1Q02A

Nmr structure of the uba domain of p62 (sqstm1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords sequestosome 1
publication title Structure of the Ubiquitin-associated Domain of p62 (SQSTM1) and Implications for Mutations That Cause Paget's Disease of Bone
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2003-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1q02A00
2JY6B 3F92A 2DAEA 2JY7A 2RRUA 2BWEA 2QHOB 2JUJA 2L4FA 2JNHA 4UN2B 4GEWA 1Q02A 1QZEA 1VEGA 3GLGE 3FRIA 4HEOA 1VQ1A 1WR1B 1V92A 4R71A 2B3TA 2EKKA 4G3OA 2DENA 4DBGB 1ZV1A 2L2DA 1T6OA 2JY8A 1F4IA 1KYIA 3MMPA 3K9PA 2QNJA 1HT2E 3FE3A 1JR3E 3IECA 1VG5A 2H5XA 1WJ7A 2KHHA 1TR8A 3B89A 1GO5A 1OTRA 3BBZA 1TTEA 2DAMA 1DO2A 2MJ5B 1IFYA 3IHPA 2DHYA 1WGLA 2KNAA 2LTUA 2OO9A 1R4GA 2CWBA 2ZTCA 1VEKA 2K0BX 3T6PA 3FRHA 1DV0A 1ZMVA 1VDLA 1DO0A 1OKSA 1AIPC 2KNZA 1HJPA 3K9OA 4Q7JA 1G3IA 1VEJA 2KNVA 2K9DA 2R0IA 2CP8A 2LVOC 2LVQD 5JI2E 2JP7A 1XB2B 2L4EA 1WGNA 2DZLA 1HQYE 1XXHE 4F1IA 2DAIA 1ZMWA 2HWJA 1IM2A 3LCUA 1WIVA 1IXSA 1UFZA 1CUKA 1P3QQ 2LVNC 4WP2A 2QSFX 2LVPC 2EKFA 2OOBA 2DAGA 1WHCA 2LVAA 5DFLA 2DI0A 1BVSA 3GLHE 1SG9A 1NV9A 2G3QA 2HAKA 1OQYA 3GLFE 2DKLA 3E21A 1T43A 2MGWA 2EJSA 4F2LA 2JY5A 1ZMUA 1Y8GA 1HT1E 2BWBA 1PGYA 2DAKA 2DNAA 1EFUB 3GLIE 1G41A 2ZTDA 1MN3A 1A5TA 2MROB 1OAIA 3H4JA 2JZ1A 2OOAA 1E94E 1C7YA 2JZ0A 3E46A 3LCVB 1NV8A 1G4AE 2WZJA 2LBCA 2MR9A 2O25A 1YLAA
chains in the Genus database with same CATH superfamily
2L7IA 2R62A 4S12A 3ZQJA 3J7AS 2DAEA 1TGUA 1DGHB 1YSYA 2C98A 2CHQA 3J2PB 3KSJA 2QBYB 4UN2B 3GPPA 3SASA 3GLFB 3GLGE 1Q02A 1QZEA 4G4RA 2HKJA 1DGFA 4GKKM 2FS1A 3J7BA 3KDSE 1IN8A 4QHTA 2J5YA 4X65M 4DV4M 4M9ZA 3KOYE 3AOGA 1ZV1A 4DBGB 2D7EA 3JAMS 2Y0TA 1R5LA 2LHCA 3TPZA 1IBLM 1N32M 4LG2A 1TH2A 2W82A 1SXJA 4IBCA 1NJFA 4QOSA 2G5GX 1JR3D 3K9PA 4LRSA 3U6CA 1DGHA 1Z6TA 2QBYA 4JN6A 1G71A 3I4VA 3GLFA 4DR6M 3B7QA 1L2BA 2FFJA 3IECA 5C18A 5KQ8A 2H5XA 3E9SA 1MX0A 1D0KA 1MJGM 2KDLA 2KHHA 3LQQA 3VKGA 1GL6A 2KZUA 2KXEA 3B89A 2CEAA 4DV3M 4DUZM 2A5YB 3UZUA 1TTEA 2QP9X 4LRTA 3R8FA 2MH8A 4IBDA 2OPFA 2MJ5B 2ZBKB 1DGBA 4LJ6A 1L2CA 1IFYA 4QNMA 2KEBA 1WGLA 2LNHC 4BLCA 1IQPA 2KNAA 4LGYA 4DR7M 2K6BA 3K1JA 3LMMA 1K3WA 1R4GA 4NXNM 2CWBA 1J09A 2ZANA 4PDIA 3A42A 1SXJD 4LF7M 3SYLA 1DO0A 1PJQA 2O01F 1HJPA 3FTCA 3KS4A 2V1CA 3K9OA 4II7A 3SARA 2DWLA 4B3TM 2CE7A 2K9DA 2XSZA 1IN7A 2LVQD 3SHGB 3W67A 3AKZA 3PNYA 4FVMA 3M0EA 3TE6A 3GRVA 2JP7A 1K82A 4AZFA 3I04M 3L27A 1V34A 1WGNA 1TF0B 3L29A 4MGHA 2Z8YM 1TDZA 2KZSA 2XF3A 2BJWA 2DAIA 3FKEA 2R46A 1ZMWA 3ZH9B 1ZQ9A 2JWSA 1IY2A 3TWKA 2UU9M 4L16A 5ITYA 5FTNA 3HHWA 1WIVA 2C96A 8CATA 3AV0A 2FH0A 2VDBB 1QVRA 1UFZA 2XGNA 4IBGA 3UK6A 