2Z4SA

Crystal structure of domain iii from the thermotoga maritima replication initiation protein dnaa
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
240
structure length
240
Chain Sequence
TPLNPDYTFENFVVGPGNSFAYHAALEVAKHPGRYNPLFIYGGVGLGKTHLLQSIGNYVVQNEPDLRVMYITSEKFLNDLVDSMKEGKLNEFREKYRKKVDILLIDDVQFLIGKTGVQTELFHTFNELHDSGKQIVICSDREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKSIARKMLEIEHGELPEEVLNFVAENVDDNLRRLRGAIIKLLVYKETTGKEVDLKEAILLLKDFIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosomal replication initiator protein dnaA
publication title A Common Mechanism for the ATP-DnaA-dependent Formation of Open Complexes at the Replication Origin
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein
total genus 82
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00308 Bac_DnaA Bacterial dnaA protein
A PF08299 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z4sA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2z4sA01
4FWIB 3FFAA 3FKSD 3GLHA 2QBYA 1UBEA 3L2OB 1G8PA 3UMSA 2FFQA 4DLYA 3PUYA 4QGAA 4MDEA 1U2RA 4BZXA 4O2RA 1FUKA 2G0NA 3W3AA 2GCOB 4UXHA 3IPYA 3WHKA 1Z3IX 2ANCA 5C1BA 4Q1AA 3TRFA 1GKIA 4HAWA 5FI0B 1ZUIA 2IBMA 3X1XA 3U7FB 4W7SA 3QF4B 1E9FA 4JBWA 2YWEA 3MWJA 1NIJA 4QBFA 5FPTA 2V7QD 5DSZA 2KI5A 2W83A 2NO0A 1NP6A 2WMOB 4NP6A 3SU8A 3ZDQA 4GNKA 3WYGA 4F91B 1TQ4A 2ZE5A 1BO6A 3FGNA 3FMOB 3B9PA 1OXXK 5FOUA 2FPKA 4TSFD 1G1MA 1W44A 1JQLB 1TMKA 2A3RA 4ESVA 4D26A 4KAXA 3REFA 1U81A 2VRWA 2WSMA 2QU8A 4OK5A 3VX4A 3HJNA 2IXGA 2OXRA 1YR9A 4K46A 3VX3A 2CMKA 1XPUA 3ZZ0A 5JEDA 3AKDA 5JEEA 3LH5A 1SVIA 3CNNA 4BLPA 3SQXA 3BC1A 4OQMA 1S2MA 1NIPA 3B85A 3AVUA 1SVSA 1H65A 2VF8A 4B75A 1XXHE 1GKYA 4NHOA 4CT4B 4M9QA 1OH6A 1UF9A 1YHNA 1ZD9A 2AWOA 2ZS9A 4R9UC 4TMTA 4KXFB 2ZYVX 3I73A 4EIWA 2ODNA 4IOKA 3O8RA 4KSBA 1DOAA 1KDPA 1CR0A 4HDCA 1NLZA 2XSZD 1NN0A 1N5KA 5CDFE 5JRZA 4LJ6A 1UEIA 2VHTA 1KY2A 2OE2A 1IHUA 3LWNA 4HB0A 5DHFA 2ZJYA 3K9NA 1F2UB 4A9AA 1DEKA 2HCBA 5EXTA 1MRNA 4PO8A 4PPGA 4AG5A 2XB4A 4A6XA 3PJRA 3NKVA 1B0UA 2R6DA 3H1TA 4A3VB 4CEIB 2EU8A 1U99A 1V5WA 2WJGA 2HLDA 2GJSA 5KSYA 3FB4A 1XD8A 5EXPA 3ETLA 1RYHA 1NBMA 1YKSA 2RMKA 2CCKA 5EE1A 1KI3A 2DPXA 2VHQA 1D2EA 1E0JA 2K5UA 3PENA 5H1YA 1T91A 1XTQA 3R8FA 2ZRLA 3ADKA 3D7MA 1K6MA 3H2YA 3PUWA 2R2AA 4JL6A 5LB4A 1VKJA 2X19A 4Q4AB 5FH9A 4HEJA 3I1FA 5JI3E 4IVQA 4BUJA 4DLZA 2XZLA 4URXR 2F1HA 2GBLA 2ZRGA 1JXMA 1E4VA 4ZDJA 5JBQA 2JLQA 3RVBA 3M0EA 2YWGA 2AXNA 3BBPA 2XZPA 3EZ9A 1ZINA 1FMJA 1IQPA 5KNBA 4GMXA 2RGBA 1E79A 1UDWA 1YZNA 4U5XA 2IW3A 3UANA 2GXQA 3IHLA 3BGWA 1EFTA 4JLOA 1AK2A 3C8UA 2WPDA 2G88A 5JJLA 3A6PC 1G4UR 2OFOA 2ZI5A 3N2EA 4A2PA 1TX4B 4A1FA 3TKLA 2CK3A 2ZI9A 1W0KD 5TB5A 4M8NE 3H86A 1W47A 2RGNC 1RPZA 4LJAA 5CIWA 3LBHA 3TAHA 2RHDA 1UKVY 1DAFA 4BFZA 4TYQA 5HE9A 2EFCB 2XTZA 1XTRA 2QE7D 2HF8A 1KO5A 4Q18A 3TH5A 1RYFA 2GJ8A 1LNZA 3C41J 2GVDC 5FUWA 5L8VA 4DCSA 2Y8EA 1II0A 3SFZA 1GNQA 3CPJB 2W00A 5ANRB 1TQ6A 1ZBDA 1CJTC 2A5YB 4B3BA 1P4SA 2E9SA 4C0AC 1GAJA 4XVUA 2GXSA 3C4JA 4Q03A 4G5RA 5D3MA 1NMZA 3GEIA 2VIIA 3RHFA 1QBKC 4JSYA 4MRPA 4K81B 2OBNA 4DSOA 4Q4JB 1NKTA 2HUPA 4D82A 4HI0E 3GJ0A 3UIEA 1ZP6A 2OAQ1 1RJ9B 4PXAA 5FI1B 4TTQA 2GDJA 3R9XA 2G1KA 4B73A 4FW9A 3BK7A 1NY6A 1KNQA 4OHVA 1Z29A 3DOFA 1CRQA 2IXEA 2IWRA 3TK1A 1OIWA 1D2MA 1NLYA 4AY2A 4KYIB 2ZEJA 1CIPA 1JPNA 2CLSA 4POAA 4TLEA 4MGZR 1T3HA 2ZVPX 1G7CA 2DFKB 3K53A 1KZGB 2G1JA 3U3MA 2PLRA 1N6HA 1YVDA 4U00A 4Z51A 4AYTA 2RGGA 3BJIC 4JN6A 3KFVA 4I1SA 5FR1A 3RWMB 3B8HA 1C9KA 1P2TA 5KO2A 1JR3D 4DJTA 4RVCA 2YZ2A 4A0FA 4Z54A 3I62A 3PQCA 4ACAA 1HQCA 4QGGA 3R9WA 1SXJB 3LBNA 3IKJA 3RS0A 2O8CA 4JKIA 4Q47A 3TSWA 1KIMA 3RRMA 1HT1E 5JSZA 3AH8A 4JLJA 2ZR7A 1ZUNB 2A78A 3AF2A 2GJKA 2CL7X 5FTJA 4U02A 1W36C 3ICEA 4ZO4A 2J87A 2NZ8A 1ZNXA 3AKEA 3T61A 3FKQA 5J4VA 3IIKA 5C4GB 1NLFA 4ZI3A 3R8CA 3BS4A 4I1OA 3A1SA 2WMNB 4LV5B 3AEZA 5CM9C 5G3ZA 1XTKA 2ZRKA 1HE1C 2JDID 2YC4C 3OEHD 4WBSA 3VHLB 1OKKA 4RKFA 1NL3A 3CLVA 3VQTA 4NH0A 4RD2A 3KJHA 3TBKA 1OXUA 3QNUA 1XD9A 721PA 4FWTA 1HV8A 3K9GA 5EE3A 1GNPA 2YYZA 2IYSA 3CRQA 1DELA 3TQCA 1ZVQA 3SHWA 4D0LB 1OB5A 4MYCA 1C4OA 1M7GA 1OIXA 3U5ZB 3C16C 4ERNA 4TSFA 2ANBA 2R8RA 2VSXA 1M1YE 4NYIQ 4PSKA 4QM6A 4LOAA 1G291 1KO7A 1E1RD 2BCGY 1E4YA 2ZSFA 4LJYA 4OYHA 4FD2A 2QI9C 2FFAA 4E5UA 3SJAA 1YZTA 4DEYA 2AD1A 5FBRB 4DUGD 2YWHA 1R8SA 4XVRA 1FOEB 2WAXA 2A30A 2CL0X 3GJ6A 4LPSA 2JAQA 4XTRA 3RS5A 1OH7A 4X8OA 1X37A 1P9NA 1FPMA 3EARA 3T1VA 3A1WA 5HE8A 2GAOA 4JJZA 4URVR 4QFMA 1VHLA 3OAAD 4MDFA 2J59A 4V0NA 3SEAA 1XZQA 1CEEA 3CM0A 2XJ9A 4DCNA 4BRWA 2BDTA 3GPLA 1VYUA 4UJ3A 2JGNA 4LZZA 3WMGA 3PUXA 3QEOA 5FTMA 3AP2A 4PSVA 1Q44A 3OF5A 2HJGA 4FCWA 2OO7A 3THYB 4IXMA 1R10A 4PQYA 3SBEA 1W46A 2BKEA 2JIZD 3EC2A 221PA 2GCNA 3FMPB 1FX0B 1NN3A 5FPKA 1LV7A 2YVUA 1S4QA 5EP1A 3A8TA 1GITA 5IT5A 2OCAA 2AFHE 4PC3A 4IDOA 1T5IA 4V02A 2RGEA 4D0GA 4EUNA 1UFQA 5HKKD 3L8ZA 3CR8A 2BBWA 1GG2A 1A2BA 1A5TA 2FH5B 4IKEA 1U8ZA 4Q7JB 4LCBA 3LVQE 1DAKA 3E1SA 1XXHA 4TWZA 5FPHA 4C3ZA 4OQLA 4C4PA 2JLXA 4IDPA 5F9HA 2EW1A 1XCGB 2OAP1 4BEJA 2V1XA 2G83A 2OG2A 1JB1A 1LF5A 3DVLA 5B30A 1TNDA 2GJAA 1ZD8A 2F7SA 3HWSA 5JMTA 5DYGA 