4GITA

Crystal structure of alpha sub-domain of lon protease from brevibacillus thermoruber
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
GYTELEKLHIMRDYLLPKQMEEHGLGRDKLQMNEEAMLKVIRQYTREAGVRNLNREAANICRKAARLIVSGEKKRVVVTPKTVESLLGKPRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for DNA-mediated allosteric regulation facilitated by the AAA(+) module of Lon protease.
pubmed doi rcsb
source organism Brevibacillus thermoruber
molecule tags Hydrolase
molecule keywords Lon protease
total genus 33
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2012-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gitA00
1E32A 3EIHA 3PVSA 1SXJB 4LJ9A 5EP1A 3GLGB 1IN8A 2C96A 2BJWA 2CHGA 2DZOB 1OFHA 1KYIA 2KRKA 4LJ6A 3H4MA 1R6BX 1NY5A 3HU3A 4GITA 3M6AA 1C1KA 1J7KA 1QZMA 1IXRC 1UM8A 4LRSA 4LGMA 2C9OA 4KO8A 4KODA 2X8AA 1S3SA 2BJVA 1IY1A 5EP2A 4EIWA 2V1UA 1G4AE 4D82A 2XSZD 1D2NA 3R8FA 4LJ8A 1L8QA 4LJAA 1DO0A 2QP9X 2VIIA 1OFIA 2QPAA 1IQPA 3U61B 3GLHA 5FTMA 1IN4A 2ZAMA 3AJIB 4QHSA 4ZPXA 3SYKA 1IM2A 3D8BA 4LRTA 4JN6A 1FNNA 3WHLA 3K1JA 1SXJC 1IY2A 5FTKA 1HQYE 5FTNA 3U5ZB 2XSZA 1JQJC 5C18A 4FWHA 1R7RA 3GLFA 4LCBA 2QENA 3B9PA 2FNAA 3HU1A 2Z4SA 3GLFB 2DZNB 2CE7A 2HCBA 4Z8XA 5EXPA 3SC3A 3HWSA 4LJ7A 1IN6A 4QNRA 3GLGA 4LZZA 3VFDA 4LJ5A 2DVWB 4L15A 4L4UA 5EXTA 3GLHB 4QOSA 5EP3A 1IY0A 1SXJE 1IN5A 3DZDA 2ZAOA 1LV7A 4L16A 3CF0A 2DWZB 1IXSB 4I81A 2CHQA 3EIEA 1E94E 2R65A 1NSFA 1XWIA 5EXXA 5FTJA 1HT1E 1XXHA 2QZ4A 5DYGA 3GLIA 5JI3E 2QBYA 5EP4A 2CEAA 3GLIB 1JR3D 2RKOA 5C1BA 2ZANA 4FD2A 2Z4RA 1OJLA 1G41A 4KLNA 5JI2E 2DHRA 4FCWA 4LJ4A 4QHTA 5DYIA 1IXZA 1QVRA 5EXSA 4I4LA 1NY6A 2C98A 3HU2A 1DO2A 4FCTA 4QNMA 5EQTA 4FCVA 3PFIA 1NVMA 1SXJA 3KDSE 1KSFX 3ZH9B 2QBYB 4WW0A 1XXHB 1JR3A 2V6ZM 2C99A 3BOSA 3CF2A 4FW9A 4D80A 3U60B 3PXGA 1W5TA 1X37A 2R62A 3WHKA 4FWDA 3M0EA 2C9CA 3KW6A 4LY6A 4D81A 1NJGA 5FTLA 1IN7A 1G3IA 2CHVA 3UK6A 1HT2E 3VLFB 3MHVC 4A3VB 1SXJD 1NJFA 4FWGA 1HQCA 3SYLA 1W5SA
chains in the Genus database with same CATH superfamily
2OOAA 1TTEA 3V76A 1ZAEA 3OTOM 3TL4X 4B3RM 2FOIC 2YFQA 3TQSA 1PJTA 2UXDM 1NHWC 2JNHA 4DV4M 1IBKM 3KOYE 1OFHA 1KYIA 1V92A 2UXBM 3Q8XA 1E9SA 1OQYA 4MGYE 5ITXA 2O25A 3LCUA 1Q3CA 2OQ4A 2RGHA 4G6ZA 4LGMA 4KO8A 4DV2M 3AFHA 3KS8A 2R0IA 2BJVA 1IY1A 2B3TA 5EP2A 3GPUA 1G4AE 4D82A 3A45A 1EE8A 2XF3A 1L2BA 4LJ8A 2F5SA 3NWLA 1DO0A 1TH4A 4JV5M 2QPAA 3TWKA 1IQPA 3J80S 3GLHA 3SYKA 4ITQA 3L29A 2QCUA 2Y0TA 3D8BA 3FRHA 1HJPA 4Q7JA 1D0KA 1SXJC 2GNOA 5LMNM 2O5RA 4LZJA 3HJQA 5ITXE 4L8RC 3GLFE 3GLFA 4HLQA 3T1YM 4I8OA 3LMMA 1HNXM 4BB9A 4LFAM 1L2DA 5E6JA 1UFZA 3C9PA 3KFUG 3H4JA 4IBCA 2JY6B 3IECA 3SC3A 2UUBM 4LJ7A 5ITYA 2R18A 3GLHE 4L78A 4X65M 4NXNM 4I5SA 3BXWA 2KDLA 3HHZA 2UU9M 4AKHA 3SFZA 3K9PA 4L15A 4YY3M 2JZ1A 5EXTA 4AW4A 3VKGA 4QOSA 1QUSA 1J5EM 1WIVA 1IY0A 1DGHA 1IN5A 1ZV1A 2QNJA 5L8RF 3GPXA 2K9DA 2YNMD 2XFSA 3CF0A 4XK8F 2DWZB 4UN2B 4LFCM 1GL6A 5IT9S 1JR3E 1PJIA 2LVOC 4IBKA 1XC8A 2R65A 2P5TA 4LFBM 2YQZA 1NSFA 3UZUA 2R46A 2LHGA 1HT1E 2CP8A 2QZ4A 2QBYA 1A5TA 4IBEA 3JAMS 2W82A 3AL0C 1VDLA 5EP4A 4BBAA 2KW0A 2EA0A 5ITQA 2H1RA 4FD2A 1IBMM 2Z4RA 4M0WA 4B3MM 1MU5A 4X66M 3M7GA 3J27B 2DWMA 1QAQA 4FCWA 2JP7A 3IG8A 4QHTA 1TF0B 1IXZA 2F5NA 2JZ0A 1NHGC 2BWEA 5EXSA 4JI4M 2C98A 1VEGA 3RE8A 3B74A 3KOWE 3HU2A 1DO2A 3LQRA 4AI6A 4DR2M 2XZFA 2HHHM 2X4AA 4IBIA 3U6MA 4DR3M 3D8LA 1XHBA 2J7OA 1ORYB 2MGWA 3HHXA 1KFVA 2Z7JA 4S12A 4JI7M 1Z59A 4FVMA 5KQ8A 1DV0A 3PXGA 2HKJA 2L4EA 3PNVA 1TR8A 1IXSA 1PJQA 2YR0A 2Y20A 2WZJA 3FYCA 3KOZE 2OO9A 1NJGA 4IIWA 1G3IA 4LY6A 5IZ7D 4D81A 5FTLA 3VLFB 1TH2A 1MJGM 1R4GA 4IBBA 3SYLA 1W5SA 2KZSA 3M6AA 2ZTDA 1WHCA 2EJSA 3KOXE 3MJ5A 3UGJA 2CV1A 1QQWA 1YSYA 1GO5A 1Y8GA 3L25A 4DV6M 3LQQA 1P3QQ 4B7GA 5F3WA 2CHGA 2DZOB 3UMMA 2R45A 2L4FA 2XEPA 2VDBB 1Q3BA 3T6PA 2D7HA 4LJ6A 3H4MA 4Z6YA 2DNAA 4YHHM 3GLIE 5E26A 1TDZA 3FTEA 1K3WA 4JI1M 4LF7M 1QAOA 2VF7A 3J7BA 1V33A 1QZMA 4REZA 1IXRC 1WXQA 4IBJA 2LNHC 3LVWA 3HHYA 3W67A 3VDPA 2X8AA 4CGYB 2R4JA 2LH0A 4KT0F 