1CUKA 1S3SA 2ZM6M 4GC9A 1IXZA 4WP2A 3SBJA 2LVPC 2OOBA 3CGWA 1W5SA 2Y21A 3VFDA 2AHMA 2R44A 3B9PA 3AOEA 2L6OA 3U5ZB 1BVSA 3GLHE 3Q8XA 4KLNA 3T15A 3E4RA 3W0FA 4B3SM 1TH3A 2HAKA 4CISA 1OQYA 2DHRA 2VIIA 1T3TA 4LJ7A 4OX9M 2EJSA 1YE9A 3HU3A 4AQYM 3HWSA 2BWBA 4L4UA 2Q2EB 1PGYA 4FWHA 2YQZA 4AKHA 5LMNM 3D8BA 1EFUB 3VK7A 2CV1A 3VDPA 3UJNA 2DZNB 1OAIA 5E6JA 2Z4SA 2YFQA 4KODA 3L28A 3SC3A 3U5ZA 1PJSA 2JZ1A 1PJIA 4BB9A 5ITXA 2QENA 2RKOA 4IIWA 4LFCM 1IY1A 2JZ0A 1QYRA 3E46A 3V76A 4W5WA 5EP3A 4LJAA 1KFVA 2F5NA 1IN4A 1IY0A 1QAMA 2MR9A 3W0LB 2O5RA 4MGIE 5C1BA 1PRBA 3Q8GA 3F92A 3VLFB 2F5OA 1GJSA 3GQ3A 3JR5A 2R18A 4K0KM 4GHLA 3W68A 2JY7A 5KQDA 4JI1M 2G8LA 2QHOB 2WSEF 3L2AA 3QAUA 5IREB 3TWLA 4DUYM 4GEWA 3GRYA 3HHYA 4R71A 1V92A 2V6ZM 2B3TA 2DXIA 4LF8M 3LVWA 4DR2M 3C3DA 7CATA 2DENA 5JI3E 3KXEC 3TWMA 1GKIA 4PCZA 1N77A 3HX3A 5IZ7D 1H6UA 1T6OA 2JY8A 4YHHM 4DV6M 4OW0A 1NJGA 1KYIA 4GH9A 4IJEA 1C1KA 2X49A 3HU2A 3MMPA 4R7GA 1HT2E 3FE3A 4LGMA 1NNUC 1JR3E 3K2LA 2L09A 1N75A 3QWLA 4IBJA 3FYDA 3FUTA 5EP4A 1NO1A 3BBZA 5KPZA 3SAVA 4DV0M 1YUBA 2EO2A 2J7NA 3HU1A 1IBMM 2QPAA 2DHYA 3VKHA 1JQJC 3AOEC 2GNOA 4XBOA 3KFUG 3PNVA 4CJ6A 4ANRA 3SMSA 4TUWA 2ZTCA 2APLA 1VEKA 5DNYA 4D82A 3FRHA 3GPYA 1FJGM 3DFZA 4REZA 1SXJE 1R6BX 1AIPC 1RU3A 4ZPXA 4Q7JA 4X64M 4NRVA 2ZAOA 5FTJA 3BOSA 2NQ8C 3DZDA 2LVOC 2QZ4A 3FTDA 5JI2E 1K3XA 3CF0A 1JB0F 4B3MM 2M60A 3HZJA 1I94M 2CRUA 3CF6E 4IBBA 3KP1E 1XXHE 4JYAM 4F1IA 2X4AA 4LCBA 1TDHA 1W5TA 3KVWA 3U60B 4G4QA 3MK6A 1NSFA 3RGSA 1P3QQ 2LVNC 1HNXM 1VDDA 1Z59A 2EUCA 3H4MA 3J80S 2EKFA 2Z4RA 1G59A 2DAGA 3KOWE 3HGIA 1WHCA 1PM5A 4L78A 1QANA 3OTOM 3FUXA 4L15A 4ITQA 4RF0A 3SAUA 5IT9S 1L8QA 4LJ9A 4P17A 4X62M 2XZFA 2J7OA 3KW6A 3E21A 1NVMA 4CIZA 2ZAMA 3GQ5A 3U60A 2JY5A 5E26A 2DAKA 2DNAA 1NY6A 2Y20A 4BBAA 1OFIA 1J7KA 3GO8A 3KOXE 3UMMA 2WSCF 2ZTDA 3EIEA 2MROB 1NHGC 1XNQM 3FUWA 1Q3BA 2LHGA 3H4JA 5A2QS 1NNJA 2OOAA 3IG5A 4M9XA 3RGPA 4LF5M 2EA0A 3FUUA 2YR0A 2XEPA 3VK8A 4MGYE 4B08A 1UM8A 2P5TA 5FSWA 1G4AE 4B3RM 2Z7JA 1X37A 1D0LA 1YLAA 2JY6B 2RGHA 3LW5F 2XSZD 1PJTA 3GRUA 4IBFA 1OFHA 2UUBM 3AL0C 3QYBA 3T38A 2KRKA 2RRUA 2BWEA 5EP1A 2JNHA 3SYKA 5LMUM 2M5ZA 5EXXA 1VEGA 4XGIA 5BR8M 1ORYB 4HEOA 4LF6M 2H1RA 1IN6A 1IN5A 4PDGA 3I01M 2R4JA 4FWGA 1WXQA 2LXEA 4G3OA 4MM3B 4RNAA 3THGA 2CHVA 3KS8A 4I5SA 1GL7A 4JI8M 2VQFM 3TL4X 4DR5M 2FNAA 4AI6A 4FCTA 4HLQA 1EIJA 4M0DA 4JI7M 3SAWA 3KP0E 3FYCA 4IBIA 5ITXE 4AG5A 4GIPA 4WURA 4JI0M 4KT0F 3VDUA 2V1UA 4P16A 3K92A 4FCVA 3HY5A 2I7NA 1EE8A 1WJ7A 3LQRA 2F5SA 3BXWA 3GQ4A 3HHXA 3WHLA 1TR8A 5FTLA 3A98B 5KPTA 2RGOA 1GO5A 3B7ZA 2DWNA 3SATA 1QZMA 3C3EA 1DO2A 3U6QA 4NL4H 3IG8A 3SHFA 3IHPA 4DV7M 1HNWM 3FUVA 2UXBM 2HCBA 4GMQA 4GITA 