KSX A;  2HKJ A;  3AV0 A;  4IBE A;  4NSR A;  1R2Z A;  4AKI A;  1IY2 A;  4IBB A;  1IXR C;  3J2P B;  1NHW C;  3JR4 A;  4M9Z A;  4IJF A;  2I7N A;  1KFV A;  2LNH C;  3R8F A;  2J7N A;  3HHZ A;  4GIP A;  4OVZ B;  4AZF A;  2DZN B;  1C1K A;  5A2Q S;  2ZM6 M;  4JI4 M;  4NRW A;  3SMS A;  4LFA M;  3DFZ A;  2BJV A;  2C9C A;  1IXS B;  1DO2 A;  2CUZ A;  4WUR A;  3U6S A;  4D82 A;  5ITT A;  2KZS A;  4FCW A;  2QEN A;  3VFD A;  3H4M A;  1TDZ A;  2FOI C;  4AKG A;  4FWD A;  1X37 A;  2YNM D;  4FWG A;  1QQW A;  3KS8 A;  3Q8X A;  1JR3 A;  3UGJ A;  4QOS A;  1OJL A;  1SXJ A;  3QWL A;  1ORY B;  3KS4 A;  1NY5 A;  3GLH A;  3HKP A;  2BJW A;  4I81 A;  2Y0T A;  3GLG A;  4DUZ M;  3M0E A;  4GKJ M;  5ITX E;  5FTN A;  3VDU A;  2Z3X A;  1HQC A;  5IWA M;  1K3W A;  2KZU A;  4LF6 M;  1XXH B;  4S12 A;  3GQ3 A;  1DGH A;  1H6U A;  3AFH A;  4LZJ A;  5EP3 A;  1E9S A;  1IY0 A;  5KPZ A;  5BR8 M;  5KQD A;  4Z8X A;  3U6D A;  4DR6 M;  4DR3 M;  2C99 A;  3AOG A;  2V1C A;  5ITR A;  3HHW A;  1TDH A;  3U6M A;  5H37 D;  4AG5 A;  1GL7 A;  4LRT A;  1L1Z A;  3VKH A;  3FUV A;  4LJ5 A;  1J09 A;  1NJG A;  3SC3 A;  5KO3 A;  4DV6 M;  1SXJ B;  5KQ8 A;  1W5T A;  3I51 A;  3SAW A;  1N32 M;  3GLH B;  3U5Z B;  1WXQ A;  3EIH A;  3GLG B;  4LJ6 A;  3VK7 A;  4LF4 M;  3GLI A;  3TWL A;  3GRY A;  4R3D A;  1R7R A;  4B3R M;  5IT9 S;  4OU7 A;  1DGH B;  2NQ8 C;  4B3M M;  4YHH M;  4B7F A;  4REZ A;  1PM5 A;  1HNW M;  1GL6 A;  3AL0 C;  1GLN A;  1KSF X;  3FTE A;  4GC5 A;  4HL4 A;  2G8L A;  2DZO B;  1QAM A;  3TL4 X;  4KLN A;  1Q3C A;  3K1J A;  3E9S A;  2CV2 A;  3DOA A;  2XH9 A;  2RGO A;  3GPU A;  3J7A S;  2XZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...