4EIWA 1R2ZA 2J7NA 1PM5A 3FUVA 2XSZD 5A2QS 3VKHA 4DBGB 1L8QA 4GC9A 3U61A 2QP9X 2VIIA 2I7PA 2Y0QA 3U6PA 3E46A 1OAOC 4W5WA 5DFLA 2JWSA 5FTMA 4QOZC 1NNUC 4LRTA 3I01M 3K1JA 4K0KM 1BVSA 3U5ZB 2XSZA 1JQJC 1OAIA 2O01F 3AKZA 4NRWA 2HWJA 5C18A 1HNWM 4FWHA 4RKUF 1R7RA 4DR1M 2E5LM 1XNQM 4GH9A 4NOOB 1YUBA 2FNAA 3HU1A 2D7EA 4LF4M 2DZNB 3FTDA 4MGIE 2CE7A 2HCBA 4Z8XA 4HL4A 5EXPA 1T3TA 2DZLA 3AOEA 3A46A 1IN6A 2MR9A 4QNRA 7CATA 2CRUA 3BBZA 5FLXS 4DR6M 1VEKA 1Z5CA 3VFDA 3KP1E 4IJFA 1K82A 4X64M 4XBOA 2L6OA 1OTRA 3PNYA 3FRIA 5EP3A 1Z6TA 3AV0A 2XLJA 3DZDA 4IBDA 1HR0M 3GPPA 1PJJA 4IJEA 3GRYA 3ZQJA 4KHPM 3FUTA 2CUZA 2JY5A 4NSOB 3I51A 2CV0A 1XWIA 3I4VA 5FTJA 1GVNA 3GLIA 1G71A 1XXHA 2R6FA 1TDHA 4PDIA 2LVPC 3I04M 4NXMM 4P16A 2EKKA 2RKOA 2WSCF 2ZANA 4PT5A 1TGUA 2G8LA 2L2DA 3B7ZA 4LF9M 1OJLA 3CF6E 3B7NA 1L1TA 5JI2E 2DHRA 2V1CA 4MB7A 3W0LB 3FD9A 3CGWA 3GP1A 1F4IA 1DGHB 3JR4A 1NY6A 3TWMA 3GPYA 2ZBKB 4FCTA 1PRBA 1QDRA 5EQTA 1NNJA 1GL7A 3T15A 5KPZA 1KSFX 3ZH9B 2R44A 3UJNA 2LHCA 2LVAA 2QBYB 1LTMA 1NV9A 1R5LA 2V6ZM 3IG5A 3FUXA 2FE8A 4FW9A 4DV5M 4D80A 5KO3A 2I7NA 4MM3B 4DUYM 3U60B 4MGZE 2MJ5B 2M5ZA 4FWDA 2C9CA 4JYAM 3C3EA 5KPTA 3SASA 3KSJA 2D7GA 2XGNA 3FTCA 3GRUA 3T38A 1V34A 3UK6A 2XZUA 1GABA 3GQ3A 1GJTA 2Y21A 1L1ZA 3J81S 1XMOM 4LGYA 3LW5F 1NJFA 3SARA 4G4NA 4DV1M 1E32A 3TPZA 3PVSA 1AIPC 1SXJB 4NC6A 3GLGB 1IN8A 2DAMA 2OPFA 2EKFA 1N36M 2C96A 2HL7A 1QAMA 2KZUA 2FFJA 4WP2A 2JY7A 2KRKA 4F1IA 4X62M 3RGSA 2KA6B 1TH3A 2EUCA 3HU3A 4GITA 2VF8A 4Y28F 1C1KA 3FKEA 3K8ZA 4AG5A 3L26A 5BR8M 4DV0M 4DR7M 2VQFM 2CFOA 4KODA 4DV7M 3C3DA 3SAUA 1S3SA 1T6OA 1GLNA 2V1UA 2K47A 4DUZM 4BLCA 1D2NA 1N75A 1SG9A 3R8FA 4LJAA 2M60A 3U6QA 3SAVA 3L2AA 2DAKA 3QYBA 4JI8M 3L28A 4DR5M 1H6UA 1MN3A 2C5RA 4GRIA 3DFZA 4XGIA 2ZAMA 3AJIB 3DOAA 3QYEA 4ZPXA 5BPVA 1DGBA 1IM2A 2QHOB 3NBIA 4JN6A 1Z5AA 3VDUA 3WHLA 3HJSA 1N32M 1IY2A 2G3QA 5FTKA 5FTNA 4CJ6A 1XB2B 3HHWA 5GKNA 4OVZB 3SAWA 2DWNA 3C58A 3SATA 1RU3A 5IWAM 2FS1A 1GKIA 3B9PA 1D0LA 2Z4SA 3MK6A 4F2LA 5ITUA 2VQEM 4MGKE 4JI2M 3KSXA 4MH0E 4AG6A 3SMSA 2KXEA 3HWSA 1WGLA 3U5ZA 1Q02A 4LZZA 2KNZA 2X49A 1AUAA 5H37D 2CV2A 5ITRA 2DVWB 2DHYA 4L4UA 4AKIA 2HAKA 3GLHB 1G8PA 4II7A 1SXJE 3VK7A 2KNAA 2EO2A 1PJSA 4TUWA 1ZMUA 4CIZA 4B08A 2CWBA 4L16A 4LF5M 3K92A 4R71A 2JA2A 4M0DA 3LCVB 2NQ8C 1N77A 2CHQA 5DNYA 3L27A 4NRVA 3RFWA 1J09A 3THGA 4PCZA 4M9SA 5JI3E 2KHHA 1ZQ9A 2BWBA 3GRVA 4AKGA 1JR3D 5C1BA 3K9OA 4LG2A 2DI0A 1G41A 4KLNA 3U6LA 3ILKA 1EIJA 4NL4H 2G5GX 3HZJA 2LTUA 1QVRA 2DAGA 4I4LA 4B3TM 4GC5A 1GJSA 2KNVA 1XMQM 2DXIA 2L7HA 2JXNA 1YE9A 4P17A 3U6SA 3LVVA 4G4QA 4WW0A 1XXHB 2DAEA 3KP0E 2C99A 3CF2A 2UUAM 2R62A 3M0EA 1OKSA 3KW6A 4JI3M 3HX3A 3GQ5A 4G4RA 3U60A 2CHVA 3TE6A 4CISA 4OX9M 1JB0F 3SBJA 1E9RA 4DR4M 2BNKA 3MHVC 2GQFA 2DAIA 3QWLA 4FWGA 1QUTA 3FUUA 3KXEC 4GHLA 3EIHA 3NBXX 3J7AS 4CHTB 4LJ9A 3DA1A 2QSFX 5EP1A 1N33M 1I4WA 2A5YB 4JXJA 3TWLA 2BJWA 2K6BA 1DGFA 3E4RA 4B7FA 1XNRM 4GMQA 1R6BX 1G59A 4GIPA 1OIPA 1NY5A 1L2CA 3AOGA 4R3DA 2UUCM 1J7KA 4ANRA 4OU7A 1UM8A 1DGGA 4LRSA 2C9OA 5IREB 4RF1A 1QDTA 3KS4A 2ZM6M 2LWXA 1HNZM 3FYDA 3GRRA 8CATA 1N34M 1FJGM 3F92A 4IBFA 3B89A 1EFUB 1VDDA 1ZMWA 3E9SA 3U6CA 1NV8A 5LMUM 1OFIA 2KEBA 4L6V6 1NO1A 1Z5BA 3U61B 1ZMVA 2ERCA 1IBLM 1IN4A 3A98B 1QYRA 4QHSA 3VK8A 5KQDA 3HY5A 4GKKM 1FNNA 4AQYM 3SMPA 5ITTA 2JY8A 2AHMA 2R4EA 4IBGA 1HQYE 3Q8GA 4AZFA 1VG5A 1WJ7A 1WGNA 3I4YA 2MH8A 5KPRA 2N35A 3CTWB 4LCBA 2QENA 3JR5A 2F5PA 2FH0A 4B7HA 2F5OA 3GLFB 5EJCA 4JI0M 4DV3M 1XXHE 4MGHA 4R7GA 4GKJM 3KVWA 3MMPA 3GO8A 4NSRA 3GLGA 1T43A 2K0BX 4PD2A 3GLGE 4LJ5A 2WSEF 2Z8YM 4G3OA 3GQ4A 3U6DA 4M9XA 1Q39A 4WURA 2Q2EB 2JUJA 3HJ8A 4OW0A 2UXCM 4JI5M 2LXEA 5FSWA 4LF6M 3FTFA 2ZAOA 1LV7A 3SHFA 3U6EA 4JI6M 1IXSB 4I81A 3A42A 2H5XA 4RF0A 3SHGB 2QQ8A 3EIEA 1E94E 5EXXA 2ZTCA 5DYGA 1QZEA 3HGIA 2J5YA 4RNAA 2CEAA 3GLIB 3T1HM 1PGYA 2APLA 2DWLA 2L09A 3IHPA 2F4VM 2F5QA 3WHKA 3AOEC 1N78A 4M9ZA 3J2PB 3HKPA 2RRUA 4LJ4A 5DYIA 1C7YA 1OIZA 1CUKA 2OOBA 2DKLA 2MROB 2RGOA 3B7QA 2LVQD 2DENA 1WR1B 3FUWA 4QNMA 1R2YA 2LBCA 3PFIA 1NVMA 2XFTA 3E21A 1SXJA 4FCVA 3ZC7B 3KDSE 3RGPA 1IFYA 4GEWA 3U6OA 1YLAA 2XH9A 2LVNC 3W0FA 1JR3A 3ZCBB 1I94M 3K2LA 3BOSA 3QAUA 4PDGA 1QANA 1D0MA 2WSFF 2Z3XA 3FE3A 1K3XA 1W5TA 1X37A 4HEOA 2KRUA 3R9XB 1IN7A 4GHAA 1HT2E 4OVZA 3W68A 4G4OA 4LF8M 4A3VB 1SXJD 1MX0A 1VQ1A 2L7IA 1VEJA 4B3SM 1HQCA