2LTUA 4D81A 1L1ZA 2OO9A 2KA6B 3ZCBB 2DVWB 3GLIB 3T6PA 4JI6M 4LJ5A 1DV0A 3C9PA 1ZMVA 3U6MA 1VDLA 1OIPA 2Y0QA 3AFHA 1OKSA 5BPVA 2XLJA 4JI4M 3GRRA 1L2DA 4JI5M 1TH4A 1G3IA 4LF4M 1IXSB 3U6LA 2CP8A 1XC8A 3WHKA 3A45A 3DOAA 4MH0E 3GPUA 2R4EA 3U61B 2DZLA 3GLIA 2CV0A 2QCUA 2VF8A 3AJIB 1J5EM 2KRUA 2VF7A 2E5LM 4MB7A 2HWJA 3GLGB 4DR3M 3EIHA 2UUCM 4AKIA 1HNZM 1IXSA 3U6EA 3A46A 3NBIA 4R3DA 4FWDA 1ZAEA 1XMOM 1JR3A 1IXRC 3HJ8A 4NXMM 2QQ8A 2FOIC 4NRWA 3HJSA 2LVAA 4FW9A 3U61A 1QDTA 2F5QA 3HHZA 2DI0A 3KOZE 3MHVC 1SXJB 4LFAM 1NHWC 1SG9A 3C58A 2F5PA 4AG6A 3GLGA 3GLFE 3FTEA 4DR1M 2LH0A 2BJVA 5EXTA 1E9RA 1T43A 2MGWA 2XH9A 2I7PA 4F2LA 1MU5A 1Y8GA 1ZMUA 1HT1E 4LY6A 4IBKA 1QDRA 2DWMA 3CF2A 1XHBA 4NC6A 4IJFA 5KO3A 3L25A 1QUSA 3UGJA 1OAOC 1XXHB 1G41A 5EXPA 4G6ZA 2C5RA 2DWZB 1A5TA 3B74A 4B7FA 5F3WA 1D2NA 1Z5AA 3M7GA 1E94E 4CHTB 3B7NA 4QNRA 4CGYB 3HKPA 4GKJM 2X8AA 4KO8A 3LCVB 2CFOA 3HJQA 3PFIA 4DV5M 3TQSA 4I4LA 4G4OA 2YNMD 3I51A 4XK8F 4L8RC 2C9CA 2WZJA 2FE8A 4GHAA 1Q3CA 3PVSA 1R2ZA 2O25A 4FCWA 4EIWA 3J81S 2LWXA 2ERCA 1XMQM 1N36M 1GVNA 1XXHA 4M9SA 4A3VB 4Z8XA 3L26A 1QAQA 1OIZA 2JUJA 2L4FA 4NSOB 5DYGA 4B7HA 3FRIA 1VQ1A 1WR1B 4YY3M 2EKKA 1L1TA 4OVZB 5ITUA 2D7HA 2L2DA 5EJCA 3T1HM 3LVVA 1AUAA 1IBKM 4JV5M 1F4IA 1V33A 2C9OA 1QUTA 3MJ5A 2QNJA 4JXJA 1NY5A 2VQEM 3I4YA 5FLXS 2BNKA 3GP1A 5ITQA 1GLNA 1VG5A 3U6DA 1FNNA 1LV7A 4LZZA 3U6OA 3SFZA 4KHPM 4OVZA 5ITTA 1OTRA 3GLHB 4B7GA 2DAMA 1G8PA 2OQ4A 4NSRA 4Z6YA 4LZJA 4X66M 4LF9M 3D8LA 4D80A 4G4NA 2L7HA 4PT5A 2R65A 4LJ8A 2KW0A 3FTFA 4HL4A 4MGKE 1LTMA 4RF1A 3KSXA 4I8OA 3PXGA 2K0BX 4GRIA 2HHHM 2CV2A 4OU7A 2XFTA 5KPRA 2K47A 3ILKA 1HQCA 3GLHA 4PD2A 2C99A 2KNZA 5FTMA 3K8ZA 3FD9A 2N35A 1VEJA 4WW0A 2GQFA 2KNVA 3RE8A 5EQTA 2R0IA 3RFWA 4QHSA 4GC5A 1SXJC 4AKGA 3T1YM 1R7RA 2R6FA 1XB2B 3NWLA 2L4EA 4LJ4A 3SMPA 3U6PA 5IWAM 3J27B 1HQYE 2Z3XA 4JI2M 2F4VM 2UUAM 2CUZA 4FD2A 1IM2A 1D0MA 5FTKA 2D7GA 3LCUA 1N78A 1QAOA 2XZUA 5GKNA 1R2YA 4IBEA 1OJLA 2DZOB 1E9SA 2QSFX 2HL7A 5DFLA 4DV1M 2UXCM 1KSFX 4I81A 3U6SA 3DA1A 1NV9A 2G3QA 3M6AA 1GABA 2XFSA 3NBXX 4L6V6 2DKLA 1XNRM 3GPXA 1PJJA 4AW4A 1N33M 1Q39A 5H37D 5DYIA 4MGZE 5EXSA 4JI3M 5ITRA 2R45A 1QQWA 1GJTA 3GLIE 3ZC7B 2JXNA 3CTWB 4M0WA 1MN3A 4Y28F 4DR4M 3R9XB 1N34M 1XWIA 1Z5BA 4DV2M 2WSFF 4QOZC 1C7YA 5L8RF 1DGGA 3JR4A 2UXDM 2CHGA 2JA2A 4LFBM 4NOOB 1E32A 1NV8A 1Z5CA 1I4WA 3QYEA 2LBCA 4RKUF 1HR0M 5EP2A
chains in the Genus database with same CATH topology
