2Z4SA

Crystal structure of domain iii from the thermotoga maritima replication initiation protein dnaa
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
240
structure length
240
Chain Sequence
TPLNPDYTFENFVVGPGNSFAYHAALEVAKHPGRYNPLFIYGGVGLGKTHLLQSIGNYVVQNEPDLRVMYITSEKFLNDLVDSMKEGKLNEFREKYRKKVDILLIDDVQFLIGKTGVQTELFHTFNELHDSGKQIVICSDREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKSIARKMLEIEHGELPEEVLNFVAENVDDNLRRLRGAIIKLLVYKETTGKEVDLKEAILLLKDFIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Chromosomal replication initiator protein dnaA
publication title A Common Mechanism for the ATP-DnaA-dependent Formation of Open Complexes at the Replication Origin
pubmed doi rcsb
source organism Thermotoga maritima
total genus 82
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00308 Bac_DnaA Bacterial dnaA protein
A PF08299 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z4sA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2z4sA01
4PAMA 1YRAA 3NIBA 2ZUBA 4Q1DA 3CPEA 3HJNA 3MD0A 1LNZA 3RRZA 5AJZA 4DB4A 2Z5FA 3AVOA 3VR5A 2FG5A 4A0RA 1IHUA 4CEHB 2CCGA 1TEXA 4C0LA 3DO6A 2P67A 4DIDA 2GK7A 2V8OA 1E4YA 2AWNA 5FUXA 3UATA 2C99A 4ESVA 3X2SA 3ZD7A 3AKYA 4MUAA 3I3SR 1SULA 1WRBA 3MJHA 5IT5A 1W46A 2BJWA 1BO6A 4I99A 4NYJR 5G40A 5EXPA 4BFYA 1CR2A 2FPLA 2HUPA 2HYDA 1SKQA 1N5LA 3QXHA 4MGZR 3EZ9A 4AG6A 3PUWA 2R44A 4CGZA 3EC1A 1Z28A 1G3MA 2IHBA 1N0VC 2FOLA 1R6BX 3BGWA 1CR1A 4IDQA 3X1XA 1E9SA 4I4LA 1NKSA 1HT1E 1CKEA 3K0SA 3OE7A 2PLFA 2IUUA 1VTKA 4PPNA 4GZLA 1IN7A 5KNDA 1ZU4A 4L5BA 1KIMA 2ONJA 4UJ5A 1EX6A 3GLFA 4IOJA 3K9GA 3KKNA 1MT0A 4QM6A 2OEPA 1N6HA 2MSEB 4B43A 2D3WA 1KI4A 4B2IA 3A37A 2KJQA 2GXUA 4XSGA 4MRVA 1EK0A 1Z3IX 3X1ZA 4P4SB 4BQSA 4JN6A 4OI4A 2GJ9A 1NY5A 1GFIA 4C0AC 4XWAA 1O87A 2IA5A 2GDJA 3QXSA 1Q1ZA 4ZV4A 1FP7A 2QQ0A 4BPBA 5EE0A 4A82A 5EP1A 1HH4A 1NMYA 2IUTA 3PUZA 2O8CA 4TZ6A 2IW3A 3QKSB 4YQFA 4NKRA 1F2TA 1GG2A 2ZJYA 3H1TA 5FOXA 1FUUA 5DISB 4ARZB 2DY1A 2QP9X 3VR4A 2FZ4A 1R0XA 2WJJA 2VEDA 2VSXA 2ZRFA 2W6ID 1CRPA 2WAYA 4B3BA 5FBWB 1CLUA 1M34E 1RJ9A 4RD3A 5E7IA 3FKSD 1XCMA 1NSTA 2JDID 4JVLA 1H8EA 4LYFA 3RS4A 3RS2A 1DAFA 4CZ2A 3I61A 2YWEA 3AUXA 3K0CA 1OFHA 1DG3A 2D62A 2IWHA 3X1YA 4GNKA 4N0EA 4B33A 3EASA 4HYYA 4JYCA 4UXJA 3I1FA 3U44A 3M0EA 4HZIA 4JVSB 4PC2A 4F4CA 2GESA 3L0SA 2DWQA 4IOKA 2J7PD 3FMOB 4JLJA 3P27A 3SJZA 3BRWD 4LUCA 2O8DA 3ZDQA 1NBMD 1GRQA 4U5XA 5E7MA 5JWRA 2C5LA 1SVMA 1OKKD 2C8VA 4IXNA 1G5RA 1NMZA 3AGPA 4M1WA 3TK1A 1XD2A 4Z54A 2C03A 3MWJA 2HCBA 1KK2A 1SXJA 1G3UA 2WSMA 3CRQA 5FBQB 5F3WB 5JS8A 1XMJA 3A1TA 4A36A 3SJBA 4IVQA 2V7QA 1TU3A 2QUZA 2BMJA 3NXSA 4AURA 4DCVA 2PJZA 4ZDKA 1KNQA 3I4LA 3N2EA 5IK2D 5FL7D 3TQFA 1VECA 2CCKA 1TAGA 3IILA 1KKMA 4ZIRA 3K70D 2ZJBA 2O52A 3ADDA 3O8CA 1QZMA 1M7BA 3OZXA 4MRNA 3PEWA 4A6PA 3GJ6A 3SHWA 1W0JD 1AN0A 1E2JA 1LF5A 1L7VC 2RGCA 3DM5A 3EZFA 1G16A 4NZYA 5EE9A 4Q21A 3H0KA 3K0EA 3HWSA 2GZHA 1US8B 2MMGA 5GVSA 5LB4A 1KI6A 2HLDD 3I32A 2PZEA 4V0ME 3X1DA 5F9HA 1UKVY 2W83A 4PPQA 3ZLJA 3J81k 2HV8A 1OSNA 2XTMA 3BXZA 2BJVA 2GCOB 2GXQA 1WBDA 5BN4A 3ZZ0A 1F6BA 4NH0A 4QJ4A 5CIQA 8OHMA 4XVUA 1FQKA 3TSOA 1PLJA 3FOZA 1GVNB 2REOA 2RB4A 2ZETA 4BZXA 2J0UB 1EWRA 3UG7A 3NTUA 3WXMA 2VSFA 1R0WA 3KJHA 1M2OB 1GTVA 1LVGA 1BYUA 2IXFA 2B8TA 2FSGA 1CJVC 3IBYA 4B3XA 3UXMA 5G3YA 3TUJC 4XJXA 3S1AB 2A3RA 1KY2A 4HUQA 4IRUB 3R9IA 3CBQA 3EPKA 3ND9A 3F3YA 3RSLA 3T1VA 3B1ZA 5TMPA 2Z6VA 3ZQ6A 4PPGA 1HA3A 4PO9A 2BEJA 4W5JA 4TLDA 2QAGB 4MKFA 1TNDA 2V9PA 2D06A 3BWDD 2P0EA 3GJ0A 1IAQA 2IYSA 3GCGA 3SNHA 4C0QC 4YMVA 5CB8A 3LQQA 2VL7A 1JNYA 2V6ZM 4RJLA 2HT6A 1Y3AA 2GAAA 3FPAA 3LDAA 5B30A 2OUKA 2DVWB 1Y63A 4EJSB 3ADBA 1NI3A 4UJ3A 3ECCA 4D81A 2FX3A 2W6JD 4LHZA 1EGAA 1JEDA 1UADA 2GAOA 5FL3A 1XTSA 3EA0A 1N6IA 2PEYA 5JFGA 3OFND 1E1RA 1NIJA 1ZW6A 1IN8A 2FZLA 4JLBA 4A2QA 2W2XA 4CEJA 3PEYA 3HPRA 1KJYA 3GLHB 3NKVA 2IYZA 3GQBA 3K0AB 3KFVA 3OEEA 2GBLC 2WSSA 3IBGA 4JT4A 1KSGA 2V54A 3UKDA 1E2MA 2GJKA 4R2IA 1JXMA 1CEEA 3HYRA 1G8YA 1ZVQA 3CM0A 1V43A 3KQLA 2J87A 3WYFA 5K8LA 2B21A 1T0HB 1EFHA 4OBEA 3BOSA 2G88A 2VHTA 2QENA 1GSIA 2G1JA 1U2RA 4HAZA 3W3ZB 4AKGA 3JZAA 3MRSA 2X2EA 2HXYA 3LH5A 2JLVA 3IPXA 3WBKA 1KI3A 5E4FA 1IY0A 1E0JA 1V5WA 4PSKA 5FPSA 3U3MA 4HI0E 1LY1A 2ZRCA 3FFBA 4Z8YA 1OHHA 1ETUA 3TR0A 2ZE7A 2DHRA 1R5OA 1XJCA 3AVWA 4B3CA 5KHOC 1RPZA 2QAJA 5KPJA 5B57C 1UDWA 4LOAA 1R8SA 1KMHA 4Q4HA 2YHSA 2P3SA 1N0WA 4I1UA 2UVQA 1KTVA 2QPOA 1GP2A 2RGDA 3KX2A 2ZSFA 4Q1FA 5CITA 3VR3A 1CJMA 4QGFA 2D7CA 2F43B 4LY6A 4FXPA 2P6NA 3K70C 2QGZA 4YC7A 4FD2A 2FFHA 4FMDB 1SQ5A 4GRAA 4H9GA 1MO6A 3L0OA 4F4IA 3AP1A 3AP3A 4XIGS 1XPUA 1XTQA 3O8DA 4TYYA 2JLRA 4F7WA 1VIYA 1KJZA 4GBMA 4IDOA 4GL2A 2E9SA 3UMSA 1W2GA 5DE3A 1I4DD 3LVQE 4IJMA 5E7JA 4A8JB 4A2PA 1F3OA 2QE7D 3B1XA 3TSZA 3X1WA 4KO8A 2ZVQX 3VX4A 5C2JB 4JMPA 1EXMA 1FMJA 4OI2A 4URVR 1J8MF 4GFDA 3P4YA 4P31A 1GITA 1NN1A 2AX4A 4HAUA 2NQ2C 1U99A 2WJGA 3KXKA 3AUYA 2RHMA 3SR0A 4MYTA 5FOSA 1XTIA 3T5GA 3OF5A 4NCIA 1GDDA 4UXHA 2I1QA 1BYIA 5UKDA 3W5IA 4EPVA 1NG1A 1P4SA 3W9YA 3EARA 2F3RA 1CIPA 1XF9A 3C7KA 4D0NA 1ZM7A 1LW7A 3MLEA 1E2PA 4UNPA 2NOAA 2VP4A 4LZZA 5IF9A 1CJKC 4FIDA 2BBTA 