2Z4SA

Crystal structure of domain iii from the thermotoga maritima replication initiation protein dnaa
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
240
structure length
240
Chain Sequence
TPLNPDYTFENFVVGPGNSFAYHAALEVAKHPGRYNPLFIYGGVGLGKTHLLQSIGNYVVQNEPDLRVMYITSEKFLNDLVDSMKEGKLNEFREKYRKKVDILLIDDVQFLIGKTGVQTELFHTFNELHDSGKQIVICSDREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKSIARKMLEIEHGELPEEVLNFVAENVDDNLRRLRGAIIKLLVYKETTGKEVDLKEAILLLKDFIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosomal replication initiator protein dnaA
publication title A Common Mechanism for the ATP-DnaA-dependent Formation of Open Complexes at the Replication Origin
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein
total genus 82
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00308 Bac_DnaA Bacterial dnaA protein
A PF08299 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z4sA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2z4sA01
5FUWA 1XTKA 4RCZA 2QORA 4C3ZA 2VHQA 4DUGA 4Q1EA 4IOMA 3EPLA 4HDQB 3T15A 5KSPA 5IHPA 2AD5A 4Q1DA 1SKYB 1E6CA 5D3MA 5ANRB 4Z8XA 5G53C 1BYIA 1ZUIA 2RGXA 2YOHA 5BXQC 2XTZA 3UPUA 3EZ6A 4P4SA 2IYZA 3LXXA 5TDHA 5TV2A 2RB4A 4AIIA 4HATA 4GOXA 4GL2A 2AKAB 3IHWA 1Q1QA 2GZHA 4PZZA 1E9CA 3D7MA 2OSBA 4A2QA 1N0UA 3IIKA 4BZQA 3GLIA 2IXGA 1E9FA 1MO5A 3ZJYA 1A82A 2Z83A 2QQEA 1AKEA 3BK7A 5EUMA 5ELXA 4RFSB 4E07A 1MKYA 3I32A 2QL6A 3ND9A 4P33A 5AUNB 1ZU4A 2FJUA 4Q00A 3ZD6A 2F3RA 1JJ7A 5KDDA 3WNCA 3NWJA 4AG5A 2BV3A 4II7A 4JBXA 1LY1A 2JLRA 2EW1A 3VHLB 1N6IA 2QPOA 1JQJC 3U7GA 4LBWA 4MRNA 3VX4A 3W8NA 3ZQ6A 5B57C 1A7JA 3PIRA 4TMTA 1JBKA 1P2VA 2V6IA 1NMZA 1WMSA 2EFHB 4OK5A 5AJWA 5HTKA 3D8BA 1LS6A 2NO9A 3RS7A 2DFLA 1JXMA 1NRJB 1XFAA 4OHZA 4D4MA 1PJRA 3CRW1 4S35A 1FUUA 3V4RA 3U3OA 2XJ4A 1GKUB 1ODFA 4LV6A 3SNHA 3ZVMA 3K70B 1SHZA 1XZPA 1U0LA 2XSZD 3OZXA 2FWRA 1E32A 2A78A 5EE1A 4A82A 4AWXA 4LJ5A 3SFVA 3PITA 2OHFA 2BVNA 3WYFA 3OFND 1R5BA 1UDWA 5HE8A 1R8SA 3QEOA 1OXVA 3AVWA 1KI4A 2ZJBA 4XTRA 1G291 2FSIA 2FFHA 4MKHA 3I62A 4IXNA 4S2EA 3PUWA 3RS2A 1HA3A 3A4LA 1YQTA 2ZQ5A 2BKEA 1CULC 3NKVA 4G5SA 4Q7MB 5DSZA 3KKNA 4BEJA 4EUNA 1ZD8A 1W36B 3IPYA 1DAHA 3TR0A 4A9AA 2QAGB 2QTVB 4AY2A 1XD9A 2QBYA 4QXAA 3UATA 2ZSAA 5AK0A 4ARZB 2GVDC 1ZU5A 2JLQA 2QROA 1RZ3A 1KDTA 1XD2B 4JSTA 5CIQA 1F3OA 2XNDD 2RGGA 1E2KA 2MSDB 2JASA 3BFKA 3N2EA 3V9PA 2QM8A 3WYAA 4GITA 4FMDF 4YMWA 1CEEA 4DLUA 2NO7A 1E9DA 1ZD9A 3QKUA 4V0LA 1GVNB 1QHSA 3T1OA 1JAIA 1PUJA 1X1RA 2GAAA 3GMTA 2UKDA 3EASA 1YJ5A 5L3RA 2GHIA 4B44A 5KNBA 4C2TA 1C1KA 2ZI9A 4DC9A 5GJVC 3IUYA 2O8FB 1P5ZB 2ZRNA 2BM1A 2YVUA 5SZHB 1W49A 1OH7A 1UKVY 3U5ZB 2VSOA 3MWLA 3BD9A 1NG1A 2C9YA 2GAOA 1G8HA 3CBQA 1HEIA 3FMOB 3K0FB 2GJKA 4V03A 5BN3A 5EP1A 2FPMA 3EZ7A 1F2TB 3BB1A 4QOSA 4FINA 4A6XA 4A0RA 2V7QD 4HEJA 1U90A 1ZVQA 5E4FA 2PZFA 3RHFA 4PC2A 4TN1A 1OYYA 1N0VC 2GCNA 2ZUCA 4MRPA 5J40A 3VR3A 2WJVA 3SFZA 5CYPA 1NIJA 2AFHE 5G3ZA 5DHAA 1GKIA 2J0SA 3MHVC 3HR8A 3FWYA 421PA 1XJ0A 3QVUA 1BOFA 1KSHA 3C5HA 1TU3A 1PVOA 3I5XA 1ZCAA 1SXJD 4LWZA 3THWB 1P9NA 5FTMA 1GZSA 4WIAA 2JDIA 4ZDWA 5HZKA 3NBFA 1F6BA 1RW4A 2FV8A 4MYUA 2G9NA 3UG6A 2QTFA 1XWIA 5JCPA 4V0MA 1J70A 2FSFA 1GSIA 1RRGA 4QGHA 1CR1A 1JB1A 5IT5A 4Q4HB 5TMPA 1XMVA 1UBCA 5CDFE 1XPUA 3U3JA 4GOKA 2FMXA 4JL6A 2ZRLA 4BLOA 5G41A 4ITRC 1FW6A 2C95A 3W5JA 3BH7A 4IRUB 3QE0A 5KYKA 3LLMA 1Q1EA 1IN6A 3H1TA 3MWJA 3AKEA 5KNCA 2QGNA 3JZMA 1T91A 1S1MA 1NVMA 1HE8B 1XTRA 2B21A 2HJVA 3B85A 4M1YA 3RRNA 5GJCA 3S1AA 2CBZA 2XNDA 4A92A 4QNRA 4MGIR 1RJ9B 1E2GA 3CKLA 4Q1BA 4BFTA 2XAUA 2HYIC 5SZKB 3B1XA 1EFCA 1N2CE 1GUAA 2DYKA 1E2DA 4OHYA 1WQ1R 3TAUA 4PFSA 1Z3IX 3B9PA 2G88A 1L8QA 1F5NA 3CX6A 5DYIA 5JWOA 3QF7A 3W5IA 5FOVA 1ANKA 1G17A 3GJ7A 1TEXA 1F2UA 4U5XA 4JSYA 1DO2A 2ZREA 2HCJB 1S9DA 3ZS9A 3BORA 4GMDA 4YQFA 5KNDA 4QL3A 4ASUD 4DDUA 3EIEA 2BDTA 1G18A 4I1OA 5AUQA 4OJKA 1TQ4A 3MG9A 1AS2A 2JGNA 1FNNA 4TLCA 4PO8A 1UEIA 3KQLA 2V7QA 2F7SA 5DI9A 2BWJA 2OZEA 3B9QA 3B60A 4Z54A 2KBEA 2EVWX 3GFPA 2H5EA 5C4GB 1H8ED 3T12A 1EFUA 1T8TA 3U3MA 1NLZA 4B73A 4ERNA 3GLIB 1XD8A 2OE2A 4RKEA 3FKQA 4DEXA 1E4YA 3K70C 3AP3A 4CVNA 4N3NA 5IK2D 3QEJA 2AHOA 4OI1A 3GFOA 1CR4A 2R6DA 1SXJA 1KDRA 4YMTA 4TLDA 3WNBA 4B75A 3L8ZA 1ELOA 3L0IB 4A2WA 1N5LA 2WPDD 3FPAA 3BXZA 1DOAA 3PQCA 2UZIR 4DSTA 5KDOA 3L82B 1E9AA 4Q9HA 1TNDA 3OEHD 3SC3A 4BE7B 4PHGA 2VHTA 2HDNB 5JWRA 4QBHA 4M8NE 3RRZA 1FPMA 3X1DA 1NSTA 3AVQA 1W36C 1XTIA 3IGFA 4RZ2A 3B13B 3GJ0A 2WWWA 2DFKB 2QAGC 2PCLA 2GJSA 1CR2A 2R44A 4CYMA 4TQ9A 3KXKA 3WHLA 1XXHE 2A7QA 2QMUA 4JYCA 1OJLA 3RABA 3TQCA 1XTJA 4IHQA 4JLKA 5EE3A 2Z4SA 1PUIA 4MQBA 2LCFA 4NYMQ 1OFUX 2MSCB 3BJIC 2P6UA 3REFA 3ECCA 1EESA 4L15A 2NO6A 4C0AC 5JSZA 1CIPA 5HE9A 1W47A 4B33A 5F9HA 2IF2A 2VPPA 4Q1FA 4Q9LA 4X8MA 3MRSA 4W5WA 2P6NA 4ZI2A 5DHFA 2ZR7A 2C03A 3KFXA 3VQTA 4C7OA 1LNZA 1QHIA 3OEEA 2GKSA 3GLFA 1VCIA 1E79D 2ZRBA 3FTQA 2Q9AA 3LW7A 3R7WA 1RE0A 3VAAA 1R0YA 1BH2A 1XJCA 4YC7A 1FX0A 5J5CA 2BC9A 4W9MC 1DADA 2VEDA 3FMPB 4L8GA 4M9SA 3JVVA 721PA 2DPXA 2CCJA 4DB4A 2EQBA 1W44A 3EWSA 4B2PA 1OFHA 1E2EA 1U94A 3TUJC 1K5GA 4LJ9A 2D3WA 4DBLC 5LB2A 4ASUA 5EE5B 3KFVA 4HLQB 2D4HA 