2JY6B 3F92A 2DAEA 2JY7A 2RRUA 2BWEA 2QHOB 2JUJA 2L4FA 2JNHA 4UN2B 4GEWA 1Q02A 1QZEA 1VEGA 3GLGE 3FRIA 4HEOA 1VQ1A 1WR1B 1V92A 4R71A 2B3TA 2EKKA 4G3OA 2DENA 4DBGB 1ZV1A 2L2DA 1T6OA 2JY8A 1F4IA 1KYIA 3MMPA 3K9PA 2QNJA 1HT2E 3FE3A 1JR3E 3IECA 1VG5A 2H5XA 1WJ7A 2KHHA 1TR8A 3B89A 1GO5A 1OTRA 3BBZA 1TTEA 2DAMA 1DO2A 2MJ5B 1IFYA 3IHPA 2DHYA 1WGLA 2KNAA 2LTUA 2OO9A 1R4GA 2CWBA 2ZTCA 1VEKA 2K0BX 3T6PA 3FRHA 1DV0A 1ZMVA 1VDLA 1DO0A 1OKSA 1AIPC 2KNZA 1HJPA 3K9OA 4Q7JA 1G3IA 1VEJA 2KNVA 2K9DA 2R0IA 2CP8A 2LVOC 2LVQD 5JI2E 2JP7A 1XB2B 2L4EA 1WGNA 2DZLA 1HQYE 1XXHE 4F1IA 2DAIA 1ZMWA 2HWJA 1IM2A 3LCUA 1WIVA 1IXSA 1UFZA 1CUKA 1P3QQ 2LVNC 4WP2A 2QSFX 2LVPC 2EKFA 2OOBA 2DAGA 1WHCA 2LVAA 5DFLA 2DI0A 1BVSA 3GLHE 1SG9A 1NV9A 2G3QA 2HAKA 1OQYA 3GLFE 2DKLA 3E21A 1T43A 2MGWA 2EJSA 4F2LA 2JY5A 1ZMUA 1Y8GA 1HT1E 2BWBA 1PGYA 2DAKA 2DNAA 1EFUB 3GLIE 1G41A 2ZTDA 1MN3A 1A5TA 2MROB 1OAIA 3H4JA 2JZ1A 2OOAA 1E94E 1C7YA 2JZ0A 3E46A 3LCVB 1NV8A 1G4AE 2WZJA 2LBCA 2MR9A 2O25A 1YLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY6 B;  3F92 A;  2DAE A;  2JY7 A;  2RRU A;  2BWE A;  2QHO B;  2JUJ A;  2L4F A;  2JNH A;  4UN2 B;  4GEW A;  1Q02 A;  1QZE A;  1VEG A;  3GLG E;  3FRI A;  4HEO A;  1VQ1 A;  1WR1 B;  1V92 A;  4R71 A;  2B3T A;  2EKK A;  4G3O A;  2DEN A;  4DBG B;  1ZV1 A;  2L2D A;  1T6O A;  2JY8 A;  1F4I A;  1KYI A;  3MMP A;  3K9P A;  2QNJ A;  1HT2 E;  3FE3 A;  1JR3 E;  3IEC A;  1VG5 A;  2H5X A;  1WJ7 A;  2KHH A;  1TR8 A;  3B89 A;  1GO5 A;  1OTR A;  3BBZ A;  1TTE A;  2DAM A;  1DO2 A;  2MJ5 B;  1IFY A;  3IHP A;  2DHY A;  1WGL A;  2KNA A;  2LTU A;  2OO9 A;  1R4G A;  2CWB A;  2ZTC A;  1VEK A;  2K0B X;  3T6P A;  3FRH A;  1DV0 A;  1ZMV A;  1VDL A;  1DO0 A;  1OKS A;  1AIP C;  2KNZ A;  1HJP A;  3K9O A;  4Q7J A;  1G3I A;  1VEJ A;  2KNV A;  2K9D A;  2R0I A;  2CP8 A;  2LVO C;  2LVQ D;  5JI2 E;  2JP7 A;  1XB2 B;  2L4E A;  1WGN A;  2DZL A;  1HQY E;  1XXH E;  4F1I A;  2DAI A;  1ZMW A;  2HWJ A;  1IM2 A;  3LCU A;  1WIV A;  1IXS A;  1UFZ A;  1CUK A;  1P3Q Q;  2LVN C;  4WP2 A;  2QSF X;  2LVP C;  2EKF A;  2OOB A;  2DAG A;  1WHC A;  2LVA A;  5DFL A;  2DI0 A;  1BVS A;  3GLH E;  1SG9 A;  1NV9 A;  2G3Q A;  2HAK A;  1OQY A;  3GLF E;  2DKL A;  3E21 A;  1T43 A;  2MGW A;  2EJS A;  4F2L A;  2JY5 A;  1ZMU A;  1Y8G A;  1HT1 E;  2BWB A;  1PGY A;  2DAK A;  2DNA A;  1EFU B;  3GLI E;  1G41 A;  2ZTD A;  1MN3 A;  1A5T A;  2MRO B;  1OAI A;  3H4J A;  2JZ1 A;  2OOA A;  1E94 E;  1C7Y A;  2JZ0 A;  3E46 A;  3LCV B;  1NV8 A;  1G4A E;  2WZJ A;  2LBC A;  2MR9 A;  2O25 A;  1YLA A; 
#chains in the Genus database with same CATH topology