3IBYA 2J7PA 2WJHA 3DO6A 2IS1A 5CDFA 2PZFA 2AKAB 3IHWA 3RSLA 2ZS7A 4A92A 4PZLA 2BBTA 1Q20A 8OHMA 2O8FB 3W8RA 4A0HA 1RIFA 1WXQA 2O5VA 4WVFA 2KSQA 4JT4A 4PPQA 3LW7A 3B7GA 4DEXA 1F5NA 3T1QA 1X1SA 4B3GA 4KODA 3U44A 4WW0A 1W0KA 3UXMA 1HUQA 1WRBA 3CBQA 4YLGA 3HYRA 5A5GA 2IS4A 2BMDA 3RAPR 3D6TB 5J4HA 3MD0A 4P4SB 4D4LA 2JLWA 1XTSA 2OEPA 4EQ6B 3FFBA 4RCYA 3I32A 4C0HA 2DFTA 3MCAA 2QE7A 1VYVA 3B78A 1OFTA 4UXJA 4OQXA 1LTQA 4LYFA 5GJWC 5IRCD 4H1VA 4BLQA 1R0WA 3LDAA 4JVLA 4JVSB 3AF0A 3ADCA 1VG0B 5B64A 1UEJA 1F3OA 4DLTA 4CRWB 1R8QA 2WOJA 3EZ2A 4O2LA 1RE0A 3LW8A 4UNSA 3MHVC 2RGXA 4L9SA 4LBYA 1IN7A 4IXNA 1R5OA 3K0SA 4RFSB 3GLGA 3AF3A 1SQ5A 3P4YA 1RRGA 3I3SR 3CR7A 4HZUA 1T5LA 4TMZA 5LD2B 1K5DA 2CHQA 5TDHA 3V4FA 2ORWA 1KGDA 1QG4A 4DZZA 4ON9A 1GM5A 3IILA 3IQWA 2J46A 4JVMA 4PFSA 2JJ8A 4WXRA 2W2TA 5B57C 3SC3A 3IPXA 1XFAA 4L5BA 1P75A 2VQSA 4YC7A 3OIVA 3K70C 1KI6A 1XPRA 4ABYA 4QRHA 1NVWQ 1G17A 3SFVA 2NPIA 1T9HA 1CJVC 2WM9B 1HEIA 3W9YA 6Q21A 3KKNA 2RGDA 2WHXA 1YZGA 3ZJYA 2BJWA 1MO3A 1ESNA 4OI2A 3SQWA 2J1LA 2RB4A 4KFRA 1JR3A 1E0AA 1GKUB 3GJXC 3T35A 4IDQA 1I4LD 1KDRA 4ZCLA 1CJKC 3ADBA 2PEZA 2N1BA 5AUOB 5TMPA 3EPKA 1T0HB 1IN5A 1SKYE 4JYBA 4MITA 3ZVRA 3AVTA 2WJYA 1EXMA 4UNRA 1P7CA 5J5CA 3TUJC 2FV8A 4NYJR 2JJ2D 4KV9A 1Y63A 4A4DA 5EP3A 4AC9A 1XP8A 2W6JA 2XTNA 3VKGA 5GVRA 5G40A 5DN6A 1QHSA 2J0VA 4LYJA 1M2OB 2BIFA 5A4JA 1XU4A 2VPPA 5EXSA 3OEHA 4MYUA 4UNQA 3NBFA 2NO7A 1U90A 2WKQA 3BERA 5LD2C 3CF2A 3MMPA 4KU4A 3VR1A 2CL6X 4CT5A 5JJKA 1BMFD 3KKOA 5BW8A 2UZIR 4L9WA 1EFCA 3QSYA 1Z07A 4YDHB 1ZCAA 4GP7A 2WTUA 3B9QA 3THXB 1M7BA 4B47A 1XD2B 3EX7C 2V6JA 3ZS9A 2C98A 1I2MA 1ZD1A 1NVVQ 1OPXA 3VMFA 1G8GA 1E1RA 4LSGA 4QL3A 4CEJA 4C0KA 4ZKDA 2EFHB 1NSFA 1UKEA 4P33A 2JATA 4MGYR 5E4FA 4DUGA 1MR3F 2REBA 1SULA 2CHGA 1XEXB 2KJQA 1E2FA 421PA 4RFVA 1Z83A 3T1TA 1M74A 4G5QA 1VCOA 1Z8FA 1W36D 2A5GA 1JEEA 4EAQA 3KZ1E 3OAAA 4Q1EA 4AKEA 3CWQA 1UKYA 3V9PA 4ASUD 4DDWA 2FEMA 3KFXA 3LBIA 3RS2A 4MRNA 5G53C 4DIDA 5B58C 1KSHA 1OV4A 1ANKA 4C0LA 1WCV1 4LHZA 2EWVA 1IAQA 3L0PA 1JJ7A 2HYDA 1EG7A 2DB3A 2ZRNA 2WV9A 4CVNA 1CU1A 1X86B 1CBUA 1I4DD 4Q00A 2JIZA 1II9A 2R9VA 5G3YA 1KI8A 1I4TD 1TU3A 3KB1A 1FNMA 2DWPA 3PG5A 4HDQB 1KI1A 1G3IA 1NJFA 2GETA 2JEOA 1JXOA 4Q9IA 2QPAA 1Q12A 5E3HA 4OHZA 1K8RA 4CEHB 1CKEA 2J3EA 2X77A 4GOKA 5HKKA 4PZYA 1COWD 1JNYA 1OT3A 1GWNA 4Q21A 1JPJA 3UWKA 1AQUA 1PUIA 4JLDA 3TUIC 3E2IA 3KUDA 3BRWD 2XXAA 1M34E 4ARZA 4FWHA 5HPYB 2N42A 2ZI7A 1NN5A 2I4IA 4AIIA 1MH1A 2B7BA 4MRRA 1TF7A 4BLOA 5JZVA 1D9ZA 2QTVB 2Z6VA 4M1TA 1S1MA 4PAMA 5B2ZA 4C0BA 1W7AA 1G7SA 1HH4A 2VBCA 4LHYA 2HT6A 2VSFA 2ZJAA 2G6BA 3AVPA 2AFIE 1ZM7A 2QMEA 1S0UA 2HXYA 1QVRA 5TXGA 1L7VC 5CJPA 4KI0A 2HT1A 4TTPA 1KKLA 1WBBA 4LGMA 4RZXA 3X1YA 3R7WB 4DLRA 4OQNA 4D81A 1OE0A 1LS6A 5L3SB 1OH8A 3VKWA 4A15A 1CS4C 3KTAB 2FSGA 4DSTA 2IYQA 4BPBA 2ZITA 3RDPA 3KXKA 4JLMA 4V03A 3H4MA 4M9ZA 3RANA 3M1IA 2VHUA 3K0CC 4BEBA 2GXAA 4TL9A 2IUUA 1XJCA 3GJ5A 3PEVA 5JHHB 3U7GA 2ZSEA 4PZZA 2QA5A 5JI2E 3GEHA 4XD7D 4DT1A 4G0NA 3WY9A 1TU4A 1U9IC 3P26A 2IHBA 1AZTA 3O47A 3PR1A 2FSIA 4LJ8A 4UXIA 1Z6XA 4LJ4A 1P6XA 2NO6A 2QMUA 4EJSC 1G20E 2V6ZM 3CPEA 3VR2A 5K8TA 3Q9LA 5DLQC 1Z0IA 5JLJA 2ERXA 3EW9A 4M53A 3K0FA 5KPDA 2B8TA 2FU5C 4JBYA 2QP9X 3TE6A 1Q22A 2AN9A 1UJ2A 1FUUA 1QHIA 4B35A 1IXSB 2V1UA 2N46A 3U4QA 1KMHA 3ZZTA 2DZOB 2ZI6A 2ERYA 1J70A 2RGNA 4QJ4A 1NSTA 2FMXA 3TR0A 3ND9A 2IL1A 1IY2A 4Q1CA 1G4AE 2UZ3A 1P60A 3F0TA 4V0ME 5CB6A 3T15A 3UPUA 5DI3A 1DO2A 3UWOA 1US8A 3BH7A 2J41A 2IXFA 4I99A 2Z5FA 1JAHA 2FSFA 4ILEA 3VU9A 3O8DA 1DG3A 1OIVA 4RKEA 3F8TA 3TMKA 1RRFA 4RJLA 2FOLA 4RZUA 2RCNA 2CDNA 2I3BA 4GRAA 3AP1A 3LVRE 4H1UA 4MUAA 2ZSDA 1ZMXA 1M8PA 2JLSA 2WSSA 4KJZA 4LV8B 4P3YA 5HTKA 1KSFX 4DDTA 2HJVA 3AKCA 2A5FA 4NYJQ 5GJVC 4EPVA 3KXLA 2JJ2A 1Z2CA 2F9MA 2NZJA 3BWDD 3L0SA 2GA8A 2ONKA 2C96A 4A8JC 4PR0A 1Z28A 3CRMA 4LHVA 1OXVA 4M1KA 4US2R 1UAAA 4N3NA 1CP2A 4BQSA 3IBGA 1I2DA 4OKSA 2ZYWX 3OIUA 3D3QA 1JALA 4FMBB 3KB2A 1XB2A 4BFUA 1NF3A 1BMFA 3BH0A 3K70D 2VHJA 3W8NA 3MJRA 2PMDA 5L3RA 4A82A 1YQTA 4D4KA 3D31A 3TSZA 3U61B 1KK3A 2AD5A 1O87A 4ZCIA 2FG5A 1OXTA 5EUMA 1G64A 2Z4RA 1HY3A 2OUKA 1U8AA 4Q9JA 2BKUA 4YMUA 2MMGA 1UDXA 5F9FA 4NCJA 2QEQA 2YOGA 1OYWA 1DPFA 4YXWD 2IK8A 5L3VA 4QC2A 1TAGA 3KQHA 3GLIB 1S9HA 3ONWA 2OT3B 1R0ZA 3NXSA 2DR3A 4NKRA 3IQXA 1TQDA 4ITRC 1WBDA 1KJWA 2J0UB 3FWYA 3NEJA 4JLAA 1A7JA 3SR0A 2FFHA 1J8YF 4WA7A 2CNWD 4ASUA 2NOAA 1OYYA 5KYKA 1W2HA 1G3MA 1J99A 1JQJC 3MFYA 2GHIA 3LO5A 4OK3A 2PCJA 2QM8A 1NY5A 4WOPA 2H7VA 3IEUA 4NE2A 2PBRA 1KAGA 4B43A 4D4JA 3ZVMA 4TYYA 2HF9A 3A4MA 3K09C 3GQBA 2ZRDA 3GFOA 1EWQA 1E32A 3G5UA 1MOZA 2EFGA 1ODFA 4RD1A 4BGDA 4QGFA 2O8BB 1ZM3A 2ZRFA 3W34A 3AVXA 4PAQA 2IYVA 1A4RA 1JJVA 1Q1BA 5C2JB 3GLHB 2QBYB 1XDBA 3A1VA 3N5CA 3CF0A 2GILA 4C9BA 2NMVA 2G3YA 1E9SA 4FWGA 2ZYUX 2J45A 4BFWA 5FOSA 4XWAA 3Q7PA 1SVOA 1G9XA 1VG1A 3TW8B 3GLFE 4PC1A 5IK2D 4RD0A 2F3TA 4PC7A 3E5HA 2NTYC 3GLGE 1U94A 2ATVA 3I8SA 4KFUA 2OFXA 3ZZUA 1Z6YA 3QXXA 5CLLA 4LRTA 2NO1A 2OV2A 5HR5A 1N5JA 3BB4A 1X6VA 2IT1A 1U0JA 5FTKA 2BHRA 3TLXA 1JAIA 4EPTA 4HUTA 1DO0A 1YE8A 4N0DA 5FPSA 1MABA 4XSGA 1IN4A 4HAZA 1GZSA 1IY0A 3QG5A 4G3XA 2ZYTX 