2CL6X 1U8YA 3R9IA 5DISB 2ZU0C 3EARA 1ZM9A 5FBQB 3WP1B 3LLUA 1LFDB 3LBIA 3Q7QA 4Q4AA 4RSGA 5E7MA 1OH6A 4LYHA 4B3CA 4C4PA 1L7VC 4M1TA 3KKQA 4IVRA 3P20A 3IO3A 1UDXA 2CCGA 4QJ5A 1Z0DA 1H8EA 3DKPA 1DG3A 4OI0A 2OCPA 2J0QA 2P5SA 3QOFA 2CHVA 1RC8A 5IK2A 4IEIA 4JLPA 1KGDA 2VHUA 3TGPA 4UQOA 3OAAA 1AS3A 2NZ8A 4P32A 4WZBE 4EFMA 4IOJA 3A36A 3UMFA 1A5TA 3QSYA 3C14C 2WPDA 4P4UA 2QP3A 1O87A 4D4KA 4HLUA 2FGJA 1II8A 2CHGA 4IEEA 4RD1A 1HH4A 2OAP1 4X8LA 3M4YA 4A0GA 2WICA 4EKDA 4A0HA 1G8FA 4RD0A 1QHXA 2ASEA 4N1AA 2XB4A 2O5VA 2FA9A 4IFEA 1W36D 4FWIB 3AUXA 3NC1C 1NL3A 2PZGA 2GRJA 2FZLA 1FMLA 2YKGA 4KITB 3AVPA 1CJMA 1FP6A 4L9WA 4QKQA 2XTNA 4ABYA 5FOTA 3CZQA 4B74A 1GM5A 3CF0A 1VDZA 3SBDA 2IHYA 3GJ8A 2XTMA 1UKEA 1QHHA 1JR3E 1T3SA 2AX4A 4MKFA 4MUAA 2GNOA 4BASA 1FZQA 1SKYE 4LSGA 3W90A 3DM5A 3TQFA 4NCKA 4URWR 4XTCS 4DDVA 1J7KA 1E79A 1NLFA 1DPFA 1CJTC 1R5NA 1SZPA 1Z8FA 1KK2A 3AQ4A 3BB3A 1KI9A 3B8HA 3CRQA 3MD0A 3QPUA 2ONJA 1IN8A 2R8RA 4CT5A 5J4YA 3ZYCA 4P3YA 4TMKA 3C41J 1OFIA 4LJ6A 3T34A 1TMKA 2AWNA 3GJXC 3VR6A 1YZTA 2EFEB 5TB5A 3FFAA 1G3IA 1KO1A 2YHSA 1AJEA 3I73A 1E2MA 4DXAA 2P67A 3NBXX 4LJAA 1MRNA 4GMXA 3DDCA 5FH9A 2CJWA 1ZJ6A 3EIQA 1WA5A 2CCKA 4ZCLA 2ORVA 2IEZA 2ZUDA 1X6VA 3T06B 3K0SA 2EU8A 3TIFA 3HR7A 2CNWD 3SBEA 2DBYA 2VRWA 3TE6A 4B43A 2GDJA 3DL0A 4O25A 1KZ7B 1QDEA 5FBRB 3ASZA 4DLWA 3Q5DA 4WXRA 1OLOA 2N46A 4NCNA 2B7BA 4A1FA 1ZNXA 2E9SA 4BZPA 1OPXA 4OI4A 4B3FX 2NPFA 5HKKD 2VF7A 4DLVA 4HUQA 5DO9A 5E95A 2WHXA 1NVVR 4NYJQ 2VP4A 1NN1A 3VLFB 4YXWA 3WRXC 1F2UB 4JJZA 4TZ6A 3AH8A 1NP6A 4TQAA 3H84A 4N0DA 3RANA 2OCBA 2W2VA 5JJLA 1QF9A 2V55B 3SJAA 3W3AA 1RPZA 2V1UA 4NYIR 2WWIA 4WBSA 1GILA 4QRHA 1Z6TA 3L0SA 1JR6A 1J2JA 2XXAA 1BYUA 2J45A 3D6TB 1TQDA 2QA5A 2ZPTX 2EFCB 3AB3A 3QPWA 2EWWA 1P72A 3CPEA 5J4KA 3ZD7A 1KI8A 2REXB 2C78A 3FVQA 4OK6A 4QBFA 1G3QA 4DJTA 3PEWA 1WB9A 4C0BA 4QBGB 1HYQA 3LV8A 4LK2A 2I4IA 2IS4A 1Q0UA 4V0KA 1JEDA 3BERA 2HCBA 2XOKD 2ZRGA 1PLJA 3L0OA 4Q19A 2OLJA 4Q47A 1A4RA 5FBVB 3U4QB 3B1ZA 2GXQA 1SXJB 1GFIA 4KLNA 3GJ5A 3QENA 1TUIA 1GRRA 1J99A 2OFWA 2W6JD 3AV0B 1MRSA 2DCUA 2X77A 2WM9B 4EPYA 3PR1A 4UNPA 5FOWA 3GEEA 1S1CA 3KW6A 3CO5A 2JATA 4IVPA 3PVSA 2FZ4A 2ZI5A 2JIZD 1OH5A 2PLFA 1T5LA 4PC1A 2E1RA 1N6KA 6Q21A 1Z47A 3LNCA 3LBNA 1KHTA 2OXCA 4YDHB 3V4FA 4D4JA 2A5DA 4LJ8A 4DCVA 4XIGS 3PUYA 1NMYA 4TL6A 5LBIA 3SU8A 4AYXA 1LS1A 3TNFA 3G0HA 2ZM5A 3U6BA 1I2MA 1M8PA 1UKYA 2H18A 1IXZA 3LQQA 2BJVA 3PUXA 2IHBA 3U3KA 5FPYA 5L3QA 2J9RA 2JEOA 4MRSA 4E09A 4A6PA 5JSZB 1U8ZA 2OEPA 3RLFA 4F4IA 4Z8YA 1AZSC 2J87A 1VG8A 3EAQA 2PMDA 2PEZA 3X1ZA 4C7OB 3BAFA 3K0AA 1P3JA 4AG6A 4B71A 2BMEA 1E2PA 1FTSA 1WP9A 4M21A 2O8DA 3GLFB 1G1MA 3R7WB 4ZV4A 4JL5A 2R6GA 1NN3A 4EPTA 4DT1A 2H7VA 4IDNA 4KODA 1FX0B 1WRBA 2GJ9A 2J59A 3MSXA 1G3MA 4B32A 4QM7A 2QNRA 1G7TA 2YWFA 3T1QA 1U0HC 5TVKA 1C1YA 4FD2A 1NKSA 4XSHA 3K53A 2NO0A 4JLAA 4PAOA 3ZVRA 1M7BA 2P0EA 2V1XA 2ZRKA 2WBLC 1N6RA 4Q5IA 4AC9A 3THOA 2QGZA 1YZNA 2V9PA 2YINC 4ZCMA 4BEBA 2BEJA 4KFRA 1CXZA 821PA 2GZDA 1G7CA 4Q4AB 2YV5A 4LYAA 3RDPA 4MGYR 3P4YA 4GFDA 2ZTSA 4R2HA 4B3DA 4CDGA 1M74A 5BWMA 2G6BA 4WXPA 3K9GA 1YE8A 3I8XA 1DAFA 2C9CA 1E2NA 2ZROA 2PLRA 4RD3A 2Q6TA 2O8BA 1E4VA 1JXOA 4FWHA 2XOKA 1OFTA 4C9BA 1P2UA 2DZOB 2Q9BA 2DB3A 5TXGA 5C46F 1GDDA 1NNEA 2QTHA 3NC0C 1P7CA 1SVSA 2H8KA 2ZRMA 1WE2A 3BC1A 4HZUA 5EP3A 3HPRA 2QUZA 4ZKDA 4G5OA 2ZJAA 4Q7JB 1II8B 1XEFA 3MGCA 3NBYC 2JIZA 4EPVA 4XWKA 3CB4A 3ZDQA 5BN5A 4BRUA 3K09A 4HB3A 2YZ2A 4FW9A 3A1UA 3GFTA 1E2FA 2IXFA 1MO3A 2ZRPA 1S8FA 1W7AA 2ZRJA 2P65A 3QXJA 2LKDA 1GOTA 4B47A 1M7GA 4R7ZA 3LBHA 2KI5A 2NGRA 1QHHB 1FQJA 4IDPA 1J8YF 5K8LA 4J0QA 1LV7A 1LF0A 2UVQA 1P2SA 5AJZA 2WWGA 4CIDA 3T61A 1CJUC 1DS6A 2ZJZA 1OYWA 1HT2E 4B76A 1W4RA 3ADCA 2ZS7A 5EE0A 3D31A 3RC3A 1AM4D 4M1MA 3VHXA 4M1SA 1PZNA 5DI3A 5CK4A 4BWYA 4BECA 2IA5A 2V4ZA 1IN5A 1ESNA 3TSOA 4CW7A 3GLIE 1S4QA 2GESA 1Z2CA 4V02A 4HLDA 2BBWA 1AK2A 3CNOA 2Q3MA 2ZSBA 4LPKA 2IS1A 4D81A 1NF3A 1ZM2A 1VTKA 4FMCF 3SQWA 1E1QD 4MA4A 2CJWB 3BBPA 2E87A 5F98A 1GL6A 2YYZA 3AF3A 5GJBA 1Z2AA 2HXYA 1G9XA 2MMCA 3VNVA 3EC1A 4HLCA 1E0KA 1UPTA 2LWIA 3QNUA 2AN9A 5CYOA 2RGBA 3WBJA 1TL7C 4CEIA 2C5LA 2IYUA 3IKJA 1JPNA 3U7EB 2JAQA 3QXXA 5AUPB 2Q21A 1D9ZA 1KI1A 1QG2A 3I1FA 4WW0A 3DO6A 3O8RA 1M1YE 1YR7A 5KPJA 1KJYA 2WKPA 2ZYWX 4H1UA 4QFMA 2XZOA 1DAIA 4LJYA 1SXJC 4HUQB 4B35A 2J0VA 3EW9A 5FUXA 2I1VB 3WNDA 2JDID 1XDBA 4ESVA 3I3SR 4DHEA 3BS4A 2F1IA 1US8A 4DSNA 1NIPA 3AJIB 2WSMA 8OHMA 2WSSD 3TK1A 4M1KA 4A15A 2ZUBA 2H17A 4DDTA 2X2FA 1P73A 4NP6A 2I1QA 5IRCD 1DO0A 4OQNA 3GPLA 4KYIB 2QT1A 2VP0A 1XU4A 4OHWA 3KQNA 1X8KA 3VR1A 1HQCA 1AS0A 2QY9A 1COWD 3I4LA 3KXLA 3HU2A 4DLXA 2DR3A 2R65A 2CEAA 1B0UA 4TL9A 3KJGA 4KFSA 5FOSA 4XSGA 4ZPXA 1J90A 3M1IA 1G5RA 4LCBA 2IUTA 3O8DA 3IO5A 4D82A 2IW3A 1KO7A 2BKUA 3OE7A 1CR0A 1ZNZA 1OHHA 2H92A 4EDHA 1ZRHA 3UANA 4Q4JA 3WRYC 3W8RA 2GETA 4C0QC 1DAGA 4JVLA 4I99A 1W4AA 3OIYA 1IJFA 3CW2A 2QMOA 2K5UA 1VIYA 2R6CA 3A37A 4O0MA 5J4HA 1LTQA 1EGAA 4DCUA 1MO4A 1FTNA 1K5DA 4NCJA 4C0LA 4PPGA 2BBTA 1AGRA 1QBKC 3QXSA 3K1JA 2BEKA 3CPHA 2GCOB 4GOJA 1ZUHA 4R71A 2XJ9A 3MJHA 1X3SA 4OI2A 5FPTA 1E69A 2CE7A 2IBMA 1E94E 1MT0A 4IDQA 4DKXA 1C9KA 