 2L7I A;  2R62 A;  4S12 A;  3ZQJ A;  3J7A S;  2DAE A;  1TGU A;  1DGH B;  1YSY A;  2C98 A;  2CHQ A;  3J2P B;  3KSJ A;  2QBY B;  4UN2 B;  3GPP A;  3SAS A;  3GLF B;  3GLG E;  1Q02 A;  1QZE A;  4G4R A;  2HKJ A;  1DGF A;  4GKK M;  2FS1 A;  3J7B A;  3KDS E;  1IN8 A;  4QHT A;  2J5Y A;  4X65 M;  4DV4 M;  4M9Z A;  3KOY E;  3AOG A;  1ZV1 A;  4DBG B;  2D7E A;  3JAM S;  2Y0T A;  1R5L A;  2LHC A;  3TPZ A;  1IBL M;  1N32 M;  4LG2 A;  1TH2 A;  2W82 A;  1SXJ A;  4IBC A;  1NJF A;  4QOS A;  2G5G X;  1JR3 D;  3K9P A;  4LRS A;  3U6C A;  1DGH A;  1Z6T A;  2QBY A;  4JN6 A;  1G71 A;  3I4V A;  3GLF A;  4DR6 M;  3B7Q A;  1L2B A;  2FFJ A;  3IEC A;  5C18 A;  5KQ8 A;  2H5X A;  3E9S A;  1MX0 A;  1D0K A;  1MJG M;  2KDL A;  2KHH A;  3LQQ A;  3VKG A;  1GL6 A;  2KZU A;  2KXE A;  3B89 A;  2CEA A;  4DV3 M;  4DUZ M;  2A5Y B;  3UZU A;  1TTE A;  2QP9 X;  4LRT A;  3R8F A;  2MH8 A;  4IBD A;  2OPF A;  2MJ5 B;  2ZBK B;  1DGB A;  4LJ6 A;  1L2C A;  1IFY A;  4QNM A;  2KEB A;  1WGL A;  2LNH C;  4BLC A;  1IQP A;  2KNA A;  4LGY A;  4DR7 M;  2K6B A;  3K1J A;  3LMM A;  1K3W A;  1R4G A;  4NXN M;  2CWB A;  1J09 A;  2ZAN A;  4PDI A;  3A42 A;  1SXJ D;  4LF7 M;  3SYL A;  1DO0 A;  1PJQ A;  2O01 F;  1HJP A;  3FTC A;  3KS4 A;  2V1C A;  3K9O A;  4II7 A;  3SAR A;  2DWL A;  4B3T M;  2CE7 A;  2K9D A;  2XSZ A;  1IN7 A;  2LVQ D;  3SHG B;  3W67 A;  3AKZ A;  3PNY A;  4FVM A;  3M0E A;  3TE6 A;  3GRV A;  2JP7 A;  1K82 A;  4AZF A;  3I04 M;  3L27 A;  1V34 A;  1WGN A;  1TF0 B;  3L29 A;  4MGH A;  2Z8Y M;  1TDZ A;  2KZS A;  2XF3 A;  2BJW A;  2DAI A;  3FKE A;  2R46 A;  1ZMW A;  3ZH9 B;  1ZQ9 A;  2JWS A;  1IY2 A;  3TWK A;  2UU9 M;  4L16 A;  5ITY A;  5FTN A;  3HHW A;  1WIV A;  2C96 A;  8CAT A;  3AV0 A;  2FH0 A;  2VDB B;  1QVR A;  1UFZ A;  2XGN A;  4IBG A;  3UK6 A;  1CUK A;  1S3S A;  2ZM6 M;  4GC9 A;  1IXZ A;  4WP2 A;  3SBJ A;  2LVP C;  2OOB A;  3CGW A;  1W5S A;  2Y21 A;  3VFD A;  2AHM A;  2R44 A;  3B9P A;  3AOE A;  2L6O A;  3U5Z B;  1BVS A;  3GLH E;  3Q8X A;  4KLN A;  3T15 A;  3E4R A;  3W0F A;  4B3S M;  1TH3 A;  2HAK A;  4CIS A;  1OQY A;  2DHR A;  2VII A;  1T3T A;  4LJ7 A;  4OX9 M;  2EJS A;  1YE9 A;  3HU3 A;  4AQY M;  3HWS A;  2BWB A;  4L4U A;  2Q2E B;  1PGY A;  4FWH A;  2YQZ A;  4AKH A;  5LMN M;  3D8B A;  1EFU B;  3VK7 A;  2CV1 A;  3VDP A;  3UJN A;  2DZN B;  1OAI A;  5E6J A;  2Z4S A;  2YFQ A;  4KOD A;  3L28 A;  3SC3 A;  3U5Z A;  1PJS A;  2JZ1 A;  1PJI A;  4BB9 A;  5ITX A;  2QEN A;  2RKO A;  4IIW A;  4LFC M;  1IY1 A;  2JZ0 A;  1QYR A;  3E46 A;  3V76 A;  4W5W A;  5EP3 A;  4LJA A;  1KFV A;  2F5N A;  1IN4 A;  1IY0 A;  1QAM A;  2MR9 A;  3W0L B;  2O5R A;  4MGI E;  5C1B A;  1PRB A;  3Q8G A;  3F92 A;  3VLF B;  2F5O A;  1GJS A;  3GQ3 A;  3JR5 A;  2R18 A;  4K0K M;  4GHL A;  3W68 A;  2JY7 A;  5KQD A;  4JI1 M;  2G8L A;  2QHO B;  2WSE F;  3L2A A;  3QAU A;  5IRE B;  3TWL A;  4DUY M;  4GEW A;  3GRY A;  3HHY A;  4R71 A;  1V92 A;  2V6Z M;  2B3T A;  2DXI A;  4LF8 M;  3LVW