chains in the Genus database with same CATH topology
3OTOM 1ZAEA 3TL4X 4B3RM 2FOIC 2YFQA 3TQSA 2UXDM 1NHWC 1IBKM 4DV4M 3KOYE 1OFHA 1KYIA 2UXBM 3Q8XA 1E9SA 4MGYE 5ITXA 1Q3CA 2OQ4A 2RGHA 4G6ZA 4LGMA 4KO8A 4DV2M 3AFHA 3KS8A 2BJVA 5EP2A 1IY1A 3GPUA 1G4AE 4D82A 3A45A 1EE8A 2XF3A 1L2BA 4LJ8A 2F5SA 3NWLA 1DO0A 1TH4A 4JV5M 2QPAA 3TWKA 1IQPA 3J80S 3GLHA 3SYKA 4ITQA 3L29A 2QCUA 2Y0TA 3D8BA 1SXJC 5LMNM 2O5RA 4LZJA 3HJQA 5ITXE 3GLFA 4HLQA 3T1YM 4I8OA 3LMMA 1HNXM 4BB9A 4LFAM 1L2DA 5E6JA 3KFUG 4IBCA 3SC3A 2UUBM 4LJ7A 5ITYA 2R18A 4L78A 4X65M 4NXNM 4I5SA 3HHZA 2UU9M 4AKHA 3SFZA 4L15A 4YY3M 3VKGA 5EXTA 4AW4A 4QOSA 1J5EM 1IY0A 1DGHA 1IN5A 3GPXA 2YNMD 2XFSA 3CF0A 2DWZB 4LFCM 1GL6A 5IT9S 1PJIA 4IBKA 1XC8A 2R65A 2P5TA 4LFBM 2YQZA 1NSFA 3UZUA 2R46A 1HT1E 2QZ4A 2QBYA 4IBEA 3JAMS 2W82A 3AL0C 5EP4A 4BBAA 2KW0A 2EA0A 5ITQA 2H1RA 4FD2A 1IBMM 2Z4RA 4M0WA 4B3MM 1MU5A 4X66M 3M7GA 3J27B 2DWMA 1QAQA 4FCWA 3IG8A 4QHTA 1IXZA 2F5NA 1NHGC 5EXSA 4JI4M 2C98A 3RE8A 3KOWE 3LQRA 3HU2A 1DO2A 4AI6A 4DR2M 2XZFA 2HHHM 2X4AA 4IBIA 3U6MA 4DR3M 3D8LA 1XHBA 2J7OA 1ORYB 3HHXA 1KFVA 2Z7JA 4S12A 4JI7M 1Z59A 4FVMA 5KQ8A 3PXGA 2HKJA 3WHKA 3PNVA 4L8RC 2YR0A 3KOZE 4IIWA 2Y20A 3FYCA 4LY6A 4D81A 1NJGA 5IZ7D 1G3IA 5FTLA 3VLFB 1TH2A 4IBBA 3SYLA 3M6AA 1W5SA 2KZSA 3KOXE 3MJ5A 3UGJA 2CV1A 1QQWA 1YSYA 3L25A 4DV6M 3LQQA 4B7GA 5F3WA 2CHGA 2DZOB 3UMMA 2R45A 2XEPA 1Q3BA 2D7HA 4LJ6A 3H4MA 4Z6YA 4YHHM 5E26A 1TDZA 3FTEA 1K3WA 4JI1M 4LF7M 1QAOA 3J7BA 1QZMA 4REZA 1IXRC 1WXQA 4IBJA 2LNHC 3LVWA 3HHYA 3VDPA 2X8AA 4CGYB 2R4JA 2LH0A 4EIWA 1R2ZA 2J7NA 1PM5A 3FUVA 2XSZD 5A2QS 3VKHA 1L8QA 4GC9A 3U61A 2QP9X 2VIIA 2I7PA 2Y0QA 3U6PA 4W5WA 5FTMA 4QOZC 1NNUC 4LRTA 3K1JA 4K0KM 3U5ZB 2XSZA 1JQJC 4NRWA 3AKZA 5C18A 1HNWM 4FWHA 1R7RA 4DR1M 2E5LM 1XNQM 4GH9A 4NOOB 1YUBA 2FNAA 3HU1A 2D7EA 4LF4M 2DZNB 3FTDA 4MGIE 2CE7A 2HCBA 4Z8XA 4HL4A 5EXPA 1T3TA 3AOEA 3A46A 1IN6A 4QNRA 7CATA 5FLXS 4DR6M 1Z5CA 3VFDA 3KP1E 4IJFA 1K82A 4X64M 4XBOA 2L6OA 3PNYA 5EP3A 1Z6TA 3AV0A 2XLJA 3DZDA 4IBDA 1HR0M 3GPPA 1PJJA 4IJEA 3GRYA 4KHPM 3FUTA 2CUZA 4NSOB 3I51A 2CV0A 1XWIA 3I4VA 5FTJA 1GVNA 3GLIA 1XXHA 1TDHA 4PDIA 4NXMM 4P16A 2RKOA 2ZANA 4PT5A 1TGUA 2G8LA 4LF9M 1OJLA 3CF6E 1L1TA 5JI2E 2DHRA 2V1CA 4MB7A 3W0LB 3FD9A 3GP1A 1DGHB 3JR4A 1NY6A 3TWMA 3GPYA 2ZBKB 4FCTA 5EQTA 1NNJA 1GL7A 3T15A 5KPZA 1KSFX 3ZH9B 3UJNA 2QBYB 2V6ZM 3IG5A 4DV5M 3FUXA 2FE8A 4FW9A 4D80A 5KO3A 2I7NA 4MM3B 4DUYM 3U60B 4MGZE 4FWDA 2M5ZA 4JYAM 2C9CA 5KPTA 3SASA 3KSJA 2D7GA 2XGNA 3FTCA 3GRUA 3T38A 3UK6A 2XZUA 3FTFA 3GQ3A 2Y21A 1L1ZA 3J81S 1XMOM 4LGYA 1NJFA 3SARA 4G4NA 4DV1M 1E32A 3TPZA 3PVSA 1SXJB 3GLGB 1IN8A 2OPFA 1N36M 2C96A 2HL7A 1QAMA 2FFJA 2KZUA 2KRKA 4X62M 3RGSA 2KA6B 1TH3A 2EUCA 3HU3A 4GITA 3L26A 1C1KA 3FKEA 3K8ZA 4AG5A 5BR8M 4DV0M 4DR7M 2VQFM 2CFOA 4KODA 4DV7M 3SAUA 1S3SA 1GLNA 2V1UA 2K47A 4DUZM 4BLCA 1D2NA 1N75A 3R8FA 4LJAA 2M60A 3U6QA 3SAVA 3L2AA 4JI8M 3L28A 4DR5M 1H6UA 2C5RA 4GRIA 3DFZA 4XGIA 2ZAMA 3AJIB 3DOAA 4ZPXA 5BPVA 1DGBA 1IM2A 3NBIA 4JN6A 1Z5AA 3VDUA 3WHLA 3HJSA 1N32M 1IY2A 5FTKA 5FTNA 3HHWA 5GKNA 4OVZB 3SAWA 2DWNA 3C58A 3SATA 5IWAM 1GKIA 3B9PA 2Z4SA 3MK6A 5ITUA 2VQEM 4MGKE 4JI2M 3KSXA 4MH0E 4AG6A 3SMSA 2KXEA 3HWSA 3U5ZA 4LZZA 2X49A 5H37D 2CV2A 5ITRA 2DVWB 4L4UA 4AKIA 3GLHB 1G8PA 4II7A 1SXJE 3VK7A 2EO2A 4TUWA 4B08A 4L16A 4LF5M 3K92A 2JA2A 4M0DA 2NQ8C 1N77A 2CHQA 5DNYA 3L27A 4NRVA 3RFWA 1J09A 3THGA 4PCZA 4M9SA 5JI3E 1ZQ9A 3GRVA 4AKGA 1JR3D 5C1BA 4LG2A 1G41A 4KLNA 3U6LA 3ILKA 4NL4H 2G5GX 1QVRA 4I4LA 4B3TM 4GC5A 1XMQM 2DXIA 2L7HA 1YE9A 3U6SA 3LVVA 4G4QA 4WW0A 1XXHB 3KP0E 2C99A 3CF2A 2UUAM 2R62A 3M0EA 3KW6A 4JI3M 4G4RA 3U60A 3GQ5A 4CISA 2CHVA 3TE6A 