1DTSA 2QRZA 5KSPA 2WZQA 1N6NA 2FPLA 2GJ9A 3SDZA 3RS4A 4C30A 2UVQA 4KCGA 2BMJA 1W4RA 3CONA 5FR2A 3TSOA 4B76A 4MGKR 1FL9A 4K8OA 4F7WA 2W6ID 2XNDA 3NDPA 4GI7A 2WWGA 4NCIA 5KNDA 5J40A 1YZLA 1VG8A 1Z2AA 3BOSA 1KY3A 2GZAA 2HXSA 2KE5A 4XOIA 1GRNA 1JR3E 4M9XA 4BZQA 2ZS8A 1TL7C 1XJQA 2GEDA 4EPXA 1MO6A 2CCGA 1LB1B 4V0LA 4DC9A 2VEDA 4BFTA 1ZAKA 4XVQA 1YU9A 1E2MA 3RSOA 2D3WA 4C0SA 2C9CA 1MT0A 1SZPA 3RRZA 3B1XA 1BH2A 1E2NA 1TQ2A 1W4AA 3DZDA 3KX2A 3SE0A 4U7DA 1CR2A 1Q21A 1CULC 1KO4A 5JSZB 3TUZC 3QKSB 2VP4A 1A1VA 4LBWA 3BFVA 2EFDB 1U8YA 1S9DA 3FHOA 1VCIA 1VIYA 4FCTA 1G21E 5KTYA 4AG6A 4D80A 1XMJA 2EVWX 1DAGA 2Q9AA 2QAGB 4FMCB 4KHZA 1D2NA 2ZIAA 5C46F 3QG1A 2W2XA 3BE4A 3EG5A 3QBTA 1AA9A 1XZPA 1VIAA 4NU0A 3VR3A 4BFSA 4D0NA 2O0JA 4I81A 1XMVA 3MAAC 1JI0A 4P0TA 4DLXA 2ORIA 5EP2A 4DB2A 5G41A 1YZQA 2XX3A 2OCYC 1HTWA 1R7RA 4JLVA 3DMNA 2VP2A 4TMWA 2WWXA 4TMXA 2QG6A 2QENA 3FKSA 1D5CA 2E87A 2TMKA 2PH1A 2R6GA 2AX4A 1VCMA 2QSZA 2WIBA 3JVVA 3X1DA 4B2LA 5J4YA 4FINA 3EIEA 3WNDA 1E2GA 5EP4A 3VNUA 5FTLA 1GL9B 4DLUA 1CRPA 3SZRA 4GFDA 2IYUA 3ZGXA 4ZI2A 1T4GA 4ZIRA 2GXUA 1XBTA 3W90A 2ZE7A 2GF0A 4HLDA 5HZKA 4O0MA 3FVQA 2AR7A 2KRKA 2WWIA 1XEWX 3Q85A 3QQ5A 1DS6A 3F3YA 2QZ4A 1E1QD 2V7QA 4GOJA 2F6RA 2WBLC 3OFND 2HYIC 4EFMA 1OFUX 1Z6GA 2QRNA 5D3QA 1WMSA 1TTTA 1E0KA 3QI2A 2ASEA 2BBSA 3L0IB 4Q4HA 2PX3A 1E99A 1Z0KA 4C7OA 1OH5A 4B33A 4LJ9A 3U7EB 1Q3HA 4JIMA 4V0MA 4CZ2A 4PPNA 2D2FA 2QROA 2QAGC 2OXCA 3PV0A 1XWIA 3B60A 5TY0A 4B44A 4UNNA 5GJBA 4PHGA 4GITA 3Q7QA 5D3MB 4AKGA 1D9XA 3NC1C 4II7A 4TQAA 3N2IA 4A6PA 4URUR 1SXJC 1FW6A 2Z43A 4DHEA 4FMDF 2WJIA 1HA3A 1ZJ6A 3T5GA 1N6RA 1MV5A 4YXWA 2WKRA 1CTQA 4EQ6A 2CJWA 3C7KA 4R2HA 5FUXA 1X8KA 2XSZA 2YOHA 4EKDA 1R0XA 2J7KA 1QHHA 4WIAA 1BIFA 3C15C 1FNNA 2BV3A 3RABA 4L16A 4M1WA 1T8TA 3CZPA 3K0AA 4TTRA 3BH6A 3U60B 4A2WA 2VP9A 4LY6A 1W5SA 2OILA 4M9SA 1EGAA 2ZPTX 4Q01A 1CR1A 3THWA 1OSNA 1DG1G 1XTJA 1Z0JA 1AM4D 1KYIA 4Z8YA 3CX6A 3EXAA 4P31A 2PZEA 5AWFC 4RSGA 4G5GA 1UPTA 3KW6A 3L8YA 1KAOA 4FCVA 2GEUA 2ZJZA 2FNAA 1QVAA 4MKIA 4OK6A 3VR4A 3G0HA 2ZUDA 2CE2X 1E9RA 2YWFA 1AS0A 3OHMA 3UG6A 4DLWA 3GP8A 3BAFA 3QPWA 3UK6A 1KDOA 1IONA 4LDJA 4Z1MD 1XJ0A 5JWHA 2R6CA 4Q66C 4YMWA 4DWJA 1LY1A 4B6EA 1SHZA 2PMKA 4XH9B 4URYR 1J7KA 1YR7A 1UBGA 1ZM9A 1Z6AA 3H84A 5IF9A 4N0EA 1KO1A 2FA9A 2MSCB 1R5NA 3BFKA 1O3YA 4WAUA 2WWYA 5FTNA 1PJRA 2X2EA 2H18A 3SI7A 2YJTD 4MKGA 1LW7A 1CLUA 1U0LA 1TEXA 1DAIA 1AJEA 3ZYCA 1WE2A 4EFNA 4Y0AA 1XCMA 4PO1A 1C1KA 1E2KA 1WA5A 2NGRA 3NIBA 3T5DA 3KQKA 2B21A 2QL6A 2OM2A 3IIJA 2ODEA 1XMSA 1ZNYA 3AP3A 5DYIA 1OFIA 1N5IA 4HB3A 2HV8A 2XAUA 2NG1A 1YRBA 5J4LA 2JLUA 3DKPA 2JLYA 3QENA 1EFRD 3C5CA 2P5TB 2J9RA 2OCBA 2QPTA 4M22A 2XNSA 4IRUB 5C4MA 2O8EA 4TT3D 2H92A 3AUXA 1D6JA 4LHXA 1II8B 2EYUA 3KJIA 3P1JA 3PEUA 4G5SA 1HYQA 3JZMA 4YDSA 3B6EA 1SVLA 4QBGB 3TGPA 1G19A 2FF7A 4IOLA 5EE0A 3GLFA 2ZRMA 5JRJA 1RZ3A 2WJJA 3QKRB 2PJRA 3GMTA 1KK2A 1W2GA 4NPHA 4TLBA 3C5HA 3DZ8A 5DNYB 1E9EA 1G6HA 2DWQA 2OLKA 1Z47A 1M6NA 4PC6A 4D4MA 4TYPA 3M6AA 4ZKEA 3Q5EA 2FGJA 1E2HA 5DISB 1KZ7B 4IOJA 1BYIA 3MGCA 3CWZA 2FZ4A 4B2PA 2AK2A 3O8BA 3FPAA 3KJGA 3LNCA 1AGRA 1F2TA 4WXPA 1H8ED 1S3SA 1P2VA 5DE3A 2ONJA 4BLRA 4NONA 4HLCA 2QSYA 4KFSA 1E94E 1NKSA 1OF1A 1HURA 4KLZA 1ZIPA 4EPWA 3CPHA 3R9IA 2HDNB 4Q9HA 3K0EA 2ODWA 3G82C 1AKEA 1P2SA 1NRJB 4RD3A 1F60A 1XMIA 2A2ZA 2OFWA 3EA0A 3ZIAD 3OESA 1W1WA 2VO1A 4AKHA 5KDOA 2FWRA 1XXHB 4TLCA 4RZ2A 2BM1A 2RAPA 1QRAA 2XB2A 2QN6A 5CLQA 4OHWA 3WMEA 1KKMA 1SVWA 4YQFA 4NCNA 2IS6A 1OXSC 5F98A 2GCPA 3K0CA 3K9LA 4R7ZA 2JLZA 4LYHA 4QHSA 1HQYE 4LRSA 2C78A 2G77B 3QIAA 3EZFA 4HUQB 2IA5A 3BORA 1AKYA 1E2QA 2G0TA 2REXB 3KKQA 4KBFA 3MUFA 4JS0A 2JA1A 3VKHA 3HR7A 1PLKA 1U9IA 1E98A 1G5PA 1V43A 2JDIA 4HB4A 4L4UA 1XCPA 2BWJA 2YC2C 4XTCS 4EJSA 3SYKA 2FX3A 1W48A 3W5IA 4PC2A 4QXAA 1NNEA 4BLSA 2R65A 5L3QA 4UNPA 4M1SA 4B3XA 4AYWA 1C1YA 2CVHA 3IDQA 1E9DA 2BEKA 5AJZA 1JBKA 1MKYA 1W4BA 4I4LA 4TZ0A 1VTKA 1ZCBA 3NTUA 2DBYA 3SJCA 3LD9A 4TQ9A 5EE9A 4TLAA 3LXRA 4W5WA 3FMFA 2CEAA 4M1OA 1NG1A 3CH5A 2O8DA 2A7QA 4D2IA 3NBXX 1MRSA 3MWYW 1ZC4A 2OESA 5HCIA 2D7CA 2ZR9A 1P61B 3GLGB 1PLLA 2KBFA 1NMXA 1Q1ZA 2GVZC 3GFPA 5HZHA 2V3CC 4HZUB 5F3WB 3WHLA 4JVNA 3FHCB 2P3SA 1SXJE 4JLNA 3R20A 4HAXA 2X2FA 3WXMA 3GJ4A 1L4UA 1FTSA 2VF7A 2WAYA 3P27A 2E1RA 3TNFA 3NG1A 3NVAA 1ZNZA 1VECA 2VTKA 3MRSA 4GZLA 5KHOC 4JYCA 4UKDA 1XPOA 1GRQA 1MO4A 1FFHA 1DADA 2FN4A 4M1MA 2BCJQ 3SNHA 3T34A 4TL7A 4A8JA 5K8LA 2R62A 1KOFA 2F43A 2IWHA 5FFMA 2VSOA 3I4LA 4KVAA 3AV0B 2HLDD 2ZRAA 3B13B 1AS3A 1NBMD 3P4XA 5EZ5A 1ZC3A 2ZRHA 3PXGA 4IHQA 4PHTA 4F93B 5JWRA 3ZVLA 3SYLA 2WOOA 4KLNA 2VP5A 3S1AA 2V8OA 4G1UC 4PTLA 2IF2A 2VA8A 5AJWA 3W5JA 3HYTA 1SXJD 1X8LA 1GTVA 3L82B 3PVSA 3SHFA 4EFLA 4OJKA 1N6PA 1IN6A 2R6AA 3FHTA 3TR5A 2A9KA 5EUQB 3B82A 3IUYA 1E9AA 3HP1A 3FYHA 4W5HA 4W5JA 3TQFA 2FDCA 1ESMA 1E79D 4OHYA 4QGHA 2GCOA 1LS1A 4FIDA 5DIFA 3WBJA 2REOA 4F38A 3L43A 3ZD7A 2I1QA 1G6OA 1J90A 2EYQA 2WPDD 1PUJA 3U3OA 2PEYA 3QF4A 4QKQA 2A5JA 3VLFB 3E70C 4G01B 4JSTA 2AXPA 1BS1A 5BXQC 1AZSC 2VH5R 3LLMA 1Z08A 3K09A 1EFRA 4P32A 3IIMA 5EZ6B 3K1JA 2J5XA 4KVGA 2DYKA 4B71A 4CEJB 1P3JA 4TT3A 3LAWA 2ZAMA 5IDVA 