A;  4DR2 M;  3C3D A;  7CAT A;  2DEN A;  5JI3 E;  3KXE C;  3TWM A;  1GKI A;  4PCZ A;  1N77 A;  3HX3 A;  5IZ7 D;  1H6U A;  1T6O A;  2JY8 A;  4YHH M;  4DV6 M;  4OW0 A;  1NJG A;  1KYI A;  4GH9 A;  4IJE A;  1C1K A;  2X49 A;  3HU2 A;  3MMP A;  4R7G A;  1HT2 E;  3FE3 A;  4LGM A;  1NNU C;  1JR3 E;  3K2L A;  2L09 A;  1N75 A;  3QWL A;  4IBJ A;  3FYD A;  3FUT A;  5EP4 A;  1NO1 A;  3BBZ A;  5KPZ A;  3SAV A;  4DV0 M;  1YUB A;  2EO2 A;  2J7N A;  3HU1 A;  1IBM M;  2QPA A;  2DHY A;  3VKH A;  1JQJ C;  3AOE C;  2GNO A;  4XBO A;  3KFU G;  3PNV A;  4CJ6 A;  4ANR A;  3SMS A;  4TUW A;  2ZTC A;  2APL A;  1VEK A;  5DNY A;  4D82 A;  3FRH A;  3GPY A;  1FJG M;  3DFZ A;  4REZ A;  1SXJ E;  1R6B X;  1AIP C;  1RU3 A;  4ZPX A;  4Q7J A;  4X64 M;  4NRV A;  2ZAO A;  5FTJ A;  3BOS A;  2NQ8 C;  3DZD A;  2LVO C;  2QZ4 A;  3FTD A;  5JI2 E;  1K3X A;  3CF0 A;  1JB0 F;  4B3M M;  2M60 A;  3HZJ A;  1I94 M;  2CRU A;  3CF6 E;  4IBB A;  3KP1 E;  1XXH E;  4JYA M;  4F1I A;  2X4A A;  4LCB A;  1TDH A;  1W5T A;  3KVW A;  3U60 B;  4G4Q A;  3MK6 A;  1NSF A;  3RGS A;  1P3Q Q;  2LVN C;  1HNX M;  1VDD A;  1Z59 A;  2EUC A;  3H4M A;  3J80 S;  2EKF A;  2Z4R A;  1G59 A;  2DAG A;  3KOW E;  3HGI A;  1WHC A;  1PM5 A;  4L78 A;  1QAN A;  3OTO M;  3FUX A;  4L15 A;  4ITQ A;  4RF0 A;  3SAU A;  5IT9 S;  1L8Q A;  4LJ9 A;  4P17 A;  4X62 M;  2XZF A;  2J7O A;  3KW6 A;  3E21 A;  1NVM A;  4CIZ A;  2ZAM A;  3GQ5 A;  3U60 A;  2JY5 A;  5E26 A;  2DAK A;  2DNA A;  1NY6 A;  2Y20 A;  4BBA A;  1OFI A;  1J7K A;  3GO8 A;  3KOX E;  3UMM A;  2WSC F;  2ZTD A;  3EIE A;  2MRO B;  1NHG C;  1XNQ M;  3FUW A;  1Q3B A;  2LHG A;  3H4J A;  5A2Q S;  1NNJ A;  2OOA A;  3IG5 A;  4M9X A;  3RGP A;  4LF5 M;  2EA0 A;  3FUU A;  2YR0 A;  2XEP A;  3VK8 A;  4MGY E;  4B08 A;  1UM8 A;  2P5T A;  5FSW A;  1G4A E;  4B3R M;  2Z7J A;  1X37 A;  1D0L A;  1YLA A;  2JY6 B;  2RGH A;  3LW5 F;  2XSZ D;  1PJT A;  3GRU A;  4IBF A;  1OFH A;  2UUB M;  3AL0 C;  3QYB A;  3T38 A;  2KRK A;  2RRU A;  2BWE A;  5EP1 A;  2JNH A;  3SYK A;  5LMU M;  2M5Z A;  5EXX A;  1VEG A;  4XGI A;  5BR8 M;  1ORY B;  4HEO A;  4LF6 M;  2H1R A;  1IN6 A;  1IN5 A;  4PDG A;  3I01 M;  2R4J A;  4FWG A;  1WXQ A;  2LXE A;  4G3O A;  4MM3 B;  4RNA A;  3THG A;  2CHV A;  3KS8 A;  4I5S A;  1GL7 A;  4JI8 M;  2VQF M;  3TL4 X;  4DR5 M;  2FNA A;  4AI6 A;  4FCT A;  4HLQ A;  1EIJ A;  4M0D A;  4JI7 M;  3SAW A;  3KP0 E;  3FYC A;  4IBI A;  5ITX E;  4AG5 A;  4GIP A;  4WUR A;  4JI0 M;  4KT0 F;  3VDU A;  2V1U A;  4P16 A;  3K92 A;  4FCV A;  3HY5 A;  2I7N A;  1EE8 A;  1WJ7 A;  3LQR A;  2F5S A;  3BXW A;  3GQ4 A;  3HHX A;  3WHL A;  1TR8 A;  5FTL A;  3A98 B;  5KPT A;  2RGO A;  1GO5 A;  