2LTUA

Solution structure of autoinhibitory domain of human amp-activated protein kinase catalytic subunit
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
GPHMSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of autoinhibitory domain of human AMP-activated protein kinase catalytic subunit
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-2
total genus 21
structure length 62
sequence length 62
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ltuA00
1HQYE 2LVPC 2DAGA 1JR3E 2DAMA 2OOBA 3IHPA 1UFZA 2KHHA 3LCUA 1G4AE 2DAEA 1YLAA 2MGWA 1OQYA 2K0BX 2HWJA 2DENA 2LVNC 2K9DA 3K9PA 1VEJA 2JY8A 3IECA 2HAKA 2EKFA 2DAIA 3LCVB 1VQ1A 2KNVA 2JY6B 2WZJA 1VDLA 1HT2E 2OOAA 1E94E 2ZTCA 2OO9A 2LVOC 2CWBA 2DNAA 2LVQD 2KNZA 2G3QA 2L4EA 4GEWA 2JNHA 1DO0A 2QSFX 1TR8A 4G3OA 2LBCA 1KYIA 1QZEA 1G41A 2JY7A 2R0IA 4F1IA 1GO5A 1Y8GA 3BBZA 2BWBA 1G3IA 1HT1E 2L4FA 5DFLA 1ZMWA 4R71A 2DHYA 2QHOB 2O25A 1WR1B 3T6PA 2MJ5B 3FRIA 2JUJA 1OKSA 2DKLA 1NV9A 1HJPA 1DV0A 2H5XA 1XB2B 1WHCA 1ZMVA 1VEGA 3MMPA 1OAIA 2QNJA 1VEKA 2DZLA 1CUKA 1R4GA 2DI0A 2JZ0A 3FE3A 2RRUA 1VG5A 2MROB 1BVSA 2B3TA 2JP7A 3GLIE 1T43A 1DO2A 2EJSA 2LTUA 1OTRA 1TTEA 3GLFE 3H4JA 1XXHE 3GLGE 5JI2E 4WP2A 1V92A 2CP8A 2L2DA 2MR9A 2KNAA 1IXSA 1Q02A 3GLHE 2BWEA 1WJ7A 3F92A 1WGLA 3E46A 1C7YA 1MN3A 2EKKA 2DAKA 4Q7JA 1ZV1A 3K9OA 1ZMUA 2ZTDA 4DBGB 1WGNA 1IM2A 1EFUB 2LVAA 4HEOA 1AIPC 1A5TA 1PGYA 1WIVA 1F4IA 4UN2B 1SG9A 1NV8A 3E21A 1P3QQ 2JY5A 2JZ1A 3B89A 4F2LA 1T6OA 1IFYA 3FRHA
chains in the Genus database with same CATH superfamily
2UXCM 1JQJC 2DAGA 4LGMA 3KS4A 1JB0F 3HGIA 3J2PB 5EP1A 1RU3A 3TE6A 1E32A 4IBEA 2K47A 4B7GA 4AG6A 3AV0A 2R6FA 4MGKE 4BBAA 5BPVA 2FNAA 2K0BX 3VDPA 5IREB 4M0WA 3HZJA 2DENA 3GLIB 3NBIA 4ITQA 2LHCA 2LVNC 1Q39A 1NHGC 4IBKA 1VEJA 2C96A 1NJFA 2VIIA 4AQYM 2UUCM 5DYGA 2EKFA 3THGA 2DAIA 2JWSA 3GP1A 2DWNA 1QQWA 1N78A 2EO2A 1YSYA 2C5RA 4L15A 3FTFA 1DGHB 3VFDA 4JI1M 5EXPA 4KHPM 2KNZA 3BXWA 1J7KA 4Y28F 3M7GA 2JNHA 