1DE0A 4D0NA 1E1QA 2ZI6A 3DZ8A 1ZAKA 1H65A 1NJFA 4EFNA 1N6LA 2B8TA 5CLQA 2B6HA 2D2FA 1U9IA 4LDJA 2A5FA 4PC3A 1W1WA 1R7RA 1N5KA 3QXCA 4E22A 2OESA 3K0AB 4RZUA 1RVDA 3IBYA 4LYJA 4H1VA 1M7HA 2O8DB 4LRWA 4FMCB 3SYNA 5FI0B 1WXQA 5BYJA 4ZCIA 3QG1A 4DT1B 2X2EA 4TTPA 1D2MA 2P5TB 1W2HA 3B5JA 4C30A 3FE2A 3VR2A 4RJLA 2FPLA 2QMEA 1UADA 3EA5A 2RGNA 2NOAA 5AJXA 521PA 1VG1A 4BLRA 1G5TA 3HU1A 1KZGB 1U81A 4LHVA 1OE0A 3PEUA 1ZC3A 4HLUC 1G8YA 2WSSA 1QVAA 4Q66C 3E70C 3ZS8A 3X1WA 2F43B 4QG7A 3VR4A 1YVDA 4JLOA 3U60B 1CKEA 4NZYA 2FGKA 5H68A 1F48A 4Q02A 4V0ME 3TKLA 4EJSA 5FOUA 5JEEA 5LD2B 1G64A 2W0MA 1S9HA 3PFIA 1COWA 1QVRA 4HAVA 4LJ7A 4XVUA 3THXA 1E0JA 1KI3A 1W5TA 5H8WA 2IT1A 2UZ3A 2O8BB 1XNJA 3CNNA 2ANCA 4G3XA 1TAGA 2BMDA 4Y0AA 4B6EA 4US1R 1KMHA 2FX3A 3IQXA 2GF0A 5FUVA 2IWHA 1G19A 1HE1C 4WVFA 3BRWD 3OEED 2QSZA 5FR1A 2PT7A 1FOEB 1G8GA 3B1YA 3Q5EA 1HY3A 1D6JA 1EFRD 4X8HA 3P1JA 3B78A 3W6NA 3C15C 1M2OB 2VA8A 1R4AA 5KOYA 2DVWB 1W46A 1XCGB 2KWIA 2NTYC 5C18A 1E1RA 4ZDJA 2JJ8A 4FXPA 3ZIAD 3TBKA 4FMDB 4DCTA 2ZANA 2B8WA 1BMFD 1NKTA 3SOPA 5H70A 1YKSA 2WIBA 1GRQA 2GXSA 5CITA 5D3MB 3LW8A 4FIDA 3MLEA 3CRRA 3LA6A 3W6PA 1OSNA 4P4SB 4PHFA 3ADDA 2WMNB 3R9XA 3CH5A 1FNMA 1KTVA 3GQBA 5CJPA 3Q85A 3WYGA 1X8JA 1KKLA 4HB0A 4PQYA 5FTNA 5KHOC 4FCTA 4US0R 2LKCA 1YHNA 2HF8A 4EQ6A 3ADBA 3RWOA 2IYRA 1L2TA 2FOLA 4POAA 1EX6A 3JZAA 4NU0A 1VHTA 5FTLA 3OAAD 5DI3B 5K8UA 4HYYA 1CTQA 1RIFA 3SJBA 3AF4A 2OBLA 5K8TA 2RAPA 4RKFA 2GK6A 4W5HA 2BIFA 2PH1A 3ZVNA 1OXSC 1QHGA 4LV8B 4M22A 4A4DA 3LFUA 4GBMA 4HSEA 3B82A 2HEIA 3L2OB 2JLXA 3EZ9A 1SXJE 1JALA 1Z0JA 2PT5A 4JJKA 4D0LB 3K9NA 1KI2A 2PX3A 2WKQA 2C96A 5EZ5A 1N3BA 4C0HA 3HP1A 1ZIOA 3WXMA 4KSBA 3NBZC 3FHTA 1XMJA 4TMXA 1VKJA 4Y0VA 2G83A 4JIMA 2R6AA 1NLYA 2GA8A 1UBFA 3NXSA 3VKGA 4CEIB 4URVR 3SQXA 3UMRA 1N5IA 1KY2A 2QENA 1CS4C 1P2TA 4YONB 4BFWA 1GL7A 2ZI4A 4U00A 2IYTA 4P0TA 2ZE8A 5EXSA 3B1WA 4XD7A 2ZJ2A 3EIHA 3TSZA 2JLYA 5EQTA 2B7CA 2OBMA 3KL4A 1YRBA 4FN5A 2J0UA 3RVBA 1W2GA 1BIFA 1ZM3A 2JJ1D 5JLJA 1HQYE 4TQUS 4KU4A 4LC0A 5JECA 3FDIA 5EXXA 4D0GA 3KJIA 5K8IA 2VSXA 3OIUA 4FCWA 1CLUA 3AVXA 1P75A 4XOIA 5GVSA 3WHKA 1EFRA 2RGAA 1SKQA 4AKIA 1W0JD 4DWJA 1IM2A 3Q9LA 1YR6A 3TH5A 5JZVA 2D62A 2CE2X 5C2JB 4DIEA 1SGWA 4PC7A 3GLFE 1GWNA 3ZIAA 1T3HA 4UJ5A 4TYWA 1ZW6A 3LX5A 2D74A 1N0WA 4GPTA 4DVGA 4BGDA 2QBYB 4GT1A 1BMFA 1GRNA 2GJ8A 4I1UA 3H0KA 5EP4A 1IJEA 2WZQA 4TL7A 3GCGA 1K8RA 1XBTA 3H2YA 2PJRA 2KE5A 2WJHA 3KXIA 2KB0A 1L4UA 3RWMB 3ZZUA 5JS8A 5BQ5A 2R6FA 4F38A 2EFDB 2KRKA 1R8QA 1X86B 1T3LA 2WOOA 4LYFA 4Q4JB 4DLSA 2QMHA 4OQXA 3Q3JB 3DZDA 4FCVA 3C7KA 3PEVA 1KDOA 3GLHA 4G5GA 2D2EA 1HUQA 4PPFA 3LWNA 3BGWA 1NI3A 5HR5A 1EFTA 5KSOA 2QG6A 1Z6YA 4OBEA 1QG4A 4KJZA 3Q7PA 4G5QA 4MDEA 4O2LA 4YXWD 2OCYC 1V43A 3GJ4A 3E1SA 5DIFA 3AVVA 3SYLA 1KI6A 4FWDA 2QRNA 2GVZC 4RCYA 4TZ0A 3N5CA 4WAUA 1IY2A 4KLZA 3A6PC 4M4SA 3KTAA 2IC5A 4LHZA 2VL7A 4KYUA 1IHUA 1R0ZA 1N6OA 3PUVA 1PLKA 2FU5C 4Q7KA 2DWPA 4RZXA 3VR5A 2RHDA 3GJ3A 5LD2C 3QKSA 4B48A 2ZYTX 3RRMA 4Q1AA 3DMDA 3ADKA 2VTKA 3IPXA 2RGCA 3KZ1E 1KYIA 2WJJA 1HV8A 3THYA 4DB2A 1OIWA 4BUJA 2F55A 3U61B 2KJQA 5FPKA 5L3VA 4NCHA 4B3BA 2ZSFA 4E03A 3LH5A 1CJKC 2QZ4A 2JJ1A 3SHFA 3CH4B 3T5DA 2HJGA 2FEOA 2O52A 5SZJA 1QRAA 3WY9A 2OBNA 3TVDA 2RKOA 2FPKA 5FBLB 3FHOA 3HYTA 1Z0KA 4TT3A 4BLQA 1SQ5A 4NTZA 2C8VA 1W0JA 2AK3A 1RFLA 3RS5A 3CF6R 2BBSA 1Z06A 3ASYA 2ZETA 2QN6A 4CEHA 3K09C 1Z5ZA 2QU8A 4TTQA 4EJSB 3R8CA 2C98A 3NHAA 4URUR 3WMFA 4YMVA 3OF5A 1S96A 1SVLA 3QJYA 4PTLA 5CB6A 2W2XA 1DG1G 2A3RA 2J41A 3THXB 5GJWC 4QHTA 1G8PA 1I2DA 5AJYA 3GP8A 4UXHA 2FG5A 2XX3A 3S1AB 1Q3TA 3MMPA 3PEYA 1YZUA 3QF4A 4G01B 2AK2A 2QAJA 1AN0A 3CPJB 4BLTA 1GP2A 3QXHA 4K8OA 1KMHB 3NTUA 4JBWA 4PZLA 2Z4RA 2IUUA 2BM0A 2MSEB 3BB4A 3K0CA 3L43A 1NVWQ 3BOSA 1BS1A 2PEYA 5FR2A 4CRWB 3U7FB 1ZNYA 1QZMA 2ONKA 2ZITA 5KPDA 3MWYW 1KO5A 3C4JA 1G3RA 4NL4H 3KUCA 4F93B 4TTRA 4ZDKA 5B30A 5BN4A 1G7SA 1YZQA 2ZS9A 4TLEA 2WKRA 3LRPA 5KO2A 2GCPA 1GL9B 4Q03A 4Z51A 1F60A 1UM8A 2RHMA 4PHHA 2X19A 3O47A 4AYWA 1ZCBA 1Q1BA 4MGKR 4QJ4A 3W6OA 1P62B 2IYWA 5B64A 2VF8A 4AURA 4PAQA 1Z6XA 2WV9A 1Z0FA 1W0KD 4KO8A 1ZINA 3FKSA 1DBSA 4KFUA 5C1BA 1GG2A 1S3SA 1UEJA 2C9OA 1E2HA 1KSJA 2ZRFA 5D3QA 5B2ZA 1E9BA 4ESHA 3B7GA 4FMBB 4P4TA 2DY1A 3BFXA 2AR7A 4BFUA 1E2JA 2ZVPX 3K0EA 4HAXA 4AYTA 3BWDD 4A0FA 4EQ6B 1E2LA 2W2TA 3P32A 4JMPA 4PSAA 5CLLA 3BE4A 1GITA 4URXR 2A30A 1MR3F 1OIVA 5EP2A 2N42A 4JN6A 2F9LA 2IEYA 1P61B 1E99A 2OM2A 3IILA 4YMUA 2H57A 2ZSEA 3SR0A 4F92B 1X8LA 1Z63A 4LY6A 4Q4LA 1GNQA 4DLZA 4RZ3A 5E7IA 5G3YA 3QKRA 2FH5B 2FFBA 3ZQJA 3AEZA 1NMXA 4OK3A 1TPZA 4RFVA 2GZAA 1CRQA 1Q57A 3FHCB 3CRMA 1OIXA 2IYXA 3FGNA 3ICEA 1FUKA 2ATXA 4GZLA 4HZIA 1XCMA 5JCZA 4IW3B 2ZJ8A 1G20E 4FWGA 4KHZA 4ZKEA 3IIMA 3T1TA 3CIOA 4IOKA 3NHBA 4EIWA 1RRFA 2GEDA 4CGZA 4MGZR 3GLGA 5P21A 1OXUA 1R0WA 2WVJA 4LBYA 1N6PA 1SHKA 2GF9A 3AP1A 3SJCA 2D06A 2J3EA 5CJ2A 3RS4A 4WZAE 4Z1MA 4NYMR 3UWOA 4EPXA 1P9RA 1Z22A 1CBUA 4L16A 1VCMA 3TAHA 2GTPA 5BYKA 2J0UB 3SEAA 3QG5A 1XEWX 1P4SA 4BZXA 2QT0A 4EFLA 1OV4A 1OXXK 2WIAA 2C99A 1X1SA 1D2NA 1KK3A 2O0HA 3B1VA 2WJGA 4GNKA 4QM6A 2GXUA 2XB2A 2ZR9A 3E2IA 1EK0A 3MFYA 4G5RA 3TRFA 4LHYA 