3B7Z A;  2DWN A;  3SAT A;  1QZM A;  3C3E A;  1DO2 A;  3U6Q A;  4NL4 H;  3IG8 A;  3SHF A;  3IHP A;  4DV7 M;  1HNW M;  3FUV A;  2UXB M;  2HCB A;  4GMQ A;  4GIT A;  2LTU A;  4D81 A;  1L1Z A;  2OO9 A;  2KA6 B;  3ZCB B;  2DVW B;  3GLI B;  3T6P A;  4JI6 M;  4LJ5 A;  1DV0 A;  3C9P A;  1ZMV A;  3U6M A;  1VDL A;  1OIP A;  2Y0Q A;  3AFH A;  1OKS A;  5BPV A;  2XLJ A;  4JI4 M;  3GRR A;  1L2D A;  4JI5 M;  1TH4 A;  1G3I A;  4LF4 M;  1IXS B;  3U6L A;  2CP8 A;  1XC8 A;  3WHK A;  3A45 A;  3DOA A;  4MH0 E;  3GPU A;  2R4E A;  3U61 B;  2DZL A;  3GLI A;  2CV0 A;  2QCU A;  2VF8 A;  3AJI B;  1J5E M;  2KRU A;  2VF7 A;  2E5L M;  4MB7 A;  2HWJ A;  3GLG B;  4DR3 M;  3EIH A;  2UUC M;  4AKI A;  1HNZ M;  1IXS A;  3U6E A;  3A46 A;  3NBI A;  4R3D A;  4FWD A;  1ZAE A;  1XMO M;  1JR3 A;  1IXR C;  3HJ8 A;  4NXM M;  2QQ8 A;  2FOI C;  4NRW A;  3HJS A;  2LVA A;  4FW9 A;  3U61 A;  1QDT A;  2F5Q A;  3HHZ A;  2DI0 A;  3KOZ E;  3MHV C;  1SXJ B;  4LFA M;  1NHW C;  1SG9 A;  3C58 A;  2F5P A;  4AG6 A;  3GLG A;  3GLF E;  3FTE A;  4DR1 M;  2LH0 A;  2BJV A;  5EXT A;  1E9R A;  1T43 A;  2MGW A;  2XH9 A;  2I7P A;  4F2L A;  1MU5 A;  1Y8G A;  1ZMU A;  1HT1 E;  4LY6 A;  4IBK A;  1QDR A;  2DWM A;  3CF2 A;  1XHB A;  4NC6 A;  4IJF A;  5KO3 A;  3L25 A;  1QUS A;  3UGJ A;  1OAO C;  1XXH B;  1G41 A;  5EXP A;  4G6Z A;  2C5R A;  2DWZ B;  1A5T A;  3B74 A;  4B7F A;  5F3W A;  1D2N A;  1Z5A A;  3M7G A;  1E94 E;  4CHT B;  3B7N A;  4QNR A;  4CGY B;  3HKP A;  4GKJ M;  2X8A A;  4KO8 A;  3LCV B;  2CFO A;  3HJQ A;  3PFI A;  4DV5 M;  3TQS A;  4I4L A;  4G4O A;  2YNM D;  3I51 A;  4XK8 F;  4L8R C;  2C9C A;  2WZJ A;  2FE8 A;  4GHA A;  1Q3C A;  3PVS A;  1R2Z A;  2O25 A;  4FCW A;  4EIW A;  3J81 S;  2LWX A;  2ERC A;  1XMQ M;  1N36 M;  1GVN A;  1XXH A;  4M9S A;  4A3V B;  4Z8X A;  3L26 A;  1QAQ A;  1OIZ A;  2JUJ A;  2L4F A;  4NSO B;  5DYG A;  4B7H A;  3FRI A;  1VQ1 A;  1WR1 B;  4YY3 M;  2EKK A;  1L1T A;  4OVZ B;  5ITU A;  2D7H A;  2L2D A;  5EJC A;  3T1H M;  3LVV A;  1AUA A;  1IBK M;  4JV5 M;  1F4I A;  1V33 A;  2C9O A;  1QUT A;  3MJ5 A;  2QNJ A;  4JXJ A;  1NY5 A;  2VQE M;  3I4Y A;  5FLX S;  2BNK A;  3GP1 A;  5ITQ A;  1GLN A;  1VG5 A;  3U6D A;  1FNN A;  1LV7 A;  4LZZ A;  3U6O A;  3SFZ A;  4KHP M;  4OVZ A;  5ITT A;  1OTR A;  3GLH B;  4B7G A;  2DAM A;  1G8P A;  2OQ4 A;  4NSR A;  4Z6Y A;  4LZJ A;  4X66 M;  4LF9 M;  3D8L A;  4D80 A;  4G4N A;  2L7H A;  4PT5 A;  2R65 A;  4LJ8 A;  2KW0 A;  3FTF A;  4HL4 A;  4MGK E;  1LTM A;  4RF1 A;  3KSX A;  4I8O A;  3PXG A;  2K0B X;  4GRI A;  2HHH M;  2CV2 A;  4OU7 A;  2XFT A;  5KPR A;  2K47 A;  3ILK A;  1HQC A;  3GLH A;  4PD2 A;  2C99 A;  2KNZ A;  5FTM A;  3K8Z