2LTUA

Solution structure of autoinhibitory domain of human amp-activated protein kinase catalytic subunit
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
GPHMSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-2
publication title Solution Structure of autoinhibitory domain of human AMP-activated protein kinase catalytic subunit
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 62
sequence length 62
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ltuA00
1IFYA 2DAMA 2DI0A 3LCVB 2OO9A 2DAEA 2LVAA 1OKSA 5DFLA 1DV0A 3BBZA 1VEKA 2QSFX 2EKKA 3E21A 2K0BX 1XB2B 2KNZA 4R71A 1QZEA 1F4IA 1Q02A 2LBCA 1NV9A 3H4JA 1TTEA 3FRHA 1JR3E 2MROB 1G41A 2DAKA 4WP2A 2HWJA 2DNAA 2JP7A 2JUJA 2L4FA 1EFUB 2RRUA 1T43A 4F2LA 2JY6B 1R4GA 3K9OA 1OTRA 2KNVA 3GLIE 2K9DA 2BWBA 2MGWA 3B89A 1ZV1A 1TR8A 1VEJA 2JY7A 1CUKA 2DAGA 1G3IA 1T6OA 1A5TA 1PGYA 2H5XA 2O25A 4HEOA 1VG5A 2QHOB 2G3QA 2DHYA 1V92A 2CWBA 1VQ1A 1C7YA 2JZ0A 1DO0A 2KHHA 4G3OA 4UN2B 2JY5A 2R0IA 2LVPC 3IHPA 1VEGA 2DENA 2HAKA 1WR1B 2ZTDA 4Q7JA 2EKFA 2EJSA 1OQYA 3GLHE 2QNJA 1OAIA 3E46A 2L2DA 3MMPA 2LVNC 1KYIA 4DBGB 1IM2A 1ZMVA 2L4EA 2ZTCA 1WIVA 2JY8A 1XXHE 2OOBA 2DZLA 3IECA 1HQYE 1P3QQ 1G4AE 3F92A 1HJPA 2JZ1A 1SG9A 3FE3A 4GEWA 2BWEA 3K9PA 1DO2A 2WZJA 1VDLA 3FRIA 1HT1E 2KNAA 3T6PA 1ZMWA 1HT2E 2DAIA 3GLGE 1IXSA 1UFZA 2LVQD 1Y8GA 1WHCA 1E94E 2LVOC 1MN3A 2MJ5B 1GO5A 2B3TA 4F1IA 2MR9A 1ZMUA 1YLAA 3LCUA 5JI2E 2CP8A 1WGNA 1BVSA 2LTUA 1WJ7A 2DKLA 2JNHA 2OOAA 3GLFE 1AIPC 1NV8A 1WGLA
chains in the Genus database with same CATH superfamily
2DI0A 3CF0A 2CFOA 3TQSA 3GLHA 3W0LB 1L1TA 3NWLA 1Q39A 2F5NA 3VKHA 2DZOB 1NNJA 2DXIA 3KS8A 4B7GA 5KPTA 1DV0A 5DFLA 3UK6A 3E9SA 1VEKA 2JXNA 3W68A 1S3SA 2BJVA 1KSFX 2ERCA 3TWKA 4R71A 1GJSA 3SHFA 3U6DA 2LBCA 5E26A 1UM8A 3A42A 4IBBA 3FRHA 3QYEA 1Z59A 2APLA 5EJCA 3WHKA 3SYKA 4G4NA 3HJQA 3GPPA 1J7KA 1JR3D 4HLQA 5EP4A 4M9SA 1R4GA 2YNMD 2CE7A 1NHWC 4LF8M 4DR3M 2KNVA 1FJGM 4AI6A 1IBKM 4JYAM 1SXJC 3EIHA 3L27A 4P16A 4IJEA 1Z6TA 2R6FA 3LQRA 3U60B 1ZV1A 1TR8A 5IWAM 1N75A 4G4RA 4IBJA 4DR1M 2NQ8C 2Z7JA 1SXJB 1T6OA 1A5TA 1PGYA 2O25A 3GRUA 1ORYB 4B3SM 5FLXS 1IY0A 2DHYA 1G8PA 2CWBA 3C9PA 3DFZA 3FUWA 4LJ8A 3T15A 3TWLA 2Z3XA 1NJFA 4B7FA 1C7YA 3HU2A 4IBKA 2KHHA 3FKEA 2FOIC 3J7BA 3VK7A 4UN2B 4K0KM 2DHRA 2JY5A 1MX0A 1EIJA 3J7AS 2L7HA 1VEGA 2DENA 4RF1A 4D81A 4LGYA 4PT5A 2EA0A 4MB7A 5EP1A 3GLHE 4GIPA 1OAIA 1G59A 4FWDA 3U5ZB 2ZAMA 4DR6M 3MMPA 2G5GX 4JN6A 3I4VA 1IM2A 3HU1A 3KOZE 3T1HM 2L4EA 2ZTCA 3KFUG 4JI2M 2XFSA 1XXHE 1IXRC 2QP9X 1PJSA 1QUTA 3H4MA 4QOSA 4XK8F 3ILKA 5DYIA 2UUCM 3PFIA 1HQYE 3F92A 4AKIA 1XXHB 1W5TA 2JZ1A 1E9RA 1SG9A 3FE3A 4LJAA 3V76A 2WSFF 2X49A 1V33A 3B9PA 4M9ZA 