2P6UA 3WRXC 3B1YA 1COWD 1IQPA 5BN5A 4FWGA 3MG9A 1VCMA 2ECKA 1E9BA 4TTQA 5IDVA 1S1MA 5F9FA 1YR9A 1UKZA 3CRMA 4QBFA 1FTSA 1ZMXA 3PV0A 3DOEA 3IIJA 3QKRB 2H16A 2WBLC 4J0QA 1YVDA 1II9A 2W6IA 4LJYA 3GLHE 1G17A 1P2TA 5DHAA 2CBZA 1GRRA 3GFPA 1X37A 1N25A 4IOMA 3H86A 2QSYA 5KDOA 2F7SA 2JLSA 4M1YA 4CT4B 1DAEA 3ZZUA 3LX8A 4YDSA 1Z07A 3KKMA 4L15A 2ZE5A 4DLVA 2CL7X 4BWYA 4NHOA 6Q21A 2VP2A 4JT2A 2ZRLA 3RC3A 4NMMA 2YV5A 3B60A 4MRPA 3L8YA 5D3QA 1MRSA 2HEIA 2P5TB 5FOVA 2MSCB 4JLAA 1TQ2A 1E1QD 2J7PA 4U00A 2EYUA 3TAUA 1IBRA 2H18A 1ZM9A 3ZVRA 2WIAA 5C18A 1OKKA 1ZNZA 3HR7A 5A0FA 3QF4B 4Y0AA 2ZYWX 2PEZA 4V0NA 1IY2A 1TU4A 2GCPA 1G7SA 1R0YA 3QUSA 1QHXA 2C96A 4JKYA 3GFTA 3MGCA 2FFAA 4DDVA 2IHYA 3B85A 1E9RA 4NE2A 1PLLA 3CO5A 4E22A 1Z6XA 3SS8A 5BYKA 1KSHA 3R7WA 1JQJC 3QEOA 1P72A 1DAMA 1Z0JA 2R2AA 5J47A 3FYHA 3E2IA 1LF0A 4B48A 2C98A 1RW4A 4HLCA 3A58B 3TIFA 2OV2A 2QT1A 3K53A 4NPHA 2NZ8A 4URUR 3A6PC 1ZUNB 5FPKA 3BBPA 2C77A 4EFLA 1N6LA 4WIAA 2VP9A 4KJZA 2PJRA 2XTZA 2EFHB 5AJWA 1E2FA 2JJ2A 4JL5A 3RWMB 1RYHA 3PG5A 1M7GA 2JLQA 4FMDF 5F2EA 1UFQA 1FL9A 2YYZA 2HLDA 3QQ5A 4MDEA 2O8EA 2OCAA 2WWGA 4R7ZA 4HB0A 1N2CE 3SFZA 2ZSDA 4XD7D 2DCUA 3U7HB 3WYGA 2O8BA 4Q18A 2CJWA 4FN5A 1S4QA 4X8LA 4GOJA 4RZXA 3QXJA 1E6CA 4IDPA 4OQLA 2X19A 2RKOA 2AHOA 2ERXA 2QM8A 4ON9A 2PL3A 2B7BA 1KO1A 2BC9A 4TL9A 4GI7A 4LYJA 2XSZD 1Q12A 2R62A 3DKPA 1J8YF 3QY0A 2GJSA 4W9MC 3W8RA 4UNQA 1ELOA 3K9LA 3CKLA 1YZNA 3I8XA 4A4DA 2DZOB 1W5TA 1W7AA 1JEEA 1OB5A 1T5IA 3SI7A 3RNLA 3PJRA 4LV6A 2HT1A 2ZI9A 5TV2A 2ZRGA 4MRSA 1NRJB 4W7SA 2FGKA 3WHLA 4DC9A 1WB9A 3WHKA 4WOPA 2DWZB 1E9EA 2ZSAA 5LD2C 4L16A 1G4UR 5DN6A 2G83A 4X8HA 4F92B 2MSDB 1ZU5A 1FMLA 2JIZA 2ZI7A 3CRVA 3IQWA 3C14C 1WP9A 3K09A 5FBLB 2B7CA 3L8ZA 3U4QA 3KJIA 1G8HA 4LWZA 1JECA 4EQ6B 3O47A 1KDRA 5FBVB 3HU2A 2IYTA 3AVYA 1FNMA 2JGNA 2XX3A 2VHCA 3OFNA 2I4IA 3U3OA 4ERNA 2ORIA 1IJEA 2QG6A 2VIIA 4QGAA 5HR5A 1OB2A 4TL6A 1VG0B 2HCJB 4AKHA 4FCTA 1T4GA 4B3GA 1LS1A 4FCWA 3RHFA 3C15C 4MGYR 2Q9CA 5J4KA 1P3JA 5EE3A 2QPTA 1XMIA 3ICEA 1ZINA 4TWZA 5E95A 1SVIA 1P2VA 2G3YA 4XTCS 4LK2A 4N1AA 3CF6R 3SC3A 1JQLB 1RKBA 1B0UA 5KSPA 4L4UA 3GLIA 1T3HA 1KNXA 5JJIA 4URXR 4PQYA 4U7DA 5H68A 3VFDA 3BE4A 3IKJA 4M1SA 4KFTA 4Q47A 2CL0X 3IQXA 2FSFA 2OE2A 1U0JA 4AIIA 2OAQ1 4P3YA 2QL6A 5FI1B 3U61B 3OIYA 1QHYA 2H5EA 4L9WA 3U3KA 4D4KA 4PQRA 4BLOA 2FPKA 3MFYA 1J7KA 4ZDWA 4ABYA 4AYWA 2ZE6A 5EJEA 4Q4AB 2V3CC 4LJ8A 4BLQA 4C7OB 4OHWA 4WXPA 4FMCF 1II8A 3I92A 2CXXA 2D2FA 2ZTSA 5EUMA 2GHIA 2GVDC 3GMTA 2UKDA 1ZBDA 4EPRA 3T5DA 3CRRA 4HLUA 1AA9A 3EZ6A 1S2MA 1X8KA 1KK1A 3EXAA 4WAUA 3A1SA 2YJTD 3TLXA 5JSZB 4A0FA 1KO4A 1DAIA 1DTSA 3AQ4A 1F2UA 1ZUIA 4HZUB 3QSYA 1HURA 5FI0B 3SFVA 3B13B 4C9BA 4JKIA 5LPNA 5HKKA 3V4RA 3T61A 1S3GA 1TQ4A 2BCJQ 4DLYA 3D8BA 2XNSA 5HCIA 3LBHA 4GPTA 1KAGA 1OH6A 5AUQA 1WBBA 2VHUA 4GDFA 1EFTA 1A5TA 1Q3TA 3CNNA 1DO0A 2ORVA 2QE7A 1PVOA 2ZRBA 2F6RA 3SDZA 3NDBB 1S9HA 1G18A 4I1OA 1TF5A 3BC1A 2OLKA 3EX7C 2AK2A 5BYJA 3H4MA 1G1MA 3CPHA 4MRRA 2ZJ2A 2QMOA 2RGNC 1ZD8A 1BH2A 1S1CA 1SVOA 1X1SA 1Z6TA 2WICA 2WWFA 4NYIR 3BK7A 5KU1A 2FH5B 1NVUQ 2WVJA 3PQCA 1KY3A 3MHVC 2PMDA 1W4RA 4FWIB 4B76A 1G7CA 3AF4A 4GP7A 1M6NA 4RSGA 1OPXA 4YMWA 3Q5EA 4C0JA 4M4SA 5SZKB 2IX3A 1UEJA 1UAAA 5LDDC 3CF2A 4DKXA 1COWA 3TGPA 4TL8A 4K46A 3KQNA 1YR7A 1G5PA 5D3MA 5C4GB 4D6PA 2JLWA 4YXWD 4QJ3A 2ZEJA 1UPTA 2GTPA 3N70A 1NN0A 3RAPR 1F2TB 1CULC 1XX6A 3BFKA 2Z0MA 4Q66C 2QZ4A 2ZJZA 4YDHB 4JBWA 1W4CA 5L3VA 4OYHA 2AR7A 1D2NA 1WDTA 1AZSC 4B75A 1WF3A 1RJ9B 2R6DA 4RFSA 1AM4D 3KXLA 5JHHB 1E69A 1FNNA 1W48A 5J5CA 1DBSA 1SHKA 3UK6A 1JR3A 3KXIA 3QIAA 3HDTA 1Z2AA 3SEAA 2ZR9A 4TT3A 4JLMA 1E1QA 3VU9A 3OEHA 4PX9A 1IN4A 1GIAA 3GD7A 3EC2A 4PPFA 4O2LA 5JRZA 5KTYA 1KDTA 1MABA 4WA7A 4ZO4A 3U44B 2GWHA 2QGNA 2PT7A 4RD6A 2KB0A 1XU4A 2ZI3A 3Q7PA 1ZNYA 2O8DB 3VTKA 2J46A 2QPAA 4WW0A 1MKYA 2JLUA 4GZMA 4TMTA 4PHGA 1XD2B 4TZ0A 3UIEA 1G8FA 2YINC 2WJVA 1N5IA 1SXJB 3N5CA 3RWOA 1KI9A 1M74A 1Z83A 2QSZA 2YWHA 3G82C 1XPOA 1FQJA 1Z0DA 1ZAKA 3EAQA 1SZPA 5P21A 2NTYC 2RGGA 4PAQA 2J41A 3BORA 4YONB 4FCVA 4BRWA 2C9CA 4BE7B 4PAOA 4IDNA 3D31A 3PEVA 2WHXA 2CEAA 1Z0IA 2ODNA 1ZIPA 2VBCA 4IXMA 1U8ZA 1NVXQ 2ZYVX 4NU0A 4NP6A 4PC3A 4ZIRB 3MSXA 5L3QA 3UWOA 1KSFX 2GXSA 4B47A 5JJKA 4IFBA 1ZM3A 4PSVA 1QHHA 5CDFE 3P26A 4X8MA 3V00A 4D2IA 1OFTA 2CLDX 2ZI4A 4AKIA 1E79D 5KUTA 2CE7A 2YOFA 3BFXA 1AKEA 2WPDD 4OQXA 2JATA 2KBEA 2V1UA 3EZ2A 4II7A 4IOLA 4Q4JA 1XRJA 5J4YA 1KI6B 3P1JA 2R9VA 1KI2A 1E2EA 1P60A 4GSYA 2HYIC 3IEUA 4PC1A 2GEVA 5C4MA 4PC6A 5AJYA 4E07A 4G5QA 3ZJYA 3SQXA 1KDPA 2WM9B 2ZIAA 4G0NA 2KI5A 2WWWA 3PR1A 3KL4A 1OYWA 4MYUA 1T91A 1JALA 2BOVA 1Q44A 2OILA 1ONBA 4H1VA 4DUGD 3AJIB 3ZS9A 1VHLA 3SJAA 2CLCX 1P6XA 1D8TA 1G21E 3PXGA 1NIPA 4V02A 1G6OA 3VKGA 1U9IC 3ND8A 1XJ0A 3PUVA 1D5CA 3R20A 3AKCA 4CEIA 4MGKR 1GWNA 1X8LA 5GADl 2CHGA 1DS6A 3WNBA 3WBJA 3ICQB 1RIFA 4HUQB 3LWNA 2FFQA 4QRHA 1R2QA 2TMKA 4UNRA 5JI2E 1II0A 1KO7A 3U7GA 1A1VA 4M9ZA 5TARA 4FMBB 4DDWA 821PA 3TKLA 1KJWA 2DZNB 1HQYE 1K5DA 4G01B 4RZ2A 4TTRA 4KSCA 3GEEA 4RD0A 5CK5A 3B82A 1NNEA 3M4YA 2ZRKA 4HUTA 4Q9JA 1CRQA 3QG1A 1EX7A 3W8NA 4B71A 3EWSA 4CEJB 4DT1A 4UNNA 3IGFA 4RKEA 2XAUA 4DZZA 