2ERCA 4HL4A 3UK6A 4G6ZA 2L7HA 3U6SA 2XEPA 4LZJA 2O01F 1QAQA 2HL7A 1D2NA 4JXJA 3U6LA 5KO3A 3BOSA 3SASA 3GRYA 3JAMS 1QZEA 1L1ZA 1G41A 2KEBA 2JY7A 2QZ4A 4F1IA 1GO5A 2DZNB 3DFZA 3BBZA 4PD2A 3SAUA 3J7BA 2P5TA 1G3IA 3PNYA 1VDDA 4GC9A 1KSFX 1IY1A 2CHGA 5DFLA 5LMNM 1SXJC 3PFIA 2R4EA 2QHOB 1IN6A 2O25A 1L2DA 4LF6M 1SXJB 1WR1B 2R4JA 4W5WA 2WSCF 2RGHA 2CUZA 3GRVA 2RKOA 3HWSA 2YR0A 3RE8A 4JI6M 3A42A 1L2BA 3K92A 2CFOA 3DZDA 1OIZA 1XB2B 4PDIA 2DXIA 1IXSB 3WHKA 1PRBA 2LWXA 2V1CA 4PT5A 2Z3XA 3KVWA 2ZAMA 3UMMA 4FWGA 2DZLA 3EIEA 3CF6E 3SMSA 1QANA 2DI0A 2KRKA 3ZH9B 2DZOB 4A3VB 3FE3A 3K8ZA 4D81A 3J7AS 2RRUA 3AOGA 4II7A 1K3WA 3U61B 1E9RA 1H6UA 3CTWB 4IJFA 2DWMA 2B3TA 1DO2A 2LTUA 4DUZM 1XXHE 5ITQA 3Q8XA 5JI2E 4LJ5A 4LJ9A 3FTCA 1QDRA 2KZSA 1N75A 4NXMM 4REZA 1Q02A 1XXHA 3SYKA 1IY2A 3KP1E 1WJ7A 4DR7M 3F92A 1EIJA 5KPZA 3KSJA 2L09A 4L78A 4WURA 2XLJA 3ZC7B 3I04M 2DAKA 4RNAA 4Q7JA 4CGYB 2R46A 5DYIA 3PNVA 2OQ4A 3K9OA 4GMQA 2I7NA 3HX3A 3LQQA 3LVWA 2LVAA 3CGWA 4HLQA 4HEOA 5FTMA 3ILKA 2MH8A 1FNNA 1FJGM 1L8QA 2Z4SA 2NQ8C 2Q2EB 1SG9A 4UN2B 4B7HA 2H1RA 5E6JA 2CV0A 4IJEA 5EXTA 2M5ZA 4LZZA 3L28A 1W5SA 3I4VA 4KODA 2CV2A 1HNXM 4OX9M 4P17A 5C18A 3A45A 2ZBKB 2UXDM 1D0MA 3GO8A 3RGPA 1UFZA 2C9CA 2X8AA 3LCUA 4QNMA 1L1TA 2DAEA 1GJSA 1D0KA 1XXHB 2F5PA 4DV0M 1OQYA 1TH4A 1QAOA 3K9PA 2R45A 4MGZE 1SXJD 4X62M 2JY8A 4X65M 2HAKA 3GPXA 2N35A 2LH0A 3JR5A 4LF5M 2I7PA 3LCVB 2HHHM 4K0KM 2KNVA 2WZJA 1LTMA 2OOAA 1J09A 2XGNA 2OO9A 3TL4X 1Q3CA 2LVOC 4ZPXA 2CHVA 4RKUF 3HY5A 1J5EM 3GRRA 4AG5A 2Z8YM 3M6AA 3H4MA 2BNKA 3I01M 1I94M 2VF8A 4DR1M 3SAVA 4NC6A 3W0LB 5A2QS 1DGBA 1SXJE 1JR3A 2L6OA 4G3OA 2GQFA 2QPAA 1NY5A 4JI8M 1KYIA 2G8LA 3C3DA 2R0IA 1SXJA 3AKZA 3W0FA 1OIPA 4IBBA 1R2ZA 2JA2A 2WSEF 4NOOB 3AOEC 1QAMA 3B9PA 5EJCA 4B3TM 2F4VM 1ORYB 4AW4A 3E4RA 3A46A 2JUJA 1MX0A 1TH2A 1IQPA 2DKLA 2AHMA 4KO8A 1NO1A 3D8LA 1DGHA 3HHXA 4I8OA 4KT0F 4QOSA 1HJPA 4QNRA 1ZMVA 5FTJA 2C99A 2F5NA 3U61A 1N34M 2D7EA 3I51A 1NY6A 4YHHM 3AFHA 3NBXX 4R3DA 