4DR5M 2WZJA 5ITRA 1VDLA 4DUZM 2Y20A 1HT1E 3R8FA 4BLCA 3RGSA 5ITXA 3PVSA 1I94M 4NXNM 2XGNA 1NJGA 2C5RA 1XNQM 3EIEA 4DR7M 3HU3A 1N36M 1UFZA 4GH9A 2UUBM 2FS1A 2F5OA 1WHCA 4W5WA 3SARA 3UGJA 4FCTA 4NXMM 1OIPA 2FH0A 2HKJA 2KW0A 2VF8A 5EXSA 4G4OA 2UU9M 2MJ5B 4DV0M 3JR5A 2DWLA 2B3TA 5ITYA 4IBDA 3GRYA 1YLAA 2RGHA 4A3VB 4KHPM 1R5LA 3KSJA 4JI5M 2I7NA 2LXEA 3KOXE 4FD2A 5C1BA 4FVMA 1Z5BA 1AIPC 3GQ4A 3J2PB 2ZAOA 2DAMA 1Z5AA 2VIIA 4IJFA 1QZMA 4G6ZA 1GL6A 3MK6A 2X4AA 4GHLA 4R7GA 2EO2A 1DGHB 3HGIA 1L8QA 2G8LA 2QBYA 4D80A 2LHCA 4MGKE 3TWMA 2QSFX 2HCBA 3W67A 3GPUA 4B3MM 2I7PA 1ZQ9A 1F4IA 4MM3B 1Q02A 3H4JA 1NV9A 2KEBA 3THGA 3GLFA 3GLGB 4B3RM 4KO8A 1PJTA 1C1KA 3KS4A 4FCVA 1IN7A 5KPZA 4WP2A 4ZPXA 1QDRA 2DNAA 2JP7A 3GQ5A 3ZC7B 4BB9A 1L2DA 1TF0B 3DA1A 1J09A 1EFUB 3C3EA 4WURA 3VDPA 4GC5A 1X37A 2C98A 2FE8A 1QVRA 1NHGC 3NBXX 2C9CA 3U6MA 1R2YA 2BWBA 2R4JA 5EXPA 3SFZA 1D0KA 4AG5A 1D2NA 4REZA 1JB0F 4KT0F 2Y21A 3J80S 5ITXE 3FYCA 4MGHA 1HQCA 1TGUA 4IBFA 2JY7A 4JI3M 3B7ZA 3SBJA 3FTFA 1NSFA 1WXQA 1YE9A 2R65A 4MGZE 2F4VM 1TDZA 4X64M 5BPVA 5JI3E 3U6OA 2QHOB 5C18A 2A5YB 1V92A 4B08A 1VQ1A 4YY3M 1GLNA 1IQPA 1NO1A 2D7HA 1DO0A 4LF6M 4OX9M 1K3XA 2GNOA 4NRVA 4NOOB 4G3OA 4JI0M 4MGIE 5ITTA 1QDTA 2R0IA 3DOAA 3IG5A 4PCZA 3GRRA 3RGPA 4LF7M 3TPZA 2HAKA 3M7GA 1WR1B 2Z4SA 3AOEA 5FTMA 3GP1A 2EJSA 1OQYA 1YSYA 3VDUA 3AL0C 2JWSA 3SAVA 5A2QS 1JR3A 1N78A 2OQ4A 2BNKA 3L26A 2D7EA 2C9OA 3KOYE 1XC8A 2WSCF 3PNYA 2QPAA 4LRSA 1QAMA 2D7GA 2QENA 1IN5A 4M0DA 2LWXA 2CV1A 3WHLA 4NL4H 4II7A 3IECA 4OVZB 4AW4A 4M9XA 2VQFM 2WSEF 1G4AE 3U6SA 1IXSB 4AKHA 4GKJM 4DR2M 1DGBA 5E6JA 3GLIA 4DV1M 1DO2A 4LGMA 2OPFA 5ITQA 3M0EA 2CHVA 1H6UA 3VLFB 3KP1E 1ZMWA 2M5ZA 4LFBM 3QYBA 3U6QA 1HNXM 4X65M 2DAIA 4I8OA 4AQYM 1T3TA 4GRIA 2XEPA 2XH9A 2BJWA 3HJSA 4DV4M 3FUVA 1E94E 3QAUA 1GJTA 1MN3A 3GLHB 3I01M 3AJIB 3ZH9B 1N34M 1NY6A 7CATA 2VDBB 3Q8GA 3LCUA 2L09A 2HHHM 2J7OA 2DWZB 4RKUF 4DV3M 2CP8A 2XSZD 1OJLA 3LVVA 2LTUA 4I4LA 4JV5M 2DKLA 2F5SA 4BBAA 3CGWA 1IFYA 2J5YA 2M60A 4PDGA 2R44A 3BXWA 2CEAA 1KFVA 3L29A 3PXGA 2OO9A 2QQ8A 1VDDA 3VK8A 4AKGA 2LVAA 3FTEA 1OAOC 3BBZA 1N77A 2LHGA 3C58A 1QAOA 4YHHM 1GKIA 2F5PA 3K8ZA 3K92A 4LFAM 1N33M 3E21A 2K0BX 1XB2B 2L7IA 3QWLA 3J81S 1GABA 1IBLM 4M0WA 4QNMA 1R6BX 1NVMA 2C99A 2DVWB 1TTEA 2XFTA 3HHXA 1QYRA 4CJ6A 1JR3E 2CHQA 4IIWA 5FTKA 3UJNA 3L25A 4GKKM 2MROB 1G41A 2E5LM 2R45A 5GKNA 4G4QA 4CIZA 3RFWA 4I5SA 4IBEA 2HL7A 2HWJA 2JUJA 2L4FA 4KLNA 3VKGA 8CATA 2UUAM 2RRUA 1T43A 3KSXA 4QOZC 3K9OA 1DGGA 3FUXA 4ITQA 1OTRA 4DV6M 4X62M 1PJQA 2XF3A 2K9DA 3IG8A 3MJ5A 3GLIE 3B89A 5LMNM 4NSOB 1TH3A 3T1YM 2ZM6M 4JI1M 1VEJA 5DNYA 5DYGA 3HHWA 1CUKA 2DAGA 4TUWA 2LNHC 3M6AA 2CRUA 2N35A 2CUZA 4LJ9A 1DGFA 