2WV9A 4JBYA 5CYPA 1O3YA 3ZIAD 1GILA 1Z2CA 5EXSA 3UMFA 3TJZA 1MO4A 5IRCD 4URZR 4CDGA 4A9AA 5HZHA 1U98A 5A5GA 3KKOA 1SXJE 3QXXA 1RYFA 3RRNA 1JPNA 4OK3A 4PQFA 5CB6A 1GRNA 4N3NA 2XGJA 1QDEA 2R8RA 3QXCA 2GZDA 1R10A 3DDCA 4JYBA 2LWIA 2ODBA 2RGEA 4DRZA 4IW3B 4KVGA 2J45A 3CLVA 3GLGA 4DDTA 1YQTA 2FWRA 2C9OA 1L8QA 4P4SA 1KSJA 4OHYA 4K81B 1JI0A 1OYYA 3TBKA 1EFRD 2BHRA 3PENA 3B9QA 1QVAA 4F38A 4KU4A 2IYLD 2GCNA 4RD4A 1E4VA 2KRKA 2QY9A 3REFA 3QKSA 3TQCA 1WCV1 1FW6A 3VMFA 4OJQA 2YZ2A 3NC0C 2ZJ8A 2GJ8A 3KJGA 4HDQB 1KMHB 1UDXA 4JJKA 4TQAA 5AJXA 3T15A 4Q9HA 4ARZA 3L43A 3I5YA 3CNOA 2CHVA 2QAGC 3TUIC 4CRWB 2DYKA 1QG2A 1ZYUA 4KYUA 3C8UA 2RMKA 3A8TA 1KHTA 5B58C 4PO8A 4YMSA 1L4UA 4RY2A 4A92A 1JPJA 2I3BA 1Z29A 2Z4SA 4RD2A 2FA9A 4X8OA 2R6GA 2IXEA 4CT5A 5DHFA 5B2ZA 4EJSC 2K5UA 4US2R 3AV0B 1G41A 2GKSA 3A4NA 2CDNA 5CM9C 1RFLA 3NHAA 1A7JA 2OXCA 2IXGA 1I4TD 2AFIE 3TMKA 3VR2A 2WWHA 3PVSA 1VG1A 1W4BA 4NTZA 3HP1A 4FWHA 5DLQC 2IYQA 4E03A 1E0AA 1Z08A 2IWRA 1L2TA 4QFMA 1T0JB 2IYRA 3TSWA 1HT2E 1E98A 2HXSA 4BLRA 3V4FA 4Q03A 3WYAA 4D4JA 4DLWA 4E09A 1VG9B 2F1RA 5BXQC 2JA1A 5JCZA 3I72A 4DCNA 3EPJA 3T1TA 1FFHA 1CTQA 4M9SA 3OAAD 1W0KD 5JCPA 1A82A 4GMDA 2BM0A 1S3SA 1DOAA 3GEHA 3TR5A 5J4HA 1BS1A 2XEXA 3WMFA 2ZI6A 1FX0B 3BIFA 4WBSA 4YXWA 4XVQA 4BZPA 4QM7A 4LJ4A 2DFNA 2AFHE 4QBGB 3LBIA 4P4UA 1HE8B 5G53C 4PC7A 4V0OA 1A4RA 3A1VA 4IKEA 3VKWA 2QNRA 1Z0FA 1E9DA 3B6EA 1E2QA 3T1QA 1RC8A 1NVVQ 1SVLA 3FMIA 1LB1B 1OFIA 4D4MA 2AD1A 4LX0A 5FBRB 4ZKEA 2N1BA 4DCSA 1CU1A 1TUEA 3WMGA 1Q3HA 621PA 3KTAA 3K0FA 3Q85A 1DADA 4PHFA 2IS6A 1NVWQ 1NJGA 3VQTA 5K8TA 3FMFA 3NVAA 4TLCA 3RLFA 2Y8EA 2PH1A 1KKLA 3LQRA 1E2HA 1OXVA 3EPHA 1Z5ZA 4LBWA 3BB4A 1Q1QA 4B44A 4M1OA 1NVMA 1H65A 2ANBA 4Q1CA 2Q6TA 3JZMA 1FTNA 2PX0A 1WMSA 2GNOA 1J99A 1N3BA 3IDQA 4TSFD 4A8JC 3M6AA 4B2PA 3OIWA 1JAHA 2VF8A 4TMWA 3RSOA 4LHXA 1FUKA 3L0IB 5EZ5A 1AZTA 1GKUB 3DMDA 1DPFA 5CK4A 2PCLA 2YWGA 2FPMA 1QHNA 1E2IA 1P73A 5M04A 1E9CA 1YKSA 3CRW1 5EE1A 3GP8A 1Q1BA 4M1TA 4KVAA 4F93B 1HV8A 1N5JA 3LNCA 2BMDA 4DDUA 2FNAA 1HE1C 4NCJA 2XOKD 3VLFB 1DAGA 2OBNA 1Q1EA 2ZAMA 1W1WA 1BMFD 1F60A 2KE5A 4LHWA 3JVUA 4HB2A 3GJ8A 2ASEA 4QNMA 1E79A 2QTVB 1YZUA 3CUEF 3QPVA 4D26A 2WMOB 2QI9C 5AUNB 1KZGB 5DYGA 1VCOA 1UBEA 3CX6A 5DI3A 4BFZA 3CWZA 3AKEA 1IY1A 2BBSA 2O8EB 3FTQA 3AGQA 1ODFA 2OCBA 3DEFA 4JSYA 2YKGA 3I8SA 4DLUA 3TW8B 2V55B 5GJBA 2WMNB 2AXNA 3K0AA 2GEDA 2O8BB 2CJWB 2A9KA 2RHDA 3SQWA 3HYTA 1VCIA 2EFGA 1X1RA 1YHNA 2GA8A 2VHQA 2ZU6A 5JEDA 2GBLA 4LYAA 2OFXA 2WKQA 3VR6A 2CNWD 3FKSA 1DAKA 2JDIA 1AS2A 2Z43A 1P62B 2F1JA 2YOHA 1G3IA 3D7MA 4UKDA 1JJVA 2D7DA 2HDNB 3LW7A 3KKPA 4JLPA 2ZUDA 2DB3A 2ZPTX 2J0VA 1IONA 3NH6A 3K9NA 4DLXA 2IS4A 2BMFA 2FJUA 1NN5A 3BH7A 4LBYA 4KFUA 1Z6AA 2OFWA 1HEIA 4D0GA 3IO5A 3CZPA 1NBMA 2FEOA 1NY6A 3JVVA 3AVUA 2A78A 3PITA 2BBOA 1Z6GA 3O8BA 3FGNA 3HPQA 4EAQA 4CF7A 4XTRA 2BWJA 4A15A 5L3SB 1PJRA 3NBYC 4YLGA 5AR1A 3R8CA 4JLDA 4QHSA 1LV7A 2V6JA 2FU5C 4FW9A 4ZCLA 4O3MA 4BLPA 2QN6A 2F3TA 2WWIA 4F4JA 5K8IA 3U4QB 2KBFA 3NBFA 3U5ZB 4JZKA 2XXAA 1OE0A 2EFDB 2EU8A 2W58A 5TDHA 2Z83A 4AKEA 2NIPA 3Q5DA 3P32A 5IK2A 5FL7A 3BJIC 4FWDA 5JLJA 1S8FA 3FDIA 3THWA 2CK3D 3BAFA 4LV5B 4RCYA 5FPTA 4L8GA 4G3XA 5G3ZA 4ILEA 1W0JA 1R5NA 3IEVA 4BEBA 4ESHA 1LS6A 4NDZA 1OF1A 2NO7A 5FR2A 4DJTA 1JXOA 5FTMA 3THXA 1CJTC 4MDFA 2EWVA 3GLIB 1RE0A 2IK8A 2WJYA 4JLNA 2OG2A 1P61B 3OE7D 1P5ZB 3I62A 3EG5A 4EPYA 1G3QA 1T6NA 2L0XA 5B64A 4ACBA 1E2GA 1KI8A 3LD9A 3RVBA 3THOA 1P9RA 2FN4A 2ZS7A 2IT1A 3ZVNA 5JJLA 2VSOA 4GOKA 4QHYA 1M8PA 2VRWA 5DO9A 2IYWA 1JJ7A 3EW9A 1OH8A 1Q21A 1J90A 1II8B 5JS7A 3DKVA 4IEEA 3CONA 1NG9A 2G1KA 4BUJA 1GL6A 1VYVA 4G5RA 1E2NA 5C1BA 1S0UA 2GZAA 2WKRA 3IUYA 2Q9BA 2WIBA 5HCNA 1J2JA 4US0R 1U90A 3NDPA 1NVVR 1VDZA 3ETLA 2WAXA 2WZQA 2A5FA 3CH5A 2ZJAA 1TTTA 2O8FB 1F2UB 2BV3A 3VNUA 5FR1A 2BDTA 3ADKA 3KQUA 2ZSEA 3FB4A 3GJXC 4M53A 1NMXA 1BIFA 1NLZA 4Q7JB 1NKTA 3SYKA 3QG5A 1XD9A 3B1VA 3QBVA 4D25A 2ZRNA 4Q4LA 4HAXA 4NYJQ 3ONWA 2QRNA 2CVHA 2H17A 4XOIA 3W34A 1H8ED 1EFCA 2NO9A 3AB3A 1XP8A 2W6JA 3FFAA 2REBA 2ORWA 5AUPB 3R9XA 1B23P 4HB4A 1VIAA 4DXAA 4Q7MB 2GJAA 4KCGA 3RRMA 5SZHB 4S2EA 5EP4A 3RS0A 1G8GA 1MV5A 1QHGA 4ASUD 3WP0A 4CVNA 2FEMA 3T1OA 1E0KA 2VQSA 2W0SA 3U6BA 1TPZA 3KDSE 1XXHA 4KV9A 2ZQ5A 1AQYA 1Q57A 4GP6A 1X6VA 3WMEA 1DE0A 3AVTA 2GXAA 4MKGA 4BASA 3RDPA 1XTKA 4LSGA 5LB2A 1M1YE 4G5SA 5KSZA 1N6PA 4XWOA 3O8RA 2VP6A 1VYTA 1D2EA 5FTJA 4ZCMA 1SXJD 2AWOA 1ZJ6A 2BEKA 5SZJA 1UJ2A 4PHTA 3TW4A 3H2YA 4Q01A 4B74A 1GM5A 2WWYA 3RANA 5KYKA 4EUNA 1XEWY 3DZ8A 3FE2A 1KGDA 1XMSA 3Q9LA 2BVNA 3BD9A 4DHEA 3C16C 721PA 3IIKA 4LI0A 1PUJA 2IL1A 3U7FB 2HJGA 2WOOA 2ZYTX 2ZSBA 2ZITA 4GITA 3RYTC 1U0HC 2P65A 4XVRA 2CE2X 3TVTA 1GZSA 3QBTA 3LO5A 2JJ1D 3R9WA 3MCAA 2A5YB 121PA 1NLYA 1XZPA 4HEJA 1E32A 2FSHA 4KLNA 1GKIA 3FHOA 2VA8A 4KHZA 1GNPA 3GLIE 3EIEA 1G64A 1G9XA 1IOZA 1HY3A 2ONKA 4S35A 3PUYA 3T12A 3LXXA 2Q21A 4KLZA 3RS5A 2H57A 1EWQA 1I2MA 1GKYA 3VU9B 5KO2A 2VO1A 4C0BA 5AJVB 3THYA 2QTHA 5CLQA 3SN6A 1JBKA 1MABB 1RVDA 2OBLA 3K1JA 1VYUA 4QNRA 4BFVA 4BFTA 1YZKA 2QMUA 1MR3F 3QKTA 4O0MA 3T35A 3C4JA 3U60B 4AWXA 4BGDA 2GETA 4R2HA 1N6OA 4TLEA 4TLBA 3U7EB 3LRPA 