2R44A 3WHLA 1YE9A 3KW6A 3T1YM 2F5OA 1R4GA 4LFCM 4AKIA 4M0DA 2LXEA 3GLFA 4MGIE 1BVSA 2XFSA 4FD2A 2EA0A 4CISA 2QBYB 2VDBB 5KQDA 4NRVA 4DV4M 1S3SA 3FTDA 1PJIA 4NXNM 3GLFE 3U6MA 1HR0M 3GLHA 3FRHA 3TWMA 1HNZM 1V92A 2MR9A 3CF0A 3U5ZA 3FUTA 4NRWA 1IXSA 3IG8A 3TQSA 3GLHE 4FCVA 4Z8XA 4G4RA 4LFBM 4DV3M 1L2CA 1IN5A 1WGLA 3KSXA 4JI7M 2ZM6M 1ZV1A 4JV5M 4DR2M 1XMQM 2XFTA 1YUBA 3W68A 3ZCBB 1IM2A 1MU5A 5C1BA 1PGYA 2D7HA 2GNOA 3E9SA 4DV2M 4DR5M 3TWKA 3R8FA 3GLIA 3SAWA 3AJIB 1NV8A 2JZ1A 3B89A 2LHGA 4L4UA 4LRSA 3D8BA 3L2AA 4AKHA 1IFYA 3L26A 2Y21A 4PDGA 1X37A 3VK7A 1TH3A 1HQYE 2LVPC 2X4AA 3GLHB 3HJ8A 1JR3E 1XMOM 2OOBA 3IHPA 4IBDA 2KHHA 3T1HM 4OU7A 2JXNA 3T38A 5L8RF 1G4AE 2FFJA 1XNRM 1YLAA 3GQ4A 2C98A 2K6BA 5BR8M 3GLGB 2R62A 2HWJA 1OJLA 3GPYA 2BJVA 5FLXS 2K9DA 2CRUA 2O5RA 3QWLA 1NNJA 2YNMD 5EP3A 5ITXA 3J80S 4G4NA 3KOWE 4M9XA 1GL7A 2DVWB 4FWHA 1VQ1A 2V1UA 2JY6B 1LV7A 1R6BX 4GHLA 2APLA 3C3EA 5ITXE 3VDUA 2ZTCA 1E94E 1Z59A 4LY6A 1G59A 4LF9M 4LG2A 2CWBA 4TUWA 4RF1A 2DNAA 3SYLA 3M0EA 4D80A 3U6PA 3LMMA 2L4EA 2E5LM 4GEWA 2L7IA 1D0LA 2CHQA 5E26A 2Z4RA 3U6OA 1IN7A 4P16A 5IT9S 2BJWA 3FTEA 4M9ZA 3K1JA 3KP0E 2KZUA 3HU2A 3VLFB 2XZUA 1NSFA 2UXBM 3KS8A 3SFZA 1Y8GA 4LRTA 4YY3M 2BWBA 3HJQA 1OFIA 1HT1E 3FUUA 3FYCA 4B7FA 3KOZE 1IXRC 3B7ZA 4PCZA 4LF4M 1ZMWA 2DHYA 3J81S 3B7QA 5DNYA 4CHTB 3AL0C 3FRIA 3FYDA 1NV9A 4LCBA 1DV0A 4MH0E 4G4OA 2H5XA 3FUVA 4AZFA 2CEAA 3U6CA 3W67A 2OPFA 1WHCA 3TWLA 3GPPA 4IIWA 1N36M 2QQ8A 1PJTA 2A5YB 5F3WA 1UM8A 1QUSA 1OAIA 4MB7A 4EIWA 2YFQA 2QNJA 1VEKA 5IZ7D 4LJ8A 1V33A 1C1KA 1CUKA 4FCWA 1GJTA 2QENA 4LFAM 2MROB 2VQFM 3U60A 1GLNA 4LF7M 5EXXA 4IBFA 2ZANA 4LJ6A 4B3SM 1V34A 3UJNA 3C9PA 2EJSA 1N77A 1PM5A 3KOXE 1IXZA 1Z5BA 3MK6A 4RF0A 5EQTA 4DV6M 2G5GX 4OW0A 4DUYM 2L2DA 2CP8A 4IBJA 1QDTA 2BWEA 4I81A 3UZUA 4ANRA 1C7YA 3TPZA 3L25A 3V76A 1MN3A 3FUWA 3KDSE 4GH9A 2KA6B 5FTKA 1XWIA 3JR4A 4G4QA 1I4WA 4FVMA 5ITTA 3HKPA 1ZMUA 2QP9X 4DBGB 3GLFB 4DR6M 1WGNA 3FUXA 3GPUA 1EFUB 1OAOC 3SHGB 