4CGYB 3CTWB 1PJIA 4DUYM 1SXJD 3HHYA 1E9SA 1VG5A 3BOSA 1MU5A 4LRTA 1NNUC 3U60A 3U61A 5EP2A 4JI7M 2O5RA 2DWMA 3J27B 2UXCM 1G71A 1SXJA 3TE6A 1YUBA 1LV7A 2ZTDA 4Q7JA 2EKFA 3B74A 2ZBKB 4LJ7A 2QNJA 2CV0A 4LF9M 2L2DA 3LW5F 4RNAA 4FCWA 1LTMA 1ZMVA 3SAUA 3KXEC 3AFHA 3HKPA 2JY8A 2KZSA 3K2LA 2OOBA 3HX3A 3HY5A 4GMQA 4X66M 2H1RA 1IXZA 2R46A 4IBGA 2DZLA 4D82A 4RF0A 3A46A 1PM5A 4GC9A 4PDIA 4LFCM 1P3QQ 1IN8A 1IN4A 1HJPA 3U5ZA 2KDLA 2Y0QA 3AV0A 4DV2M 4GEWA 2BWEA 3K9PA 3T38A 3U6PA 1RU3A 1TH4A 1OIZA 3KDSE 1Q3CA 2KNAA 3D8LA 3GO8A 1QANA 5IZ7D 4LJ6A 3K1JA 3HHZA 3D8BA 1HT2E 1XMQM 1JQJC 1K82A 1IY1A 1XXHA 2LVQD 2R62A 2RKOA 4I81A 1QQWA 5EQTA 2DWNA 2X8AA 5BR8M 2V1CA 2V6ZM 3ZQJA 1E32A 3NBIA 4R3DA 4L6V6 3HJ8A 1ZMUA 4WW0A 3SHGB 3SMSA 4Z6YA 2KRUA 3HWSA 5JI2E 4QNRA 4AG6A 4OU7A 3CF2A 1WGNA 3LMMA 5EP3A 2C96A 2QZ4A 5L8RF 3FTCA 3GLFE 3U6EA 1R2ZA 2MH8A 4JI8M 2CHGA 2VF7A 3GRVA 4IBIA 5KQ8A 2UXDM 3LCVB 4GHAA 3GLFB 1L2CA 2UXBM 1N32M 5FTNA 3SC3A 2DAEA 1OKSA 4LCBA 1GVNA 2ZANA 3KVWA 4GITA 1XMOM 4B7HA 1SXJE 4Y28F 3U61B 5ITUA 2W82A 3UZUA 2EKKA 3AKZA 2K6BA 5KQDA 3GPXA 2KNZA 3LQQA 1QZEA 2V1UA 1EE8A 3FUUA 4FWGA 1NY5A 2O01F 3AOGA 4LZZA 3VFDA 3TL4X 4QHSA 1IY2A 1ZAEA 4XBOA 3SYLA 4DR4M 2GQFA 1DGHA 1TH2A 3JR4A 5IREB 1AUAA 1J5EM 5KPRA 1I4WA 2DAKA 3U6CA 3OTOM 3A45A 1QAQA 2Q2EB 2JA2A 3FD9A 1W5SA 4DV7M 4NRWA 4F2LA 2XZUA 2FNAA 5F3WA 2JY6B 3GLGA 1OFIA 1HR0M 1IN6A 5KO3A 5IT9S 4FW9A 1GL7A 4HL4A 2F5QA 2XSZA 2MGWA 2L6OA 4ANRA 2VQEM 3U6LA 3AOEC 1PJJA 1TDHA 3KP0E 4CHTB 3R9XB 2LH0A 4NSRA 4L78A 1Q3BA 4P17A 1HNWM 1D0MA 2J7NA 4L4UA 4LG2A 4XGIA 4MGYE 3W0FA 3C3DA 4AZFA 1G3IA 3MHVC 3JAMS 2CV2A 5EXTA 3ZCBB 2H5XA 4L8RC 2AHMA 4HEOA 3SATA 3B7QA 2KRKA 2G3QA 3I51A 4KODA 5FSWA 2YFQA 3FUTA 3UMMA 1XNRM 3A98B 3Q8XA 2DZNB 3FYDA 2JZ0A 2P5TA 4JI4M 2KA6B 1PRBA 2EUCA 4Z8XA 3GPYA 4OW0A 2LVPC 2RGOA 4LY6A 4L16A 1L2BA 3IHPA 3DZDA 1L1ZA 2QBYB 2Y0TA 3KOWE 4IBCA 1XWIA 3SAWA 1Z5CA 2FFJA 2R4EA 2LVNC 1KYIA 3E46A 4DBGB 4CISA 4MH0E 3GLIB 4LF4M 4NC6A 3CF6E 1WIVA 2Z4RA 5LMUM 1IBMM 3GQ3A 3E4RA 3HZJA 4FWHA 2K47A 4L15A 1V34A 3I04M 5EXXA 3SMPA 4S12A 4EIWA 3RE8A 5H37D 3KW6A 2KZUA 1FNNA 3I4YA 1MJGM 2Z8YM 3FRIA 3L28A 3T6PA 4JXJA 4LZJA 4OVZA 3SASA 1K3WA 2R18A 3GLGE 4JI6M 1IXSA 3B7NA 1HNZM 1Y8GA 4B3TM 1XHBA 2QCUA 2XZFA 2LVOC 3L2AA 5FTJA 2YR0A 1QUSA 1D0LA 1GO5A 3PNVA 4F1IA 2MR9A 4LF5M 1OFHA 2KXEA 2YQZA 2XLJA 4DV5M 1BVSA 3LVWA 1WJ7A 3FTDA 2JNHA 2OOAA 4QHTA 4PD2A 5FTLA 4LJ5A 4LJ4A 1NV8A 1R7RA 1WGLA
chains in the Genus database with same CATH topology