3AH8A 1YZGA 1MO3A 3TNFA 3WY9A 4M9XA 4Q9KA 3MAAC 1X8JA 2B92A 3OIVA 3Q8XB 2QP4A 1CJUC 1JB1A 2XJ4A 2IF2A 4BFSA 1TADA 4G1UC 2BBWA 4TYNA 2W0MA 2OCYC 3GLFB 3CNLA 1GL7A 3NBXX 2OXRA 3MJRA 4ACAA 4QGHA 4EQ6A 1OIVA 1X86B 3F8TA 4GOXA 5ELXA 1ZCAA 1QHHB 3AF1A 2RGXA 3WRYC 1BKDR 4JS0A 3TAHA 1OV4A 3RRYA 1SKYB 2XNDD 3OESA 2J5XA 3LW8A 3FMPB 4TQUS 4KI0A 5KSOA 2FMXA 4Q4JB 4XSHA 1E1RD 2ODWA 2WJIA 2O8CB 3B9PA 3WP1B 1CBUA 4BLSA 3EWAA 4V0LA 1XD8A 2W2VA 4KBGA 3TRFA 1ZNXA 1MOZA 2WJHA 4QOSA 1EESA 2FDCA 5E3HA 2EWWA 3LBNA 3OEED 5JRJA 3QJYA 1MH1A 2REXB 4RVCA 2Z4RA 1Z22A 1GAJA 4LC0A 4M22A 5JMTA 3LX5A 4RFVA 3K0CC 5J4LA 3AVXA 1NP6A 3L0PA 4WZ6A 1KI1A 2W2TA 4JBXA 2OLJA 4CEIB 5EP2A 2GK6A 3B1WA 1GOTA 4AY2A 2QM7A 3PEUA 3G5UA 2J3EA 2FGJA 4IDHA 4JLKA 2A5GA 4PZLA 1X3SA 4UQOA 3LFUA 3P4XA 3L2OB 4EPTA 1OHHD 5KDDA 1UBCA 1OIXA 1XEXA 5JSZA 3ADCA 1SXJC 4UXIA 4RCZA 3EA5A 3HR8A 2GF0A 4HZUA 1Z0KA 3LLMA 3M1IA 4IVPA 1XPRA 2VP5A 4ZPXA 4PO1A 1GUAA 3QOFA 4ZI2A 2ZYUX 5FPYA 4PR0A 1G3RA 3B78A 5DSZA 2F9LA 3TE6A 3GPLA 1JR3E 2IUSA 4MYHA 2CK3A 2OZEA 2RCNA 5JHGB 4I81A 3NWJA 4E5UA 5JEEA 1WXQA 3AF0A 4LHYA 3NC1C 2Q3MA 3Q3JB 5CDFA 3ZVMA 3LAWA 3ZZTA 4LC1A 1E2DA 3EPLA 2WKPA 4DLSA 1P2SA 1C1KA 2QBYA 5SZIA 1OT3A 2AK3A 3CF0A 4A1FA 4DT1B 5DI9A 2WWXA 2QMEA 4F91B 1Z6YA 1P7CA 3SHFA 2JLXA 5JBQA 1VHTA 4JSTA 3UPUA 4TMZA 4LRTA 4XD7A 2ZRIA 3NEJA 1IXSB 1TEVA 4BECA 3GJ5A 3DPUA 1L4YA 2RGNA 4NYMQ 3LVRE 4R71A 2XITA 1KO8A 4A0HA 3DOFA 5JWOA 2DPXA 4M2LA 4C2UA 3C5CA 4RZ3A 2VF7A 4TQ9A 3VNVA 3GLFE 4OQFA 3G0HA 2XSZA 3GLGB 2IYUA 3T34A 3I5XA 5IHPA 4XH9B 4XWKA 5JI3E 5DH9A 2P5SA 2RGBA 2QEQA 4P0TA 2J9RA 3R8FA 2IYYA 2UZIR 4LGMA 4MA4A 1Z06A 1SKYE 2OT3B 4LJ7A 3DVLA 3KZ1E 3AVVA 3VR1A 5BW8A 1BOFA 2NPFA 4MUBA 2DFTA 4G5OA 1E3MA 1Q0UA 2DWPA 5C46F 5EXTA 5EXXA 3PIRA 1W36C 3QVVA 2G77B 4JVNA 3LLUA 3W6OA 4OK5A 3KQHA 3D6TB 2IBMA 2Q0HA 4WZBE 1W36B 2CCJA 4CEHA 4BZQA 4ZDIA 2FF7A 5EP3A 1ESMA 1EFUA 1ZM4A 3U3JA 1IXZA 2B8WA 5BQ5A 1FP6A 1R7RA 2A5DA 4ASUA 4KFRA 5BWMA 2RAPA 5CLLA 2VPPA 5L8VA 1XEFA 3NG1A 4DEXA 2J1LA 2GILA 5KNBA 2F55A 4AI6A 1ZUHA 3VKHA 1SHZA 1DO2A 1E94E 2Q9AA 1ZC4A 2IYXA 4LYHA 2ZANA 1HYQA 2PT5A 2JAQA 1IXRC 2PZGA 1U0LA 2O0JA 4KXFB 1OXUA 2FV8A 4OQMA 2XJ9A 1NJFA 1KK3A 2ZS8A 4NBSA 1OXXK 1NLFA 2P2LA 4V0MA 4B6EA 4KBFA 421PA 1XNJA 4HATA 2PCJA 5CJPA 1H8HD 2XZPA 1D6JA 4B73A 4TLAA 1Z63A 1ZC3A 2VLIA 4KODA 1NSFA 1G20E 2ZE8A 3BFVA 5L3RA 2H7VA 5FFMA 2ZXUA 2OSBA 3PUXA 4M8NE 3SYNA 4RD1A 4C30A 4TYQA 2X77A 1VKJA 1IN6A 3ZS8A 1OXTA 2JJ1A 1G6HA 4D4LA 2BCGY 3VHLB 1OXSC 2JJ2D 4I1VA 4WVFA 1G5TA 1TX4B 2QTFA 1TL7C 3BB3A 1AK2A 1TF2A 1VCNA 3CPJB 3LV8A 1XB2A 4DSOA 3CWQA 1CR4A 2H8KA 3KTAB 2ZAOA 3K0FB 4LDJA 4LJ5A 4QBIA 4U02A 4TN1A 1N0UA 1KO5A 4AG5A 1S96A 1ZM2A 3DZDA 3C41J 4Q4HB 1Q20A 1UF9A 3KB2A 1VMAA 1MO5A 3FWYA 2AD5A 2EYQA 3E1SA 4IFEA 3QPWA 1UM8A 3UWKA 1E9FA 1XCGB 1NL3A 3UANA 4G5GA 1G7TA 4LCBA 4PSAA 5FTNA 3OIUA 4KFSA 1K8RA 4RZUA 4YMTA 3GLGE 1RRGA 4C2TA 5CIWA 5J40A 4BFUA 4HDCA 2QQEA 3CIOA 1Z8FA 5FUVA 1DVRA 2QP3A 4JVMA 2O0HA 4Q5IA 1EG7A 1TQDA 1U9IA 4TL7A 2DWOA 1R0ZA 4ITRC 4Z51A 4ZI3A 3U6KA 5AK0A 2J0QA 4HB3A 2NMVA 1OW3B 1E96A 3A36A 3TH5A 5GJCA 2EFEB 1QG4A 3PCRB 1T3SA 2J59A 3N2IA 1QF9A 3V9PA 2CL6X 1UKYA 3AF3A 5AWFC 3MMPA 1F48A 4M1KA 1W2HA 2X8AA 5LBIA 5DN6D 4JJZA 3CR7A 3ZVLA 4ZDJA 4C0KA 4OI0A 1W44A 2YNMA 1HTWA 2JIZD 2R6FA 1XCPA 4R9UC 2BKUA 2ZU0C 1SVKA 2LKCA 2ZJOA 2XNDA 3FVQA 2Q3FA 5FTLA 4WZAE 5DI3B 2DR3A 5GJWC 4OHZA 1YE8A 3RC8A 2NPIA 5HZKA 4GT1A 1UEIA 5K8UA 1JAIA 2A30A 2VYFA 4DWJA 5FOUA 3U3RA 3EIQA 2OCPA 2EQBA 1G8PA 4PZZA 4AYTA 4OI1A 4D82A 1QRAA 2NO1A 2QU8A 4TTPA 3SOPA 4PHHA 3FHTA 5FPHA 2ZM5A 4MH0R 4W5HA 4NYMR 5FTKA 1NN3A 1US8A 4FINA 2SHKA 4D80A 2G0NA 4D0LB 4CIDA 4NCHA 3QENA 1AGRA 5FOTA 1E0SA 1T9HA 5CJ2A 3SYLA 2BIFA 4LJ6A 1K5GA 3QE0A 4KSBA 1U8AA 4DSNA 2GCOA 4KYIB 1C9KA 4MKIA 3BERA 5HE9A 2JLYA 4Z1MD 1CXZA 1K6MA 1YRBA 1KDOA 4DCTA 2RGAA 2ODEA 3CX8A 4L9SA 5TXGA 3A1UA 2ZRJA 1U81A 2LCFA 3RABA 1R8QA 4TMKA 4M9QA 4PTLA 4AK9A 2J0UA 1DAHA 3HU1A 1UBFA 3AM1A 3LA6A 4IEIA 4O25A 1RZ3A 1W47A 5KOYA 4Q02A 3REGA 1WQ1R 4LPKA 4MYCA 2ZREA 3S1AA 4A6XA 4DLZA 2IYVA 3CX7A 1ZD1A 4BEJA 2J0SA 4JLVA 2XXAB 4P4TA 3R7WB 2XZLA 3RS7A 2QAGA 2WTUA 5HKKD 1FOEB 2H92A 3KW6A 1C1YA 4Q1AA 2GRJA 2XTNA 3CH4B 3W3AA 4GMXA 5TVKA 4K8OA 3THWB 3AVQA 3K70B 3Q72A 2RH5A 4LRWA 3UMRA 2EW1A 2WOJA 1SGWA 5FOWA 1TQ6A 2ZVPX 2N46A 1ZCBA 3AKDA 3HU3A 4QJ5A 3W6NA 4OJKA 4EJSA 4NCNA 1R5BA 3EZ7A 4B2LA 2NG1A 2WPDA 4OK6A 4Q1BA 221PA 3THXB 5EE5B 1P9WA 3CB4A 4JL6A 5AUOB 2ATVA 3AF2A 4TMXA 1S9DA 1XZQA 3F5FA 4JL8A 5JZVA 3A4MA 1RRFA 3L82B 4Q7LA 3GLHA 3IIMA 4US1R 3KQKA 4B3DA 3VX3A 2X2FA 3BB1A 2OO7A 5JWHA 2ZJ5A 4DB2A 1AJEA 1Q22A 4B32A 4DEYA 1OIWA 4RKFA 1P75A 3DHWC 2KSQA 1U8YA 4DUGA 3I73A 1FX0A 2ERYA 2EFCB 2N42A 1AIPA 1YJ5A 2NO6A 3GEIA 4DCUA 2PLRA 3NEYA 1G291 1R4AA 2OAP1 2XZOA 2DBYA 4PFSA 3UG6A 2ZUCA 2O5VA 1XFAA 3A1WA 2GF9A 2ZR0A 1N6RA 1PUIA 2IS2A 3ZD6A 3B8HA 3E70C 2DFKB 2XB2A 2MMCA 2D4HA 5GJVC 4A2WA 4O2RA 5DGXA 4EIWA 1VPLA 3K09C 3KB1A 2F1IA 2PMKA 4LHVA 4MKHA 5BN3A 3ASZA 2R65A 3A4LA 2ZI5A 4Q7KA 2G0TA 2G9NA 3RS3A 4OKSA 2ANCA 4DBLC 2O0KA 1JR3D 1T3LA 4C4PA 2F43A 2V4ZA 4TT3D 4DLRA 3DMNA 3OEHD 3CW2A 