4KITB 5TARA 4GDFA 4CIDA 5KNCA 3RRNA 2Z0MA 2ZJ8A 3AVWA 1E6CA 3FE2A 1BYUA 4ZPXA 4B32A 1GUAA 2GWHA 1S8FA 1VG9B 2RGCA 4LRWA 4QOSA 3H0KA 3SYNA 3B1ZA 4E03A 2GEVA 4MYTA 1NMYA 2QMHA 3EPHA 3EPLA 4PO9A 4B34A 4JT2A 2P6RA 3CNLA 3CO5A 2QQEA 2R44A 5FUYA 4HYYA 1VMAA 3AKYA 1T3LA 4IDNA 3PFIA 2Q21A 1YZUA 1G7RA 1QG2A 1UBCA 3EWSA 5FBLB 5JS8A 1T8UA 1H8EA 2MMCA 2ORVA 2Q9CA 3LQQA 4N1AA 3O8CA 4EPRA 1IM2A 4PSAA 2JASA 2F1JA 2J0UA 3GCGA 3QXCA 3SJBA 3B1YA 1N6KA 2ZTSA 1A82A 1F2UA 3NC0C 4NTZA 4R2IA 4GBMA 2YINC 3I92A 1XTIA 1XEWY 2LWIA 4ACBA 4CEIA 1S1CA 3CX8A 1LFDB 4B48A 2CE7A 3NHBA 4M2LA 4DCUA 4QNRA 1VYTA 4BRUA 1Z06A 4OQFA 3OIWA 5E7MA 5K8UA 3U3KA 2XXAB 4ARZB 1P62B 3A37A 4MRVA 3T1OA 3W6NA 5TV2A 2ZR0A 3BD9A 1TPZA 2FJUA 4LJ5A 4IEEA 2F9LA 4URZR 4Q4AA 1KI7A 1S96A 3CUEF 4E07A 5E7JA 4NMMA 3MLEA 1VPLA 1LVGA 5BN4A 3FDIA 5H68A 1Q0UA 2IEYA 3EZ6A 2IHYA 2C95A 2BM0A 2P6NA 3NBZC 4MYHA 1NJGA 1CXZA 3LXXA 1NG9A 5FPYA 2H5EA 3OIYA 2XEXA 4ZDIA 2B6HA 3U2QA 3U6KA 3JZAA 2QGZA 3WNCA 2WWFA 1OKKD 3BB1A 1HE8B 1AS2A 1FP6A 4PHFA 2D4HA 3QVVA 1AQYA 5BN5A 1MO5A 2ZRCA 4YMSA 3SN6A 1RW4A 4GSYA 1ZYUA 5CM8B 3SS8A 3LA6A 1DAMA 1ZU4A 2BEJA 1YJ5A 4J0QA 4CDGA 5AK0A 5FOXA 2H8KA 1UADA 2ECKA 1G7TA 3I5XA 1DE0A 5BQ5A 4NYIR 1AN0A 3IO3A 4DT1B 1WQ1R 4HLUC 3WRYC 1KSJA 3RC8A 4JKYA 5KOYA 2W58A 2IYTA 4GMDA 5AR1A 2ZSBA 4M0LA 1DAHA 1OJLA 4QM7A 1W4CA 1XRJA 2Q3MA 5F2EA 3GD7A 1E9BA 4JLBA 4I1VA 4YMVA 1WDTA 3TW4A 4DXAA 3AJIB 3TAUA 3UKDA 1LF0A 1ZM4A 3I61A 1L8QA 4MUBA 3NBYC 3K0FB 3QXHA 2NO9A 1IY1A 1IXZA 3DM5A 4Q4JA 1FZQA 1RKBA 2QT1A 3Q72A 3GJ7A 1RJ9A 4FMDB 1P2UA 3U4QB 1KMHB 1XF9A 4QHTA 2EWWA 4F4IA 2R6FA 5SZHB 4F92B 4O3MA 4OBEA 4Q02A 4LJ7A 1FQKA 4E09A 5EJEA 1QHGA 2DHRA 2C03A 3PEWA 3VNVA 2ZQ5A 3EASA 3KDSE 3QKSA 3D8BA 2CXXA 1KTVA 2KWIA 4NYMR 4CF7A 2WIAA 1FMLA 1T0JB 1E2IA 1PLJA 2GF9A 2LCFA 2PX0A 2W0SA 1US8B 2ZUCA 3CNOA 5DI3B 2MSEB 5DO9A 2OBMA 3TIFA 3WBKA 4DDUA 2D7DA 1ZIOA 3VU9B 4R71A 1COWA 4GOXA 3AVQA 2DZNB 2QAGA 4XWOA 1L2TA 4GT1A 4OL0A 2C8VA 2OBLA 2P67A 3B1VA 2Z4SA 3CF6R 2GZDA 1GRRA 1N3BA 1N0UA 4LK2A 1G5TA 5AJVB 2ZJOA 1SXJA 3FMIA 4TN1A 3EA5A 4Q7LA 1XX6A 4XJXA 5GVSA 4R98A 2C9YA 3PUZA 3NH6A 3QY0A 2X1VA 3RS3A 5J4KA 3NHAA 1N6LA 4JZKA 3WYFA 2J7PD 4IW3B 2Q6TA 4A0GA 2ZJ5A 4O25A 3U3JA 3HU2A 4QG7A 4P4UA 1ZRHA 1QHNA 2CLDX 2P2LA 4HAUA 4IFEA 2WJVA 4AK9A 2O0HA 1RFLA 2ZREA 4TL6A 3WYAA 5BYKA 1W49A 4PX9A 1KO8A 4LYAA 3I72A 2CCJA 4H9GA 4KSCA 3QKUA 5CYOA 4OI1A 3QPVA 3I8XA 3ZVNA 4V0KA 2IYLD 2GZHA 4HB2A 4GZMA 1ETUA 4Q19A 3EPJA 1R0YA 1XNJA 2FGKA 2GK6A 3TJZA 4JLKA 1W0JD 2ZM5A 3GEEA 2YV5A 3T06B 1E2LA 5EXXA 3VTKA 1SKYB 3C14C 4NDZA 5LBIA 1QZMA 5LDDC 3K8YA 1TUEA 3DMDA 1G3QA 4L8GA 4NCHA 5H70A 4B74A 2XOKD 3ASYA 2ZRIA 2JLVA 1KI4A 1KK0A 4HAYA 4XD7A 4MRSA 1G8YA 5FL3A 1UBFA 1Z0AA 2FPMA 2ZRJA 3AF1A 1W36B 821PA 3X1ZA 3V00A 1VCNA 2Z83A 1G3UA 1KNXA 2AWNA 5CIQA 2OCPA 2J0SA 3KJEA 1ZU5A 4ZCMA 2UKDA 1J8MF 4Q7MB 1H8HD 4X8LA 2MSDB 3W3ZB 1NVUQ 3VHXA 3HU1A 2GRJA 3WP0A 4X8MA 4E22A 1SHKA 5KDLA 1YZKA 1ZM2A 4JLPA 2QP4A 3OE7D 1PV4A 3SJZA 4JL8A 3REGA 4OI4A 3IO5A 4ZDKA 3THYA 5KU1A 1ONBA 1WP9A 1YRAA 1P5ZB 3DHWC 1M7HA 1FX0A 2AKYA 2JJ1D 3I5YA 2KBEA 1JR6A 2HCJB 2BC9A 2B8WA 3EZ7A 4AD8A 1QF9A 2F1RA 1E2PA 4BWYA 2VHCA 2YHSA 3CIOA 1PVOA 4DIEA 5JWOA 2GESA 1Z6TA 1NN1A 5LPNA 3KKMA 2ZANA 4LHWA 4D25A 4LC0A 2QTHA 1KI9A 5DH9A 5AUQA 4EPYA 1X8JA 3LX5A 2RGAA 5TVKA 3MSXA 1X3SA 3AVYA 3HU3A 2QNRA 1HT2E 1G8FA 4G5OA 3ADDA 1N5LA 2PL3A 1JEDA 1MABB 3TVTA 2PCLA 4DSUA 3DPUA 2QPOA 4BLTA 1SVKA 2BVNA 4CYMA 3QE0A 1Z0DA 5JCPA 3DL0A 2W6JD 1ELOA 1T6NA 2AHOA 3QPUA 3UMFA 2EFEB 5DN6D 3ZLJA 1CJMA 2F3RA 3DEFA 3ND8A 4MH0R 2O8FA 4AWXA 4BE7B 1SKQA 2GNOA 5SZKB 4EDHA 4LI0A 2FSHA 3AF4A 3A36A 3LRPA 4YONB 1U98A 2O0KA 1PZNA 2IYRA 3B1WA 1J2JA 2QGNA 1RVDA 3X1WA 3CB4A 1E2JA 1P9RA 2XZOA 3LY5A 4MGIR 1QDEA 1L4YA 3ASZA 3QUSA 2GBLC 1RRPA 2ZSAA 1QZXA 2AL7A 1QHXA 4P4SA 2I1VB 5BYJA 2X8AA 2SHKA 5BWMA 1NVVR 2C9OA 2FZLA 2ZI3A 1VHTA 1II8A 2H1LA 1G3RA 3AGPA 3LFUA 4MA4A 5UKDA 2XTMA 5JHGB 4HSEA 2CNWA 3GJ8A 5GJCA 5A0FA 2ZU0C 1W5TA 2O52A 3QKRA 3WRXC 5C18A 2BMFA 4RFSA 2VYFA 4NBSA 4IEIA 2BOVA 4KBGA 1ZUHA 2ZI4A 4DB4A 2AK3A 5GADl 4B3DA 5AUPB 1N0VC 3M4YA 1NVXQ 4S2EA 5CK4A 2O8CB 4I1UA 3KL4A 4B3FX 4D6PA 1GFIA 3OEED 1TUIA 2OZEA 1KK1A 4NYMQ 2P65A 2QUZA 4RY2A 1SGWA 2C77A 4S35A 1T3SA 5KSOA 1DBSA 2BJVA 4Y0VA 3N70A 3IEVA 2V54A 1NI3A 4ZIRB 4IDHA 2CHVA 3LQRA 1F48A 2H17A 2DCUA 2IYXA 2OLJA 2V9PA 4PHHA 5IK2A 3HPQA 4TZ6A 4LUCA 1TF5A 2IF0A 2PZGA 1OHHD 2ZVQX 4W9MC 3Q5DA 2QORA 5E7IA 5AJYA 1G18A 5FBQB 3K9HA 3RRYA 4LBVA 4KYUA 3GLIE 1A2KC 2A5DA 3QXSA 4M21A 3WMFA 1AGPA 3NH9A 5CJ2A 4Q4HB 5SZJA 2IYWA 1E9CA 2JLRA 4HUQA 4Q9LA 4C0QC 3NDBB 4C7OB 5FOTA 4V0OA 2ZUBA 3NEYA 3K70B 2WICA 2D06A 4OJQA 3AVVA 1VDZA 2WWHA 3FOZA 2IUSA 2W6IA 1B23P 1KJZA 2VP6A 1OFHA 3CRRA 3DM9B 2NQ2C 5LB2A 4MKHA 3ZH9B 3GFTA 3ZQJA 2RH5A 2PT5A 3CRVA 4Q1FA 1IBRA 2ZE8A 1ZNWA 4IJMA 1TADA 2BBOA 1W0JA 1TF2A 2WVJA 1N25A 2QQ0A 3CRW1 3THXA 1OLOA 1XD2A 4M4SA 3QBVA 1BOFA 4WZAE 2QMOA 3HR8A 2J0QA 2CJWB 2Q9BA 2ZE6A 2XOKA 3HDTA 4B3CA 2WWWA 4DLSA 3CX7A 4NL4H 1E69A 3VFDA 1QHHB 3EIQA 2DFLA 4QBIA 2YNMA 3GLHE 4AI6A 4B6FA 1DVRA 4TMKA 4IVPA 3ZQ6A 3V4RA 1Q1QA 1UKZA 3K0AB 2WKPA 