1IFYA 2DAMA 2DI0A 3LCVB 2OO9A 2DAEA 2LVAA 1OKSA 5DFLA 1DV0A 3BBZA 1VEKA 2QSFX 2EKKA 3E21A 2K0BX 1XB2B 2KNZA 4R71A 1QZEA 1F4IA 1Q02A 2LBCA 1NV9A 3H4JA 1TTEA 3FRHA 1JR3E 2MROB 1G41A 2DAKA 4WP2A 2HWJA 2DNAA 2JP7A 2JUJA 2L4FA 1EFUB 2RRUA 1T43A 4F2LA 2JY6B 1R4GA 3K9OA 1OTRA 2KNVA 3GLIE 2K9DA 2BWBA 2MGWA 3B89A 1ZV1A 1TR8A 1VEJA 2JY7A 1CUKA 2DAGA 1G3IA 1T6OA 1A5TA 1PGYA 2H5XA 2O25A 4HEOA 1VG5A 2QHOB 2G3QA 2DHYA 1V92A 2CWBA 1VQ1A 1C7YA 2JZ0A 1DO0A 2KHHA 4G3OA 4UN2B 2JY5A 2R0IA 2LVPC 3IHPA 1VEGA 2DENA 2HAKA 1WR1B 2ZTDA 4Q7JA 2EKFA 2EJSA 1OQYA 3GLHE 2QNJA 1OAIA 3E46A 2L2DA 3MMPA 2LVNC 1KYIA 4DBGB 1IM2A 1ZMVA 2L4EA 2ZTCA 1WIVA 2JY8A 1XXHE 2OOBA 2DZLA 3IECA 1HQYE 1P3QQ 1G4AE 3F92A 1HJPA 2JZ1A 1SG9A 3FE3A 4GEWA 2BWEA 3K9PA 1DO2A 2WZJA 1VDLA 3FRIA 1HT1E 2KNAA 3T6PA 1ZMWA 1HT2E 2DAIA 3GLGE 1IXSA 1UFZA 2LVQD 1Y8GA 1WHCA 1E94E 2LVOC 1MN3A 2MJ5B 1GO5A 2B3TA 4F1IA 2MR9A 1ZMUA 1YLAA 3LCUA 5JI2E 2CP8A 1WGNA 1BVSA 2LTUA 1WJ7A 2DKLA 2JNHA 2OOAA 3GLFE 1AIPC 1NV8A 1WGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFY A;  2DAM A;  2DI0 A;  3LCV B;  2OO9 A;  2DAE A;  2LVA A;  1OKS A;  5DFL A;  1DV0 A;  3BBZ A;  1VEK A;  2QSF X;  2EKK A;  3E21 A;  2K0B X;  1XB2 B;  2KNZ A;  4R71 A;  1QZE A;  1F4I A;  1Q02 A;  2LBC A;  1NV9 A;  3H4J A;  1TTE A;  3FRH A;  1JR3 E;  2MRO B;  1G41 A;  2DAK A;  4WP2 A;  2HWJ A;  2DNA A;  2JP7 A;  2JUJ A;  2L4F A;  1EFU B;  2RRU A;  1T43 A;  4F2L A;  2JY6 B;  1R4G A;  3K9O A;  1OTR A;  2KNV A;  3GLI E;  2K9D A;  2BWB A;  2MGW A;  3B89 A;  1ZV1 A;  1TR8 A;  1VEJ A;  2JY7 A;  1CUK A;  2DAG A;  1G3I A;  1T6O A;  1A5T A;  1PGY A;  2H5X A;  2O25 A;  4HEO A;  1VG5 A;  2QHO B;  2G3Q A;  2DHY A;  1V92 A;  2CWB A;  1VQ1 A;  1C7Y A;  2JZ0 A;  1DO0 A;  2KHH A;  4G3O A;  4UN2 B;  2JY5 A;  2R0I A;  2LVP C;  3IHP A;  1VEG A;  2DEN A;  2HAK A;  1WR1 B;  2ZTD A;  4Q7J A;  2EKF A;  2EJS A;  1OQY A;  3GLH E;  2QNJ A;  1OAI A;  3E46 A;  2L2D A;  3MMP A;  2LVN C;  1KYI A;  4DBG B;  1IM2 A;  1ZMV A;  2L4E A;  2ZTC A;  1WIV A;  2JY8 A;  1XXH E;  2OOB A;  2DZL A;  3IEC A;  1HQY E;  1P3Q Q;  1G4A E;  3F92 A;  1HJP A;  2JZ1 A;  1SG9 A;  3FE3 A;  4GEW A;  2BWE A;  3K9P A;  1DO2 A;  2WZJ A;  1VDL A;  3FRI A;  1HT1 E;  2KNA A;  3T6P A;  1ZMW A;  1HT2 E;  2DAI A;  3GLG E;  1IXS A;  1UFZ A;  2LVQ D;  1Y8G A;  1WHC A;  1E94 E;  2LVO C;  1MN3 A;  2MJ5 B;  1GO5 A;  2B3T A;  4F1I A;  2MR9 A;  1ZMU A;  1YLA A;  3LCU A;  5JI2 E;  2CP8 A;  1WGN A;  1BVS A;  2LTU A;  1WJ7 A;  2DKL A;  2JNH A;  2OOA A;  3GLF E;  1AIP C;  1NV8 A;  1WGL A; 
#chains in the Genus database with same CATH topology