2UU9M 2FS1A 4GITA 2KRUA 1A5TA 2R18A 2R65A 3OTOM 4NSOB 3SARA 1F4IA 4JYAM 4X66M 4B3MM 2FE8A 4I4LA 3E21A 2KDLA 4F2LA 1DGFA 1T6OA 4OVZB 1G8PA 1EE8A 4LF8M 4B08A 2DWLA 3HJSA 1HQCA 3K2LA 3HHZA 4JI5M 3QAUA 4Z6YA 4LJAA 1GVNA 2DAMA 8CATA 4QOZC 3L29A 1PJJA 1IY0A 4B3RM 1Q3BA 4FCTA 4MGYE 2J7OA 1XC8A 2EUCA 2MGWA 3HU3A 2W82A 3PVSA 7CATA 4LJ7A 2UUBM 3HHYA 5FTLA 3KXEC 2WSFF 4L8RC 4XK8F 3QYBA 3DA1A 5H37D 5ITRA 2X49A 3VKGA 3IECA 1NVMA 1HNWM 2RGOA 4QHSA 1TGUA 3UGJA 1NJGA 1IBMM 3GRUA 3Q8GA 1G71A 4FW9A 1GABA 1VDLA 5KQ8A 4DV5M 1K82A 1HT2E 3FKEA 1KFVA 3R9XB 3PXGA 3T15A 4GKJM 1PJSA 3GQ5A 2LVQD 4GC5A 1MJGM 2G3QA 2DWZB 2YQZA 3LVVA 4D82A 4OVZA 2XZFA 1DO0A 2QSFX 3L27A 3B74A 1TR8A 2HKJA 1R2YA 1IBKM 2XH9A 1ZQ9A 1T3TA 1N33M 3SHFA 2LBCA 3U5ZB 3B7NA 4IBIA 4BLCA 3U6EA 3VK8A 4JI4M 2M60A 2FH0A 2F5SA 4JN6A 4R7GA 5ITYA 2L4FA 1PJQA 5LMUM 5EP4A 2XSZA 5KPRA 3SBJA 4R71A 1GKIA 1E9SA 3VKHA 1K3XA 2C9OA 4S12A 3T6PA 1QYRA 5KPTA 2MJ5B 2LNHC 1OKSA 3U6QA 1IBLM 4JI3M 1NHWC 3IG5A 5JI3E 2QCUA 2XF3A 1QVRA 4AKGA 2FOIC 2KW0A 1Z5CA 4FWDA 1Z6TA 5EXSA 3KFUG 1VEGA 1JR3D 3MMPA 4I5SA 4CJ6A 5ITUA 3U6DA 4BB9A 1R5LA 1XHBA 2CV1A 2DHRA 4DR3M 1XNQM 4AI6A 4XGIA 3RFWA 3QYEA 5FTNA 4GRIA 2JZ0A 2Y0QA 4IBCA 5EP2A 3AOEA 3LW5F 3ZQJA 1QZMA 3HU1A 1VG5A 3GLGA 4GKKM 2J5YA 1N32M 4X64M 4DV7M 3RGSA 2XSZD 3MJ5A 2JP7A 4LGYA 3CF2A 1DGGA 1T43A 3HHWA 3I4YA 4JI0M 1OTRA 3GLIE 1TTEA 3A98B 4L6V6 4MGHA 4L16A 3H4JA 3GLGE 4DV1M 4NL4H 2CE7A 4WP2A 4GIPA 2VF7A 4MM3B 1TDZA 1IN8A 1GL6A 2UUAM 1OFHA 2ZAOA 3EIHA 4LJ4A 2KNAA 2D7GA 4DR4M 1NNUC 3C58A 4GHAA 2V6ZM 2Y0TA 4KLNA 3E46A 3NWLA 3DOAA 3FD9A 1Z5AA 4XBOA 4CIZA 4JI2M 2EKKA 1TDHA 4QHTA 3KOYE 1QUTA 2VQEM 1WXQA 3SATA 2ZTDA 2QBYA 1TF0B 5GKNA 5IWAM 2Z7JA 3J27B 1W5TA 1AIPC 3LQRA 2HCBA 1R7RA 3MHVC 1WIVA 3SMPA 2F5QA 2KXEA 1P3QQ 2JY5A 3U60B 4IBGA 2J7NA 4NSRA 4WW0A 3GQ3A 3SC3A 2Y20A 1IN4A 1AUAA 4M9SA 5FSWA 1ZAEA
chains in the Genus database with same CATH topology