4C3ZA 4R98A 1AS0A 1XEWX 1AS3A 2IF0A 1IN5A 4JIMA 3TUZC 1OH7A 1TMKA 4EKDA 5HPYB 1XDBA 1KI7A 1YU9A 1TF7A 2D74A 4EFMA 4B6FA 4Q9IA 1XXHB 3SJCA 1RRCA 4QC2A 4A8JA 1NBME 4NYIQ 2IEZA 4OQNA 3ZIAA 2HJVA 1TUIA 1QBKC 2F1HA 2QA5A 4TYWA 2NGRA 2AL7A 5TY0A 2J7KA 3B5JA 2YOGA 3DL0A 2OM2A 1H8HA 4AD8A 1PZNA 5DYIA 4KITB 4M1MA 1KYIA 2YVUA 4Q1EA 521PA 3E5HA 4FMCB 1GNQA 1D2MA 4HLDA 3SBEA 4QG7A 3SE0A 4M21A 4UNSA 2VH5R 2UZ3A 5EUQB 3NH9A 1A2BA 2NO0A 4PZYA 3OHMA 3KKQA 3AVPA 3MWLA 2C2HA 1LFDB 2BMEA 5GVRA 1W49A 1EFRA 5EQTA 2NZJA 1CR0A 4HLUC 3LY5A 2E1RA 2FFBA 3VHXA 2JASA 4LV8B 1I2DA 4V03A 3QI2A 1CS4C 4EPWA 2ZRMA 5KNCA 4QHTA 1KZ7B 2CVFA 2R6AA 2ZRPA 1IJFA 2E87A 2AKAB 4DIEA 2CHQA 4ZCIA 3H84A 4DVGA 3W90A 4Y0VA 4B34A 5TB5A 3QKRA 4MQBA 4URYR 1QHIA 3EIHA 1D9ZA 2ZROA 2KWIA 1D9XA 4PANA 2ZRDA 1GNRA 2BKEA 4Q00A 2V1XA 2HF9A 2ATXA 4HAWA 5ANRB 3SU8A 2H1LA 3THYB 4V0KA 1MRNA 4Z8XA 4FI3C 1XJQA 2PBRA 4LBVA 3ZGXA 3WNCA 1PV4A 1E2LA 1ANKA 1LTQA 4EDHA 1KAOA 4CYMA 1AGPA 2R6CA 3ZQJA 2JCSA 1FPMA 4PXAA 1UBGA 3K9HA 1F5NA 1N6NA 2IS1A 1KMQA 3MUFA 2I1VB 1ESNA 2B6HA 4YMUA 5KSYA 3MWYW 4AC9A 2QRZA 1XTJA 3QF4A 3ZH9B 1C4OA 2QROA 2A5JA 2QMHA 5L3SA 4BLTA 2A7QA 5LD2B 5F98A 2X1VA 2LKDA 5EZ6B 1E99A 1ZIOA 3OAAA 2OHFA 1W0KA 1XTRA 5H8WA 3T06B 1T8UA 1T5LA 1W5SA 4NL4H 2C78A 4EPXA 1FZQA 4I1SA 1NF3A 1HQCA 4MGIR 2V7QD 4ZKDA 2VTKA 3FHCB 4BRUA 4POAA 5D3MB 5FH9A 1DG1G 2OFOA 4M0LA 1XBTA 3QF7A 3QVUA 3IHLA 4HAVA 1N5KA 1UKEA 4P33A 2IC5A 1YZLA 1ZNWA 2OBMA 3DM9B 4QGGA 1OLOA 2AN9A 4Q9LA 1XXHE 2EVWX 2P6RA 4NCKA 4QBHA 3IPYA 1ZP6A 5CYOA 4FWTA 3ASYA 3FKQA 5HTKA 4DLTA 5KPDA 4B3FX 3QEJA 3W6PA 4DSUA 1A2KC 3BH0A 1GL9B 3GJ3A 2JEOA 4HSEA 4IVRA 1QHSA 4QXAA 4RFSB 5H1YA 4Z1MA 2AXPA 1DEKA 1OH5A 2ZRAA 3GJ7A 2FSIA 5H70A 2JJ8A 2JLZA 1SVWA 4N0DA 2FE4A 5CM8B 1YZTA 4BFWA 5DIFA 2AKYA 4HLQB 2QT0A 2A2ZA 1G4AE 4LBZA 3W5JA 4TSFA 3CZQA 4TYPA 2PX3A 3CR8A 2DFLA 3Q7QA 1WA5A 2V6IA 3B2EA 1Z47A 1XEXB 2G6BA 3D3QA 4Q48A 4QL3A 2W00A 3TVDA 1G19A 3NHBA 1WE2A 4WXRA 5A4JA 1KOFA 3B7GA 2O8FA 4W5WA 5FUWA 5HE8A 3U2QA 1VG8A 4IHQA 1YR6A 3AEZA 1YZQA 4MITA 1OJLA 1KK0A 2ZR7A 2XOKA 1W4AA 2F9MA 1DELA 2CLSA 3SZRA 4CW7A 2VP0A 1HUQA 4HAYA 4QKQA 4A0GA 3AP2A 1BMFA 1OFUX 1YR8A 3LXRA 4URWR 5J4VA 3PFIA 2GVZC 4OHXA 2C95A 4AYXA 1W36D 1I4LD 3K8YA 5KDLA 2YC2C 2CMKA 1U94A 5DNYB 3SBDA 1IM2A 2QBYB 3GJ4A 5L3QB 2C04A 2BM1A 1P2UA 2QORA 1CF4A 2HF8A 1M7HA 5G41A 3IHWA 3WNDA 2YWFA 1Z0AA 3QKUA 1CP2A 4C0SA 1ZRHA 2ZRHA 3P20A 3KUCA 1JR6A 4OL0A 2XB4A 1DARA 4EFNA 2YC4C 4HDOB 4B35A 3BH6A 2PZFA 1RRPA 2VHJA 1G7RA 1E2KA 1N6KA 1QZXA 2CNWA 3KFXA 1P9NA 4NONA 1ZD9A 2IEYA 2WSSD 1T8TA 3KJEA 3IO3A 1QVRA 5JECA 4Q19A 4LPSA 4BFXA 3QPUA 3C5HA 5FUYA 2GEUA 1PLKA 1XWIA 1J70A 2C9YA 4C0HA 1AKYA 1XMVA 3KUDA 4Q4AA 1AQUA 2ZS9A 3QNUA 4H1UA 4A3VB 4JLOA 4OHVA 4LRSA 4TMVA 3VAAA 4C7OA 2Q3HA 4KAXA 2OESA 3MWKA 4P32A 2D2EA 3GFOA 3NBZC 3ZYCA 4DSTA 4LJAA 1SVSA 1E9AA 3F0TA 4LJ9A 3BS4A
chains in the Genus database with same CATH superfamily
2HPZA 1NF9A 3DO6A 5BRNA 2GK7A 4JI4B 5L7YA 4AJKA 5KMGA 3O90A 4ARIA 3B3AA 3N0WA 4DLAA 1WRBA 1FS4A 5IJ9A 1FRZA 2FPLA 2HYDA 3NP7A 2YASA 3GP3A 2P9ZA 3A1NA 5B36A 5HK8A 4JUAA 3K0SA 2HA0A 1NTOA 3ESBA 1M2KA 4MRVA 4PLGA 4LECA 1M33A 4B3SB 4XWAA 1O87A 3R5FA 1DBVO 4ZQFA 1P44A 3GO8A 3OE1A 1CRPA 4RH1A 1GADO 3WGIA 2W11A 3GUCA 1MB2A 4NV0A 3VR6D 3FIJA 3AESB 1NSTA 3M1YA 2C3MA 2YWEA 3AUXA 1OFHA 1DG3A 4RQAA 4N0EA 3WX0A 3MJVA 2PSHA 3SJZA 4QIHA 1NBMD 3E1GA 3AGPA 4M1WA 4EENA 3Q3GE 1KDYA 4AURA 2VWQA 1JIXA 3N2EA 1Z5BA 2IVFA 3W4IA 6GPBA 4LQLA 4EHAA 5DBGA 2BEWA 3DVSX 3LC7O 2H4YA 3CEPB 1YL6A 2L19A 5F64A 2HLDD 3R3UA 3C6KA 4DNFA 4LDRA 5DTEA 4JVOA 3BXZA 3BE8A 3HZZA 5D85A 3QVOA 4XEHA 4RE6A 1M2OB 2HTEA 1UC9A 2B8TA 3RVNA 1BE0A 1LI5A 3R9IA 1IBMM 3CG0A 3T5BA 3F3YA 4PPGA 2F8TA 1YMUA 5T5QA 3SNHA 4C0QC 2HCRA 2IPNA 3OHPA 3WLKX 2MIIA 1O7JA 5A71A 4BCDA 3PSHA 1NI5A 1E1RA 1UFRA 3HPRA 3OX3A 4G0UA 4JD5A 3GJTA 3IBGA 4P83A 3UKDA 4RNDB 2GJKA 1G8YA 4K9KA 5J1TB 2X2EA 4JFAA 1T6YA 4EUFA 1V5WA 1LFAA 1ETUA 1S2NA 4B3CA 3L40A 4NPAA 3M9WA 5L7TA 4FGKA 4LYEA 1KTVA 1LBIA 1LQUA 3OY7A 2P6NA 2IEDA 2HH9A 1ZEMA 4RY8A 2XIJA 4GOOD 4PLYA 1JDVA 4RMNA 1I0LA 5B1YA 1RI3A 1G8MA 3KXKA 3SIXA 1PZGA 2HI0A 4IQ0A 1I13A 5E6JA 3UUEA 1CUDA 1CJKC 1NRWA 2DH5A 3RIMA 3RUHA 1Y3BE 3GGPA 4O2BF 1TGYA 3H2IA 1XZGA 4JUFA 1FC0A 4W5QA 1DAEA 3K16A 3E5MA 2BP7B 1VLJA 3NTOA 3L7IA 4JI2M 1WL8A 4GC5A 3EZLA 4UU0A 1RWWA 3I9LA 3M4XA 2QJWA 3B85A 2RAUA 1ONSA 1AGNA 3TRHA 1JLHA 5I7UA 3K53A 2BEUA 2ECQA 2I4NA 4EX7A 3CPSA 1E2FA 2JJ2A 3VYTB 1FFBA 2YYZA 4MHSA 5AKYA 5A3VA 4LW8A 5A7HA 5PGMA 3QYJA 3R44A 5LZ8A 4QFDA 5EIAA 2VJOA 3UJ8A 2XKKA 2FSPA 1IWPB 3SXPA 4ZJPA 1MBZA 1NC1A 3ZIDA 1QU3A 1GR1A 2Y21A 3Q0TA 4C6RA 1UCFA 5C4IA 1C0LA 3E8XA 3DCNA 1PG2A 1PFQA 5FBLB 3PX2A 4KJXA 5BVGA 1KDRA 3DO8A 2ORIA 2HCJB 4MIKA 4BAUA 3SS7X 5J4KA 3RB8A 1D8AA 3O2JA 3CF6R 4ZVLA 3GLIA 1UKBA 2B34A 4XYGA 1Q3KA 1I80A 2SBTA 4KIFA 1CP3A 1U0JA 3VH2A 4D97A 1LCIA 4R1SA 2H5EA 2G40A 4DS3A 4BLUA 2ZSKA 1WTCA 4WXPA 5TF0A 2GHIA 3HGQA 1R6VA 4IJWA 5CT5A 3TLXA 1K9VF 4H7FA 1ZJ5A 1KOGA 3EDMA 1O57A 2GLTA 4CNBA 1OBCA 4GDFA 3PQDA 1MOPA 3GDGA 1N8SA 2DQKA 5THKA 1KMNA 3AHGA 3R0VA 5FORA 1TEHA 1UUFA 2ZJ2A 2QRLA 