 2DI0 A;  3CF0 A;  2CFO A;  3TQS A;  3GLH A;  3W0L B;  1L1T A;  3NWL A;  1Q39 A;  2F5N A;  3VKH A;  2DZO B;  1NNJ A;  2DXI A;  3KS8 A;  4B7G A;  5KPT A;  1DV0 A;  5DFL A;  3UK6 A;  3E9S A;  1VEK A;  2JXN A;  3W68 A;  1S3S A;  2BJV A;  1KSF X;  2ERC A;  3TWK A;  4R71 A;  1GJS A;  3SHF A;  3U6D A;  2LBC A;  5E26 A;  1UM8 A;  3A42 A;  4IBB A;  3FRH A;  3QYE A;  1Z59 A;  2APL A;  5EJC A;  3WHK A;  3SYK A;  4G4N A;  3HJQ A;  3GPP A;  1J7K A;  1JR3 D;  4HLQ A;  5EP4 A;  4M9S A;  1R4G A;  2YNM D;  2CE7 A;  1NHW C;  4LF8 M;  4DR3 M;  2KNV A;  1FJG M;  4AI6 A;  1IBK M;  4JYA M;  1SXJ C;  3EIH A;  3L27 A;  4P16 A;  4IJE A;  1Z6T A;  2R6F A;  3LQR A;  3U60 B;  1ZV1 A;  1TR8 A;  5IWA M;  1N75 A;  4G4R A;  4IBJ A;  4DR1 M;  2NQ8 C;  2Z7J A;  1SXJ B;  1T6O A;  1A5T A;  1PGY A;  2O25 A;  3GRU A;  1ORY B;  4B3S M;  5FLX S;  1IY0 A;  2DHY A;  1G8P A;  2CWB A;  3C9P A;  3DFZ A;  3FUW A;  4LJ8 A;  3T15 A;  3TWL A;  2Z3X A;  1NJF A;  4B7F A;  1C7Y A;  3HU2 A;  4IBK A;  2KHH A;  3FKE A;  2FOI C;  3J7B A;  3VK7 A;  4UN2 B;  4K0K M;  2DHR A;  2JY5 A;  1MX0 A;  1EIJ A;  3J7A S;  2L7H A;  1VEG A;  2DEN A;  4RF1 A;  4D81 A;  4LGY A;  4PT5 A;  2EA0 A;  4MB7 A;  5EP1 A;  3GLH E;  4GIP A;  1OAI A;  1G59 A;  4FWD A;  3U5Z B;  2ZAM A;  4DR6 M;  3MMP A;  2G5G X;  4JN6 A;  3I4V A;  1IM2 A;  3HU1 A;  3KOZ E;  3T1H M;  2L4E A;  2ZTC A;  3KFU G;  4JI2 M;  2XFS A;  1XXH E;  1IXR C;  2QP9 X;  1PJS A;  1QUT A;  3H4M A;  4QOS A;  4XK8 F;  3ILK A;  5DYI A;  2UUC M;  3PFI A;  1HQY E;  3F92 A;  4AKI A;  1XXH B;  1W5T A;  2JZ1 A;  1E9R A;  1SG9 A;  3FE3 A;  4LJA A;  3V76 A;  2WSF F;  2X49 A;  1V33 A;  3B9P A;  4M9Z A;  4DR5 M;  2WZJ A;  5ITR A;  1VDL A;  4DUZ M;  2Y20 A;  1HT1 E;  3R8F A;  4BLC A;  3RGS A;  5ITX A;  3PVS A;  1I94 M;  4NXN M;  2XGN A;  1NJG A;  2C5R A;  1XNQ M;  3EIE A;  4DR7 M;  3HU3 A;  1N36 M;  1UFZ A;  4GH9 A;  2UUB M;  2FS1 A;  2F5O A;  1WHC A;  4W5W A;  3SAR A;  3UGJ A;  4FCT A;  4NXM M;  1OIP A;  2FH0 A;  2HKJ A;  2KW0 A;  2VF8 A;  5EXS A;  4G4O A;  2UU9 M;  2MJ5 B;  4DV0 M;  3JR5 A;  2DWL A;  2B3T A;  5ITY A;  4IBD A;  3GRY A;  1YLA A;  2RGH A;  4A3V B;  4KHP M;  1R5L A;  3KSJ A;  4JI5 M;  2I7N A;  2LXE A;  3KOX E;  4FD2 A;  5C1B A;  4FVM A;  1Z5B A;  1AIP C;  3GQ4 A;  3J2P B;  2ZAO A;  2DAM A;  1Z5A A;  2VII A;  4IJF A;  1QZM A;  4G6Z A;  1GL6 A;  3MK6 A;  2X4A A;  4GHL A;  4R7G A;  2EO2 A;  1DGH B;  3HGI A;  1L8Q A;  2G8L A;  2QBY A;  4D80 A;  2LHC A;  4MGK E;  3TWM A;  2QSF X;  2HCB A;  3W67 A;  3GPU A;  4B3M M;  2I7P A;  1ZQ9 A;  1F4I A;  4MM3 B;  1Q02 A;  3H4J A;  1NV9 A;  2KEB A;  3THG A;  3GLF A;  3GLG B;  4B3R M;  4KO8 A;  1PJT A;  1C1K A;  3KS4 A;  4FCV A;  1IN7 A;  5KPZ A;  4WP2 A;  4ZPX A;  1QDR A;  2DNA A;  2JP7 A;  3GQ5 A;  3ZC7 B;  4BB9 A;  1L2D A;  1TF0 B;  3DA1 A;  1J09 A;  1EFU B;  3C3E A;  4WUR A;  3VDP A;  4GC5 A;  1X37 A;  2C98 A;  2FE8 A;  1QVR A;  