3NEYA 1Z83A 2GBLA 3VNUA 3N2IA 1N5JA 4JT4A 1HURA 2OT3B 4MRVA 1G7RA 1OB2A 4LJ4A 3KKPA 4Q9KA 5JWHA 4U7DA 1KSGA 4MYTA 3QQ5A 1VHLA 5FL3A 1G4UR 4CF7A 4HI0E 2OG2A 4MDFA 2C77A 1W0KA 1DVRA 1Q22A 3NEJA 4TYQA 2XEXA 4DDWA 4RD6A 1AKYA 4BLPA 4JZKA 3Q72A 4QHYA 1CRPA 1KMQA 4OYHA 3SYKA 4PQFA 4D26A 3TVTA 2ZJ5A 1ETUA 2YJTD 2N1BA 4KBFA 4ON9A 4WOPA 2FE4A 3EWAA 2FF7A 3F3YA 5JBQA 2RH5A 3AGPA 5JS7A 4UKDA 3P4XA 4RD2A 4NDZA 3FB4A 2IX3A 3HDTA 3REGA 2BHRA 5LDDC 2YWGA 3LXRA 1SVKA 1VG0B 3GJ6A 4D80A 1KJWA 2RGNC 2IK8A 3RSLA 4JLBA 1MABA 5F2EA 4M9QA 1XF9A 2F6RA 1T0HB 1MH1A 2VYFA 1NBMA 2Y8EA 1D2EA 2ZRDA 1NY6A 1T9HA 2F9MA 3ICQB 3NH9A 2JLSA 2VO1A 2ZSDA 3HJNA 3RNLA 2QQ0A 4BFZA 3QVVA 121PA 1GIAA 2ERXA 2V6JA 5JEDA 2FFAA 4RD4A 1G21E 2VQSA 4CZ2A 1YRAA 3SE0A 4LGMA 4EJSC 4GDFA 4PSVA 3QKSB 2A5JA 3RC8A 2Z0MA 2FFQA 2PCJA 1Z0IA 4B3XA 4LX0A 5SZIA 2AXNA 2OILA 3ZGXA 4O2RA 5DYGA 4MUBA 1TEVA 3THYB 4IFBA 3KDSE 1TUEA 3OE7D 2VBCA 4TWZA 3ZLJA 2G0TA 1OHHD 2ZU6A 1NN0A 3O8BA 1Q44A 5L8VA 2QPAA 4JS0A 2J7PA 2ZI3A 3KJHA 2VP5A 3LO5A 3LVRE 2HLDD 1VYVA 1C4OA 1JAHA 5IDVA 1H8HD 4GRAA 2I3BA 2QE7A 3V00A 2Z6VA 4A8JA 4AD8A 4QNMA 4TLBA 5JI3E 4LBVA 4JL8A 3GEIA 4CEHB 3B6EA 2IS6A 2WJIA 3A4NA 3JVUA 1XX6A 3TUIC 1K6MA 3GD7A 3DPUA 3K9HA 4L5BA 1IY1A 1IN7A 3PV0A 2WWYA 1KNQA 3DKVA 1E2IA 5GVRA 3B2EA 2OXRA 5UKDA 3AP2A 1LW7A 1Q12A 2JJ2D 4GI7A 5HCNA 3I61A 3QF4B 3RYTC 1Z28A 221PA 5HPYB 4EPWA 3X1YA 1ZM4A 2V3CC 5FPSA 2PJZA 4QGGA 4K81B 2VP6A 4QJ3A 1N25A 1ZIPA 2BMFA 3PCRB 4LZZA 3PG5A 2XZLA 5FTJA 3X1XA 3TR5A 2HXSA 3PJRA 1OH8A 3X2SA 4JVNA 3W34A 1ZBDA 4NH0A 1G5PA 3H4MA 2MMGA 2BMJA 3KQUA 2OO7A 3AF0A 1VPLA 1OXTA 4NE2A 4PO9A 4NYJR 1N6HA 5BW8A 4MYCA 3RAPR 2CHQA 4JLJA 3NDPA 1WCV1 1BO6A 4JYBA 1R2QA 3FYHA 1X37A 4XH9B 2XXAB 1IQPA 2V54A 3DOEA 3UMSA 3AVOA 3TSWA 2WTUA 1G3UA 3AVTA 5LPNA 3N70A 4D6PA 1WDTA 4MH0R 1XEXA 2OV2A 5FUYA 5FI1B 1ZC4A 1CF4A 1QZXA 2FSHA 1DTSA 2EYUA 4M1OA 1Z07A 4OKSA 4JLDA 5HZHA 4C0KA 5AJVB 4US2R 4HB4A 5DN6D 2BOVA 1G6OA 2TMKA 2HV8A 4LOAA 1AQYA 1ZMXA 3KKOA 2VHCA 1MO6A 1EG7A 2NMVA 2V6ZM 3K8YA 2HLDA 1R0XA 4I4LA 4HAYA 1H8HA 3QKRB 3EC2A 2F1JA 4Q1CA 3KQHA 3AKYA 2GXAA 1S2MA 3VX3A 3QPVA 2QPTA 3UXMA 4OHXA 2CVHA 2VHJA 4TL8A 3RS0A 4QHSA 1W5SA 3T1VA 2GWHA 1KAOA 1OT3A 4LI0A 5KUTA 1E1RD 3J81k 1P6XA 3C8UA 3IHLA 1AA9A 5AR1A 4Q18A 3I8SA 4F7WA 5HCIA 2Z43A 3HU3A 3GLGB 2H16A 2CLSA 4ZI3A 5L3QB 3ZH9B 4NMMA 4HUTA 2JJ2A 3WMGA 2YOFA 4ZO4A 5EXPA 3AKDA 2PMKA 1VIAA 3L8YA 2RMKA 1Q20A 2Q3HA 3SI7A 1UF9A 2ZRAA 2YWHA 5J4LA 1ZNWA 2ODBA 4BLSA 5M04A 1U98A 5EXTA 4Q21A 1VECA 5E3HA 3ZZ0A 3KJEA 4DCNA 2ZR0A 3U44A 2FNAA 3I5YA 3OIVA 2PBRA 4H9GA 4Q9JA 1UBGA 2REOA 4Q01A 1Q21A 4OL0A 4OHVA 4D25A 3NVAA 4TSFD 1U8AA 4D2IA 2O8EA 2JCSA 2AWOA 4HAZA 3WMEA 4B6FA 4IKEA 4TMWA 3UK6A 3EZ2A 4M9ZA 2JLVA 2ANBA 1S3GA 5EZ6B 4RY2A 3CR7A 4ZIRA 3FFBA 1TX4B 1KJZA 3QBVA 4TYNA 5F9FA 2XSZA 3CWZA 2QSYA 4PAMA 3MJRA 4PXAA 3RSOA 3P26A 3IIJA 621PA 1TTTA 5CDFA 1O3YA 2CL7X 3BH6A 3OFNA 3M0EA 1XPOA 3R9WA 1KNXA 4Q7LA 4GP7A 4A36A 2L0XA 4UJ3A 1YZLA 1BKDR 2QM7A 4XD7D 1II9A 1TF5A 2F1HA 5DN6A 3A58B 2IF0A 3KKMA 4DLYA 3LVQE 4PSKA 5J4VA 3LY5A 5DLQC 3HWSA 2A9KA 4HZUB 2CL0X 5FL7D 5L3SA 2CVFA 1T8UA 1MABB 5JMTA 2ODEA 1JQLB 2YC4C 4URYR 5TY0A 1SVMA 3QIAA 2IYYA 1OF1A 2EWVA 4B2IA 4LPSA 4PX9A 1Z6AA 4NPHA 3W9YA 4TMZA 2ODNA 4KAXA 4ILEA 4DIDA 2F3TA 3OESA 4LHXA 1EXMA 2WWFA 4QC2A 1G16A 4CEJA 2O0JA 4LRSA 4JLMA 4W7SA 1HT1E 2ZAOA 2IYLD 1TU4A 5AUOB 3CX8A 2OFOA 2W83A 1JECA 2W0SA 5FFMA 1SVIA 4IOLA 2VH5R 3UG7A 5JI2E 1NVVQ 4TMVA 2WAXA 2NIPA 4L4UA 1LVGA 2A5YB 2FEMA 4NONA 1XP8A 1UJ2A 1Z29A 4V0OA 1XTQA 1U2RA 4IDOA 4IVQA 3VKHA 4BPBA 1QHNA 4R9UC 3IDQA 2BCJQ 1NN5A 4NYIQ 3K0CC 3CR8A 4JVMA 2X8AA 1R5OA 3DEFA 1UBEA 3QBTA 4I1SA 4C0SA 5KSYA 2IL1A 2XGJA 4LUCA 3EZFA 2P2LA 4DSUA 3NDBB 3A1TA 5EJEA 1ESMA 1XMIA 4M9XA 1RKBA 3PUZA 1IBRA 4C2UA 1E9RA 1XEWY 3CUEF 2ZRHA 4A8JB 4WZ6A 5KSZA 3A1SA 2PL3A 4JLVA 1E0AA 3FMFA 1XMSA 2RCNA 1IOZA 4FI3C 4XWAA 2G0NA 3W3ZB 2JLWA 4TSFA 4PR0A 4TYPA 3VU9A 5E7JA 1EWQA 1Q3HA 2ZE6A 2D7CA 2ZRCA 3IEVA 4I81A 2ZJOA 4WA7A 2DZNB 3I72A 4YLGA 3U4QA 5G40A 3EPHA 1GAJA 4B3GA 1WBBA 4DCSA 4KXFB 1ZD1A 4NHOA 3T35A 4P31A 1W48A 4GP6A 4GSYA 1ZUNB 4HDCA 4UXJA 2P3SA 4X8OA 3SJZA 4BFSA 4F91B 4E5UA 3TLXA 2O8CA 1KOFA 2A5GA 1FL9A 1XXHA 4MKIA 2W58A 4YDSA 4BFVA 4QGAA 5F3WB 1N6NA 2RGEA 3OIWA 4UNNA 3F0TA 2DWQA 5FL7A 1Q1ZA 1YU9A 5FPHA 2FDCA 2BJWA 3AVYA 2WWXA 3A1VA 1UKZA 1US8B 2CMKA 3LD9A 4HDOB 2NPIA 4DZZA 4LHWA 1JR3D 5CB8A 4TT3D 4XWOA 4MKGA 1P9WA 1L4YA 3TMKA 1R6BX 2VSFA 2XZPA 2PZEA 1E9EA 1AGPA 4B34A 2B92A 2QRZA 3QUSA 4PPQA 1XEXB 4U02A 1YZKA 4LV5B 2O0KA 3ONWA 1JPJA 4D4LA 4DRZA 3ETLA 3HYRA 3PENA 3F8TA 2J7KA 1RYHA 1V5WA 2Q3FA 3CLVA 3CWQA 1G4AE 1VYUA 3ZZTA 1ZP6A 4JT2A 1KK1A 2AFIE 3LQRA 3NG1A 1FFHA 1XJQA 2CK3D 3DMNA 3EG5A 3CZPA 2AD1A 5B58C 2GJAA 1KK0A 4IXMA 1FP7A 2Q9CA 1W4BA 2ZE5A 4QGFA 4HAUA 1ONBA 5C4MA 2AL7A 1E3MA 4OQMA 4URZR 3VTKA 3GLHE 3U6KA 3I92A 1IONA 2GBLC 1M6NA 1XRJA 3KB1A 1T6NA 5JRJA 2YC2C 1EWRA 5DGXA 4OQFA 3R20A 2A2ZA 1CU1A 3G5UA 5AWFC 3K70D 2J1LA 4C0JA 1XPRA 5JJIA 3BH0A 3FKSD 2OUKA 5CK5A 2D7DA 3K9LA 1NG9A 1NJGA 3CF2A 1XCPA 1SULA 2ODWA 4IDHA 3RRYA 2X1VA 2HF9A 2VLIA 1GNRA 2R9VA 4M53A 2ZE7A 