2FH5B 2OKGA 1MJGA 5F35A 1UEJA 1RXIA 2FZ5A 3CF2A 3WLQA 1KE1A 5ABPA 5IC6A 1CUUA 4D6PA 3F9IA 3RAPR 1DRUA 4YDHB 1GU1A 2AR7A 1L4HA 1AZSC 1P5FA 2VN8A 1UMBB 3O21A 2XMBA 1QBGA 3DGFC 3BBZA 4D46A 2IHZA 4F85A 5ER6A 5C8VA 3O3CA 1KI9A 1Z83A 3G82C 5D01A 4H3KB 2R8OA 2E4VA 3ZE8A 5B1HA 1XTPA 4YRLA 2FOIC 1D2RA 1FBNA 4FFMA 1AKEA 4COOA 4DLPA 4J90A 3K0BA 2R9VA 1CRZA 3GQ3A 5B2FA 1ODLA 4U9IS 1CUHA 3CT4A 3OLZA 4EUSA 4UFNA 5LXTF 1QP7A 1G42A 3LPAA 3ND8A 3PUVA 1D5CA 1QQ5A 3C7DB 4R6XA 1U2DC 1DFHA 2J3DA 3CQ9A 2TMKA 2FE1A 4F72A 5JI2E 1G71A 1YC2A 4F60A 1UWVA 1XTZA 1YMQA 2PU5A 1R8XA 5JDIA 1RU3A 2PZ8A 3PE3A 4HX5A 1NNEA 3E03A 2ZRKA 5KYGA 1CRQA 5BORA 2II6A 1N2JA 4GKVA 4QUAA 5CAEA 3AUJB 1U2SA 4WY2A 2D2IA 1H22A 4D5EA 4QSMA 5LA6A 1RI4A 1OC4A 3OJCA 4EG1A 1QLWA 5CDHA 4FFBA 2G9UA 1ZK2A 1CW2B 2PSEA 4LF5B 2Y0DA 4LK3A 3HO6A 3A8TA 4YMSA 3RE1A 3CLKA 1K63A 5DHFA 2K5UA 2VT3A 1YASA 1PR2A 3PQ7A 2HZ7A 3OQBA 3IP1A 1PAUA 1T0JB 4NICA 5KTSA 1T1EA 4F7DA 2F1RA 4JUIA 1FFHA 3V46A 3D6VA 2ZI6A 3PK0A 4YXWA 4HDKA 4JUCA 3RVDA 4ZAGA 4RTJA 1J33A 1XQ9A 1V11A 5ITRA 5EMNA 1JQBA 4LX0A 5IW8A 1DL5A 5SY4A 3WMGA 4K9MA 3K0FA 5FWAA 5K8TA 4YJ3B 3CUTA 3LQRA 1RT9A 5DGHA 3Q87B 4E5YA 2G06A 4RK6A 4TSFD 3UK0A 3IDQA 2HMWA 3IUPA 5EZ5A 1T1GA 3I9NA 1I1OA 2RSLA 5EL0A 3EN0A 1Q1EA 3DE5X 1PRBA 1NNUA 5A9RA 3K15A 4ONEA 2AG0A 3CX6A 1E62A 3JQGB 3DLCA 3FTQA 1RYZA 2OCBA 3TW8B 1DC7A 3K0AA 5EWJB 1MEEA 4I8DA 1UM9A 3RKUA 4ZEOA 1N5MA 4RAQA 3WHPA 4GKAA 4BNKA 3D4IA 3DAYA 4BMYA 4BNHA 2BMFA 3HEBA 2OFWA 5KPZA 2J3HA 3N07A 2ZIZA 3KVWA 4ZXPA 1IHDA 3KB8A 1ENZA 4Z4IA 4JCCA 3KCQA 4I55B 2QJTA 3HQ4O 3LFHA 5FPTA 1RI5A 3MTAA 2KHZA 3OIFA 3KOXA 4BEBA 1GQSA 3DDUA 4UATA 2FLWA 4WGGA 3NGXA 4CHGA 2XGNA 1SBNE 1FXWA 3IDFA 1CQZA 1FSGA 3LD9A 3DDWA 4B84A 3HKDA 4ZICA 4P0PB 5JJLA 4GOKA 1JIVA 1II8B 3BIJA 3ERCA 2XOEA 4ED9A 5A4IS 4OV6B 1TJPB 4ZQBA 4MI1A 3F6PA 3A4TA 3NDPA 2RIRA 2WZQA 3WJAA 3ADKA 3KQUA 2Q8QA 2VUUA 2DHQA 1SH7A 5C8YF 1R37A 1V25A 3DDOA 2CEKA 4WCDA 4EW6A 3S8MA 5KYYA 4KUEA 4OM8A 3KP1E 3RRMA 1X13A 3ER9A 2R1ZA 3AT1A 4NBKA 2Q5EA 3FCUB 1X6VA 4MKGA 1MC4A 4GZ5A 1R2YA 1ZJ6A 5LP6F 3D81A 4HS4A 1XMSA 2RCYA 2V45A 3GAZA 3RRBA 1L7RA 5FV4A 5KWJA 3QBTA 2DQSA 4E21A 1Q3CA 1ADFA 2R18A 3JYLA 1TZJA 4R1LA 4H3SA 2XIQA 2Q21A 5FADA 4N9QA 1B14A 2KS6A 2I7XA 4JMLA 1JBKA 4AZWA 2AB0A 3WLEA 1ZOLA 3NT5A 3ZY6A 1PWYE 1KVTA 2IH2A 1XRMA 4WCVA 2WF8A 3K6RA 4O4LF 1T4CB 3ROMA 3WLFA 4QXRA 4J4TA 5JH7A 1Y89A 1ESCA 1CDDA 1V45E 1YB6A 1OIVA 2GARA 4IJFA 1EJ0A 4R9RA 3WRYC 3OOHA 2YS6A 1LXCA 1FFXB 4M46A 3WP1B 1XD8A 1ZNXA 1MOZA 2WJHA 1CY6A 1EIZA 1MH1A 4RVCA 3S29A 3M1LA 4LF6B 4CEIB 4HLQA 3SMVA 2V58A 3B1WA 3PEUA 3OLXA 1JFSA 1XZ8A 5DWDA 3H1FA 3FCYA 4RJKA 1JIIA 2J67A 1T2AA 2QX9A 2YHIA 2FR8A 1JR3E 4E5UA 5CXUA 1IH8A 5HQTA 5AOBA 5SZIA 2AK3A 2ZYSA 5KS2A 2W6QA 5HS4A 1A9YA 4FLMA 1MQSA 1RXCA 3SHFA 1FZTA 2IY7A 1K4KA 2OHJA 4OQPA 5AKHA 4K1XA 2DX7A 1GN9A 3S40A 4A0HA 4CLHA 4RPCA 2Q2OA 3VNVA 2PR2A 4KACA 4Q3NA 3U4AA 4BN4A 2J9RA 3QMVA 5EJGA 3W9BA 3DVLA 2B4KA 4BNMA 4RDIA 3O8QB 3DEJA 4PTZA 1VXRA 3ILKA 4MKRA 1QG6A 2NXNA 4G4RA 3VKHA 1SHZA 3JARA 3ACCA 5U9CA 4QE3A 1B4DA 4LYHA 5BT9A 4MWEA 1U0LA 4DKJA 2X15A 1O03A 2RAFA 2H4ZA 1NJFA 1UMKA 4EUHA 4CLOA 4OLFA 5DHUA 4B73A 5BY2A 3IECA 3LPLA 1BWSA 3VOAA 1Z82A 2PAFA 3E7FA 4TXNA 4PZ0A 5ER9A 3K2BA 3C7AA 1SK9A 2W98A 3ZJ5A 3SAVA 3EY9A 1VCNA 3LV8A 1GZ4A 3M33A 1PT5A 4LDJA 2LBPA 3DZDA 5LU8A 2PA3A 5LA6F 3UANA 4PSAA 1RZRA 5GM1A 3RJZA 5J40A 4HDCA 2QP3A 1EEHA 1CDEA 3K9CA 2ORED 1I3LA 3PHIA 4EW3A 2O14A 4BE4A 1T4BA 3PE4A 1QP8A 2ESRA 1JZTA 3VDPA 2QZZA 1J2TA 2C2XA 4WZAE 1P9LA 2R8PA 3D6HA 4JBLA 5K8UA 2ZAIA 4HNAB 2BY4A 4H17A 3OOYA 1V5FA 2YWCA 3H9JA 5GIPE 2JD0A 4W5HA 2IZ0A 4NYMR 4D80A 4D0LB 4ARUA 5FOTA 5CPFA 4N0PA 3O3MB 2IXTA 1EVEA 1U31A 3VMMA 1R2ZA 4NEQA 1Z88A 1RLIA 2X5XA 1PJBA 5TC4A 2X6TA 3COWA 1EM8B 2HHHM 1N32B 3EUWA 5E1DA 3CX7A 1QR6A 1ZD1A 1FEZA 4P4TA 1P3Y1 5KPTA 3DE2X 1SZJG 1XCOA 2JY7A 1DX4A 2OQVA 2VDPB 3W6NA 2HSGA 3EIXA 4HXEB 2AYXA 2DBZA 4CF5A 2VDNB 1HFEL 3U40A 5JWHA 4DA0A 2ZJ5A 3TLBA 4BUZA 3H4IA 1UMDB 3DKIA 4IUCS 4MW9A 4N0MA 1UWKA 1RYNA 3GVIA 4JP5A 3ESXA 5H3LA 2PVSA 3L29A 4N76A 1XVTA 1TUGA 4PBRA 4KIJA 5IAAA 5HJ2A 3EQ7A 4TT3D 3BHNA 3OEHD 1NYLA 2QRQA 4XAQA 4JIMA 1RMYA 3QE9Y 3GAFA 4MROA 3G9TA 4IIHA 4U2DA 2QV7A 4X7RA 3L92A 5ARCA 2PUGA 2NGRA 4JBIA 2J31A 4NQRA 1N57A 4G63A 521PA 1XN4A 4QG7A 1XYVA 2J9GA 3BCSA 3HS3A 5DNUA 4PCLA 2BGJA 1LFDB 2EBHX 3NT4A 1W49A 4Q24A 4NJEB 5IJ0A 3LY5A 4U6QA 2Q0SA 3SQOA 5L6MB 2WC1A 4BMDA 4BU1A 3ND7A 5FLXS 1YDHA 5AW7A 2C00A 3T9AA 3OT5A 1ZESA 3BMOB 1MRNA 4Z8XA 4I08A 1XJQA 5ILGA 1ANKA 5CDUA 3L3BA 1KMQA 4RMGA 1NPTO 1DQRA 2IEGA 3KEOA 3P0HA 2BMAA 3H0CA 3ZV6A 3QNWA 4ZKDA 3U7QB 5D3MB 1KKUA 1OAAA 3E61A 1XT6A 4EYSA 4KR0A 3U1TA 5EQDA 1A27A 9LDTA 1C7EA 1LSJA 1OX4A 5KPDA 1CS0A 2Y1GA 2CJFA 3JQQA 2CXPA 1WW3A 1ECBA 4FD3A 4HJXA 2Z08A 2AQIA 1G4AE 1EZZA 4FWBA 1WA5A 3TVDA 4WXRA 3CVWA 1YI8A 3AEZA 4MITA 3DE7X 3H1GA 3H99A 4H2DA 3BMNA 4WN9A 2YC2C 4AY3A 2YRXA 2C04A 3KKKA 2HWUA 5LMNM 4IGEA 5G41A 5I4BA 3RC7A 1ZRHA 4FHDA 3KUCA 1H4TA 2J07A 2O4UX 1V33A 1IXKA 2Q1YA 2VHJA 9ATCA 4HNVA 1T8TA 5EJ7A 3A6DA 3DL2A 2VTBB 4TROA 1J70A 1AKNA 4ZVMA 1B8NA 5CDGA 2XW6A 