1NHG C;  3NBX X;  2C9C A;  3U6M A;  1R2Y A;  2BWB A;  2R4J A;  5EXP A;  3SFZ A;  1D0K A;  4AG5 A;  1D2N A;  4REZ A;  1JB0 F;  4KT0 F;  2Y21 A;  3J80 S;  5ITX E;  3FYC A;  4MGH A;  1HQC A;  1TGU A;  4IBF A;  2JY7 A;  4JI3 M;  3B7Z A;  3SBJ A;  3FTF A;  1NSF A;  1WXQ A;  1YE9 A;  2R65 A;  4MGZ E;  2F4V M;  1TDZ A;  4X64 M;  5BPV A;  5JI3 E;  3U6O A;  2QHO B;  5C18 A;  2A5Y B;  1V92 A;  4B08 A;  1VQ1 A;  4YY3 M;  1GLN A;  1IQP A;  1NO1 A;  2D7H A;  1DO0 A;  4LF6 M;  4OX9 M;  1K3X A;  2GNO A;  4NRV A;  4NOO B;  4G3O A;  4JI0 M;  4MGI E;  5ITT A;  1QDT A;  2R0I A;  3DOA A;  3IG5 A;  4PCZ A;  3GRR A;  3RGP A;  4LF7 M;  3TPZ A;  2HAK A;  3M7G A;  1WR1 B;  2Z4S A;  3AOE A;  5FTM A;  3GP1 A;  2EJS A;  1OQY A;  1YSY A;  3VDU A;  3AL0 C;  2JWS A;  3SAV A;  5A2Q S;  1JR3 A;  1N78 A;  2OQ4 A;  2BNK A;  3L26 A;  2D7E A;  2C9O A;  3KOY E;  1XC8 A;  2WSC F;  3PNY A;  2QPA A;  4LRS A;  1QAM A;  2D7G A;  2QEN A;  1IN5 A;  4M0D A;  2LWX A;  2CV1 A;  3WHL A;  4NL4 H;  4II7 A;  3IEC A;  4OVZ B;  4AW4 A;  4M9X A;  2VQF M;  2WSE F;  1G4A E;  3U6S A;  1IXS B;  4AKH A;  4GKJ M;  4DR2 M;  1DGB A;  5E6J A;  3GLI A;  4DV1 M;  1DO2 A;  4LGM A;  2OPF A;  5ITQ A;  3M0E A;  2CHV A;  1H6U A;  3VLF B;  3KP1 E;  1ZMW A;  2M5Z A;  4LFB M;  3QYB A;  3U6Q A;  1HNX M;  4X65 M;  2DAI A;  4I8O A;  4AQY M;  1T3T A;  4GRI A;  2XEP A;  2XH9 A;  2BJW A;  3HJS A;  4DV4 M;  3FUV A;  1E94 E;  3QAU A;  1GJT A;  1MN3 A;  3GLH B;  3I01 M;  3AJI B;  3ZH9 B;  1N34 M;  1NY6 A;  7CAT A;  2VDB B;  3Q8G A;  3LCU A;  2L09 A;  2HHH M;  2J7O A;  2DWZ B;  4RKU F;  4DV3 M;  2CP8 A;  2XSZ D;  1OJL A;  3LVV A;  2LTU A;  4I4L A;  4JV5 M;  2DKL A;  2F5S A;  4BBA A;  3CGW A;  1IFY A;  2J5Y A;  2M60 A;  4PDG A;  2R44 A;  3BXW A;  2CEA A;  1KFV A;  3L29 A;  3PXG A;  2OO9 A;  2QQ8 A;  1VDD A;  3VK8 A;  4AKG A;  2LVA A;  3FTE A;  1OAO C;  3BBZ A;  1N77 A;  2LHG A;  3C58 A;  1QAO A;  4YHH M;  1GKI A;  2F5P A;  3K8Z A;  3K92 A;  4LFA M;  1N33 M;  3E21 A;  2K0B X;  1XB2 B;  2L7I A;  3QWL A;  3J81 S;  1GAB A;  1IBL M;  4M0W A;  4QNM A;  1R6B X;  1NVM A;  2C99 A;  2DVW B;  1TTE A;  2XFT A;  3HHX A;  1QYR A;  4CJ6 A;  1JR3 E;  2CHQ A;  4IIW A;  5FTK A;  3UJN A;  3L25 A;  4GKK M;  2MRO B;  1G41 A;  2E5L M;  2R45 A;  5GKN A;  4G4Q A;  4CIZ A;  3RFW A;  4I5S A;  4IBE A;  2HL7 A;  2HWJ A;  2JUJ A;  2L4F A;  4KLN A;  3VKG A;  8CAT A;  2UUA M;  2RRU A;  1T43 A;  3KSX A;  4QOZ C;  3K9O A;  1DGG A;  3FUX A;  4ITQ A;  1OTR A;  4DV6 M;  4X62 M;  1PJQ A;  2XF3 A;  2K9D A;  3IG8 A;  3MJ5 A;  3GLI E;  3B89 A;  5LMN M;  4NSO B;  1TH3 A;  3T1Y M;  2ZM6 M;  4JI1 M;  1VEJ A;  5DNY A;  5DYG A;  3HHW A;  1CUK