1HQYE 2LVPC 2DAGA 1JR3E 2DAMA 2OOBA 3IHPA 1UFZA 2KHHA 3LCUA 1G4AE 2DAEA 1YLAA 2MGWA 1OQYA 2K0BX 2HWJA 2DENA 2LVNC 2K9DA 3K9PA 1VEJA 2JY8A 3IECA 2HAKA 2EKFA 2DAIA 3LCVB 1VQ1A 2KNVA 2JY6B 2WZJA 1VDLA 1HT2E 2OOAA 1E94E 2ZTCA 2OO9A 2LVOC 2CWBA 2DNAA 2LVQD 2KNZA 2G3QA 2L4EA 4GEWA 2JNHA 1DO0A 2QSFX 1TR8A 4G3OA 2LBCA 1KYIA 1QZEA 1G41A 2JY7A 2R0IA 4F1IA 1GO5A 1Y8GA 3BBZA 2BWBA 1G3IA 1HT1E 2L4FA 5DFLA 1ZMWA 4R71A 2DHYA 2QHOB 2O25A 1WR1B 3T6PA 2MJ5B 3FRIA 2JUJA 1OKSA 2DKLA 1NV9A 1HJPA 1DV0A 2H5XA 1XB2B 1WHCA 1ZMVA 1VEGA 3MMPA 1OAIA 2QNJA 1VEKA 2DZLA 1CUKA 1R4GA 2DI0A 2JZ0A 3FE3A 2RRUA 1VG5A 2MROB 1BVSA 2B3TA 2JP7A 3GLIE 1T43A 1DO2A 2EJSA 2LTUA 1OTRA 1TTEA 3GLFE 3H4JA 1XXHE 3GLGE 5JI2E 4WP2A 1V92A 2CP8A 2L2DA 2MR9A 2KNAA 1IXSA 1Q02A 3GLHE 2BWEA 1WJ7A 3F92A 1WGLA 3E46A 1C7YA 1MN3A 2EKKA 2DAKA 4Q7JA 1ZV1A 3K9OA 1ZMUA 2ZTDA 4DBGB 1WGNA 1IM2A 1EFUB 2LVAA 4HEOA 1AIPC 1A5TA 1PGYA 1WIVA 1F4IA 4UN2B 1SG9A 1NV8A 3E21A 1P3QQ 2JY5A 2JZ1A 3B89A 4F2LA 1T6OA 1IFYA 3FRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQY E;  2LVP C;  2DAG A;  1JR3 E;  2DAM A;  2OOB A;  3IHP A;  1UFZ A;  2KHH A;  3LCU A;  1G4A E;  2DAE A;  1YLA A;  2MGW A;  1OQY A;  2K0B X;  2HWJ A;  2DEN A;  2LVN C;  2K9D A;  3K9P A;  1VEJ A;  2JY8 A;  3IEC A;  2HAK A;  2EKF A;  2DAI A;  3LCV B;  1VQ1 A;  2KNV A;  2JY6 B;  2WZJ A;  1VDL A;  1HT2 E;  2OOA A;  1E94 E;  2ZTC A;  2OO9 A;  2LVO C;  2CWB A;  2DNA A;  2LVQ D;  2KNZ A;  2G3Q A;  2L4E A;  4GEW A;  2JNH A;  1DO0 A;  2QSF X;  1TR8 A;  4G3O A;  2LBC A;  1KYI A;  1QZE A;  1G41 A;  2JY7 A;  2R0I A;  4F1I A;  1GO5 A;  1Y8G A;  3BBZ A;  2BWB A;  1G3I A;  1HT1 E;  2L4F A;  5DFL A;  1ZMW A;  4R71 A;  2DHY A;  2QHO B;  2O25 A;  1WR1 B;  3T6P A;  2MJ5 B;  3FRI A;  2JUJ A;  1OKS A;  2DKL A;  1NV9 A;  1HJP A;  1DV0 A;  2H5X A;  1XB2 B;  1WHC A;  1ZMV A;  1VEG A;  3MMP A;  1OAI A;  2QNJ A;  1VEK A;  2DZL A;  1CUK A;  1R4G A;  2DI0 A;  2JZ0 A;  3FE3 A;  2RRU A;  1VG5 A;  2MRO B;  1BVS A;  2B3T A;  2JP7 A;  3GLI E;  1T43 A;  