3OEHA 1DARA 2IUSA 3CNLA 3KB2A 3KQKA 3M6AA 3AUYA 4K46A 4EAQA 1M34E 3LDAA 3U44B 2NZJA 1CJVC 2CDNA 1KKMA 1E96A 1RYFA 5JHHB 4PQRA 1VYTA 1LB1B 2IXEA 3BFVA 4UNQA 1MV5A 1FQKA 3CM0A 1JI0A 1YR9A 1JR3A 5LB4A 1TADA 1KO8A 1AIPA 2ZJYA 4QBIA 3SDZA 2O8EB 4AI6A 2XITA 1WBDA 2P6RA 1LF5A 4KFTA 4A2PA 5DH9A 3EX7C 4PPNA 4MRRA 3AKCA 4ZIRB 2QP9X 1DELA 3VKWA 1Z08A 2J46A 3SS8A 1KIMA 5FOXA 4R2IA 2JLZA 1UAAA 4A3VB 3WP0A 2ERYA 3D3QA 5TARA 3OHMA 1II0A 3MCAA 1NVXQ 4L9SA 4OJQA 1E98A 3A4MA 4Q48A 4RVCA 1JNYA 5CM9C 2W6ID 4F4JA 4RFSA 1SVWA 2JA1A 4Z1MD 3NIBA 4NBSA 1KDPA 2IS2A 2BBOA 4G1UC 2NO1A 3SZRA 4KSCA 2Z5FA 4IJMA 2GEVA 2KSQA 4JLNA 1S0UA 3C16C 4LRTA 4NKRA 1FMJA 1YZGA 3RS3A 5L3SB 4M0LA 2DWOA 3UIEA 2CK3A 3VMFA 4DLRA 3R8FA 5DE3A 3TJZA 2IYVA 3U2QA 4TYYA 2CLDX 4LBZA 5A5GA 1DEKA 1Y3AA 4KVAA 4BFYA 1B23P 3WBKA 4PC6A 2NG1A 1T4GA 4A8JC 3DHWC 4FWTA 4MITA 3L0PA 3UKDA 1G6HA 3DM9B 4CEJB 3U3RA 3MAAC 2SHKA 5EE9A 2DWZB 2ZXUA 1TQ2A 2ZRIA 2H1LA 4V0NA 3TW4A 4B2LA 3AVUA 4UNSA 1GKYA 2NQ2C 3NH6A 3C5CA 3E5HA 4I1VA 1E0SA 2F1RA 1KAGA 1GTVA 3AF2A 1TF2A 2ATVA 2ZI7A 1CP2A 1VCNA 4KVGA 4NCIA 3SHWA 2QP4A 5IF9A 1QHYA 3ND8A 1W4CA 3KUDA 3GEHA 5EUQB 1TF7A 1ZM7A 5CM8B 1OW3B 3TW8B 5GADl 2XNSA 1IXSB 5JJKA 5KTYA 1OKKD 2WJYA 2C2HA 3KX2A 1D5CA 2HUPA 2REBA 3HPQA 3BIFA 5KDLA 3CRVA 4W5JA 2JLUA 2QAGA 2GEUA 1G41A 2EYQA 4AKGA 3FOZA 2ZAMA 1NBMD 1DAKA 1EFHA 1RRPA 1VG9B 3MUFA 3VU9B 4ARZA 2WWHA 2IYSA 2YWEA 4M2LA 1PLLA 2G1KA 4JBYA 1YR8A 2VP2A 1E9SA 4XVQA 1XD2A 1KSFX 5DNYB 4AK9A 1UFQA 4BQSA 2ZYUX 2GILA 1J8MF 4JKYA 2OCAA 3LX8A 4KCGA 5CIWA 3TUZC 2CLCX 3VFDA 3UWKA 4LC1A 3EPKA 4KBGA 1DAEA 2HYDA 2W6IA 4XJXA 4Q9IA 2O8CB 2R62A 4YMSA 1JJVA 3SN6A 2ZYVX 1XXHB 3A1WA 1WF3A 1GNPA 2PX0A 4HB2A 2GCOA 2O8FA 3GLGE 2KBFA 2ZIAA 2AXPA 2J7PD 2ORWA 1HTWA 3H86A 2QEQA 4PHTA 1E2QA 4DUGD 1NY5A 1A2BA 2CXXA 3IQWA 4XVRA 1VMAA 4GZMA 4JKIA 3K0FA 4HAWA 4JVSB 4PANA 2QE7D 3EXAA 1F2TA 1MOZA 2IYQA 2ZEJA 1PV4A 4DLTA 2EFGA 1IAQA 3IEUA 2FSGA 2CNWA 1EX7A 1KO4A 4DSOA 1T5IA 3A8TA 2VP9A 1VCOA 5JFGA 4ACAA 2QI9C 2J5XA 2C04A 4BRWA 4MYHA 1JEEA 2YNMA 1KI7A 3U7HB 2FN4A 1NSFA 5HKKA 3AM1A 1D9XA 5FTKA 3Q8XB 4UNRA 3THWA 1U9IC 1A1VA 3ZVLA 2DHRA 3O8CA 3QKTA 3AGQA 4UXIA 1A2KC 4DEYA 2G3YA 3CONA 1P60A 3LAWA 3GLHB 5KU1A 2WOJA 2W00A 2ORIA 3DOFA 2VIIA 1SVOA 1OKKA 2ZVQX 1AQUA 4TLAA 3PXGA 2F43A 1IY0A 3IBGA 2YOGA 3DVLA 1Y63A 3FMIA 1ZYUA 4M1WA 4N0EA 4Q4HA 4BFXA 2IWRA 4CT4B 4EPRA 1NVUQ 2G1JA 2Q0HA 1DAMA 3EPJA 3F5FA 1Z6GA 1R10A 2ECKA 2BCGY 1IXRC 1U99A 4G0NA 1TQ6A 2DFTA 1KI6B 4KV9A 2R2AA 4ZDIA 1XTSA 4OQLA 4R98A 2OLKA 3CX7A 5A4JA 2V8OA 4AKEA 1KY3A 2OAQ1 3T5GA 4ACBA 3KTAB 1IN4A 2AKYA 2WMOB 3AF1A 1D8TA 4PO1A 4F4CA 2WAYA 1NBME 2HT6A 1RRCA 1RJ9A 2RGDA 2W6JA 3P27A 1XZQA 1I4LD 1T0JB 2DFNA 2OFXA 3EA0A 1I4TD 3QY0A 1OB5A 5FBWB 4KI0A 2GK7A 4O3MA 4AKHA 2HT1A 1XB2A 5A0FA 2G77B 5JRZA 3MWKA 1Z0AA 1AZTA 3QI2A 4PZYA 5H1YA 5J47A 2ZS8A 3G82C 1I4DD 1U0JA 5JHGB
chains in the Genus database with same CATH superfamily
2MSLA 4K3UA 2W43A 2Y6VA 5ALMA 4Q1DA 2XAAA 2G8LA 5FNVF 5LUAA 4DQDA 1E9CA 3CN7A 4F9GA 3L0BA 2CFCA 3AX6A 3IAS1 2HJWA 2GBCA 5CEEA 3U6OA 3S8MA 2CUNA 1NRIA 3DMTC 3QX7A 3ZD6A 3QYAA 3HQ4O 1O6BA 3N53A 4EW2A 3U7GA 4B7XA 4DJFC 3VO9A 2EFHB 3ZZNA 3GUVA 4PO3X 1KU0A 4J0JA 4HNUA 2J4FA 3KSRA 1FUUA 2DXIA 1FU7A 3P45A 1MP0A 3FTCA 1E32A 1G42A 3I09A 3TE7A 5CNJA 2AJCA 3U31A 2WVGA 2ZQ5A 3VM6A 3KKNA 4RA6A 1H6DA 4B3SM 1XD9A 3FVWA 4BX8A 1U1EA 1KIAA 3AIOA 1D6NA 1E3TA 3D3KA 4TROA 1RAAA 4UHFA 2OCGA 5A5FA 5G4KA 1ECGA 3ZGNA 3WYAA 4DLUA 3SX4A 3AHIA 1JYEA 5IM4A 3T5MA 2RH9B 2HDHA 1UKVY 4C87A 4CL0A 1GPAA 3BD9A 3RE8A 1J5PA 4GGPA 4G6ZA 1PT5A 2H54A 4A6XA 1U90A 2XT6A 3IUPA 4XX0A 5DHAA 2CV1A 3U61A 2R4JA 3ZDRA 1UM9A 5IBQA 1Y34E 5EG5A 2QVYX 1J6UA 4PIPA 2DAKA 3WQQA 1DKNA 1LK0A 1FBTA 3R5FA 3AKEA 4F3KA 3IV7A 1ISRA 2B4YA 3CKLA 2XAUA 1Y7LA 4CQMA 5IAKA 1OWOA 1NOJA 3GRYA 3CX6A 4B3RB 1VLQA 3NDIA 3SSNA 3ONFA 1TKAA 1LPNA 1TQ4A 1AS2A 1RYYA 3TINA 4TLCA 1Y6ZA 4CR8A 4Z54A 2EVWX 2GO1A 2O23A 1EFUA 1T1RA 3E81A 4Y1RB 4RKEA 5K09A 5KKCA 1W59A 1TJNA 4S05A 1I4WA 3B3QA 2VHTA 2W6ZA 1FPMA 5AVOA 4NQRA 3E15A 1QMGA 4JYCA 1LKZA 3A6LA 4L15A 4QPNA 4F2WA 1CIPA 1W47A 5F9HA 1DLJA 1X7ZA 2VPPA 4I50B 1IRXA 3ZCTA 4WKOA 5DEOA 1VCIA 3QLVA 4ZTBA 5J5CA 1UMCA 3AZPA 3W4KA 2HFJA 1P1BA 3UCXA 2FG7C 2C83A 2CL6X 1N5MA 3ZCSA 1CCWA 3KDAA 4R9SA 1JA0A 3LLUA 3LBIA 3T3OA 2IPMA 4KMRA 3MGBA 1GTSA 1MFPA 1Z0DA 4OI0A 2AMFA 1TMGE 4IICA 1DKQA 2C4HA 3O8QB 1HDIA 4IIJB 4LMPA 1N7IA 4HLUA 2OAP1 2X0IA 1G8FA 3L6OO 3SASA 4IFEA 1PR0A 3FWZA 1KMMA 1NL3A 2JNHA 5K1ZA 5ALFA 1IFYA 4NC6A 5T3YA 3PDIA 1VDZA 2NVBA 3P97A 2A1IA 4XTCS 4KIJA 1YDGA 1SZPA 1CJTC 3JS5A 1IQRA 2ONJA 5IASA 3W78A 2PIAA 3E61A 3T34A 2AWNA 3KYJB 2EFEB 3ANSA 4ETMA 2YHSA 2PUGA 4UTXA 3TRHA 4B08A 4G2TA 3GR6A 2ZWAA 2AW3A 3BDIA 2IGTA 3D8TA 3HL4A 3SJUA 3ZI4A 4OVZB 2MTBA 1ZNXA 2E9SA 1OPXA 4HUQA 5E95A 2WHXA 3SM3A 1UWVA 5BNFA 5B7NA 3V34A 3DAPA 2ZQYA 1KRHA 1J1UA 2WWIA 3QPWA 4MINA 4OA8A 1HYQA 4LK2A 4GKKB 5C8ZA 2QD5A 2ZRGA 3GAZA 3EYAA 4NHEA 1XI2A 3DMGA 1PFQA 3C6MA 3I76A 1HNXM 4PXSA 5AI5A 3UW3A 1FTGA 3VYSB 2H52A 4LF6B 4A6PA 1B73A 1SG6A 4Z8YA 4MIKA 4BV2A 3U26A 1XCJA 4Z4CA 5H9WA 4C7OB 6AT1A 1WP9A 1N4AA 1G1MA 