A;  2DAG A;  4TUW A;  2LNH C;  3M6A A;  2CRU A;  2N35 A;  2CUZ A;  4LJ9 A;  1DGF A;  4CGY B;  3CTW B;  1PJI A;  4DUY M;  1SXJ D;  3HHY A;  1E9S A;  1VG5 A;  3BOS A;  1MU5 A;  4LRT A;  1NNU C;  3U60 A;  3U61 A;  5EP2 A;  4JI7 M;  2O5R A;  2DWM A;  3J27 B;  2UXC M;  1G71 A;  1SXJ A;  3TE6 A;  1YUB A;  1LV7 A;  2ZTD A;  4Q7J A;  2EKF A;  3B74 A;  2ZBK B;  4LJ7 A;  2QNJ A;  2CV0 A;  4LF9 M;  2L2D A;  3LW5 F;  4RNA A;  4FCW A;  1LTM A;  1ZMV A;  3SAU A;  3KXE C;  3AFH A;  3HKP A;  2JY8 A;  2KZS A;  3K2L A;  2OOB A;  3HX3 A;  3HY5 A;  4GMQ A;  4X66 M;  2H1R A;  1IXZ A;  2R46 A;  4IBG A;  2DZL A;  4D82 A;  4RF0 A;  3A46 A;  1PM5 A;  4GC9 A;  4PDI A;  4LFC M;  1P3Q Q;  1IN8 A;  1IN4 A;  1HJP A;  3U5Z A;  2KDL A;  2Y0Q A;  3AV0 A;  4DV2 M;  4GEW A;  2BWE A;  3K9P A;  3T38 A;  3U6P A;  1RU3 A;  1TH4 A;  1OIZ A;  3KDS E;  1Q3C A;  2KNA A;  3D8L A;  3GO8 A;  1QAN A;  5IZ7 D;  4LJ6 A;  3K1J A;  3HHZ A;  3D8B A;  1HT2 E;  1XMQ M;  1JQJ C;  1K82 A;  1IY1 A;  1XXH A;  2LVQ D;  2R62 A;  2RKO A;  4I81 A;  1QQW A;  5EQT A;  2DWN A;  2X8A A;  5BR8 M;  2V1C A;  2V6Z M;  3ZQJ A;  1E32 A;  3NBI A;  4R3D A;  4L6V 6;  3HJ8 A;  1ZMU A;  4WW0 A;  3SHG B;  3SMS A;  4Z6Y A;  2KRU A;  3HWS A;  5JI2 E;  4QNR A;  4AG6 A;  4OU7 A;  3CF2 A;  1WGN A;  3LMM A;  5EP3 A;  2C96 A;  2QZ4 A;  5L8R F;  3FTC A;  3GLF E;  3U6E A;  1R2Z A;  2MH8 A;  4JI8 M;  2CHG A;  2VF7 A;  3GRV A;  4IBI A;  5KQ8 A;  2UXD M;  3LCV B;  4GHA A;  3GLF B;  1L2C A;  2UXB M;  1N32 M;  5FTN A;  3SC3 A;  2DAE A;  1OKS A;  4LCB A;  1GVN A;  2ZAN A;  3KVW A;  4GIT A;  1XMO M;  4B7H A;  1SXJ E;  4Y28 F;  3U61 B;  5ITU A;  2W82 A;  3UZU A;  2EKK A;  3AKZ A;  2K6B A;  5KQD A;  3GPX A;  2KNZ A;  3LQQ A;  1QZE A;  2V1U A;  1EE8 A;  3FUU A;  4FWG A;  1NY5 A;  2O01 F;  3AOG A;  4LZZ A;  3VFD A;  3TL4 X;  4QHS A;  1IY2 A;  1ZAE A;  4XBO A;  3SYL A;  4DR4 M;  2GQF A;  1DGH A;  1TH2 A;  3JR4 A;  5IRE B;  1AUA A;  1J5E M;  5KPR A;  1I4W A;  2DAK A;  3U6C A;  3OTO M;  3A45 A;  1QAQ A;  2Q2E B;  2JA2 A;  3FD9 A;  1W5S A;  4DV7 M;  4NRW A;  4F2L A;  2XZU A;  2FNA A;  5F3W A;  2JY6 B;  3GLG A;  1OFI A;  1HR0 M;  1IN6 A;  5KO3 A;  5IT9 S;  4FW9 A;  1GL7 A;  4HL4 A;  2F5Q A;  2XSZ A;  2MGW A;  2L6O A;  4ANR A;  2VQE M;  3U6L A;  3AOE C;  1PJJ A;  1TDH A;  3KP0 E;  4CHT B;  3R9X B;  2LH0 A;  4NSR A;  4L78 A;  1Q3B A;  4P17 A;  1HNW M;  1D0M A;  2J7N A;  4L4U A;  4LG2 A;  4XGI A;  4MGY E;  3W0F A;  3C3D A;  4AZF A;  1G3I A;  3MHV C;  3JAM S;  2CV2 A;  5EXT A;  3ZCB B;  2H5X A;  4L8R C;  2AHM A;  4HEO A;  3SAT A;  3B7Q A;  2KRK A;  2G3Q A;  3I51 A;  4KOD A;  5FSW A;  2YFQ A;  3FUT A;  3UMM A;  1XNR M;  