4OX9M 3SBJA 1E9RA 4DR4M 2BNKA 3MHVC 4FWGA 3QWLA 3FUUA 3KXEC 4GHLA 3EIHA 3J7AS 4CHTB 4LJ9A 3DA1A 5EP1A 1N33M 1I4WA 2A5YB 4JXJA 3TWLA 2BJWA 1DGFA 3E4RA 4B7FA 1XNRM 4GMQA 1R6BX 1G59A 4GIPA 1NY5A 1L2CA 3AOGA 4R3DA 2UUCM 1J7KA 4OU7A 1UM8A 1DGGA 4LRSA 2C9OA 5IREB 4RF1A 3KS4A 2ZM6M 2LWXA 1HNZM 3FYDA 3GRRA 8CATA 1N34M 1FJGM 4IBFA 1VDDA 3E9SA 3U6CA 5LMUM 1OFIA 2KEBA 1Z5BA 3U61B 2ERCA 1IBLM 1IN4A 3A98B 1QYRA 4QHSA 3VK8A 5KQDA 4GKKM 1FNNA 4AQYM 3SMPA 5ITTA 2AHMA 2R4EA 4IBGA 1HQYE 4AZFA 3I4YA 5KPRA 3CTWB 4LCBA 2QENA 3JR5A 2F5PA 4B7HA 2F5OA 3GLFB 5EJCA 4JI0M 4DV3M 4MGHA 4R7GA 4GKJM 3KVWA 3GO8A 4NSRA 3GLGA 4PD2A 4LJ5A 3GQ4A 3U6DA 4M9XA 1Q39A 4WURA 2Q2EB 3HJ8A 4OW0A 2UXCM 4JI5M 2LXEA 5FSWA 4LF6M 2ZAOA 1LV7A 3SHFA 3U6EA 4JI6M 1IXSB 4I81A 3A42A 4RF0A 3SHGB 3EIEA 1E94E 5EXXA 5DYGA 3HGIA 4RNAA 2CEAA 3GLIB 3T1HM 2DWLA 2L09A 2F4VM 2F5QA 3AOEC 1N78A 4M9ZA 3J2PB 3HKPA 4LJ4A 5DYIA 2RGOA 3FUWA 4QNMA 1R2YA 4FCVA 3PFIA 1NVMA 2XFTA 3ZC7B 1SXJA 3KDSE 3RGPA 3U6OA 2XH9A 3W0FA 1JR3A 3ZCBB 1I94M 3K2LA 3BOSA 3QAUA 4PDGA 1QANA 1K3XA 2Z3XA 1W5TA 1X37A 2KRUA 3R9XB 1IN7A 4GHAA 1HT2E 4OVZA 4G4OA 4LF8M 4A3VB 1SXJD 1MX0A 2L7IA 4B3SM 1HQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E32 A;  3EIH A;  3PVS A;  1SXJ B;  4LJ9 A;  5EP1 A;  3GLG B;  1IN8 A;  2C96 A;  2BJW A;  2CHG A;  2DZO B;  1OFH A;  1KYI A;  2KRK A;  4LJ6 A;  3H4M A;  1R6B X;  1NY5 A;  3HU3 A;  4GIT A;  3M6A A;  1C1K A;  1J7K A;  1QZM A;  1IXR C;  1UM8 A;  4LRS A;  4LGM A;  2C9O A;  4KO8 A;  4KOD A;  2X8A A;  1S3S A;  2BJV A;  1IY1 A;  5EP2 A;  4EIW A;  2V1U A;  1G4A E;  4D82 A;  2XSZ D;  1D2N A;  3R8F A;  4LJ8 A;  1L8Q A;  4LJA A;  1DO0 A;  2QP9 X;  2VII A;  1OFI A;  2QPA A;  1IQP A;  3U61 B;  3GLH A;  5FTM A;  1IN4 A;  2ZAM A;  3AJI B;  4QHS A;  4ZPX A;  3SYK A;  1IM2 A;  3D8B A;  4LRT A;  4JN6 A;  1FNN A;  3WHL A;  3K1J A;  1SXJ C;  1IY2 A;  5FTK A;  1HQY E;  5FTN A;  3U5Z B;  2XSZ A;  1JQJ C;  5C18 A;  4FWH A;  1R7R A;  3GLF A;  4LCB A;  2QEN A;  3B9P A;  2FNA A;  3HU1 A;  2Z4S A;  3GLF B;  2DZN B;  2CE7 A;  2HCB A;  4Z8X A;  5EXP A;  3SC3 A;  3HWS A;  4LJ7 A;  1IN6 A;  4QNR A;  3GLG A;  4LZZ A;  3VFD A;  4LJ5 A;  2DVW B;  4L15 A;  4L4U A;  5EXT A;  3GLH B;  4QOS A;  5EP3 A;  1IY0 A;  1SXJ E;  1IN5 A;  3DZD A;  2ZAO A;  1LV7 A;  4L16 A;  3CF0 A;  2DWZ B;  1IXS B;  4I81 A;  2CHQ A;  3EIE A;  1E94 E;  2R65 A;  1NSF A;  1XWI A;  5EXX A;  5FTJ A;  1HT1 E;  1XXH A;  2QZ4 A;  5DYG A;  3GLI A;  5JI3 E;  2QBY A;  5EP4 A;  2CEA A;  3GLI B;  1JR3 D;  2RKO A;  5C1B A;  2ZAN A;  4FD2 A;  2Z4R A;  1OJL A;  1G41 A;  4KLN A;  5JI2 E;  2DHR A;  4FCW A;  4LJ4 A;  4QHT A;  5DYI A;  1IXZ A;  1QVR A;  5EXS A;  4I4L A;  1NY6 A;  2C98 A;  3HU2 A;  1DO2 A;  4FCT A;  4QNM A;  5EQT A;  4FCV A;  3PFI A;  1NVM A;  1SXJ A;  3KDS E;  1KSF X;  3ZH9 B;  2QBY B;  4WW0 A;  1XXH B;  1JR3 A;  2V6Z M;  2C99 A;  3BOS A;  3CF2 A;  4FW9 A;  4D80 A;  3U60 B;  3PXG A;  1W5T A;  1X37 A;  2R62 A;  3WHK A;  4FWD A;  3M0E A;  2C9C A;  3KW6 A;  4LY6 A;  4D81 A;  1NJG A;  5FTL A;  1IN7 A;  1G3I A;  2CHV A;  3UK6 A;  1HT2 E;  3VLF B;  3MHV C;  4A3V B;  1SXJ D;  1NJF A;  4FWG A;  1HQC A;  3SYL A;  1W5S A; 
#chains in the Genus database with same CATH topology
 2OOA A;  1TTE A;  3V76 A;  1ZAE A;  3OTO M;  3TL4 X;  4B3R M;  2FOI C;  2YFQ A;  3TQS A;  1PJT A;  2UXD M;  1NHW C;  2JNH A;  4DV4 M;  1IBK M;  3KOY E;  1OFH A;  1KYI A;  1V92 A;  2UXB M;  3Q8X A;  1E9S A;  1OQY A;  4MGY E;  5ITX A;  2O25 A;  3LCU A;  1Q3C A;  2OQ4 A;  2RGH A;  4G6Z A;  4LGM A;  4KO8 A;  4DV2 M;  3AFH A;  3KS8 A;  2R0I A;  2BJV A;  1IY1 A;  2B3T A;  5EP2 A;  3GPU A;  1G4A E;  4D82 A;  3A45 A;  1EE8 A;  2XF3 A;  1L2B A;  4LJ8 A;  2F5S A;  3NWL A;  1DO0 A;  1TH4 A;  4JV5 M;  2QPA A;  3TWK A;  1IQP A;  3J80 S;  3GLH A;  3SYK A;  4ITQ A;  3L29 A;  2QCU A;  2Y0T A;  3D8B A;  3FRH A;  1HJP A;  4Q7J A;  1D0K A;  1SXJ C;  2GNO A;  5LMN M;  2O5R A;  4LZJ A;  3HJQ A;  5ITX