1LKZA 4LF4M 3NIBA 4C89A 3C3PA 1QC5A 3MD0A 3HB5X 3RRZA 4BNNA 3O31A 2VZEA 1ZY2A 4UCXA 2PH5A 1E4YA 5IZ7D 3M1AA 1ZOSA 3HFGA 2Q5IA 3X2SA 3ZDFA 3V97A 3AKYA 4C01A 5FLEX 1KF0A 1PKXA 1BO6A 3SJUA 4MV4A 4GYJA 4ZAZA 2GN4A 2CMGA 3V2GA 1N5LA 4MGZR 4ILKA 3EZ9A 1U5BB 1IEWA 3HXLA 3HKBA 1MAAA 1Y1LA 3IEKA 2XF3A 2O1EA 2PN1A 2MU1A 3WBBA 1ZU4A 4RTSA 4BHTA 4O4JB 2OEPA 4B43A 4KKVA 5DX0A 4RL4A 1JSRA 1PGOA 3R3ZA 4AVYA 4I19A 1RQ7A 4B7GA 5LMUM 5EJIA 2Y6VA 1ZN2A 4YQFA 1OIZA 1CR6A 4QGBA 3RAGA 2NNLD 4EG5A 4HT3B 1XL0A 1X70A 3UMJA 2OVFA 1SC4A 5C1PA 4YCCA 3LYAA 4EG7A 3CUUA 2I1WA 2QTMA 1Y48E 3Q6NA 1PDVA 4GNKA 3I2JA 3AWIA 1RCTE 2GESA 3L0SA 2QRKA 3P27A 3AEQA 3PP8A 1QCYA 4GP9A 2NM0A 1G5RA 1NKVA 3GA5A 1KK2A 4QXOA 1L4GA 2AC7A 1HE2A 1VQ1A 3KSBC 4Z7JA 4P2GA 2DSNA 4A16A 3ONNA 2GSDA 3C97A 4NZYA 3H0KA 2D54A 2NV2B 1ZOPA 2VRCA 4EB8A 2FDRA 1C50A 2I6UA 3O26A 3D3WA 2B78A 2GXQA 4Z7QB 2Q6OA 1FQKA 3TSOA 1E60A 2NU7B 3KP0E 1GVNB 1HDOA 3WGYA 2X7JA 4G25A 4CM5A 4HGPA 2VT6A 1YJQA 2M6LA 1OV6A 1BN6A 1MDBA 2QAGB 1W87A 3HVJA 3DYVA 5ED4A 3AHHA 3PXUA 3Q6MA 1VJ0A 1XZNA 3IB3A 2DC1A 4WJLA 4WSOA 1BZYA 3SEZA 2W2XA 3MWDB 1KJYA 2YJZA 3EEQA 1GGJA 3ICVA 1Z16A 2EWMA 2OQ4A 1HETA 2J48A 4WKPA 3ILHA 3W77A 1W5BA 2K9DA 4AKGA 2G9ZA 3ETDA 3H65A 4V24A 4AZ0A 5KJEA 5KHOC 5HRCA 4R8LA 2P30A 3FVVA 3PL5A 2P3SA 2I0FA 3JV7A 1OR8A 4UE6A 3EHDA 1C41A 3DOJA 4YC7A 1LD3A 1WY7A 1VIYA 4I9GA 4B4KA 5LZ4A 5CX4A 2YICA 4A2PA 4KO8A 5FBKA 1KJNA 1L5LA 1AC5A 2O3UA 1YD7A 5ITYA 5CFPA 3RLIA 3U13A 4J0GA 4KE6A 3NBQA 4COKA 2AOUB 2ZTHA 1BYIA 2B1GA 2F3RA 4AJ9A 2JRCA 4ZT5A 1XF9A 1E2PA 4UNPA 2GN2A 1TKCA 4UEWA 4U1RA 4RVUA 3N2LA 3GK3A 2NYVA 3L1JA 1J2EA 5CA1B 3QKRB 1IOVA 1H2EA 5CLGA 3Q98A 1SCDA 4ZMSA 4WLNA 5FBZA 4BGEA 4G5YA 3BL6A 2ZWPA 1ZNQO 2R8XA 3BT7A 4X97A 3HEMA 3E21A 3LP5A 4YP0A 4I50A 5HBRA 5BYKA 2WHPB 2BTOA 2R2AA 3MQ2A 3L05A 2OV2A 2XKAA 2VYCA 5BR1A 4WIAA 5AMXA 1TYDE 1M2EA 4EVIA 5TPZA 3SARA 2HZBA 2Y68A 4HPWA 3L41A 1YS1X 2G08A 4KDRA 2RKOA 3RUIA 2PL3A 2XH8A 4GI7A 3P0EA 2PZMA 2GJSA 4AY5A 3CKLA 1K3FA 1AV6A 2XKBA 4OGKA 3TPFA 5JNUA 1M1NA 2PYZA 2ISSD 5DN6A 1VLHA 2ZYAA 4X8HA 1UFVA 4GX0A 1JTEA 3RSZA 5BNZA 1V8BA 3I1YA 2EDCA 2L42A 2VNJA 2JFVA 1BTOA 2QPTA 4CIXA 1WHSB 2IPXA 3TZBA 2NV6A 3IPRA 3RKSA 4URXR 3F78A 4F2DA 4PQRA 5JCOC 2XD9A 3MFYA 4ABYA 5EJEA 4Q4AB 1VP9A 5KQMA 1OPRA 2JH8A 3ET5A 4HLUA 1X8KA 4JXXA 5JSZB 1J1UA 3QSYA 4XX1A 4C9BA 1S89A 3S4YA 2CLOB 3RBAA 4MRAA 2QUAA 1N34M 2XNSA 4DXDA 1KAGA 1ABFA 4K6MA 1JG3A 1DO0A 1ULHA 3NDBB 5LUAA 4CUKA 2OXIA 3CPHA 3HHEA 1RNLA 1SHTX 4L3WA 1PJTA 1X7GA 1TFRA 4W1PA 1U4OA 3D4BA 3QA9A 4BB0A 3ZV7A 2PMDA 3D1VA 3S44A 2XQVA 3M6LA 4KREA 1G21B 1Z4KA 2JXNA 4QOIA 3LVVA 3V2IA 3ZZNA 2NSJA 2GTPA 4IXTA 2ZJZA 2FF5A 2OPHA 4IH9A 4EFDA 1U8UA 1HM5A 3TVYA 2B2NA 3ABIA 4MW0A 1DBSA 2YJ3A 4HAOA 1V8OA 5LM3A 3V7NA 1FVHA 4I4IA 3WA7A 3UW3A 4MGKE 4A6DA 4BX2A 1CSEE 3X1JA 4EABA 2EX0A 3VTKA 1DSSG 4Z2YA 2XB9A 4Q34A 4WKCA 3PRYA 4GKBA 1U1GA 3P2JA 1WTAA 2J41A 2A57A 4Y8VA 4YONB 1YL7A 4BRWA 4CM8A 4KGZA 4J76A 5L3QA 4L0DA 1AV7A 1GFZA 4D2IA 4AKIA 2A0YA 4LF9M 4YUAA 3OM1A 5KTTA 2YOFA 4CFZA 3WRYA 2ZUFA 2HRZA 3P1JA 2QD4A 2FUEA 2OP1A 2VTEA 3NHPA 4E07A 4G0NA 4Y67A 3WK8A 4MYUA 2Y2VA 1WDMA 1ONBA 2ZUTA 3K9BA 3AKCA 2IKQA 1DXHA 1NPDA 4PNHA 2Q7XA 3I9FA 1E6WA 2ZULA 5TARA 4MCIA 1GQ2A 3PVCA 4EY4A 3VU8A 4YRAA 1AKTA 2EIXA 3D5EA 2G82A 3DDSA 3EWSA 4UNNA 3PGVA 3ZUGA 2D13A 4A9AA 3RRNA 3F5SA 2CLFB 5B6JA 3GVHA 2RGEA 4DRZA 2ZIWB 2C9OA 1WUIS 3A10A 3PENA 4DOMA 2JNWA 1QP0A 1H3FA 1D0LA 4HDMA 4E2ZA 2VAVA 4XYEA 3EE6A 5CCXA 3AUSA 2QAGC 1H69A 4LGYA 2HSWA 3M6XA 4OXRA 2BRUC 2X9LA 3CT6A 4PCUA 4J0KA 1WUYA 1QRDA 1TYZA 3TM4A 2H1RA 2OXCA 4JSRA 2IXGA 2JFQA 3VR2A 1ABEA 5B4UA 2X8JA 4IJUA 5K51A 1B76A 1HT2E 4DN6A 1VG9B 2IRWA 2JA1A 5G02A 4M1ZA 3G0CA 3DC7A 4IBJA 3GD5A 5BMVF 5BN5B 3KJFA 1TYCA 2IQIA 3LBIA 1K0UA 5IULC 1IOWA 3B6EA 4UE2A 1E2QA 3NRBA 2E7ZA 3TD6A 3M5DA 3HB0A 4U2EA 3OZFA 2IS6A 1Q0LA 1YULA 2NZUG 3P2OA 4KQ1A 4L9RA 3LCUA 2PX0A 3BG5A 3EQ6A 4LHXA 3AFNA 2YVLA 4MIOA 2JZOA 1VCHA 3UGKA 2E1PA 4GE3A 1YKSA 1NX6A 5TQVA 5CFOA 3KVNA 5I4IA 4WI1A 1KC3A 4U9UA 1L3CA 2VQ3A 2WKWA 5HXAA 1UBEA 3IV9A 3QEMB 2KM1A 4R31A 2WUGA 5KHLB 2O8BB 4CTOA 3PT5A 5D2CA 1E1KA 4YAGA 5DEIA 1TO6A 2A9VA 3PRJA 1KJIA 5IVDA 3MAGA 1JUDA 4R2LA 3S2ZA 4FDLA 3STVA 4ZYUA 5AQEA 3DTTA 4AMUA 5KWIA 5C81A 1JDTA 2LVAA 4YV2A 1T5OA 2GA9A 3E9CA 3IP7A 4RWZA 1ULUA 1DIOB 3ZWAA 4BQRA 4FW9A 4EHFA 5LNK6 3UICA 3CKYA 4NBUA 4BB6A 4MR9B 4RCYA 4ILEA 1UAGA 5KQLA 5C1OA 3ABSB 2M60A 3THOA 2ZS7A 1PP4A 4F4FA 3IT3A 1KYQA 1JJ7A 3K2LA 3GMDA 1IXYA 3AV3A 5C1DA 4CM4A 4CISA 5DT2A 2C4HA 3G1WA 5I4KA 4UTNA 3COZA 3I09A 1ZIDA 4PM4A 5JQGB 3TRKA 1XD9A 4BZZA 3PXCX 2MT9A 3QV2A 4L5YA 4IBIA 1H8ED 3GEGA 1Z8NA 4ZHSA 2W6JA 1GUBA 5AUPB 1RE1A 5G0SA 4M54A 4FVMA 2W0SA 1GU0A 1ZUD1 3Q3VA 2MSNA 3C7TA 1YOVB 1M1YE 1Q1AA 4MGHA 3ZXXA 3D5QA 4JP1A 3H2BA 1H6CA 4IHAA 2NX2A 1A97A 4EHLA 3EXG1 4N5MA 4FHEA 3MJEA 4XVRA 3WAJA 2B94A 1F1JA 2CE2X 2DERA 4GOLD 3TECE 2IDMA 3H87A 1GNPA 1XELA 1DV1A 16PKA 3ZY5A 1O9HA 1I2MA 3D54D 4JI5B 1TOAA 1DLJA 2OBLA 4HMQA 1JKMA 4BFVA 2CLEB 1YAJA 2LVNC 3TR6A 1WS6A 3ZJTA 3W68A 2JGDA 4Q9KA 3FDXA 1X8JA 3KEMA 1L5SA 2IF2A 3MMNA 2OCYC 1GL7A 1OYVA 