2W11A 1NN3A 2JHPA 4PPYA 3DYVA 4H59A 5LYJB 3K53A 5A4AA 3CE6A 4EUEA 3Q8GA 1F20A 5I51A 4I5IA 1KMIY 3VI3B 3T5TA 1T6XA 4R2HA 3SQLA 3NWEA 1JIQA 2QW0X 4MQEA 2XDQB 4ZRMA 4MS3B 4RD3A 3WR5A 2O8BA 3WAGA 1W581 2GBPA 3OZCA 3Q3HA 3MZ0A 3QYEA 2ZRMA 4OHOA 2PS9A 4ZKDA 1NXOA 1NR1A 2KQUA 4FE3A 5D84A 4EZIA 4DMLA 2EDAA 4OAQA 4BEVA 5JDCA 4A23A 1X15A 1S8FA 1EBBA 1V7ZA 3FLBA 5B4UA 2DQYA 3IT2A 4R7ZA 4GHAA 1NVBA 1FQJA 1QHHB 2YDXA 4J0QA 5COBA 1V3VA 1EFLA 2EKQA 1ZOOA 3HRIA 4CWAA 5C37A 1U7UA 2JAHA 4Z9FA 2V4ZA 2FMKA 2Q1TA 2BBWA 1E9VA 3OT1A 1T26A 4YK7A 1HE4A 5GJBA 2HXYA 4GM0A 4O59O 3NJ8A 1A7KA 1JPNA 4PDGA 2JAQA 4OP2A 4NF2A 4MS4A 5J2UF 2AB0A 2ZYWX 3MINA 3EEQA 3SMPA 3FH0A 1I24A 1P7WA 2ZUBA 2H17A 4DDTA 2JCVA 5A3RA 2JCXA 4HBZA 3ZDXB 1HYHA 1E64A 3WKAA 3EVBA 4OHWA 4WQMA 3CF4G 3CRZA 2R65A 4KAAA 2HMWA 5K6AC 3KPYA 1TK9A 5B6IA 1GXSB 3DDSA 3QLUA 1QX3A 4OQYA 3OIFA 1D7AA 2ERCA 1GTJ1 4GI3A 2VF5X 3SQOA 2JAXA 3R7AA 2O19A 3N2GB 3GEGA 2JD1A 1DBVO 1K6IA 1XTPA 1NTOA 2Q1SA 3MTDA 3G0BA 1N5KA 4E22A 3KR9A 3RUFA 5CX1A 3QG1A 2IV3A 1G55A 1N9ZA 2HQ1A 3Q11A 3WFJA 3EA5A 4QDKA 1RHKA 5J5VA 1HSZA 3I9MA 1G5TA 1U81A 3UZUA 1WB6A 2OMKA 3A0RB 3SZGA 4FHFA 4RHTA 3OMWA 3KT3A 3BGSA 2CXHA 4FOLA 1N34B 5IMBA 3DBVO 3K30A 4QYTA 1JU4A 3QHQA 3OEED 4EI2A 4MGKE 1ZIDA 4AUEA 1TK3A 2O2JA 3HJBA 2QJRA 3GAMA 2DVWB 4HVTA 2B8WA 4PIMA 2ILTA 2VDBB 4L4ZA 3MLEA 3ADDA 2QTCA 3LPLA 3KEGA 3R9XA 5EC8A 1Z6PA 2O2SA 3FYUC 3E46A 4R1PA 3QRWA 4HB0A 1P6UA 3CEHA 1L2TA 4CM7A 4NU0A 1VHTA 4DR5M 5GP1A 4RKFA 4AJ1A 5GONB 4DIMA 2ZB8A 4KEAA 3BFPA 4QE3A 3KHTA 2GA8A 4CM8B 3H9JA 3ET5A 1HNNA 1UBOS 4EI7A 1W88A 5D1NA 5EINA 5CA1A 1U8EA 2JIBA 2BKAA 2H1SA 3DUFA 5IAOA 5JZVA 2D62A 1QQ5A 4Q3EA 2EQ5A 3KOWE 2P8JA 5JS8A 3IH5A 1VJDA 5KNLA 4RVDA 4V0SA 3Q3JB 2HPAA 4G5GA 3FRHA 4YT2A 4YHHM 4OBEA 1QG4A 3GT4A 3BA1A 3EAFA 3L4JA 3A6EA 4I1PA 2Q3DA 1CZUA 4K6GA 3DXXA 3UWDA 4ZEXA 1PHPA 3F71A 3CUTA 1WD7A 4Q7KA 4RV4A 3EG9B 4H3KB 3PNSA 1JT2A 3T5DA 1KFEB 3GXBA 2B9VA 1I0LA 3O95A 1XO1A 2FW1A 4BLQA 1YGPA 1N3IA 3ASYA 4EJSB 1DRVA 5JQGF 1O4WA 3TLKA 1VRVA 3D9QX 3SCZA 2R5WA 2FG5A 1NVMB 3S1AB 1H5QA 3IUJA 2BAGA 2Z04A 4K8OA 3UT5B 1IVNA 3BOSA 2ONKA 5BV1A 3C85A 4XFKA 5FLEX 4YAFA 5JBIA 5EJ6A 5KOIA 1MTOA 1EE9A 2DUWA 4MAAA 2QOEA 3CIFA 4RVFA 4NXMM 4AURA 2I3AA 2WV9A 1Z0FA 4JJAA 1FP2A 3IQFA 1FFCA 1QUFA 3ROKA 4DS3A 1IUKA 3PKIA 1WMDA 2DY1A 1AUXA 2BKXA 4ED9A 4U9IS 4E32A 2ZSEA 3DHNA 4YPVA 4O5OA 3SM9A 3AG6A 2FH5B 2Y0BA 3O38A 4OK3A 1TPZA 3FHCB 4D9HA 3IKVA 1MIHA 3H2ZA 3VC3A 2I2AA 3L7KA 2GOYA 2I3DA 2B3TA 1U28A 4NECA 4YJ2B 2QTNA 3ZE1B 3NXKA 4NYMR 1P9RA 4NXNB 5IXJA 1T15A 4U2DA 1MQSA 4S0ZA 4TUYF 5ISMA 3SJ7A 4P98A 1GADO 2RJNA 1N5JA 4KKVA 2KXEA 4JP1A 4LJ4A 1BA2A 4P0PB 3OFKA 4U63A 2GPAA 5H7XA 4QHYA 1X38A 1RBZA 3SYKA 2MSNA 1NP7A 3EWAA 1P1RA 3KQYA 1AQNA 3HDTA 1OWLA 2BHRA 3ESZA 5AJUA 1OGIA 2E4YA 3FOWA 2XCUA 2F6RA 3N58A 4MW4A 3QIVA 3IXQA 4IIXA 4FOSA 4RD4A 4MW1A 3N7UA 4B45A 1E2BA 4FUQA 1YQ9A 4LGMA 4G97A 2AG1A 1GZHB 2ZU6A 2G5GX 5K8VA 2WUDA 1JHXA 4U6QA 4RXMA 1VYVA 3BE8A 3L7DA 1JJAA 2FKNA 3OC6A 4QNMA 3GGOA 1DC5A 4DZRA 4UBKA 3H2KA 3U1BA 3A4NA 3JR3A 2BGRA 3T4EA 3V4ZA 4EG4A 4JJ8A 2X4AA 3VZRA 3JQ6A 4I1YA 5MGBA 2C54A 3KZVA 4F8JA 2BHTA 4QJ3A 4FR2A 3V1NA 1GG5A 3PJRA 5YASA 6GPBA 4U7FA 2CDRA 2PS0A 2Z2KA 3NDPA 4B1FA 1NM5C 1W2WB 4DQLA 1VPTA 3FYHA 3QEKA 2XXAB 4LWPA 1YJAA 4X44A 2FRVA 1V3UA 1ML3A 3VYRB 1TZ2A 4KPUA 3CQ9A 1TTPB 2IFTA 4HV4A 4C03A 4HB4A 5DN6D 1R8JA 2MOKA 2BOVA 2TMKA 1IBCA 4DCJA 2QPTA 2AN3A 2VHJA 1ADJA 2O3UA 4K6HA 3GGPA 4OHMA 2D0PB 4F7WA 2WZDA 4X7PA 4EJ6A 2ZTHA 3OURA 4ODIA 3AKDA 1A9ZA 4KXYA 1GGJA 3O8QA 2QYTA 5TSDA 4B3JA 1VECA 3O75A 4BWGA 1Z73A 2ECFA 4OL0A 2QRHA 4AMYA 2NUAB 3LVBA 4Y2JA 4TQGA 1YVRA 3NYQA 3ZU2A 5F9FA 3SXUA 4PXAA 4I9NA 3O90A 5HIAA 2QRUA 1R4MA 3M0EA 2UUBB 3L4BA 5K6TA 2GGSA 1JSRA 3IE0A 3LK6A 3HWSA 1JZTA 1HMYA 2EWVA 3ER9A 4TMZA 4UPEA 2D1FA 5BOVA 1EXMA 4JLMA 2IYLD 3CBGA 2PFSA 3UG7A 4FKMA 1ZXLA 1TYAE 1UBLS 1I3MA 3IBCA 4BN5A 3PD1A 1RXSA 5IM5A 3FUWA 3ZWOA 3D2LA 3NDBB 4RVNA 4R84A 1IBRA 2D8AA 4EGCB 1E0AA 3OOYA 4MKZA 1FFGA 4MGZE 4RS4A 1ZEMA 3A31A 3NMUF 3PP8A 4YLGA 3Q0EA 4WMLA 5B3JA 5CTAA 4UXJA 1F9EA 5FYDA 5EJCA 1ZMWA 3ETJA 3OLCX 4PGHA 1YMQA 4QGAA 3DUWA 2I6UA 4EJ2A 3FCSB 3OIWA 3AVYA 2WWXA 2CLLB 1F14A 1OZ0A 1JFVA 4ZI7F 4HX2A 5HKOA 2QRZA 4AXBA 1MX0A 2XXBA 2XUFA 3JRXA 3PFGA 3G5TA 5F76A 4R41A 1YS2X 3L7JA 3QVOA 3VTKA 3GLHE 1P8JA 3WRWA 1EWRA 2C5HA 1QE0A 4DY4A 3UAGA 3G7NA 5ICMA 1UZMA 3AL3A 2OUKA 4UUAA 3PU6A 1CHNA 3TLBA 2XA1A 1HGXA 4RM3A 4HNHA 1YTUA 4ZARA 3WA6A 1T0UA 4ZOQI 4IDBA 2G5CA 2YXDA 1YR9A 2YMMA 3I2JA 1EJ6A 3AKCA 3NANA 1UBKS 2B6NA 3HCCA 4WY2A 1NVXQ 3S0JA 4IRXA 2R8OA 4RVCA 4F4JA 1K9VF 4OYRA 3Q3CA 4EVSA 1KDPA 4IDGA 4YRQA 3VDRA 1E7WA 3H13A 2KW5A 4JBGA 4FYMA 5BO5A 4YECA 1M8FA 3V80A 1DEKA 1L5RA 5CU7A 4ND2A 3QWIA 5LMNB 1P0MA 3L01A 3AVUA 3VMMA 5CR9A 3TG8A 4R3DA 3T7DA 4YAKA 1Z8NA 1L5SA 1L5WA 1CP2A 2XCTB 1WULS 5KTYA 2C2GA 3I9KA 3STYA 3KX2A 4H1TA 5KVCA 3EGOA 2O54A 1I9CA 2GD2A 3U6EA 2QHXA 2C7GA 1VG9B 5LN1A 4BVFA 2V65A 1UFVA 3SICE 3E3LA 4KTVE 2OCAA 3DXZA 2GM5A 3STXA 4LC1A 1YQGA 4YCNA 4PVDA 4YMSA 2G1AA 3I58A 2GDZA 4UCWA 2J3QA 2M32A 5K6RA 1NT4A 3DDZX 3N2GA 2IYQA 3PFHA 4WK6A 