E;  4L8R C;  3GLF E;  3GLF A;  4HLQ A;  3T1Y M;  4I8O A;  3LMM A;  1HNX M;  4BB9 A;  4LFA M;  1L2D A;  5E6J A;  1UFZ A;  3C9P A;  3KFU G;  3H4J A;  4IBC A;  2JY6 B;  3IEC A;  3SC3 A;  2UUB M;  4LJ7 A;  5ITY A;  2R18 A;  3GLH E;  4L78 A;  4X65 M;  4NXN M;  4I5S A;  3BXW A;  2KDL A;  3HHZ A;  2UU9 M;  4AKH A;  3SFZ A;  3K9P A;  4L15 A;  4YY3 M;  2JZ1 A;  5EXT A;  4AW4 A;  3VKG A;  4QOS A;  1QUS A;  1J5E M;  1WIV A;  1IY0 A;  1DGH A;  1IN5 A;  1ZV1 A;  2QNJ A;  5L8R F;  3GPX A;  2K9D A;  2YNM D;  2XFS A;  3CF0 A;  4XK8 F;  2DWZ B;  4UN2 B;  4LFC M;  1GL6 A;  5IT9 S;  1JR3 E;  1PJI A;  2LVO C;  4IBK A;  1XC8 A;  2R65 A;  2P5T A;  4LFB M;  2YQZ A;  1NSF A;  3UZU A;  2R46 A;  2LHG A;  1HT1 E;  2CP8 A;  2QZ4 A;  2QBY A;  1A5T A;  4IBE A;  3JAM S;  2W82 A;  3AL0 C;  1VDL A;  5EP4 A;  4BBA A;  2KW0 A;  2EA0 A;  5ITQ A;  2H1R A;  4FD2 A;  1IBM M;  2Z4R A;  4M0W A;  4B3M M;  1MU5 A;  4X66 M;  3M7G A;  3J27 B;  2DWM A;  1QAQ A;  4FCW A;  2JP7 A;  3IG8 A;  4QHT A;  1TF0 B;  1IXZ A;  2F5N A;  2JZ0 A;  1NHG C;  2BWE A;  5EXS A;  4JI4 M;  2C98 A;  1VEG A;  3RE8 A;  3B74 A;  3KOW E;  3HU2 A;  1DO2 A;  3LQR A;  4AI6 A;  4DR2 M;  2XZF A;  2HHH M;  2X4A A;  4IBI A;  3U6M A;  4DR3 M;  3D8L A;  1XHB A;  2J7O A;  1ORY B;  2MGW A;  3HHX A;  1KFV A;  2Z7J A;  4S12 A;  4JI7 M;  1Z59 A;  4FVM A;  5KQ8 A;  1DV0 A;  3PXG A;  2HKJ A;  2L4E A;  3PNV A;  1TR8 A;  1IXS A;  1PJQ A;  2YR0 A;  2Y20 A;  2WZJ A;  3FYC A;  3KOZ E;  2OO9 A;  1NJG A;  4IIW A;  1G3I A;  4LY6 A;  5IZ7 D;  4D81 A;  5FTL A;  3VLF B;  1TH2 A;  1MJG M;  1R4G A;  4IBB A;  3SYL A;  1W5S A;  2KZS A;  3M6A A;  2ZTD A;  1WHC A;  2EJS A;  3KOX E;  3MJ5 A;  3UGJ A;  2CV1 A;  1QQW A;  1YSY A;  1GO5 A;  1Y8G A;  3L25 A;  4DV6 M;  3LQQ A;  1P3Q Q;  4B7G A;  5F3W A;  2CHG A;  2DZO B;  3UMM A;  2R45 A;  2L4F A;  2XEP A;  2VDB B;  1Q3B A;  3T6P A;  2D7H A;  4LJ6 A;  3H4M A;  4Z6Y A;  2DNA A;  4YHH M;  3GLI E;  5E26 A;  1TDZ A;  3FTE A;  1K3W A;  4JI1 M;  4LF7 M;  1QAO A;  2VF7 A;  3J7B A;  1V33 A;  1QZM A;  4REZ A;  1IXR C;  1WXQ A;  4IBJ A;  2LNH C;  3LVW A;  3HHY A;  3W67 A;  3VDP A;  2X8A A;  4CGY B;  2R4J A;  2LH0 A;  4KT0 F;  4EIW A;  1R2Z A;  2J7N A;  1PM5 A;  3FUV A;  2XSZ D;  5A2Q S;  3VKH A;  4DBG B;  1L8Q A;  4GC9 A;  3U61 A;  2QP9 X;  2VII A;  2I7P A;  2Y0Q A;  3U6P A;  3E46 A;  1OAO C;  4W5W A;  5DFL A;  2JWS A;  5FTM A;  4QOZ C;  1NNU C;  4LRT A;  3I01 M;  3K1J A;  4K0K M;  1BVS A;  3U5Z B;  2XSZ A;  1JQJ C;  1OAI A;  2O01 F;  3AKZ A;  4NRW A;  2HWJ A;  5C18 A;  1HNW M;  4FWH A;  4RKU F;  1R7R A;  4DR1 M;  2E5L M;  1XNQ M;  4GH9 A;  4NOO B;  1YUB A;  2FNA A;  3HU1 A;  2D7E A;  4LF4 M;  2DZN B;  3FTD A;  4MGI E;  2CE7 A;  2HCB A;  4Z8X A;  4HL4 A;  5EXP A;  1T3T A;  2DZL A;  3AOE A;  3A46 A;  1IN6 A;  2MR9 A;  4QNR A;  7CAT A;  2CRU A;  3BBZ A;  5FLX S;  4DR6 M;  1VEK A;  1Z5C A;  3VFD A;  3KP1 E;  4IJF A;  1K82 A;  4X64 M;  4XBO A;  2L6O A;  1OTR A;  3PNY A;  3FRI A;  5EP3 A;  1Z6T A;  3AV0 A;  2XLJ A;  3DZD A;  4IBD A;  1HR0 M;  3GPP A;  1PJJ A;  4IJE A;  3GRY A;  3ZQJ A;  4KHP M;  3FUT A;  2CUZ A;  2JY5 A;  4NSO B;  3I51 A;  2CV0 A;  1XWI A;  3I4V A;  5FTJ A;  1GVN A;  3GLI A;  1G71 A;  1XXH A;  2R6F A;  1TDH A;  4PDI A;  2LVP C;  3I04 M;  4NXM M;  4P16 A;  2EKK A;  2RKO A;  2WSC F;  2ZAN A;  4PT5 A;  1TGU A;  2G8L A;  2L2D A;  3B7Z A;  4LF9 M;  1OJL A;  3CF6 E;  3B7N A;  1L1T A;  5JI2 E;  2DHR A;  2V1C A;  4MB7 A;  3W0L B;  3FD9 A;  3CGW A;  3GP1 A;  1F4I A;  1DGH B;  3JR4 A;  1NY6 A;  3TWM A;  3GPY A;  2ZBK B;  4FCT A;  1PRB A;  1QDR A;  5EQT A;  1NNJ A;  1GL7 A;  3T15 A;  5KPZ A;  1KSF X;  3ZH9 B;  2R44 A;  3UJN A;  2LHC A;  2LVA A;  2QBY B;  1LTM A;  1NV9 A;  1R5L A;  2V6Z M;  3IG5 A;  3FUX A;  2FE8 A;  4FW9 A;  4DV5 M;  4D80 A;  5KO3 A;  2I7N A;  4MM3 B;  4DUY M;  3U60 B;  4MGZ E;  2MJ5 B;  2M5Z A;  4FWD A;  2C9C A;  4JYA M;  3C3E A;  5KPT A;  3SAS A;  3KSJ A;  2D7G A;  2XGN