2KNAA 1CZRA 1HT3A 1XVIA 2ZPUA 2RGXA 4EY5A 5DOVA 3KKZA 5KSOA 2ODWA 3VDNB 2O8CB 4D1YA 4U39A 1WR8A 4Q16A 1RCFA 3MEQA 4UBKA 1CF9A 2JI4A 3MB8A 1KAQA 4L95C 1Q16A 3R74A 2D5BA 3SHOA 1YS4A 1FRVA 3P4XA 5BUCA 1XEXA 3HR8A 1E1CB 2BNKA 2LXEA 4PR0A 2OZEA 4K28A 5DWQA 3MPUA 3EXEA 1GPYA 1UK9A 5CDFA 1E2DA 4AS1A 4UM7A 3EFEA 4DT1B 2VVTA 2Q2NA 4OO3A 1F4LA 1TYAE 3JQAB 4Y98A 4LRTA 1JR2A 4RELA 3DPUA 1L4YA 4TRNA 4PN3A 3CW8X 3GRVA 5LXTA 1I32A 4M2LA 5ADWA 3OO0A 3IFSA 2GZRA 3G0HA 4GLJA 3ISTA 1F0NA 2UUOA 3VDXA 2RGBA 1U5CA 3U4HA 4NJOA 2CYBA 1Z06A 2I76A 3DQZA 1BA2A 4ZO6A 1CCWA 2PUWA 3EYAA 4IH1A 4G5OA 2PYDA 5EXXA 4HNUA 3PIRA 1QIGA 3KLOA 3AR7A 3U6LA 1HDGO 3D6TB 2KYRA 4X63A 4PFKA 2HXGA 3K32A 4KFRA 1AHNA 1VJTA 4AI6A 2I2XB 2GILA 2J1LA 2CNNA 3E9YA 2E4AA 4BEWA 3ZDDA 3WQRA 1U7HA 3ZKWB 3GPYA 2P2LA 2OECA 2N0SA 2AXEA 4KV7A 3I9KA 1WR1B 4S1VA 1B15A 4M8NE 3SYNA 2IP2A 4Q12A 3ZI7A 5H59A 1DRWA 3G7UA 1F0KA 1V4VA 1GZVA 1Q20A 3H5LA 2VHXA 5BR4A 2O07A 3WGQA 4G4SO 4MW2A 4NAUA 1WEKA 5ITVA 5EMJA 2CNDA 1U9IA 4ZI3A 2D0DA 1OGIA 1NO1A 2J59A 2HA7A 3GU3A 4AP9A 4M0EA 4JJZA 5F3WA 5I9BA 5CXSA 2YV2A 1E1MA 2LKCA 4YN3A 1V16B 4NENA 5GJWC 2WDPA 4BWVA 1FLAA 1YE8A 1BAPA 1Z13A 5FOUA 1FVOA 3EVTA 1TGUA 3N8DA 1KH2A 4TX1A 5KYUB 2QG4A 4ML3A 5A1JA 4G0PA 2XGGA 1Z26A 1BKYA 1DPGA 3PCXA 4J94A 1O5IA 4CIDA 3DO5A 1T9HA 2OM6A 3HV0A 4HYQA 1UPBA 2RGAA 1AKQA 4OB6A 5TQ2A 4Y1GA 4PCZA 3DTVD 1WQ1R 4PVCA 2A1UB 2GBPA 3R7WB 3PNPA 2XBMA 2CXOA 1EA7A 4EY3A 4UVIA 5CVCA 1SGWA 5KOHA 2IYAA 2XDWA 4ZVVA 1VPEA 3PI7A 5EE5B 4CU2A 5AUOB 1UBKS 1XZQA 4JL8A 1RD4A 2H5JA 3EZGA 4AJPA 2VK2A 4DDMA 3FSRA 4PVDA 1P75A 2HBRA 3O93A 1LJLA 3R9KA 2EFCB 4PY2A 1R4AA 2OAP1 3VPBA 1R1DA 4PFSA 1SCAA 4L8LA 3PC6A 1MEOA 3A7EA 3AERB 1M66A 1ZMRA 1OTRA 4EA9A 3LLVA 1ZD4A 4OKSA 4MVJD 1DJPA 4B4DA 1AS0A 3ULKA 1L2CA 1IBKM 1XKLA 3TLGB 1TMKA 3PDJA 3A6LA 4QC2A 3OA0A 3QLEA 5CG2A 1RYEA 2AL7A 2ZBRA 1KYIA 1W96A 4FMCB 5ALUA 2UZ3A 1DBQA 3ZNNA 4I5FA 1LH0A 2WFLA 1SUEA 1U7OA 3H5RA 4XD2A 5H5JA 1YO6A 4FHFA 1OBHA 5C8YA 4KN8A 4ZCIA 2R00C 3SG0A 4L07A 3VZSA 5CW1A 1L7OA 4PANA 2NACA 2DU8A 1MB9A 2ATXA 3EOZA 2FPOA 4IZOA 1PWXA 2VT2A 4G9GA 1DC3A 5A4DA 4X92A 4ARVA 2B4TO 4ER7A 4JEMA 4OIFA 3CEJA 5KSYA 2OYSA 2HEGA 5LP6A 3R3YA 4MCAA 1A0OA 1XU7A 1ZHHA 2IXAA 3RG2A 1XTRA 1IUPA 1EA5A 4WVLA 5BSWA 4R01A 3EIWA 3A3PA 3QUAA 4N40A 3OT1A 2V7QD 1CDZA 4BO8A 3NJ8A 3R0JA 4I55F 3T4UA 2XYHA 1XXHE 5ADUS 1D7AA 4DSUA 3BH0A 4F2LA 4DCGA 1J0XO 5COQA 2AKYA 2OG1A 3BK2A 1H6AA 3WGGA 3FFTA 5K3EA 1BEUB 1VMEA 3FNHA 4AY4A 4O4LA 2J4DA 4WNYA 4M0MA 3EDYA 3PUKA 2WINI 1SUBA 1HUQA 4D74A 2C0CA 1E5XA 3LHSA 3PFIA 2C95A 2V59A 1W36D 1I4LD 3K8YA 1XZMA 1NLUA 3OQPA 5DRYA 3H18A 2WMDA 4HNQA 2H00A 4HL4A 1W76A 1V1MB 1KMMA 2J7OA 1OREA 1JR6A 4HDOB 4QWMA 3DLTA 5KTOA 3DLHA 5EKSA 3VGPA 3NP9A 1QVRA 5EG5A 3U49A 3QPUA 4Y2TA 4S05A 1XMVA 3KUDA 3BZUA 4JLOA 4C7OA 4GBED 4FGJA 2H4WA 4O4HB 4MARA 1I0ZA 4A0RA 1IJKA 2IHKA 5C5CA 4UHBA 4J0EA 2NVUA 4QATA 2HWKA 2H3HA 2VJCA 1A8IA 1NYQA 3S99A 3QLUC 5IT5A 1NV8A 1QB7A 4W5NA 5HFAA 4BFYA 1SKQA 4TXMA 3W1EA 5HF5A 1B8VA 1E9SA 3LK6A 4EZIA 2R6HA 4M49A 4YJGA 4EW1A 3HHPA 3H9UA 4A82A 5EP1A 1NMYA 4X1OA 2PBFA 2IW3A 1DI0A 1QDTA 1C0KA 3TXXA 4B3BA 4OKNA 3W5AA 3KS4A 4JYCA 2O7QA 1ZCZA 4PC2A 1I7PA 4EYEA 5KNLA 4WRRA 1SXJA 1TVCA 3HNRA 4IVQA 1M2HA 2WM3A 3HBAA 2A84A 3NOQA 5U4QA 4OVZB 2X5JO 1KKMA 5A6SA 5IUJC 4M0FA 3K70D 1NUTA 4MB6A 3OZXA 3L7YA 1GTRA 1W0JD 1ENYA 3AOEA 2I6XA 1FDUA 1KI6A 1G98A 1PR4A 4MWZA 4QXMA 3KT8A 3IAUA 3ZZ0A 3PRKE 1JBQA 4OMCA 1DRKA 3WXMA 3LXUX 1LZLA 3STTA 2B61A 1KY2A 1KEEB 3G9ZA 3CBQA 1YB5A 2G80A 1HA3A 1LTHR 2CXRA 3HFSA 3OG9A 2VL7A 2PJDA 1Y6RA 4ZHQB 3LDAA 3OC0A 3TDNA 1JEJA 4E32A 2NZ2A 4ZXFA 3RYCB 1NIJA 2VLBA 1HLPA 3FOCA 3HL0A 2E2WA 3OEEA 4GPD1 4EJ2A 1J2RA 1QMGA 1QUFA 4NCBA 2PMCA 3UPDA 3Q3HA 4B0PA 3WQBA 2OPBA 3TR0A 1S5PA 3NVDA 1RPZA 4ROSA 1R8SA 3THGA 3C6XA 2QPOA 3C6MA 4P5EA 2AUTA 1SUSA 1I3MA 1Z2PX 5ULLA 2EKDA 3F9RA 3HYSA 4TYYA 3PC7A 1W2GA 3NDJA 2Q45A 3ZHZA 1Y8CA 4FW8A 3D64A 1A98A 1EFDN 3PTZA 2VF2A 4ALNA 5JD6A 4OX9M 2P6UA 5I3CA 4I9UA 4P81A 3NUGA 2G5CA 4LJYA 1XLUA 1GRRA 3ETJA 3MYYA 1XQVA 2DUUA 2HY7A 2PE5A 2V5AA 3FWNA 1WUJS 3TTUA 2DKNA 5IBPA 5KVQA 2F2TA 5L51A 1ZNZA 4DBVO 3QF4B 5BSKA 1T6ZA 1ZK1A 2BFDB 4Y6OA 2IHYA 3CO5A 1Z6XA 3PQFA 4D3XA 5DXAA 1RM5A 4BLWA 5TGDA 4R3DA 2JHCA 1TYEB 1Q0QA 2PJRA 2QRVA 1DDGA 3QQPA 2XDQA 4KE7A 2DQ4A 1R27A 4N49A 5CD9A 5DNEA 3A46A 4YWJA 2P2GA 1HR0M 1UJ4A 4IDDA 4E6PA 4NV1A 1Q12A 3UAGA 5ERGB 1UP7A 3EDRA 3K9LA 1H1LA 2V5UA 1W5TA 1W7AA 2FFJA 1T5IA 1C3OA 3CH6A 2ZI9A 1RRMA 1AA6A 4BO0A 3E7XA 3NT2A 4L16A 2G83A 2XE8A 3DV0A 1BQ4A 3I6YA 2MSDB 4F92B 2I99A 1FMLA 3PGMA 4IQ8A 4YEDA 2HBQA 4G09A 1T9KA 3R0QA 3I2GA 1AGYA 3D8TA 2XX3A 2VHCA 3LY7A 1YSYA 3ICOA 4HUJA 1OB2A 4ZVOA 1BROA 4MGYR 1ZFNA 2CGEA 4MW7A 3TTXA 3QUCA 2QV0A 4HEA6 3U7JA 3BE6A 1P2VA 1HQKA 1KRHA 3PXAA 3DNPA 1QDLB 2BGTA 5H68A 3VFDA 4LF7B 3ROXA 2CNBA 3EWNA 5A03A 3WNVA 1IK6A 3AR6A 5LMUB 3K6SB 4BLQA 3ZBPA 4OTZA 5EUMA 1FYEA 5BUZA 3EZ6A 5HSGA 5K0BA 1S2MA 4UAGA 1GCUA 1J07A 1F2UA 1KEPA 4G1MB 3U4MA 1M2NA 3FPCA 4EO7A 3D8BA 1C9DB 1FLVA 3SAUA 1P1BA 1A5TA 5A7GA 1X39A 1ND5A 3PHCA 4F06A 3ZY2A 3AY3A 1BH2A 1Z6TA 2OCXA 4OSPA 4XASA