3OZXA 1IOZA 1XEXA 5J47A 5FL7D 4FMCF 4YMTA 1OB2A 4XIGS 4TL8A 4JMPA 4PQFA 5HCNA 3THWB 4NZYA 4Q48A 2PT7A 1H8HA 2ZU6A 4DVGA 1WF3A 1R2QA 2FEOA 5FOWA 1GDDA 1NVMA 4M1YA 4FXPA 4XWKA 3OE7A 2H57A 5P21A 3CH4B 3TVDA 2ZXUA 4TLDA 1QHYA 4KO8A 2G9NA 3ZD6A 5DGXA 5EE5B 4NCKA 2JJ1A 1S3GA 3ECCA 1U0HC 2W2VA 4Q7KA 3RNLA 1EESA 2OSBA 1GVNB 1CJUC 3JVUA 1EX7A 3CW2A 4AYXA 2C99A 4IFBA 2D74A 1P9WA 2H16A 4TMVA 3BXZA 4CEHA 3DKVA 2IYYA 2QY9A 4BFXA 2NIPA 4LC1A 1GNRA 2QT0A 5JCZA 1YR8A 1E2DA 1YR6A 3U44B 1E1QA 4QJ5A 4F4JA 2WSSD 1Z22A 3OFNA 5BN3A 1AIPA 4DRZA 2QM7A 1KJYA 3A1UA 3Q3JB 2ZRPA 4FWDA 1KHTA 2PLFA 4P4TA 1Z5ZA 4HATA 1CR4A 2Q0HA 2QTFA 4TQUS 2O8EB 3VR5A 4RZ3A 3RC3A 3W6OA 621PA 2IYZA 4GPTA 1BKDR 4PAOA 4JL5A 3X2SA 2EQBA 2L0XA 3SOPA 3ICQB 3QJYA 1F6BA 3P20A 4WZ6A 3FTQA 3PCRB 3R7WA 2C5LA 3VAAA 5L3SA 1NBME 4B2IA 3GLFB 4Z8XA 2KB0A 1EX6A 3KTAA 4GL2A 1G16A 4C0JA 2ZETA 5DHAA 3CZQA 1GIAA 1P72A 2DWZB 5SZIA 4RCZA 4DKXA 2ZAOA 1DAEA 3LX8A 3EWAA 4X8HA 1X1RA 2C2HA 4A0RA 1P73A 2GTPA 2GAAA 3LLUA 4A36A 4QBHA 1CF4A 3P32A 4US0R 1F2TB 3W6PA 3RLFA 3A4LA 4IVRA 4IOMA 5CITA 2LKCA 3AUYA 1KI6B 3BB3A 4FN5A 1G5RA 1KSGA 2XGJA 3EC1A 3ZS8A 2QP3A 4TYNA 4Q1DA 1GILA 3GJ3A 2ZJ2A 1FP7A 2QAJA 1EWRA 2IX3A 4PPFA 1IJFA 1E96A 4XSHA 2V55B 4Q4LA 4A2QA 4BASA 4Q5IA 2VLIA 4QNMA 3AVOA 4BECA 3DDCA 1ZW6A 1K5GA 3MWKA 4DLVA 1FTNA 3BIFA 5JECA 2DVWB 1R4AA 3KQUA 1GL7A 2GK7A 2CLCX 3QXJA 3OEEA 4UQOA 4L15A 4DDVA 5AJXA 1JECA 3A58B 2DWOA 4MQBA 4Z1MA 1N2CE 2DFNA 4PQRA 4UJ5A 3AM1A 1DARA 1XEFA 3L0OA 3A4NA 3T12A 3KQLA 4HLQB 2OHFA 4C2TA 1N0WA 2F1IA 1IXRC 3LV8A 3PUVA 2V6IA 5CB8A 2P0EA 2NPFA 1N6OA 2V4ZA 3MJHA 4WZBE 3UMRA 2BMEA 3AB3A 3AGQA 1RC8A 4AKIA 4HLUA 4Q1BA 4RD4A 1IJEA 3F5FA 3NWJA 4HZIA 1EFHA 5FBVB 1Q1EA 1GL6A 3QF7A 2YOFA 2GKSA 3KXIA 3PEYA 4Q9KA 3CKLA 1Q3TA 4EJSB 1OHHA 3IGFA 5KDDA 3U6BA 3KQNA 2ZROA 3EIHA 2B92A 4HDOB 5L3QB 2Q3HA 4FI3C 3QOFA 2P5SA 5KUTA 1Y3AA 4CGZA 3QKTA 2VP0A 4LPKA 5EQTA 2CK3D 4QHYA 521PA 4ESHA 3MWLA 4URWR 2IUTA 1Z0FA 5KPJA 1EK0A 2RHMA 2RKOA 2Q3FA 2W0MA 2LKDA 2ODBA 3BFXA 4OHXA 4TYWA 3UG7A 1N6IA 5JJIA 1GSIA 3MG9A 1GP2A 3SBDA 1G41A 121PA 5CK5A 4ZV4A 3J81k 2CVFA 2O8DB 5H8WA 3VR6A 3UATA 5FUVA 2XNDD 1KMQA 3THOA 3B2EA 5DI9A 3B5JA 4BFVA 2CBZA 2F55A 1UM8A 1EFUA 3RYTC 4LV6A 4C2UA 2IEZA 1FQJA 1D8TA 5K8IA 4RD6A 2YKGA 5CYPA 4GP6A 4DSNA 2C04A 5IHPA 3WNBA 2FE4A 2D2EA 5M04A 3HPRA 2XITA 4DCVA 5AUNB 1RRCA 4HAVA 1R6BX 3WP1B 4F4CA 1E2EA 2ZJBA 2IC5A 3Q8XB 3QEJA 1E3MA 1R5BA 3DOEA 3GLIA 1Z63A 1OW3B 2XJ4A 4JJKA 4MKFA 1E0SA 5FL7A 5FBWB 4A8JB 2P6UA 2FFBA 2HEIA 2JCSA 2PJZA 3KKPA 3RWOA 2F43B 3KUCA 4LBZA 4LWZA 3U3RA 1GOTA 1KI2A 2B7CA 1IN8A 4LX0A 4JBXA 2ATXA 3AQ4A 3ZIAA 4KFTA 5E95A 5JFGA 2D62A 3RS7A 4PANA 4CW7A 3QVUA 3U7HB 5ELXA 4OI0A 3EAQA 5FOVA 3PITA 4ZDWA 3S1AB 2IS2A 4AURA 5JS7A 3A1TA 4BZPA 5KSZA 1WB9A 4DBLC 1Q57A 1G8HA 1KDTA 4DCTA 4US1R 2VL7A 2ZRBA 4QJ3A 2O8BA 4BFYA 3PIRA 1TEVA 2DY1A 1SVMA
chains in the Genus database with same CATH superfamily
3EAGA 1IBLM 3PUYA 1U2RA 4PS1A 1DGQA 3E27A 4FUQA 5I9IA 3TW0A 3T3DA 3M6LA 3MMNA 1DGGA 4QQRA 2BTOA 2CKMA 3H97A 2VJKA 3B9PA 1G1MA 3WSVA 3U09A 1YR9A 3DTVB 3ZJ4A 1SVIA 5DM1A 3WDSA 3SQXA 4OQMA 3AVUA 3FCOA 2VF8A 1UF9A 4EKEA 1XVTA 1IIBA 4EIWA 2X4IA 4HDCA 2XSZD 1NN0A 5JISA 4MB7A 5JFOA 4HNUA 2YIJA 5U1PA 3U4GA 4A3VB 3GYBA 2PUAA 3OY7A 4I19A 1XTQA 4BJ1A 5AIBA 5LB4A 3RSSA 3RVOA 2P5UA 2WM2A 4REMA 5BN4B 5TVGA 3IV9A 3G2QA 1O8CA 1GYPA 4QECA 1NBAA 2WPDA 1VRWA 1U7UA 2ZI9A 1W0KD 1MNAA 3JWHA 2RHDA 1Q1AA 1XTRA 3JVDA 1O9HA 3PDWA 5BSUA 3G7SA 1P4SA 1SXHA 5ALJA 4UVEA 4QQKA 2C97A 4EITA 2EBUA 2Y1EA 1HE5A 2C7PA 2MCFA 4WNIA 2CXTA 4QO8A 4B73A 5CB4F 4DR5B 1VL0A 4QWMA 4B3HA 1YZVA 3MIIA 1OIWA 1NLYA 3BRCA 4POAA 3L41A 1GTSA 3I4VA 1UBOS 4O6VA 1KTIA 1X15A 1XHFA 4YV1A 4DJTA 3OUTA 1K75A 3PDCA 5F51A 5FJIA 4KQFA 1UK7A 1QDRA 1EUCB 5FWXA 5J4VA 3P2MA 2X22A 2ZCUA 4I1OA 2YZGA 3AEZA 5D01A 2ZRKA 4PCLA 3DDZX 3D1VA 4CF3A 1LBIA 1U8FO 2HA6A 2K87A 1AUPA 3PA6A 2Q3EA 3FMVA 4MPRA 1ZEJA 1W76A 1M1YE 1E1RD 2FFAA 3QMPA 3PEEA 1D8AA 4LPSA 1U28C 2Y1CA 1P9NA 2BZSA 3L1IA 4MDFA 3CM0A 5DNYA 3RJZA 5LYJB 3WMGA 2EEPA 2G4CA 1G59A 1W46A 5H3CA 5EP1A 2XUDA 3C2QA 1Y5RA 4U6QA 4JR2A 5EHXA 1V0JA 2BBWA 2FH5B 2X1MA 3M9XA 3EOBI 4Z9XA 3E1SA 1I5OA 1Z88A 4PZCA 1ZGGA 3SXPA 1ZR2A 2G83A 2NVUB 4KJXA 4G3OA 4YCAA 2J7PA 1FDTA 2IS1A 1LBHA 2AR0A 4HNGA 5AKJA 5A05A 3DZCA 3AUFA 4B3GA 4NEQA 2BKAA 4PF1A 2B4TO 2IELA 1GAXA 1XJ5A 4GI5A 4QJBA 4BLQA 1R0WA 3ADCA 5F12A 4AULA 2BFAA 4CRWB 4L9SA 4ZI7B 5G0SA 2CV1A 2WIKA 3A6GA 2Q4BA 4LJKA 3ZWPA 4BNTA 1QG4A 4TVBA 1QCCA 4XD2A 2DERA 2C1ZA 1OY1A 2FMKA 3BA1A 4N7MA 3D8SA 2F4VB 2P3QA 4KPUB 1O96A 5D7NA 1MO3A 3RUAA 2XLCA 1V48A 2A35A 3PQ7A 3N2NA 1YUNA 3LT4A 4N82A 1JSZA 3TUJC 3HVRA 3V33A 4DEVA 4NYJR 1Y5LA 1TXGA 1XP8A 4JOCA 3VKGA 5CLFA 2BF4A 1X1AA 2CFTA 2BHTA 3KVYA 3IBFA 5JJKA 3SKYA 3G0BA 2C29D 4W5TA 1RJEA 4M3NA 3N59A 1ZL2A 4FE4A 4Y6SA 2JJQA 5KJFA 1NQAO 1D4AA 4Q15A 1LNSA 1LPBB 421PA 1OU0A 5ICSA 4EEZA 2P4SA 1I10A 2IPOA 4QLAA 1V25A 2EWVA 1QPGA 4DMUB 4GRDA 3TDNA 4PCZA 1TC2A 3NNSA 1M1YA 3V1TC 3IHKA 1XMXA 4RQBA 1P7WA 3RREA 3O8OB 1WW2A 3MTEA 2X41A 2CLKB 1JIKA 4RAQA 5HDQA 4ZEXA 1WG8A 3M3PA 2IVFA 2Z6VA 3A9CA 2QRKA 2HSWA 