A;  3FD9 A;  2N35 A;  1VEJ A;  4WW0 A;  2GQF A;  2KNV A;  3RE8 A;  5EQT A;  2R0I A;  3RFW A;  4QHS A;  4GC5 A;  1SXJ C;  4AKG A;  3T1Y M;  1R7R A;  2R6F A;  1XB2 B;  3NWL A;  2L4E A;  4LJ4 A;  3SMP A;  3U6P A;  5IWA M;  3J27 B;  1HQY E;  2Z3X A;  4JI2 M;  2F4V M;  2UUA M;  2CUZ A;  4FD2 A;  1IM2 A;  1D0M A;  5FTK A;  2D7G A;  3LCU A;  1N78 A;  1QAO A;  2XZU A;  5GKN A;  1R2Y A;  4IBE A;  1OJL A;  2DZO B;  1E9S A;  2QSF X;  2HL7 A;  5DFL A;  4DV1 M;  2UXC M;  1KSF X;  4I81 A;  3U6S A;  3DA1 A;  1NV9 A;  2G3Q A;  3M6A A;  1GAB A;  2XFS A;  3NBX X;  4L6V 6;  2DKL A;  1XNR M;  3GPX A;  1PJJ A;  4AW4 A;  1N33 M;  1Q39 A;  5H37 D;  5DYI A;  4MGZ E;  5EXS A;  4JI3 M;  5ITR A;  2R45 A;  1QQW A;  1GJT A;  3GLI E;  3ZC7 B;  2JXN A;  3CTW B;  4M0W A;  1MN3 A;  4Y28 F;  4DR4 M;  3R9X B;  1N34 M;  1XWI A;  1Z5B A;  4DV2 M;  2WSF F;  4QOZ C;  1C7Y A;  5L8R F;  1DGG A;  3JR4 A;  2UXD M;  2CHG A;  2JA2 A;  4LFB M;  4NOO B;  1E32 A;  1NV8 A;  1Z5C A;  1I4W A;  3QYE A;  2LBC A;  4RKU F;  1HR0 M;  5EP2 A; 
#chains in the Genus database with same CATH homology
 2JY6 B;  3F92 A;  2DAE A;  2JY7 A;  2RRU A;  2BWE A;  2QHO B;  2JUJ A;  2L4F A;  2JNH A;  4UN2 B;  4GEW A;  1Q02 A;  1QZE A;  1VEG A;  3GLG E;  3FRI A;  4HEO A;  1VQ1 A;  1WR1 B;  1V92 A;  4R71 A;  2B3T A;  2EKK A;  4G3O A;  2DEN A;  4DBG B;  1ZV1 A;  2L2D A;  1T6O A;  2JY8 A;  1F4I A;  1KYI A;  3MMP A;  3K9P A;  2QNJ A;  1HT2 E;  3FE3 A;  1JR3 E;  3IEC A;  1VG5 A;  2H5X A;  1WJ7 A;  2KHH A;  1TR8 A;  3B89 A;  1GO5 A;  1OTR A;  3BBZ A;  1TTE A;  2DAM A;  1DO2 A;  2MJ5 B;  1IFY A;  3IHP A;  2DHY A;  1WGL A;  2KNA A;  2LTU A;  2OO9 A;  1R4G A;  2CWB A;  2ZTC A;  1VEK A;  2K0B X;  3T6P A;  3FRH A;  1DV0 A;  1ZMV A;  1VDL A;  1DO0 A;  1OKS A;  1AIP C;  2KNZ A;  1HJP A;  3K9O A;  4Q7J A;  1G3I A;  1VEJ A;  2KNV A;  2K9D A;  2R0I A;  2CP8 A;  2LVO C;  2LVQ D;  5JI2 E;  2JP7 A;  1XB2 B;  2L4E A;  1WGN A;  2DZL A;  1HQY E;  1XXH E;  4F1I A;  2DAI A;  1ZMW A;  2HWJ A;  1IM2 A;  3LCU A;  1WIV A;  1IXS A;  1UFZ A;  1CUK A;  1P3Q Q;  2LVN C;  4WP2 A;  2QSF X;  2LVP C;  2EKF A;  2OOB A;  2DAG A;  1WHC A;  2LVA A;  5DFL A;  2DI0 A;  1BVS A;  3GLH E;  1SG9 A;  1NV9 A;  2G3Q A;  2HAK A;  1OQY A;  3GLF E;  2DKL A;  3E21 A;  1T43 A;  2MGW A;  2EJS A;  4F2L A;  2JY5 A;  1ZMU A;  1Y8G A;  1HT1 E;  2BWB A;  1PGY A;  2DAK A;  2DNA A;  1EFU B;  3GLI E;  1G41 A;  2ZTD A;  1MN3 A;  1A5T A;  2MRO B;  1OAI A;  3H4J A;  2JZ1 A;  2OOA A;  1E94 E;  1C7Y A;  2JZ0 A;  3E46 A;  3LCV B;  1NV8 A;  1G4A E;  2WZJ A;  2LBC A;  2MR9 A;  2O25 A;  1YLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...