A;  3FTC A;  3GRU A;  3T38 A;  1V34 A;  3UK6 A;  2XZU A;  1GAB A;  3GQ3 A;  1GJT A;  2Y21 A;  1L1Z A;  3J81 S;  1XMO M;  4LGY A;  3LW5 F;  1NJF A;  3SAR A;  4G4N A;  4DV1 M;  1E32 A;  3TPZ A;  3PVS A;  1AIP C;  1SXJ B;  4NC6 A;  3GLG B;  1IN8 A;  2DAM A;  2OPF A;  2EKF A;  1N36 M;  2C96 A;  2HL7 A;  1QAM A;  2KZU A;  2FFJ A;  4WP2 A;  2JY7 A;  2KRK A;  4F1I A;  4X62 M;  3RGS A;  2KA6 B;  1TH3 A;  2EUC A;  3HU3 A;  4GIT A;  2VF8 A;  4Y28 F;  1C1K A;  3FKE A;  3K8Z A;  4AG5 A;  3L26 A;  5BR8 M;  4DV0 M;  4DR7 M;  2VQF M;  2CFO A;  4KOD A;  4DV7 M;  3C3D A;  3SAU A;  1S3S A;  1T6O A;  1GLN A;  2V1U A;  2K47 A;  4DUZ M;  4BLC A;  1D2N A;  1N75 A;  1SG9 A;  3R8F A;  4LJA A;  2M60 A;  3U6Q A;  3SAV A;  3L2A A;  2DAK A;  3QYB A;  4JI8 M;  3L28 A;  4DR5 M;  1H6U A;  1MN3 A;  2C5R A;  4GRI A;  3DFZ A;  4XGI A;  2ZAM A;  3AJI B;  3DOA A;  3QYE A;  4ZPX A;  5BPV A;  1DGB A;  1IM2 A;  2QHO B;  3NBI A;  4JN6 A;  1Z5A A;  3VDU A;  3WHL A;  3HJS A;  1N32 M;  1IY2 A;  2G3Q A;  5FTK A;  5FTN A;  4CJ6 A;  1XB2 B;  3HHW A;  5GKN A;  4OVZ B;  3SAW A;  2DWN A;  3C58 A;  3SAT A;  1RU3 A;  5IWA M;  2FS1 A;  1GKI A;  3B9P A;  1D0L A;  2Z4S A;  3MK6 A;  4F2L A;  5ITU A;  2VQE M;  4MGK E;  4JI2 M;  3KSX A;  4MH0 E;  4AG6 A;  3SMS A;  2KXE A;  3HWS A;  1WGL A;  3U5Z A;  1Q02 A;  4LZZ A;  2KNZ A;  2X49 A;  1AUA A;  5H37 D;  2CV2 A;  5ITR A;  2DVW B;  2DHY A;  4L4U A;  4AKI A;  2HAK A;  3GLH B;  1G8P A;  4II7 A;  1SXJ E;  3VK7 A;  2KNA A;  2EO2 A;  1PJS A;  4TUW A;  1ZMU A;  4CIZ A;  4B08 A;  2CWB A;  4L16 A;  4LF5 M;  3K92 A;  4R71 A;  2JA2 A;  4M0D A;  3LCV B;  2NQ8 C;  1N77 A;  2CHQ A;  5DNY A;  3L27 A;  4NRV A;  3RFW A;  1J09 A;  3THG A;  4PCZ A;  4M9S A;  5JI3 E;  2KHH A;  1ZQ9 A;  2BWB A;  3GRV A;  4AKG A;  1JR3 D;  5C1B A;  3K9O A;  4LG2 A;  2DI0 A;  1G41 A;  4KLN A;  3U6L A;  3ILK A;  1EIJ A;  4NL4 H;  2G5G X;  3HZJ A;  2LTU A;  1QVR A;  2DAG A;  4I4L A;  4B3T M;  4GC5 A;  1GJS A;  2KNV A;  1XMQ M;  2DXI A;  2L7H A;  2JXN A;  1YE9 A;  4P17 A;  3U6S A;  3LVV A;  4G4Q A;  4WW0 A;  1XXH B;  2DAE A;  3KP0 E;  2C99 A;  3CF2 A;  2UUA M;  2R62 A;  3M0E A;  1OKS A;  3KW6 A;  4JI3 M;  3HX3 A;  3GQ5 A;  4G4R A;  3U60 A;  2CHV A;  3TE6 A;  4CIS A;  4OX9 M;  1JB0 F;  3SBJ A;  1E9R A;  4DR4 M;  2BNK A;  3MHV C;  2GQF A;  2DAI A;  3QWL A;  4FWG A;  1QUT A;  3FUU A;  3KXE C;  4GHL A;  3EIH A;  3NBX X;  3J7A S;  4CHT B;  4LJ9 A;  3DA1 A;  2QSF X;  5EP1 A;  1N33 M;  1I4W A;  2A5Y B;  4JXJ A;  3TWL A;  2BJW A;  2K6B A;  1DGF A;  3E4R A;  4B7F A;  1XNR M;  4GMQ A;  1R6B X;  1G59 A;  4GIP A;  1OIP A;  1NY5 A;  1L2C A;  3AOG A;  4R3D A;  2UUC M;  1J7K A;  4ANR A;  4OU7 A;  1UM8 A;  1DGG A;  4LRS A;  2C9O A;  5IRE B;  4RF1 A;  1QDT A;  3KS4 A;  2ZM6 M;  2LWX A;  1HNZ M;  3FYD A;  3GRR A;  8CAT A;  1N34 M;  1FJG M;  3F92 A;  4IBF A;  3B89 A;  1EFU B;  1VDD A;  1ZMW A;  3E9S A;  3U6C A;  1NV8 A;  5LMU M;  1OFI A;  2KEB A;  4L6V 6;  1NO1 A;  1Z5B A;  3U61 B;  1ZMV A;  2ERC A;  1IBL M;  1IN4 A;  3A98 B;  1QYR A;  4QHS A;  3VK8 A;  5KQD A;  3HY5 A;  4GKK M;  1FNN A;  4AQY M;  3SMP A;  5ITT A;  2JY8 A;  2AHM A;  2R4E A;  4IBG A;  1HQY E;  3Q8G A;  4AZF A;  1VG5 A;  1WJ7 A;  1WGN A;  3I4Y A;  2MH8 A;  5KPR A;  2N35 A;  3CTW B;  4LCB A;  2QEN A;  3JR5 A;  2F5P A;  2FH0 A;  4B7H A;  2F5O A;  3GLF B;  5EJC A;  4JI0 M;  4DV3 M;  1XXH E;  4MGH A;  4R7G A;  4GKJ M;  3KVW A;  3MMP A;  3GO8 A;  4NSR A;  3GLG A;  1T43 A;  2K0B X;  4PD2 A;  3GLG E;  4LJ5 A;  2WSE F;  2Z8Y M;  4G3O A;  3GQ4 A;  3U6D A;  4M9X A;  1Q39 A;  4WUR A;  2Q2E B;  2JUJ A;  3HJ8 A;  4OW0 A;  2UXC M;  4JI5 M;  2LXE A;  5FSW A;  4LF6 M;  3FTF A;  2ZAO A;  1LV7 A;  3SHF A;  3U6E A;  4JI6 M;  1IXS B;  4I81 A;  3A42 A;  2H5X A;  4RF0 A;  3SHG B;  2QQ8 A;  3EIE A;  1E94 E;  5EXX A;  2ZTC A;  5DYG A;  1QZE A;  3HGI A;  2J5Y A;  4RNA A;  2CEA A;  3GLI B;  3T1H M;  1PGY A;  2APL A;  2DWL A;  2L09 A;  3IHP A;  2F4V