3GEPA 1S3FA 3QMMA 4CIVA 1L7VC 4YPFA 3PC6A 1D6MA 4G07A 3D5TA 4JYPA 4TROA 4RTMA 1M6EX 2R3SA 3MNFA 2ZTLA 2V7EA 2IHBA 3GUUA 1GKKA 5DLQC 2GPWA 2QP9X 2NSLA 4KNVA 3U4QA 3QVMA 2B0CA 1O77A 2NTEA 2OL4A 3WLRA 2B8JA 1GDHA 4Q1CA 3OZAA 2PZBA 4O8CA 2BF7A 1A9RA 3OX4A 2YMMA 3T9AA 1EXVA 4IJKA 3AYXB 2E6UX 2H1VA 3RYHB 1Z2CA 2F9MA 1XDSA 4OHBA 1X1EA 3E5NA 3LL7A 1ZO8A 2MH8A 4M1KA 2OZLA 4CKCB 4BQSA 3OM1A 3K70D 3IALA 4GE3A 2PMDA 5JNWA 2YH2A 3LCCA 3DCYA 4IS3A 3FZQA 4LWQA 1G71A 3SQNA 1SURA 3I2IA 4F60A 2QV0A 5DFAA 3OHPA 2M1ZA 3KSXA 3MK31 1E92A 1TB4A 4JLAA 3DXXA 2NOAA 4ASUA 1W2HA 3HHYA 1J99A 1JQJC 4ZQHA 1GO2A 4AL4A 1KAGA 4D4JA 2JD2A 3PNKA 1E1DA 4OFWA 1L5FA 2H0AA 2B4QA 3O4JA 1A4RA 4XJSA 1VPTA 3N5CA 4GPAA 4HJXA 2ZVJA 4BU0A 1NC1A 4P5DA 3A2MA 3D43A 4RD0A 3DP9A 2VYNA 4TUYA 5BN5B 3CF4G 1CQIA 2ZYTX 1BCRA 4EMSA 3ETNA 4IDDA 2QW1A 5BOVA 3ESRA 4M9XA 4DMLA 4IHAA 4FLFA 2HSEA 4JLSA 4Z7NB 5HGXA 1LB1B 5ALXA 3KSJA 2VEDA 3N53A 2C9CA 4F38A 5JZ9A 5CT8A 3FYUA 1CULC 4WT7A 1C0LA 3BFVA 1SIOA 1NJ1A 1J0BA 1YHZA 4YP9A 5C46F 4HX9A 3O8LA 1SUWA 4ZHQF 3T0GA 3UT6A 2WIBA 2CF6A 1EUYA 4P1ZA 1JEQB 3NYRA 3LSTA 5G1OA 2BR4A 3CUUA 3UK0A 4GU5A 1TH4A 5DHQA 3L18A 1X2BA 1GKLA 3TIVA 3J7AC 3QNWA 4RVUA 3QUTA 2WV7A 2VDWA 4AJOA 3NAQA 3Q7QA 4CPDA 4BNDB 1RABA 4L74A 2J09A 1PNRA 5B2EA 3WSWA 1YQDA 2MU1A 4FFBA 2VP3A 4PX2A 1K08A 3O2NA 2CJPA 4FSXA 3TKYA 2ZT6A 1JZQA 5JXGA 1W87A 4FYKA 2ZAIA 3GFVA 3BWVA 4FEAA 1OSNA 5HXAA 1DG1G 4DSZA 1TJYA 2AOTA 2OO9A 2QM3A 3KYDB 4OM7A 4UFPA 3PNQA 1OWLA 5E7QA 4C2AA 4GHLA 3E6AA 1RM3A 1KO1A 4NAVA 4K3UA 3SI7A 4E2WA 3WXBA 1DAIA 2XWJI 4PO1A 1Z17A 4OJNA 4WKBA 1X9IA 4HB3A 2HMUA 2J5QA 5DU2A 1WW3A 3ISTA 2JLYA 4QULA 1YIAA 4OHRA 4IRUB 4I6EA 2H92A 1PZEA 5JAUA 1D6JA 2NU7A 3DOAA 1NATA 1C0PA 4Q3BA 1M1ZA 3N1UA 3UNXA 5JSKA 4ANFA 1W9HA 4PC6A 1UKAA 4L51A 3LGXA 1YA6A 2LUOA 1FX1A 1WMDA 1U4NA 2KNVA 1KJJA 3WMRA 4HGPA 3W0FA 3AONB 4MZXA 1XA0A 3BMXA 2XCTB 4EGQA 5EGNA 2ODWA 1XQ9A 2IEGA 1ILEA 4TLCA 4HQ0A 3FLMA 4PLTA 2I1WA 2C58A 2FK7A 5FULA 3K0CA 3QFFA 4LYHA 4CTJA 3QBDA 3OZGA 4II2A 2MYUA 4JEMA 3Q3CA 4LFCM 2BI7A 4IWYA 4YTEA 3K9CA 1UJBA 4PC2A 5JH7A 2Q07A 4NX2A 3EEOA 2YBDA 3IDQA 5CCEA 3O3NB 2CWDA 4QFCA 3AHCA 4W5WA 3ORQA 1VA5A 4B17A 1MW9X 2Q8NA 2NSDA 2OESA 1JA9A 5HCIA 3RLIA 1NMXA 3EUEA 2H5JA 1N33B 1KDZA 2Z2YA 4P84A 4NI5A 3NVAA 2B1IA 3B7WA 2K2WA 4TL7A 2XLBA 1M2FA 1YO6A 4CR8A 1ZC3A 3V3TA 2FW9A 3K9BA 1KZ9A 1ZLXA 2XQJA 3AF5A 2D54A 3ZGOA 4JX9A 4C89A 2JEYA 4H4CA 2H1RA 2GCOA 1LS1A 1DJOA 4FIDA 5JPCA 4GH9A 2VEOA 1ZUWA 1PUJA 1M1NA 2EFYA 2I7CA 4PCAA 3RROA 1AZSC 3C3DA 2VH5R 4QVGA 4BV2A 1YI0A 4KVGA 5A03A 4FOSA 3LAWA 4Q3LA 2TMGA 1P91A 3NBAA 2X9LA 3VXKA 3DVSX 3LX4A 3WLSA 4H3KB 4MP8A 2JGKA 1T3LA 3L7NA 2JBAB 5LIPA 1QG2A 4EBBA 3T1YB 1IWBB 4HXGA 3K32A 5TS2A 1DRUA 4FHDA 3U7JA 3I92A 1W93A 1I3MA 4HT3B 4N5DA 3G9TA 4RACA 5DM60 3KP1E 1YQEA 3T1OA 4DV5B 3M4XA 4MVYA 2O1SA 2NV2B 3CUEF 5I7FA 5H68A 1JFLA 4MI9A 1SPXA 1GARA 3ISVA 1NJGA 2H5EA 1GPH1 3IVMA 3WNCA 5JCJD 5A02A 1HE8B 1DRVA 2YL2A 3DEHA 1VZ3A 3LA6A 4BNHA 1D1SA 4RY0A 4CETA 2VF2A 3RC8A 2JAUA 3TX6A 2W58A 4U63A 4YMVA 3U1TA 4JNCA 3O1HB 4BZWA 1IL0A 2B8EA 3WHIA 1ECLA 1KMHB 3NPAA 2EWWA 3MHPA 1W85B 4GBGA 2ZQ5A 1L4FA 2C3OA 1Q1GA 4M99A 3IKMB 3ZHOA 2HA4A 1FDRA 3MOIA 4GOXA 1A8PA 3DPIA 2XV1A 1V37A 3T9FA 4MQEB 1Q74A 1N0UA 4TN1A 3MFQA 5E6SA 3D3WB 5ALGA 1JHVA 4GYJA 1GFSA 1N6LA 4UMEA 1ZRHA 1QHNA 3X1JA 4HAUA 1OTYA 4CFSA 5C7YA 3BCUA 4R68A 5FQNA 1V8FA 3RJTA 5CUQA 1JXQA 3Q2KA 3ZVNA 5KYWA 4GEGA 3UPDA 4PGGA 1V1RA 4YN3A 1LX6A 4S1TA 1I33A 5F1KA 1SC1A 1QZMA 4CGYB 3OEWA 3ZZNA 3CJQA 4YP5A 3HADA 1I3KA 1IN1A 3V00A 5CXQA 2VN8A 4L57A 2GRJA 5BWBA 5KDLA 4TKVA 4H35A 1FU4A 3MB8A 5T6BA 1MO2A 1PD1A 3BN3A 4B3MB 1YRAA 5B4TA 2AYZA 2GARA 4ZVRA 4DR2M 2IZ0A 3Q2IA 5JY1A 4MV3A 4QUJA 2VYVD 2DAEA 2RGAA 1QGUA 1X3SA 2WZJA 2PL3A 1RXYA 5KAMA 2BVNA 1EBBA 3D4OA 3GCWA 5JCPA 1O57A 4MJXA 5EJAA 2Q5JA 3RYIB 4LI0A 3RIEA 2B4AA 3KP1A 1JYSA 4UNIA 1P39A 3JASB 1TDHA 4HP8A 2O2CA 2V7VA 2PQ0A 2QLLA 1PEDA 3G2MA 1SUSA 2NYRA 2CNWA 2JVIA 4YRTA 4U2GA 3PDHA 3EQ2A 4KL8S 1OXKB 3EISA 2AXQA 3IT2A 3PFFA 3EEQA 3KL4A 3CJRA 3RB8A 1P7YA 3T7DA 3W8FA 1FS6A 4JA0A 1SGWA 3E23A 4GG1A 3GFGA 3H3FA 4CLRB 4LW8A 2NXEA 1D1QA 4TZ6A 1G2PA 2IF0A 1OHHD 3G9QA 1A2KC 5IM5A 5CJ2A 5TQVA 3GCXA 4Q9LA 1E9CA 4C7OB 4DV1B 2PH5A 3PX7A 1M8KA 4QYWA 2JLBA 3W0LB 3OH8A 2AS0A 2NQ2C 1K5HA 4G1BA 5TLSA 4Q24A 3OHSX 4B7ZA 5JDIC 3B52X 1RHQA 4WXEA 1QNFA 2YNMA 4CMEA 2OXTA 2PTHA 3K0AB 3OZXA 5J47A 4MS4B 4FMCF 4JMPA 1NUQA 2PT7A 4LOHA 4IDGA 5B7QA 3WAJA 4M1YA 3CH4B 2W6QA 1EMDA 2XUIA 4IFIA 4KO8A 1LBEA 2G9NA 3T6PA 3ZXYA 1WXEA 3CW2A 3ZLVA 3C87A 3DKVA 4Z7JA 3K8QA 3AWDA 1YA8A 2RJOA 2FKNA 2OUIA 2QX8A 3Q3JB 3GELA 1K7YA 1GCAA 3QITA 1PQ4A 4BB0A 1RDFA 1DIOB 3FPKA 4AQ7A 2VSNA 1PFUA 2BE9A 2O0LA 1YL6A 4DM3A 1ZK3A 3ZHQA 3C39A 4FVMA 2HFKA 2XXBA 3I1YA 4GL4A 3I58A 3W8DA 4I8IA 2GM5A 4NG5A 3GNQA 3L6CA 2GTPA 4A36A 3TZ6A 1CF4A 3TLGA 1DX6A 4IOMA 5CITA 2Q2EB 5DLDA 3GCDA 3HK2A 4W5NA 2EL7A 1VIVA 2IX3A 1U0RA 5EZYF 2AG5A 3FVVA 3A06A 5C3MA 1LLUA 4I8DA 1R4AA 3O95A 4AJHA 2R8PA 3P9ZA 3TX2A 5HJ7A 5IH7A 2D1RA 3A4NA 3T12A 1ZHHA 1W75A 4WZBE 3GFQA 3P52A 3AETA 1XGKA 3BEDA 1Q17A 4TMFA 3ZEIA 3B20A 4O1IA 