1DO2 A;  2EJS A;  2LTU A;  1OTR A;  1TTE A;  3GLF E;  3H4J A;  1XXH E;  3GLG E;  5JI2 E;  4WP2 A;  1V92 A;  2CP8 A;  2L2D A;  2MR9 A;  2KNA A;  1IXS A;  1Q02 A;  3GLH E;  2BWE A;  1WJ7 A;  3F92 A;  1WGL A;  3E46 A;  1C7Y A;  1MN3 A;  2EKK A;  2DAK A;  4Q7J A;  1ZV1 A;  3K9O A;  1ZMU A;  2ZTD A;  4DBG B;  1WGN A;  1IM2 A;  1EFU B;  2LVA A;  4HEO A;  1AIP C;  1A5T A;  1PGY A;  1WIV A;  1F4I A;  4UN2 B;  1SG9 A;  1NV8 A;  3E21 A;  1P3Q Q;  2JY5 A;  2JZ1 A;  3B89 A;  4F2L A;  1T6O A;  1IFY A;  3FRH A; 
#chains in the Genus database with same CATH topology
 2UXC M;  1JQJ C;  2DAG A;  4LGM A;  3KS4 A;  1JB0 F;  3HGI A;  3J2P B;  5EP1 A;  1RU3 A;  3TE6 A;  1E32 A;  4IBE A;  2K47 A;  4B7G A;  4AG6 A;  3AV0 A;  2R6F A;  4MGK E;  4BBA A;  5BPV A;  2FNA A;  2K0B X;  3VDP A;  5IRE B;  4M0W A;  3HZJ A;  2DEN A;  3GLI B;  3NBI A;  4ITQ A;  2LHC A;  2LVN C;  1Q39 A;  1NHG C;  4IBK A;  1VEJ A;  2C96 A;  1NJF A;  2VII A;  4AQY M;  2UUC M;  5DYG A;  2EKF A;  3THG A;  2DAI A;  2JWS A;  3GP1 A;  2DWN A;  1QQW A;  1N78 A;  2EO2 A;  1YSY A;  2C5R A;  4L15 A;  3FTF A;  1DGH B;  3VFD A;  4JI1 M;  5EXP A;  4KHP M;  2KNZ A;  3BXW A;  1J7K A;  4Y28 F;  3M7G A;  2JNH A;  2ERC A;  4HL4 A;  3UK6 A;  4G6Z A;  2L7H A;  3U6S A;  2XEP A;  4LZJ A;  2O01 F;  1QAQ A;  2HL7 A;  1D2N A;  4JXJ A;  3U6L A;  5KO3 A;  3BOS A;  3SAS A;  3GRY A;  3JAM S;  1QZE A;  1L1Z A;  1G41 A;  2KEB A;  2JY7 A;  2QZ4 A;  4F1I A;  1GO5 A;  2DZN B;  3DFZ A;  3BBZ A;  4PD2 A;  3SAU A;  3J7B A;  2P5T A;  1G3I A;  3PNY A;  1VDD A;  4GC9 A;  1KSF X;  1IY1 A;  2CHG A;  5DFL A;  5LMN M;  1SXJ C;  3PFI A;  2R4E A;  2QHO B;  1IN6 A;  2O25 A;  1L2D A;  4LF6 M;  1SXJ B;  1WR1 B;  2R4J A;  4W5W A;  2WSC F;  2RGH A;  2CUZ A;  3GRV A;  2RKO A;  3HWS A;  2YR0 A;  3RE8 A;  4JI6 M;  3A42 A;  1L2B A;  3K92 A;  2CFO A;  3DZD A;  1OIZ A;  1XB2 B;  4PDI A;  2DXI A;  1IXS B;  3WHK A;  1PRB A;  2LWX A;  2V1C A;  4PT5 A;  2Z3X A;  3KVW