M;  2F5Q A;  3WHK A;  3AOE C;  1N78 A;  4M9Z A;  3J2P B;  3HKP A;  2RRU A;  4LJ4 A;  5DYI A;  1C7Y A;  1OIZ A;  1CUK A;  2OOB A;  2DKL A;  2MRO B;  2RGO A;  3B7Q A;  2LVQ D;  2DEN A;  1WR1 B;  3FUW A;  4QNM A;  1R2Y A;  2LBC A;  3PFI A;  1NVM A;  2XFT A;  3E21 A;  1SXJ A;  4FCV A;  3ZC7 B;  3KDS E;  3RGP A;  1IFY A;  4GEW A;  3U6O A;  1YLA A;  2XH9 A;  2LVN C;  3W0F A;  1JR3 A;  3ZCB B;  1I94 M;  3K2L A;  3BOS A;  3QAU A;  4PDG A;  1QAN A;  1D0M A;  2WSF F;  2Z3X A;  3FE3 A;  1K3X A;  1W5T A;  1X37 A;  4HEO A;  2KRU A;  3R9X B;  1IN7 A;  4GHA A;  1HT2 E;  4OVZ A;  3W68 A;  4G4O A;  4LF8 M;  4A3V B;  1SXJ D;  1MX0 A;  1VQ1 A;  2L7I A;  1VEJ A;  4B3S M;  1HQC A; 
#chains in the Genus database with same CATH homology
 3OTO M;  1ZAE A;  3TL4 X;  4B3R M;  2FOI C;  2YFQ A;  3TQS A;  2UXD M;  1NHW C;  1IBK M;  4DV4 M;  3KOY E;  1OFH A;  1KYI A;  2UXB M;  3Q8X A;  1E9S A;  4MGY E;  5ITX A;  1Q3C A;  2OQ4 A;  2RGH A;  4G6Z A;  4LGM A;  4KO8 A;  4DV2 M;  3AFH A;  3KS8 A;  2BJV A;  5EP2 A;  1IY1 A;  3GPU A;  1G4A E;  4D82 A;  3A45 A;  1EE8 A;  2XF3 A;  1L2B A;  4LJ8 A;  2F5S A;  3NWL A;  1DO0 A;  1TH4 A;  4JV5 M;  2QPA A;  3TWK A;  1IQP A;  3J80 S;  3GLH A;  3SYK A;  4ITQ A;  3L29 A;  2QCU A;  2Y0T A;  3D8B A;  1SXJ C;  5LMN M;  2O5R A;  4LZJ A;  3HJQ A;  5ITX E;  3GLF A;  4HLQ A;  3T1Y M;  4I8O A;  3LMM A;  1HNX M;  4BB9 A;  4LFA M;  1L2D A;  5E6J A;  3KFU G;  4IBC A;  3SC3 A;  2UUB M;  4LJ7 A;  5ITY A;  2R18 A;  4L78 A;  4X65 M;  4NXN M;  4I5S A;  3HHZ A;  2UU9 M;  4AKH A;  3SFZ A;  4L15 A;  4YY3 M;  3VKG A;  5EXT A;  4AW4 A;  4QOS A;  1J5E M;  1IY0 A;  1DGH A;  1IN5 A;  3GPX A;  2YNM D;  2XFS A;  3CF0 A;  2DWZ B;  4LFC M;  1GL6 A;  5IT9 S;  1PJI A;  4IBK A;  1XC8 A;  2R65 A;  2P5T A;  4LFB M;  2YQZ A;  1NSF A;  3UZU A;  2R46 A;  1HT1 E;  2QZ4 A;  2QBY A;  4IBE A;  3JAM S;  2W82 A;  3AL0 C;  5EP4 A;  4BBA A;  2KW0 A;  2EA0 A;  5ITQ A;  2H1R A;  4FD2 A;  1IBM M;  2Z4R A;  4M0W A;  4B3M M;  1MU5 A;  4X66 M;  3M7G A;  3J27 B;  2DWM A;  1QAQ A;  4FCW A;  3IG8 A;  4QHT A;  1IXZ A;  2F5N A;  1NHG C;  5EXS A;  4JI4 M;  2C98 A;  3RE8 A;  3KOW E;  3LQR A;  3HU2 A;  1DO2 A;  4AI6 A;  4DR2 M;  2XZF A;  2HHH M;  2X4A A;  4IBI A;  3U6M A;  4DR3 M;  3D8L A;  1XHB A;  2J7O A;  1ORY B;  3HHX A;  1KFV A;  2Z7J A;  4S12 A;  4JI7 M;  1Z59 A;  4FVM A;  5KQ8 A;  3PXG A;  2HKJ A;  3WHK A;  3PNV A;  4L8R C;  2YR0 A;  3KOZ E;  4IIW A;  2Y20 A;  3FYC A;  4LY6 A;  4D81 A;  1NJG A;  5IZ7 D;  1G3I A;  5FTL A;  3VLF B;  1TH2 A;  4IBB A;  3SYL A;  3M6A A;  1W5S A;  2KZS A;  3KOX E;  3MJ5 A;  3UGJ A;  2CV1 A;  1QQW A;  1YSY A;  3L25 A;  4DV6 M;  3LQQ A;  4B7G A;  5F3W A;  2CHG A;  2DZO B;  3UMM A;  2R45 A;  2XEP A;  1Q3B A;  2D7H A;  4LJ6 A;  3H4M A;  4Z6Y A;  4YHH M;  5E26 A;  1TDZ A;  3FTE A;  1K3W A;  4JI1 M;  4LF7 M;  1QAO A;  3J7B A;  1QZM A;  4REZ A;  1IXR C;  1WXQ A;  4IBJ A;  2LNH C;  3LVW A;  3HHY A;  3VDP A;  2X8A A;  4CGY B;  2R4J A;  2LH0 A;  4EIW A;  1R2Z A;  2J7N A;  1PM5 A;  3FUV A;  2XSZ D;  5A2Q S;  3VKH A;  1L8Q A;  4GC9 A;  3U61 A;  2QP9 X;  2VII A;  2I7P A;  2Y0Q A;  3U6P A;  4W5W A;  5FTM A;  4QOZ C;  1NNU C;  4LRT A;  3K1J A;  4K0K M;  3U5Z B;  2XSZ A;  1JQJ C;  4NRW A;  3AKZ A;  5C18 A;  1HNW M;  4FWH A;  1R7R A;  4DR1 M;  2E5L M;  1XNQ M;  4GH9 A;  4NOO B;  1YUB A;  2FNA A;  3HU1 A;  2D7E A;  4LF4 M;  2DZN B;  3FTD A;  4MGI E;  2CE7 A;  2HCB A;  4Z8X A;  4HL4 A;  5EXP A;  1T3T A;  3AOE A;  3A46 A;  1IN6 A;  4QNR A;  7CAT A;  5FLX S;  4DR6 M;  1Z5C A;  3VFD A;  3KP1 E;  4IJF A;  1K82 A;  4X64 M;  4XBO A;  2L6O A;  3PNY A;  5EP3 A;  1Z6T A;  3AV0 A;  2XLJ A;  3DZD A;  4IBD A;  1HR0 M;  3GPP A;  1PJJ A;  4IJE A;  3GRY A;  4KHP M;  3FUT A;  2CUZ A;  4NSO B;  3I51 A;  2CV0 A;  1XWI A;  3I4V A;  5FTJ A;  1GVN A;  3GLI A;  1XXH A;  1TDH A;  4PDI A;  4NXM M;  4P16 A;  2RKO A;  2ZAN A;  4PT5 A;  1TGU A;  2G8L A;  4LF9 M;  1OJL A;  3CF6 E;  1L1T