1Y6JA 1SCUA 4HDOB 2GS9A 4Z99A 3T7JA 1XN1A 2PXHA 2WIFA 5ADHA 4YEDA 1LX7A 1PFKA 4URWR 3D4NA 4LFBB 3GDHA 4DA9A 5L9AA 2AMVA 3WL8A 3HCEA 5J63A 3A11A 1I2BA 5IXYA 3SGLA 3UATA 4MW9A 4X1IA 3MRTA 4CQMD 3W5DA 3H18A 5JNRA 3K5HA 2F55A 4FYMA 4LV6A 2IEZA 3PK0A 1TMGE 4KKXB 5FLXA 1KGSA 2FWNA 2W37A 1PJ2A 1XLWA 3EXG1 3PNOA 4E5MA 4I1PA 4EW6A 4CJXA 4L8LA 3ZE1B 2P6PA 3EGIA 1GOTA 1J39A 3MT8A 3ABQB 4LX0A 1A8QA 1OWNA 3VYTB 5KYUA 4CW7A 3S1AB 2IS2A 4X91A 2A9OA 2A14A 1DIGA 1WB9A 1Q57A 2X3UA 2C2BA 4FWIB 3FFAA 2R1VB 4MIKA 2HNAA 4YV0A 2P6MA 2DPMA 1Y7HA 4TSRA 3JQ8B 1NQUA 3CG4A 3KIPA 1YC5A 5FI0B 1ULZA 4W7SA 4JBWA 4NOLA 3ICWA 1LQ2A 5DWDA 2BJHA 4BVFA 4EECA 3P9YA 3NLLA 5ICCA 1W1IA 1W44A 3HM2A 4V24A 4LWPA 3PDUA 3OMWA 3HH8A 3LVWA 3QW2A 1LCIA 2H48A 1DI0A 2AWOA 3BFPA 4TMTA 3TXAA 4K6CA 5MHTA 5MN5A 2XT9A 1N1EA 1RAGA 1C50A 4EB0A 4L8VA 4KSBA 1U7XA 1TIBA 5HEKA 1KY2A 3ANXA 5D87A 1A8UA 4A6XA 2R6DA 1EX9A 2QZZA 3ORSA 2JS7A 3RT9A 5EE1A 1KI3A 1E0JA 2F5NA 4JELA 4AMVA 4UREA 1ZESA 1B2RA 5JAOA 4PONA 2J3QA 2QGFA 2GBLA 4GMQA 1LSJA 3OTWA 1WY7A 1TLFA 3TTWA 3V7FA 1DKNA 3EZ9A 3PC3A 4ZA2A 1FMJA 1EM8A 1E79A 2GBFA 2VBFA 1UPXA 3ETEA 2A9JA 4AW9A 5F3RA 3KSZO 4FOOA 4M8NE 1DV0A 3U4HA 3UK7A 1B76A 3IAEA 2NM0A 4YMHA 1JHOA 5FUWA 5L8VA 3D0QA 2NZ2A 1GNQA 2WFZA 4WZBA 4IGEA 2G72A 3GEIA 5JAMA 1GPYA 1M34A 2WVHA 3JQEA 4JKOA 3VH3A 1HETA 1VM6A 3BICA 4WXMA 4BDSA 3LG2A 1YJAA 3SICE 2J4CA 4XYMA 1Z29A 4ONEA 2DH6A 5IPFA 3E9ZA 1NFFA 4CLDA 1QZEA 3U60A 4MXDA 3SXUB 3CVOA 13PKA 2Z9DA 2YZ2A 3G1TA 3OZEA 1MDFA 3L9WA 1V71A 4GKBA 3OZBA 1IY8A 1GV1A 4DMHA 5EMLA 3L46A 4XDGA 3BS4A 3EMBA 5CM9C 2XB8A 1B0ZA 5CEJA 2A1TR 4EJ0A 1OKKA 2PLWA 1ZI6A 1LSSA 2D7EA 4UU0A 2PZAA 2VNIA 1H2RS 3VH1A 4I4CA 4QUKA 3U5ZB 4X64B 2Q29A 5L3ZA 2H2GA 1KY4A 2H1WA 3N05A 4OXIA 3BE8A 1Z2NX 1TAUA 1D4ZA 3RS5A 4RABA 2O4CA 3LC0A 1LZLA 2J59A 1XZQA 2E0IA 4U0KA 3C58A 1NV8A 2PNFA 3LUFA 3QEOA 3NHWA 4PSVA 5LVAA 2HJGA 3KE9A 4YWJA 4MWCA 1GPLA 1RXWA 2ZJ1A 5FPKA 4RTRA 5EAIA 4BVEA 3GZTB 4E88A 3H9CA 1DUIA 4GQIA 4C4PA 3RJMA 2OAP1 4UVGA 3M34A 4HVAA 3OT1A 5B30A 1P8AA 4WKOA 2QVZX 3F8WA 2UYHA 4PZLA 2FUEA 2G0AA 2L7HA 4CF6A 1GNLA 5JPDA 2VDOB 4W6QA 2O5VA 4IBEA 3B7GA 1G38A 1GA1A 3VGPA 4FGJA 3VDRA 5AJUA 5DZSA 2J07A 2NN3C 3B78A 1OFTA 5IRCD 1OC2A 1WKVA 1X1BA 5JVDB 2FUG6 4AY3A 5B64A 1KF0A 3DAOA 2RGXA 1ZH8A 4IXNA 1FU8A 2BFWA 3C3WA 2FLVA 2DH5A 5LA6F 4ESOA 4HHEA 5B57C 4UTRA 1KQNA 4D8XA 2PWZA 1T9HA 2WM9B 3C6BA 1ZEMA 2WHXA 3H2GA 1GQQA 2VJAA 2ZWIA 3NZEA 1Y6QA 4Y1EA 1Y6GA 5DTRA 1Z4MA 4JYBA 5LNK6 2BEUA 1JJBA 3VPBA 2C1EA 4TTIA 1F1JA 5EXSA 4EL5A 3NBFA 1BMFD 2IXBA 5DCYA 3MBIA 2Y0PA 3S1SA 2LP4Y 4LDNA 1BWQA 2W8BB 3P2JA 1QIIA 3O83A 3AZQA 3BJZA 4CU5A 1LK0A 1NBHA 1F0KA 5D7BA 4AKEA 2F67A 5DNCA 4KE9A 3KZNA 1LV8A 5B53A 1JJ7A 2HYDA 2JIZA 4XAQA 1GRCA 5KIAA 2DWPA 3LXMA 4OY3A 4KWCA 1A5ZA 2E37A 5E1OA 1YKFA 1YS4A 2HRBA 1MH1A 3TO5A 3HTXA 4KKVA 4M1TA 3GFRA 3FY4A 1NNI1 3PVCA 2P2CA 3S2FA 3CUKA 3OQ1A 1XRPA 4TTPA 1WBBA 3HY5A 4OQNA 1NOIA 1CS4C 2R1UA 4DJJA 4KQKA 1PE0A 1V96A 3RDPA 3JQGA 3L28A 3QX9A 3FNHA 2L42A 5JI2E 4PN3A 3P26A 3PR1A 4J3FA 1GUZA 1ZMVA 2JFGA 3AB8A 1Z0IA 1QJ4A 1THGA 3WG9A 5IXJA 4XK8F 2N46A 2DTEA 1YNSA 4LG2A 4YUAA 1BWRA 1SC6A 1J70A 4HWRA 1NSTA 4P22A 3VPHA 1UZAA 4RV4A 4YJ2A 4O33A 1QC5A 1JAHA 1DG3A 5CU7A 2WKSA 4MUAA 4UD2A 2HJVA 1Q92A 1SIUA 4FR2A 5EJMA 5LOVB 4LRXA 5BV2P 3G2KA 2Q2NA 2BFDA 3IBGA 4QATA 2J3HA 4HGOA 3GPUA 1XB2A 1B6SA 4XIYA 1G98A 4DILA 1XKQA 2AD5A 3BF8A 1Z56C 3W7AA 3NTVA 3SNKA 1ML4A 2O2YA 1SXIA 4GF5A 4TS4A 4MP3A 1HLPA 2WYVA 2H7VA 1VGVA 4G67A 3G9UA 2UV8A 3D8HA 3IOCA 4X7PA 3EW7A 2R0IA 3K6JA 1DB3A 3RD5A 3MUOA 2E55A 1U94A 4MKXA 1U28A 5JR3A 2COKA 3TZBA 2Z2ZA 2BHRA 2R6HA 1J4AA 1DG9A 5FPSA 4YR9A 3WWEA 1UMKA 4ND2A 4KUGA 4F7WA 1QOZA 4L28A 2X3YA 3KT8A 1R6XA 2G80A 3HO1A 2HXSA 5HQ3B 4HAIA 4MLDA 1JR3E 3KAPA 4TKZA 1QH9A 4PIMA 1ZX1A 3CURA 5C32A 2W11A 5CA0A 4QOJA 3UOWA 3RSOA 2NZVG 4WEOA 3B1XA 1LQTA 3L4BC 1VKHA 5JSZB 1P5HA 2QUHA 2EAUA 2EQAA 1I4WA 3PJDA 1GA4A 2F8SA 2ZJFA 4HQOA 3WB2A 4LCEA 2NUPB 4D0NA 1R9GA 5T3YA 3KUKA 2GCEA 3EIOA 2VJOA 5DX0A 2WWXA 4TMXA 1WU8A 2PH1A 3X1DA 4BP9A 1ML3A 3WNDA 3U31A 2ZIUB 2C2GA 3RYCA 3W90A 1B74A 3FVQA 2VQDA 1QYRA 4OHMA 4HPJB 4BUZA 1Z6GA 1WIWA 3FOBA 5BYAA 4B33A 3MJCA 5TF4A 4HYTA 4E08A 3PV0A 3QAUA 2GWRA 5JBIA 1SXJC 1H5QA 3RRJA 4Z2YA 2XIJA 2XBLA 3G0IA 2WFAA 3WO0A 4L3WA 1LNQA 1D0VA 3BIJA 3FWNA 2GTHA 4R9SA 4LX8A 2OILA 1EGAA 2ATCA 3THWA 3QYPA 1AM4D 3KW6A 4L50A 1BVSA 5IVKA 4AVYA 3L93A 4Z1MD 1VL5A 1H9AA 1LY1A 3KPWA 5CNIA 4BJ3A 4OKIA 3SZUA 1PJRA 1LW7A 4MHTA 1CLUA 3E4DA 4JCOA 4ZOEA 5LP6F 1TVKB 2NNLD 1OREA 2W98A 1F14A 2L2QA 1AKNA 2WT8A 2Q1TA 4H7HA 5I3CA 1N2HA 3HXKA 5SY6A 5KNCD 1EDDA 3JZMA 3FSGA 1G19A 4YJDA 4EM6A 4KRFA 3DZGA 3WGHA 1Z2DA 1Z47A 4E3WA 2AJ8A 4TYPA 4EYKA 1UH5A 3PQ6A 3P96A 4R0MA 4CKYA 2YHIA 1PZGA 2K7FA 1DEOA 5ERXA 3TLCA 5L7TA 1WCWA 4AKHA 1U3WA 4MCAA 2XDQA 1BHQ1 4YQFA 2H4FA 1K9SA 2BHSA 1L2CA 3EXIB 3FCUB 3U37A 5A1JA 1QXSA 3CLRC 2C2KA 2CFCA 2EWMA 2J3JA 2IA5A 5A0VA 4MI6A 3N6RA 2O1XA 4FT2A 3UOGA 5IDQA 2EF0A 4OKNA 2DZLA 4ND5A 1NNEA 4YP0A 3TGLA 4L3VA 1WB6A 3HJSA 1C7ZA 1FUYB 4FE7A 4RKQA 3QWAA 3H5WA 2G8NA 2AV6A 2B83A 1T9ZA 4X84A 5DIZA 1J5EB 1TJPB 