A;  2ZAM A;  3UMM A;  4FWG A;  2DZL A;  3EIE A;  3CF6 E;  3SMS A;  1QAN A;  2DI0 A;  2KRK A;  3ZH9 B;  2DZO B;  4A3V B;  3FE3 A;  3K8Z A;  4D81 A;  3J7A S;  2RRU A;  3AOG A;  4II7 A;  1K3W A;  3U61 B;  1E9R A;  1H6U A;  3CTW B;  4IJF A;  2DWM A;  2B3T A;  1DO2 A;  2LTU A;  4DUZ M;  1XXH E;  5ITQ A;  3Q8X A;  5JI2 E;  4LJ5 A;  4LJ9 A;  3FTC A;  1QDR A;  2KZS A;  1N75 A;  4NXM M;  4REZ A;  1Q02 A;  1XXH A;  3SYK A;  1IY2 A;  3KP1 E;  1WJ7 A;  4DR7 M;  3F92 A;  1EIJ A;  5KPZ A;  3KSJ A;  2L09 A;  4L78 A;  4WUR A;  2XLJ A;  3ZC7 B;  3I04 M;  2DAK A;  4RNA A;  4Q7J A;  4CGY B;  2R46 A;  5DYI A;  3PNV A;  2OQ4 A;  3K9O A;  4GMQ A;  2I7N A;  3HX3 A;  3LQQ A;  3LVW A;  2LVA A;  3CGW A;  4HLQ A;  4HEO A;  5FTM A;  3ILK A;  2MH8 A;  1FNN A;  1FJG M;  1L8Q A;  2Z4S A;  2NQ8 C;  2Q2E B;  1SG9 A;  4UN2 B;  4B7H A;  2H1R A;  5E6J A;  2CV0 A;  4IJE A;  5EXT A;  2M5Z A;  4LZZ A;  3L28 A;  1W5S A;  3I4V A;  4KOD A;  2CV2 A;  1HNX M;  4OX9 M;  4P17 A;  5C18 A;  3A45 A;  2ZBK B;  2UXD M;  1D0M A;  3GO8 A;  3RGP A;  1UFZ A;  2C9C A;  2X8A A;  3LCU A;  4QNM A;  1L1T A;  2DAE A;  1GJS A;  1D0K A;  1XXH B;  2F5P A;  4DV0 M;  1OQY A;  1TH4 A;  1QAO A;  3K9P A;  2R45 A;  4MGZ E;  1SXJ D;  4X62 M;  2JY8 A;  4X65 M;  2HAK A;  3GPX A;  2N35 A;  2LH0 A;  3JR5 A;  4LF5 M;  2I7P A;  3LCV B;  2HHH M;  4K0K M;  2KNV A;  2WZJ A;  1LTM A;  2OOA A;  1J09 A;  2XGN A;  2OO9 A;  3TL4 X;  1Q3C A;  2LVO C;  4ZPX A;  2CHV A;  4RKU F;  3HY5 A;  1J5E M;  3GRR A;  4AG5 A;  2Z8Y M;  3M6A A;  3H4M A;  2BNK A;  3I01 M;  1I94 M;  2VF8 A;  4DR1 M;  3SAV A;  4NC6 A;  3W0L B;  5A2Q S;  1DGB A;  1SXJ E;  1JR3 A;  2L6O A;  4G3O A;  2GQF A;  2QPA A;  1NY5 A;  4JI8 M;  1KYI A;  2G8L A;  3C3D A;  2R0I A;  1SXJ A;  3AKZ A;  3W0F A;  1OIP A;  4IBB A;  1R2Z A;  2JA2 A;  2WSE F;  4NOO B;  3AOE C;  1QAM A;  3B9P A;  5EJC A;  4B3T M;  2F4V M;  1ORY B;  4AW4 A;  3E4R A;  3A46 A;  2JUJ A;  1MX0 A;  1TH2 A;  1IQP A;  2DKL