2EP7A 3B1KA 5IF3A 3VA7A 4P7JA 1SCIA 1Z34A 3E1KA 3KSDO 2J9ZB 1KI7A 3U7HB 4QEZA 1QYRA 1XZBA 2WF6A 3ZVLA 3R0ZA 3PC8C 2C97A 3HMKA 3G85A 2XF8A 4RTQA 1Y1RA 2GUWA 1SKMA 1W5FA 3NBMA 5BUZA 3IBGA 5B58T 3N2LA 3FMIA 3U3RA 4ZC8A 3A42A 4J7CA 4KXUA 2HA6A 2UXBB 3A2NA 2P5YA 2V8OA 5I01A 2OFFA 4Z9AA 3A6HA 4MUFA 3A1NA 3U4DA 1N32B 2OFXA 4LYDA 5U1PA 5JRZA 1N1DA 3UK1A 1C3XA 2L4FA 1IIRA 2Z09A 1SUIA 2NPOA 4WN9A 2VHQA 3HWRA 3T15A 4LG1A 2V3VA 1B14A 4IGEA 1BDBA 1JSLA 1ODIA 2WA2A 4BDSA 4H3VA 3RGWS 4ZT5A 2VDPB 4ZALA 3WYCA 3WIDA 1A82A 4EGAA 1K63A 2GN4A 1TKCA 1MNQA 2VS1A 4BV8A 4IBCA 1PGOA 2VZ9A 4R5MA 1DGGA 4O3FA 4J16C 4MJ7A 4E1AA 3O74A 3ZQ6A 2GRAA 4TGLA 2ZJ7A 3OIDA 1JXMA 3VR3D 1FSZA 2WLTA 1Q0TA 3V4RA 3CZ4A 4AL4A 2P2GA 1SHZA 1REQB 5EE1A 2Q8PA 1X1DA 3GJZA 2WILA 1IH8A 5EUBA 3AVWA 4NBNA 4ATNA 3PUWA 4C4OA 3TAXA 1K06A 3WLQA 1JIIA 3HKBA 5HVNA 4PGMA 4QOEA 4A16A 2EEZA 3R0IA 3C8HA 5AM3A 1E2KA 2JASA 5IN5A 1NNLA 2GAAA 1ORRA 3TTVA 2GHIA 4MV8A 2HK8A 4DC9A 4E1VA 1R6XA 4FWBA 2D5LA 4DAEA 4ETNA 3K0FB 4V03A 3KLMX 4FINA 4NNPA 4AU1A 5E4FA 2PZFA 1N0VC 4KUHA 3QFFA 4YRNA 3AF6A 1ZCAA 1FCJA 5HZKA 4QYWA 1NYRA 3HEBA 4RK0A 2RHCA 2X0KA 1AE1A 2W2KB 5C1IA 4U8GA 1QKIA 4DA7A 2C8LA 5LR6A 5EWMB 3H1TA 3K5PA 3IKLA 1S1MA 1NVMA 3PX2A 3S1AA 1FUIA 1Z4OA 1BC5A 4DSAA 1XTTA 1XQ1A 5ITWA 2DYKA 3D59A 5EIBD 4LRUA 5DYIA 1USWA 2X7JA 3PT9A 3GJ7A 4NX2A 4EHDA 1I3KA 4I1OA 4ERXA 2FSUA 3MB8A 1UEIA 5DM4A 3FYCA 1GPUA 3T7AA 3I5MA 2DPGA 3HNOA 3QEJA 5JSHA 4WKPA 4OJYA 1SXJA 1VFPA 4L57A 5B7QA 1I6WA 5DLEA 2DQ4A 4CMBA 2WPDD 3FPAA 3I5AA 5DB4A 4JOSA 1KEWA 1DRWA 4N8DA 4EENA 1WVMA 3IP3A 1OBFO 2X5OA 1XXHE 2I4OA 2ZB3A 1X7WA 1UH5A 4MQBA 3ORRA 4FFPA 3L7MA 1Q3BA 3C58A 4CLEA 4IBEA 3MRSA 5JMOA 5D01A 2Q5EA 3F97A 3OSZA 1H9AA 2Q9AA 2NN3C 1FX0A 1SG0A 3EWSA 4RA6B 1ZXXA 2LIPA 4HLQB 2D4HA 2AOTA 1BEEA 4ZRDA 1I3NA 2JANA 5G4KB 4YAEA 5F78A 1PZEA 4E4RA 4NIMA 3TBHA 3WDKA 2A58A 3NWPA 1PGYA 4LXYA 1OI7A 4WZBE 1GGNA 2GPTA 5L3ZA 2VHZA 1YGYA 1PR6A 4D3DA 1II8A 4RD1A 1V9CA 2B83A 1J25A 3AUXA 5D6NA 5KBYA 1KEKA 4WACA 5AXDA 1VE7A 4EX6A 1SKYE 5KKAA 1UM9B 3UJCA 4TVBA 2BFEA 3OE1A 2DTEA 4WCFA 4MUYA 3BHMA 3R0VA 3GGCA 3LFHA 1Y3BE 3BXEA 4M87A 5FH9A 3S2GA 2WJZB 3EIQA 2ORVA 1FRQA 4HR7A 2JFNA 4W1SA 3T06B 4TYMA 3M33A 1TYEB 1KZ7B 5FBRB 3ZWVA 4JXJA 4CQMB 1N57A 4KN6A 5F2OA 1NN1A 1NP6A 1VLVA 1LPMA 3C8ZA 3L0SA 2XXAA 1AB6A 2EFCB 1EFUB 1MD9A 4V0KA 2A9JA 2GXQA 1QGAA 2NO4A 4PTYA 4BQFA 4DR4M 4FHDA 4KOAA 2FZ4A 4KO1S 3NFYA 3DOAA 1C9NA 3BAZA 3HDGA 5EZYA 3E8XA 4UMFA 1HF3A 5FPYA 4MRSA 4E09A 1A4XA 2WZCA 1X7ZB 3MGAA 3BSWA 3A45A 1JVBA 3HZZA 4AWAA 2P5TA 2GJ9A 3NHFA 3NWLA 1UMCB 2Q3EA 4P6VF 4N3CA 3Q3VA 1H6UA 4LYAA 1QGUA 1YVEI 2ZTSA 4X85A 1YBVA 1Y4DE 3I8XA 4HGNA 2C9CA 2PLRA 3LWBA 1TKRA 4C9BA 1UWKA 2XIJA 3HPRA 1QPGA 3ODGA 1ONNA 4ZQIA 3F7OA 1EUYA 4FSXA 1AZWA 2UXCB 2YJNA 4M88A 4QVGA 3NTVA 3LMKA 2IEDA 3BXXA 3PDIB 5ENZA 4D9KA 1G8SA 2XYHA 3EXG1 3I6ZA 1CP3A 1QK3A 4PYKA 1M72A 4B76A 1VA5A 1JDNA 1GTL1 1X7HA 3PWTA 3VHXA 3I9NA 1QLJA 3GQ4A 4UUPA 1O94A 2YBEA 3GLIE 3RT1A 2WDPA 3CKKA 1NF3A 3VJMA 2ZXFA 2HSJA 3AF3A 1Z2AA 3MOSA 1HFKA 1EQ2A 2Y1CA 2CVPA 3A04A 3BGIA 1KI1A 3MCTA 5AJTA 2XZOA 4HUQB 4A27A 5BSTA 1OI2A 4QGSA 2XUPA 1OAAA 3PF9A 2IEGA 1B3BA 1RQLA 1GLGA 1FX1A 2E18A 3QMWA 1S2IA 2WU8A 1W94A 3T0IA 4R8SA 5BRJA 4V3CA 3HUTA 1BVRA 3B2QA 2AI1A 1ZH4A 1VGVA 2ZW9A 2WHQA 2I67A 4BVAA 1YL7A 1TLLA 3HKDA 2XJ9A 1ORDA 3I5UA 2CD7A 2HMTA 3AW8A 2CFTA 3GDGA 3ZV7A 2UYHA 1OT5A 3VPXA 5FDFA 2D2FA 3GNTA 4LDJA 5KQSA 5JAQA 3ORSA 1M7HA 3S5UA 1T8RA 5BYJA 2FW7A 3V2IA 4L4XA 4BNMA 1I14A 1DX9A 4LXIA 2XH9A 2VUTA 4KR2A 3ESDA 1POXA 1U3FA 4QG7A 2HR1A 2FGKA 5DXAA 5H68A 3DEZA 2ZAGA 3R44A 3RI3A 4MQEB 1BHO1 4RPCA 2O8BB 3PEFA 1XNJA 3I9LA 3UO8B 1TAGA 3TRKA 3VR5H 5K0GA 1MO2A 1DMSA 3QVXA 5AVKA 5JYCA 3LYUA 1G8GA 2XUAA 3DKRA 3CWCA 1YCDA 2OFPA 3U4CA 3FCEA 2Q4BA 9GPBA 1QU2A 1CR6A 2ZANA 4QECA 4XB2A 2WIBA 3CH5A 1FNMA 1S2GA 4HDKA 1ZVVA 4US0R 3RWOA 1U1CA 1N2ZA 2DENA 2PMBA 2HQOA 3B82A 1P4GA 3OT1B 4PCUA 2AVDA 2PA3A 2LGJA 1IBSA 1ZIOA 3QVSA 2UYGA 1B41A 1E8DA 1JN0A 4WFKA 1Q74A 3DS8A 4JEMA 3BREA 3WADA 1N5IA 1SCKA 1NOKA 4MS4B 2G6TA 2HQRA 4JI3M 2CYBA 2FF5A 4I9GA 4XOIA 2RGAA 2AE1A 1KQ3A 4IS2A 4IKPA 2X49A 4LE2A 1T3HA 4H7JA 5THQA 1QR2A 1TW2A 1ZW6A 3SMVA 3I1YA 3FAKA 9LDBA 5K0FA 1BMFA 3JQFA 1E18A 2KB0A 1L4UA 1T13A 2R79A 4LYFA 3S2IA 4OQXA 3C7KA 3PEVA 4U1RA 3COZA 4PPFA 4L4SA 3BGWA 3EIUA 4EHFA 1RLMA 5B7PA 4QQ8A 1LSUA 2PXXA 1YAJA 1THMA 5LU9A 1PS0A 2Z6UA 4WAUA 4DUZM 1SIBE 4M4SA 2I1WA 5D8DA 2DWPA 3ZCUA 2ZYTX 2RHRA 1QH1A 5CX1B 1ZL0A 5AW4A 5L3VA 2X0RA 4IX1A 4PN3A 1E3QA 1CJKC 2PQ0A 2JJ1A 1UOOA 3GLSA 1R74A 4H17A 1Z0KA 3H9GA 4TT3A 1WMAA 4YUWA 3BWEA 5GTDA 3M7IA 4PTLA 3JR5A 4WK4B 3X43A 1NJSA 3VHRA 4RGQA 3NTUA 2MSEB 3UVEA 1ZNYA 4ZEMA 4ZVMA 4EB8A 1GA4A 3C4JA 4NL4H 4HCJA 1WR8A 1G7SA 1ODTC 4RKUF 4TWIA 2W2QA 4B4UA 2ES4A 3RLIA 1GGFA 1REQA 4YN3A 3E0XA 4NCAA 3R9XB 4GM1A 1GG2A 1S3SA 4E30A 2H59A 2AR7A 4EYKA 3VISA 4KO4S 2PHZA 1MPXA 1XZAA 1KYQA 4IG4A 3INGA 2QX8A 2YN4A 1O0SA 4WKCA 2IYXA 3FGNA 3G9ZA 2QR3A 1IEWA 3IRUA 2XVXA 1JSZA 3M6XA 4X00A 5DCUA 1SBYA 2X9QA 3TQIA 1QZTA 3SJCA 3QVGA 1W88B 4ND6A 4BQPA 4L4YA 5CA1B 2H2HA 4L16A 1SUCA 1GPKA 3I2GA 1SO8A 