2D7CA 4GLLA 5KKCA 4P93A 4HZUB 5DJ5A 3R23A 5E2BA 5DGDA 4WJKB 3KWLA 1PT9A 2XECA 3TZKA 3KQYA 1T9DA 2VHXA 4H6VA 5JCOC 2ZT5A 4KLNA 4PTLA 2WZDA 3OUUA 3UTCA 4JYAB 3L82B 3SHFA 2QK4A 2RAFA 1GR1A 4GO1A 4F3RA 4IHJB 1LFAA 4B3SB 3SATA 1Y1PA 1PEAA 1VSQA 1WEHA 4TWJA 5TPWA 2A5JA 1HKHA 1TD1A 3E70C 5COAA 3CISA 5A3JA 1DJMA 5EZ6B 1VBFA 1KQFA 4WCFC 5IBRA 1NKVA 3UB4A 3RE8A 4MWOA 4N65A 1Z7BA 5J9FA 2BGTA 1UJMA 1I1QB 2WLTA 4E03A 4QUBA 4HYYA 5EJFA 4J7AA 1UWKA 5GIPE 3B7QA 2E82A 4PSAA 3PD0A 4UHEA 3OKCA 3QXCA 2XBUA 1K0UA 2H08A 4B48A 3O1LA 5K0BA 3ZGYA 4ID9A 5FIUA 4ARZB 2B94A 3UYLA 3Q9NA 2PWPA 5IULC 1L7BA 4UM9B 4C6SA 3C9PA 4EGJA 2OOSA 3QX3A 1ISMA 3NBZC 3LXXA 3F5QA 3LNTA 3A6ZA 3ONVA 2K4MA 3JZAA 1JXAA 3FROA 2H07A 2VHYA 2K47A 3KLOA 3OQJA 1DAMA 2H8KA 3OKFA 3L6EA 1CQXA 3LWDA 2P1ZA 1MNQA 4QM7A 4K86A 5LUBA 5K8VA 4B3IA 4XDZA 4I1VA 3OQVA 1NR5A 3QTLA 1WMFA 3QXHA 1UPAA 1RKBA 3IV6A 1Z4JA 3Q72A 2NVWA 3WTCA 4O3MA 2QN8A 2X9VA 1FP4B 4E09A 4RH0A 4AWAA 4AUMA 1T0JB 1US8B 2OG1A 5U4QA 1QTRA 4EYEA 1DQPA 1A5SB 3B1JA 4BO1A 2P67A 1DAOA 1NBWB 4H1WA 5A2QS 2H9AA 1MC1A 2ZJ5A 1QO0D 2AX3A 5CHYA 5B6JA 4AK9A 5K4AA 1MA0A 4H0NA 3I72A 4ZMSA 5BR8B 1ZRMA 1NQWA 3HCFA 2GK6A 1W0JD 1UR5A 4G0VA 3EYWA 5HK8A 4B74A 3ASYA 4OYYA 3F5MA 4B08A 3WGYA 1VCNA 1ZCFA 2XMZA 3KJEA 1NXPA 4ZCMA 1H5UA 5C52B 2HF2A 3WNVA 3VHXA 5E1BA 3WP0A 2UYCA 4AS2A 3MT0A 4DG8A 4X6XA 1BS2A 2DHYA 1ULSA 3BF7A 4ZDKA 5KU1A 3DEZA 4XA8A 1AUAA 2XR1A 2GPJA 1OTXA 1SCNE 2HCJB 3ZHBA 5KQLA 5LQCA 4FNOA 1FU7A 3DOCA 1E62A 4BC0A 1VSTA 1X8JA 4KO4S 1Z82A 5TVKA 4UTZA 2WLSA 2IDJA 4L08A 3WGGA 3F7NA 4CFZA 2PT9A 1MABB 5J2UA 3DPUA 4TTTS 3QVGB 2ZBDA 4RSRA 2F3RA 3OOEA 4J0JA 2CMFA 3GC6A 3LY5A 5E8JA 3ZD9A 4PZ0A 1QZXA 1Z5AA 2VNHA 1XSEA 1BX1A 4G0UA 1NQOA 1QF6A 3AHFA 5CW1A 3AGPA 3NIDB 2YV2A 5TR9A 3VR5H 1U8UA 3C3MA 3ZQUA 1AMOA 1MJ5A 3LC2O 4WN9B 5IWCA 2ZI4A 2GZ1A 1YJCA 3OEED 4DADA 1Y82A 4Y0VA 5CA1F 4DZTA 2FQYA 3ZHYA 2MSLA 5EJ2A 5E6RB 5K51A 1OT5A 2PZGA 1ND5A 3RRYA 2H0QA 1GABA 1RAHA 3IXMA 3V1LA 2Q0QA 2WICA 3AVVA 1XAIA 3P71T 2R8ZA 5FO1A 4ZO8A 3WMXA 5DLPA 3IOEA 4D3DA 2O4UX 5EIAA 5AKZA 2QQ0A 1GYRA 1TYAE 4FOPA 3R0VA 1EHCA 3TB6A 2OK7A 2WSEF 1PS0A 4NV0A 3B48A 1YDEA 3WYDA 2P11A 1U9ZA 1YNOA 2J5RA 4YCBA 2FEOA 5AOBA 3A6KA 1CZKA 3R0JA 3BJMA 2H57A 4WJZA 5P21A 1WXFA 3WSTA 4CTMA 4R5HA 3EVCA 2Q45A 2C99A 1FRFS 5IC6A 1UWVA 4YP6A 1SD2A 3QEKA 4EFDA 1E2DA 2R66A 4JBNA 2ZRPA 2I54A 2NYAA 5IFLA 5DHRA 3OCVA 4X66M 4RZ3A 621PA 1D6SA 4JL5A 3SOPA 2W6NA 2HSJA 2C5LA 2IEBA 4B2IA 4PNHA 1XCOA 3WKBA 2QUKA 1EJ6A 3ROTA 4CHTA 3BDAA 2LV8A 2BELA 3EGWA 1U0NA 1P29A 3LLUA 4QBHA 4MWGA 4KE8A 1G5RA 2FN8A 2QP3A 3VI3B 1QP7A 3Q8WA 1CZRA 1Q3BA 5FNVF 1Y7LA 4D1YA 3USCS 5BVGB 1XEFA 4CV3A 1LRLA 3ESYA 1N6OA 2J30A 4FX2A 2BMEA 4L7QA 2CLEB 1XYGA 3RTGA 2QVBA 1R00A 3TNYA 5FUQA 5HMLA 2GN6A 4RYLA 4OCZA 2B9EA 4WX2B 3KWFA 3W5VA 4BJ5A 1KS9A 3UUEA 1GP2A 4YRJA 4PRYA 1B73A 2O8DB 2XNDD 4BQQA 3PFKA 5TNXA 5DK4A 5KNBH 4Y7CA 3VDXA 3CVUA 1UC9A 4WQMA 5AUNB 1UBRS 4G65A 3Q8XB 2W42A 2YWRA 5IJAA 4MKFA 4D92A 1FFSA 2JCSA 4LWZA 2B7CA 3JR5A 5AVVA 4KR6A 1EE2A 4JJEA 2R48A 4ZDWA 4ZAFA 1U5BB 2C9ZA 2O8BA 3PIRA 1VZ2A 1G8PA 5IVPA 4BZXA 3WHKA 2ANCA 4Q1AA 1E63A 3U7FB 3LKVA 4PVDA 4GH5A 1TQ4A 4RK4A 1L4LA 3I5MA 1KZ4A 3OZFA 2QU8A 3CE9A 2CMKA 5JEEA 3IAS1 4YRIA 1XRRA 1XO1A 3GZNB 4AO8A 2DKNA 3IB3A 1Q16A 4FGZA 3AJ8A 3RPEA 1K3FA 1X7GA 1P1HA 1G5IA 5B5SA 2O8NA 2Q4OA 1F2UB 4D9NA 3P94A 2EU8A 4CKEB 3ZWQA 4HFRA 5EXPA 4NEGA 2Q3CA 2AB0A 4MVWA 5H1YA 1T2AA 4I6JA 1T91A 4ZICA 4AMYA 1IB0A 3H04A 4IBGA 4QQFA 2ZRGA 3FRHA 1HG0A 1E7RA 1SCDA 3TB4A 2H2FA 3B3FA 1KY5A 5SICE 2E1PA 4JWTA 3UAXA 2IW3A 1SXPA 4RSMA 2G88A 3FX2A 5GONF 2OFOA 3N2EA 4A1FA 3SYTA 2RGNC 3CG0A 2XYVA 3WGMA 1JVBA 4RJJA 4Q03A 2VATA 4D96A 1NMZA 1HL7A 3EIWA 4F3YA 3B3JA 4D82A 2G1KA 4A6EA 2Q5OA 2ZVDA 1JG4A 4H59A 1JPNA 4TLEA 3AF6A 1YVDA 3RWMB 1E5QA 3IVRA 4I9FA 4QOIA 1L8LA 1C9NA 3PJEA 5AJTA 5EZQA 5T8KC 4C4SA 3P5BA 4JKIA 4LXHA 2OC4A 5JDIA 2ZR7A 3HJAA 3PWTA 1RHKA 3AERB 2Q0SA 2V7TA 2HO4A 1DRJA 1CQJA 2JDID 4WBSA 1ABBA 2BH9A 4UM8B 2DJ5A 3NO4A 5I7SA 1JQAA 4GIPA 2IYSA 3U81A 3KTDA 2KS6A 3HRHA 4DY6A 1H2EA 2HRRA 1E4YA 1F12A 1ZY2A 2QI9C 5I4BA 2J4FA 3MJ5A 1R8SA 3NTQA 2OORC 2H1CA 5HE8A 1O0BA 3LYHA 2H7XA 1FLAA 2JGNA 2TRSB 3V32A 4LE2A 1FPQA 1V41E 5FB3A 1H2BA 1E7SA 4ZALA 1S4QA 1YF3A 2UZAA 1KRHA 1U8ZA 4FKZA 4R51A 5LXTB 2FEPA 4MOWA 3Q3IA 2V1XA 4IXTA 1J25A 4OIMA 4BB9A 2GN4A 1MUUA 3GI1A 5A4DA 3E15A 1YB2A 2PUDA 3CUVA 1RIFA 2WMDA 2X5NA 1P3Y1 2X58A 3HYNA 1WRBA 1VLMA 3CBQA 1QM5A 3TD9A 4QSMA 4TWRA 2DFTA 3DC7A 3BMQB 5B1IA 2Y2VA 5TX7A 3UT5B 2HWXA 3T0FA 4AKSA 1VG0B 1R8QA 4W5RA 1GPWB 1UZUA 5KYVA 5IZCC 5F3WA 4TMZA 4NS4A 2EJSA 3I12A 2CHQA 3BILA 3ZBPA 2I2FA 3N3BC 1MAAA 1QNLA 3K30A 2P5YA 5DYYA 5JC8A 3HCPA 1YZGA 2IRWA 2IUFA 2HMVA 2J3MA 4K0KB 3SQWA 1EP9A 1E0AA 5CG2A 4IDQA 1L3BA 3JWJA 5F7XA 1SXGA 2WHQA 5K0ZA 3OJOA 3ILSA 1T9GR 5J5CA 2YIVX 4R0NA 1YCGA 4G23A 4BFLA 2XE8A 5E6UB 3LCVB 3KYCA 3OEHA 5LD2C 2WKQA 2ADMA 3LQ2A 3BTOA 5A9RA 3F6EX 1ZJ4A 3KUUA 2Y0BA 4OTZA 2AXEA 4HC4A 2VPYA 1OPXA 3FR8A 5CDTA 3LI2A 3ZDBA 3IR5A 4MGYR 2XTAA 1MR3F 3E9SA 1XC7A 1M74A 1Z8FA 3GEMA 3VHRA 1W36D 3RH0A 3LBIA 4Q05A 1ADCA 3VU1A 1BROA 2WD8A 4HVLA