3A98 B;  3Q8X A;  2DZN B;  3FYD A;  2JZ0 A;  2P5T A;  4JI4 M;  2KA6 B;  1PRB A;  2EUC A;  4Z8X A;  3GPY A;  4OW0 A;  2LVP C;  2RGO A;  4LY6 A;  4L16 A;  1L2B A;  3IHP A;  3DZD A;  1L1Z A;  2QBY B;  2Y0T A;  3KOW E;  4IBC A;  1XWI A;  3SAW A;  1Z5C A;  2FFJ A;  2R4E A;  2LVN C;  1KYI A;  3E46 A;  4DBG B;  4CIS A;  4MH0 E;  3GLI B;  4LF4 M;  4NC6 A;  3CF6 E;  1WIV A;  2Z4R A;  5LMU M;  1IBM M;  3GQ3 A;  3E4R A;  3HZJ A;  4FWH A;  2K47 A;  4L15 A;  1V34 A;  3I04 M;  5EXX A;  3SMP A;  4S12 A;  4EIW A;  3RE8 A;  5H37 D;  3KW6 A;  2KZU A;  1FNN A;  3I4Y A;  1MJG M;  2Z8Y M;  3FRI A;  3L28 A;  3T6P A;  4JXJ A;  4LZJ A;  4OVZ A;  3SAS A;  1K3W A;  2R18 A;  3GLG E;  4JI6 M;  1IXS A;  3B7N A;  1HNZ M;  1Y8G A;  4B3T M;  1XHB A;  2QCU A;  2XZF A;  2LVO C;  3L2A A;  5FTJ A;  2YR0 A;  1QUS A;  1D0L A;  1GO5 A;  3PNV A;  4F1I A;  2MR9 A;  4LF5 M;  1OFH A;  2KXE A;  2YQZ A;  2XLJ A;  4DV5 M;  1BVS A;  3LVW A;  1WJ7 A;  3FTD A;  2JNH A;  2OOA A;  4QHT A;  4PD2 A;  5FTL A;  4LJ5 A;  4LJ4 A;  1NV8 A;  1R7R A;  1WGL A; 
#chains in the Genus database with same CATH homology
 1IFY A;  2DAM A;  2DI0 A;  3LCV B;  2OO9 A;  2DAE A;  2LVA A;  1OKS A;  5DFL A;  1DV0 A;  3BBZ A;  1VEK A;  2QSF X;  2EKK A;  3E21 A;  2K0B X;  1XB2 B;  2KNZ A;  4R71 A;  1QZE A;  1F4I A;  1Q02 A;  2LBC A;  1NV9 A;  3H4J A;  1TTE A;  3FRH A;  1JR3 E;  2MRO B;  1G41 A;  2DAK A;  4WP2 A;  2HWJ A;  2DNA A;  2JP7 A;  2JUJ A;  2L4F A;  1EFU B;  2RRU A;  1T43 A;  4F2L A;  2JY6 B;  1R4G A;  3K9O A;  1OTR A;  2KNV A;  3GLI E;  2K9D A;  2BWB A;  2MGW A;  3B89 A;  1ZV1 A;  1TR8 A;  1VEJ A;  2JY7 A;  1CUK A;  2DAG A;  1G3I A;  1T6O A;  1A5T A;  1PGY A;  2H5X A;  2O25 A;  4HEO A;  1VG5 A;  2QHO B;  2G3Q A;  2DHY A;  1V92 A;  2CWB A;  1VQ1 A;  1C7Y A;  2JZ0 A;  1DO0 A;  2KHH A;  4G3O A;  4UN2 B;  2JY5 A;  2R0I A;  2LVP C;  3IHP A;  1VEG A;  2DEN A;  2HAK A;  1WR1 B;  2ZTD A;  4Q7J A;  2EKF A;  2EJS A;  1OQY A;  3GLH E;  2QNJ A;  1OAI A;  3E46 A;  2L2D A;  3MMP A;  2LVN C;  1KYI A;  4DBG B;  1IM2 A;  1ZMV A;  2L4E A;  2ZTC A;  1WIV A;  2JY8 A;  1XXH E;  2OOB A;  2DZL A;  3IEC A;  1HQY E;  1P3Q Q;  1G4A E;  3F92 A;  1HJP A;  2JZ1 A;  1SG9 A;  3FE3 A;  4GEW A;  2BWE A;  3K9P A;  1DO2 A;  2WZJ A;  1VDL A;  3FRI A;  1HT1 E;  2KNA A;  3T6P A;  1ZMW A;  1HT2 E;  2DAI A;  3GLG E;  1IXS A;  1UFZ A;  2LVQ D;  1Y8G A;  1WHC A;  1E94 E;  2LVO C;  1MN3 A;  2MJ5 B;  1GO5 A;  2B3T A;  4F1I A;  2MR9 A;  1ZMU A;  1YLA A;  3LCU A;  5JI2 E;  2CP8 A;  1WGN A;  1BVS A;  2LTU A;  1WJ7 A;  2DKL A;  2JNH A;  2OOA A;  3GLF E;  1AIP C;  1NV8 A;  1WGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...