A;  5JI2 E;  2DHR A;  2V1C A;  4MB7 A;  3W0L B;  3FD9 A;  3GP1 A;  1DGH B;  3JR4 A;  1NY6 A;  3TWM A;  3GPY A;  2ZBK B;  4FCT A;  5EQT A;  1NNJ A;  1GL7 A;  3T15 A;  5KPZ A;  1KSF X;  3ZH9 B;  3UJN A;  2QBY B;  2V6Z M;  3IG5 A;  4DV5 M;  3FUX A;  2FE8 A;  4FW9 A;  4D80 A;  5KO3 A;  2I7N A;  4MM3 B;  4DUY M;  3U60 B;  4MGZ E;  4FWD A;  2M5Z A;  4JYA M;  2C9C A;  5KPT A;  3SAS A;  3KSJ A;  2D7G A;  2XGN A;  3FTC A;  3GRU A;  3T38 A;  3UK6 A;  2XZU A;  3FTF A;  3GQ3 A;  2Y21 A;  1L1Z A;  3J81 S;  1XMO M;  4LGY A;  1NJF A;  3SAR A;  4G4N A;  4DV1 M;  1E32 A;  3TPZ A;  3PVS A;  1SXJ B;  3GLG B;  1IN8 A;  2OPF A;  1N36 M;  2C96 A;  2HL7 A;  1QAM A;  2FFJ A;  2KZU A;  2KRK A;  4X62 M;  3RGS A;  2KA6 B;  1TH3 A;  2EUC A;  3HU3 A;  4GIT A;  3L26 A;  1C1K A;  3FKE A;  3K8Z A;  4AG5 A;  5BR8 M;  4DV0 M;  4DR7 M;  2VQF M;  2CFO A;  4KOD A;  4DV7 M;  3SAU A;  1S3S A;  1GLN A;  2V1U A;  2K47 A;  4DUZ M;  4BLC A;  1D2N A;  1N75 A;  3R8F A;  4LJA A;  2M60 A;  3U6Q A;  3SAV A;  3L2A A;  4JI8 M;  3L28 A;  4DR5 M;  1H6U A;  2C5R A;  4GRI A;  3DFZ A;  4XGI A;  2ZAM A;  3AJI B;  3DOA A;  4ZPX A;  5BPV A;  1DGB A;  1IM2 A;  3NBI A;  4JN6 A;  1Z5A A;  3VDU A;  3WHL A;  3HJS A;  1N32 M;  1IY2 A;  5FTK A;  5FTN A;  3HHW A;  5GKN A;  4OVZ B;  3SAW A;  2DWN A;  3C58 A;  3SAT A;  5IWA M;  1GKI A;  3B9P A;  2Z4S A;  3MK6 A;  5ITU A;  2VQE M;  4MGK E;  4JI2 M;  3KSX A;  4MH0 E;  4AG6 A;  3SMS A;  2KXE A;  3HWS A;  3U5Z A;  4LZZ A;  2X49 A;  5H37 D;  2CV2 A;  5ITR A;  2DVW B;  4L4U A;  4AKI A;  3GLH B;  1G8P A;  4II7 A;  1SXJ E;  3VK7 A;  2EO2 A;  4TUW A;  4B08 A;  4L16 A;  4LF5 M;  3K92 A;  2JA2 A;  4M0D A;  2NQ8 C;  1N77 A;  2CHQ A;  5DNY A;  3L27 A;  4NRV A;  3RFW A;  1J09 A;  3THG A;  4PCZ A;  4M9S A;  5JI3 E;  1ZQ9 A;  3GRV A;  4AKG A;  1JR3 D;  5C1B A;  4LG2 A;  1G41 A;  4KLN A;  3U6L A;  3ILK A;  4NL4 H;  2G5G X;  1QVR A;  4I4L A;  4B3T M;  4GC5 A;  1XMQ M;  2DXI A;  2L7H A;  1YE9 A;  3U6S A;  3LVV A;  4G4Q A;  4WW0 A;  1XXH B;  3KP0 E;  2C99 A;  3CF2 A;  2UUA M;  2R62 A;  3M0E A;  3KW6 A;  4JI3 M;  4G4R A;  3U60 A;  3GQ5 A;  4CIS A;  2CHV A;  3TE6 A;  4OX9 M;  3SBJ A;  1E9R A;  4DR4 M;  2BNK A;  3MHV C;  4FWG A;  3QWL A;  3FUU A;  3KXE C;  4GHL A;  3EIH A;  3J7A S;  4CHT B;  4LJ9 A;  3DA1 A;  5EP1 A;  1N33 M;  1I4W A;  2A5Y B;  4JXJ A;  3TWL A;  2BJW A;  1DGF A;  3E4R A;  4B7F A;  1XNR M;  4GMQ A;  1R6B X;  1G59 A;  4GIP A;  1NY5 A;  1L2C A;  3AOG A;  4R3D A;  2UUC M;  1J7K A;  4OU7 A;  1UM8 A;  1DGG A;  4LRS A;  2C9O A;  5IRE B;  4RF1 A;  3KS4 A;  2ZM6 M;  2LWX A;  1HNZ M;  3FYD A;  3GRR A;  8CAT A;  1N34 M;  1FJG M;  4IBF A;  1VDD A;  3E9S A;  3U6C A;  5LMU M;  1OFI A;  2KEB A;  1Z5B A;  3U61 B;  2ERC A;  1IBL M;  1IN4 A;  3A98 B;  1QYR A;  4QHS A;  3VK8 A;  5KQD A;  4GKK M;  1FNN A;  4AQY M;  3SMP A;  5ITT A;  2AHM A;  2R4E A;  4IBG A;  1HQY E;  4AZF A;  3I4Y A;  5KPR A;  3CTW B;  4LCB A;  2QEN A;  3JR5 A;  2F5P A;  4B7H A;  2F5O A;  3GLF B;  5EJC A;  4JI0 M;  4DV3 M;  4MGH A;  4R7G A;  4GKJ M;  3KVW A;  3GO8 A;  4NSR A;  3GLG A;  4PD2 A;  4LJ5 A;  3GQ4 A;  3U6D A;  4M9X A;  1Q39 A;  4WUR A;  2Q2E B;  3HJ8 A;  4OW0 A;  2UXC M;  4JI5 M;  2LXE A;  5FSW A;  4LF6 M;  2ZAO A;  1LV7 A;  3SHF A;  3U6E A;  4JI6 M;  1IXS B;  4I81 A;  3A42 A;  4RF0 A;  3SHG B;  3EIE A;  1E94 E;  5EXX A;  5DYG A;  3HGI A;  4RNA A;  2CEA A;  3GLI B;  3T1H M;  2DWL A;  2L09 A;  2F4V M;  2F5Q A;  3AOE C;  1N78 A;  4M9Z A;  3J2P B;  3HKP A;  4LJ4 A;  5DYI A;  2RGO A;  3FUW A;  4QNM A;  1R2Y A;  4FCV A;  3PFI A;  1NVM A;  2XFT A;  3ZC7 B;  1SXJ A;  3KDS E;  3RGP A;  3U6O A;  2XH9 A;  3W0F A;  1JR3 A;  3ZCB B;  1I94 M;  3K2L A;  3BOS A;  3QAU A;  4PDG A;  1QAN A;  1K3X A;  2Z3X A;  1W5T A;  1X37 A;  2KRU A;  3R9X B;  1IN7 A;  4GHA A;  1HT2 E;  4OVZ A;  4G4O A;  4LF8 M;  4A3V B;  1SXJ D;  1MX0 A;  2L7I A;  4B3S M;  1HQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...