3E03A 4F56A 1X1SA 1KK3A 2O0HA 1Z5AA 3DUFB 1YVUA 1CFJA 1DV0A 3HB0A 3MFYA 1PGPA 2OCKA 3ZWAA 5A0VA 5DYTA 4HI0E 2H4JA 4D92A 4BLPA 1CHDA 1JPUA 2GSDA 5EY5B 5KVVA 4LKOA 3EVGA 3JR4A 4TV8F 5IUNC 2BMWA 4B46A 3ZDZB 1V92A 4JLBA 5EWMA 1D2EA 2RGYA 1UFRA 3LI2A 3E2PA 3ZU3A 3ICVA 4N5NA 2V6JA 5BXYA 3KOXE 2LTAA 4GDFA 1VJTA 3WDMA 4MUIA 5AVUA 3ZGXA 3MPUA 4K05A 3AEUA 1X87A 4CF5A 3ZDFA 1U0GA 5AW7A 1C4OA 4RDIA 4GRAA 5HQ3B 2BFCB 4JU9A 2J4CA 5FD8A 4N65A 3AJEA 4LBVA 1JDBC 4PCZA 4PYLA 2EKBA 1K6MA 2FQ1A 3H5WA 1LW7A 2JJ2D 2DAMA 2WWVD 1GTG1 1WCIB 3I2IA 2HHLA 2EATA 4GF5A 3PCRB 1EDEA 3OZWA 4G25A 1P3QQ 4IH1A 3FUCA 4BFLA 3IAXA 1VPLA 4NE2A 5DCWA 5JCXA 3R1IA 1V8DA 5JJCA 4R7GA 4EITA 2VBIA 1NURA 4QWWA 2NAPA 5FI1B 1X7DA 3R6DA 2JJMA 1UC4B 2HV8A 3HXOA 3FNQA 2OOSA 3NVMB 1H8HA 4HLQA 1PV2A 1XQWA 1HEUA 1W5SA 3J81k 4JUIA 4C20A 3AFOA 3BL5A 1O95D 2W6NA 1B8NA 3BILA 3HXTA 1HNWM 4BGVA 1RVV1 3WGHA 3SOZA 5EKSA 3L8YA 1Q20A 4ND3A 1UF9A 4K2AA 3UAVA 2VJBA 2OMEA 4Z2AA 2DZLA 2HJ9A 5JTUA 4NI5A 3KJEA 1XNGA 4KE9A 4QOJA 4DCNA 2FNAA 3DO5A 3E8MA 2D1QA 1GPDG 2DAGA 3G9XA 3TRDA 3Q8WA 3GGJA 3EQZA 3N0VA 1EK6A 4M0DA 2XSZA 4IUBS 4ENQA 1M6WA 1TTTA 1ID1A 3OFNA 1II9A 4D79A 1E3EA 4KPFC 1WEKA 4RJIA 1T36A 1OF1A 3ZLVA 3WG9A 1G16A 4CEJA 3A26A 3CX8A 2X14A 3D8UA 2FN8A 4IOLA 5K0ZA 1ZMBA 5E1OA 1JJBA 1N1EA 1RYNA 3OO0A 3K0CC 4HYQA 1PAUA 3G6KA 2IL1A 3VAYA 1OAOC 3OLYA 3HV2A 1PX0A 2HMUA 1J07A 5KINB 3QHPA 4PY2A 4B5LA 1Q3HA 3W06A 3RVSA 3ITDA 1TH4A 4JOCA 3SJZA 4ZXFA 2JI8A 2E1PA 1TZMA 1LI4A 3ACCA 3A1VA 1UKZA 3EWIA 4DZZA 2OGSA 4XQGA 1MRZA 2X0EA 1R6BX 2JCGA 4BO9A 2CRUA 2AMLA 4B34A 3D02A 5A06A 4H4DA 4ETWA 4KPUB 2HCRA 2HUNA 2VDKB 3WX0A 1Y3HA 3F8TA 1G4AE 4LEIA 1ULSA 4FCCA 3DE1X 2X9VA 1TO1E 1W4BA 3GEMA 4FVMA 2UUCM 1FJGM 2GBLC 2YVKA 4LJRA 1L4BA 3QBJA 1FEZA 1VDMA 4KN5A 1Z7EA 4ND4A 3A46A 2R9VA 1DARA 2OWDA 3K73O 2PRSA 1VYTA 1FQKA 2YV1A 4N8EA 3HDQA 4UHBA 5LB4A 3H9EO 4NOLA 2P6PA 3V8VA 3ZY5A 5ITXE 5IDYA 3VKWA 2OQ4A 2J46A 4BAGA 3SXUB 1VL6A 1A88A 3WP0A 4BTVA 2ERYA 3D3QA 5FWNA 3AI1A 4C08A 2IE8A 1R4MB 1XAIA 1D04A 1Y6QA 4C4SA 2GEVA 3LPAA 3T5AA 5AVQA 2GHQA 4R01A 1Y3AA 4KB5A 3ZWCA 5IULC 4BDTA 3F74A 4JC0A 5JXIA 4MQ5A 2ATVA 4NCIA 1P1CA 3COPA 4DE5A 3DZIA 5CM8B 1BD3A 2ZJ6A 4DLBA 4FT2A 5JJKA 3WGLA 1DQSA 2MJ5B 3TTTA 4KXLA 2GEUA 3KOUA 2CXUA 4QUKA 1CF9A 4ZO6A 3TLYA 4KCGA 5CIWA 4RV9A 5LZ8A 1UQRA 4ITQA 2YJ4A 3U4AA 2OKCA 5MGNA 1J1ZA 1E2QA 4H16A 3ZBTA 3IODA 4PANA 3EXAA 2O0MA 3SMQA 4XPZA 3NBUA 1OAKA 1CVIA 4FGZA 3R77A 4B4WA 2AFIB 1JXQA 4YHHB 4DV2M 1QMPA 1IHOA 4OJMX 1K86A 3PXGA 1RMYA 1IY0A 4JITA 3RFFA 3W7VA 3A98B 1R10A 1CJSA 2R2AA 1KY3A 2B1JA 1E7YA 2R6R1 2PVCA 1D8TA 3KZNA 4R8MA 4TN5A 2BFMA 1RJ9A 4X3CA 1XZQA 1Z5PA 4LWOA 2F5OA 1I4TD 5A0FA 4TMYA 5J47A 2GM3A 4RCZA 2V7PA 3VO2A 4LWQA 5CBPB 1U5CA 4A1OA 3VNRA 4HQNA 3NW9A 3GRRA 1BYIA 1ZUIA 3LRTA 5TDHA 4HATA 4Y6SA 1Q1QA 2QRQA 4BZQA 3RGSA 1MUUA 5CH8A 4G4SO 2I76A 3U7JA 5C35A 2ODTX 1DZIA 5CDTA 1EXVA 4AG5A 4KQJA 2JLRA 2HLPA 4LBWA 1NMZA 2XVAA 4F6CA 1HQKA 4IX9A 2QIOA 3K31A 4FOPA 3IQEA 3C3PA 1U04A 4JUCA 2CBXA 1I1HA 1FRZA 3U81A 4LJ5A 1AX9A 5JFOA 4OKNA 1Z0UA 3QEOA 1L1FA 3I0ZA 1GZ4A 2FSIA 3A1DA 4TVOA 3FJOA 3UHJA 1B1AA 1CZKA 1H66A 3SC4A 1SC6A 3GT0A 4QEKA 1MG0A 2QM8A 3L06A 3ANNA 3T1OA 1ENOA 3PFWO 3LKVA 3P2JA 1D2HA 5CA0F 4MR9A 4EK9A 2QZZA 2A9PA 1A0OA 2X7XA 2JFYA 3PC7A 1MMFB 1W96A 3C7AA 2UV8A 1S8NA 4IWYA 2O2HA 2AFHE 3O5AA 1C41A 3ZHOA 4I2VA 4R2MA 4X65M 421PA 1KSHA 2X86A 3H1EA 4Y2YA 3PA8A 1UBSB 2AKEA 3IG5A 2G9NA 5JADA 3HYCA 1UC8A 3WSTA 4PGAA 3UM9A 5K0LA 4QATA 1QTRA 1V5EA 4QNRA 2H0RA 2W8ZA 2EUCA 1E2GA 4PLTA 5C53B 2QTGA 3MMNA 1VRCA 3DKIA 1GPYA 5BV8A 4K1LA 3PQ8A 5F1OA 3W5IA 1L5YA 4WN9B 2RAVA 4B8YA 3DQQA 3S8YA 3FYDA 2NXCA 3DBRA 2CKDA 4PO8A 2V7QA 2F7SA 1YL5A 2H0QA 1GABA 4DL9A 4F96A 1MXFA 1K8ZB 4RS3A 1JE0A 1Y3FE 3LWDA 5HIIA 4U7JA 3OTQA 3L0IB 5KDOA 3IP7A 4PHGA 1XTIA 2QAGC 3O94A 2NSDA 1OJLA 2Z4SA 3QKIA 3GO8A 4Y2XA 2M6RA 2OVBA 2O1XA 4AJHA 5K6AA 4Q9LA 3PNKA 5DHFA 5HOEA 4YT4A 1VB5A 3D7LA 1RBYA 3UV3A 2UYQA 4BATA 2CDBA 3PZBA 4OHRA 4OHPA 1LU9A 3FMPB 5F21A 2PKQO 1IYZA 721PA 4X45A 3HKBB 2E37A 4DBLC 3TSCA 5LB2A 4YRSA 3GARA 4G81A 3QU9A 1COZA 5DNCA 1M0TA 3CLTD 2F59A 4NOOB 5C4IA 2FPIA 2P11A 4YR7A 2WW8A 1AUAA 4HGPA 3BGOS 4EFMA 1WSBA 4MIEA 5LZ5A 4EY6A 4E94A 2LR0A 4O4IB 2QW1A 3SEQA 4PZAA 2FA9A 2JG3A 1WW2A 1QVWA 4YHBA 1FMLA 1L2BA 3HFRA 2VDQB 4RWZA 3E4RA 4NAUA 3IOYA 1FZQA 4KP7A 4L72A 3GUYA 3DD1A 3AQ4A 4P4GA 3PKZA 5HQ3A 5LZ4A 3DF7A 2BFCA 1YJQA 2NYUA 4P3YA 4IUDS 4C7XA 1F4LA 5ALPA 4I55F 4MUHA 1CUGA 2PKYX 1NF9A 4MUXA 1AJEA 1VE3A 4ZCLA 1WCIA 5KHAA 3FYUA 2RJOA 4AW9A 4P9NA 5KTKA 1O08A 1L5KA 2OGTA 1RYBA 3PXUA 2YYAA 3PC3A 3MMXA 2BI7A 2Q4EA 3IMGA 1IB0A 4YRTA 1EBUA 1XZNA 2DUJA 2JFQA 1GPWB 1Y8RA 1YCFA 1DL5A 2ECPA 1Z6TA 3AJAA 3PJEA 1H9CA 4YI3A 1ML4A 2Q6LA 5DF1A 3R0QA 4QTXA 1YMUA 1Q0UA 1PLJA 4Q47A 2Z8XA 1SXJB 1TUIA 5JS1A 3HGIA 3RSSA 4K9RA 1S1CA 4F5EA 3DBLA 4IVPA 2HMAA 4JNKA 1DC6A 2XW6A 2X0FA 3EFEA 4PBTA 3LBNA 2A3NA 2ZYAA 4F9FA 4XIGS 1QV7A 2BMAA 1X7WB 5BNWA 1UKYA 4BP9A 1TCVA 5I9TA 1OCEA 2XYGA 5JMWA 4B40A 1Y5NA 4MVJI 1FTSA 1FX0B 3MSXA 1G7TA 5IBCA 1MOSA 4XLTA 3GD5A 2NXJA 2AQ8A 2YINC 4HK4A 2AOTB 2Q62A 3EQ7A 3K94A 3U60A