A;  2AHM A;  4KO8 A;  1NO1 A;  3D8L A;  1DGH A;  3HHX A;  4I8O A;  4KT0 F;  4QOS A;  1HJP A;  4QNR A;  1ZMV A;  5FTJ A;  2C99 A;  2F5N A;  3U61 A;  1N34 M;  2D7E A;  3I51 A;  1NY6 A;  4YHH M;  3AFH A;  3NBX X;  4R3D A;  2R44 A;  3WHL A;  1YE9 A;  3KW6 A;  3T1Y M;  2F5O A;  1R4G A;  4LFC M;  4AKI A;  4M0D A;  2LXE A;  3GLF A;  4MGI E;  1BVS A;  2XFS A;  4FD2 A;  2EA0 A;  4CIS A;  2QBY B;  2VDB B;  5KQD A;  4NRV A;  4DV4 M;  1S3S A;  3FTD A;  1PJI A;  4NXN M;  3GLF E;  3U6M A;  1HR0 M;  3GLH A;  3FRH A;  3TWM A;  1HNZ M;  1V92 A;  2MR9 A;  3CF0 A;  3U5Z A;  3FUT A;  4NRW A;  1IXS A;  3IG8 A;  3TQS A;  3GLH E;  4FCV A;  4Z8X A;  4G4R A;  4LFB M;  4DV3 M;  1L2C A;  1IN5 A;  1WGL A;  3KSX A;  4JI7 M;  2ZM6 M;  1ZV1 A;  4JV5 M;  4DR2 M;  1XMQ M;  2XFT A;  1YUB A;  3W68 A;  3ZCB B;  1IM2 A;  1MU5 A;  5C1B A;  1PGY A;  2D7H A;  2GNO A;  3E9S A;  4DV2 M;  4DR5 M;  3TWK A;  3R8F A;  3GLI A;  3SAW A;  3AJI B;  1NV8 A;  2JZ1 A;  3B89 A;  2LHG A;  4L4U A;  4LRS A;  3D8B A;  3L2A A;  4AKH A;  1IFY A;  3L26 A;  2Y21 A;  4PDG A;  1X37 A;  3VK7 A;  1TH3 A;  1HQY E;  2LVP C;  2X4A A;  3GLH B;  3HJ8 A;  1JR3 E;  1XMO M;  2OOB A;  3IHP A;  4IBD A;  2KHH A;  3T1H M;  4OU7 A;  2JXN A;  3T38 A;  5L8R F;  1G4A E;  2FFJ A;  1XNR M;  1YLA A;  3GQ4 A;  2C98 A;  2K6B A;  5BR8 M;  3GLG B;  2R62 A;  2HWJ A;  1OJL A;  3GPY A;  2BJV A;  5FLX S;  2K9D A;  2CRU A;  2O5R A;  3QWL A;  1NNJ A;  2YNM D;  5EP3 A;  5ITX A;  3J80 S;  4G4N A;  3KOW E;  4M9X A;  1GL7 A;  2DVW B;  4FWH A;  1VQ1 A;  2V1U A;  2JY6 B;  1LV7 A;  1R6B X;  4GHL A;  2APL A;  3C3E A;  5ITX E;  3VDU A;  2ZTC A;  1E94 E;  1Z59 A;  4LY6 A;  1G59 A;  4LF9 M;  4LG2 A;  2CWB A;  4TUW A;  4RF1 A;  2DNA A;  3SYL A;  3M0E A;  4D80 A;  3U6P A;  3LMM A;  2L4E A;  2E5L M;  4GEW A;  2L7I A;  1D0L A;  2CHQ A;  5E26 A;  2Z4R A;  3U6O A;  1IN7 A;  4P16 A;  5IT9 S;  2BJW A;  3FTE A;  4M9Z A;  3K1J A;  3KP0 E;  2KZU A;  3HU2 A;  3VLF B;  2XZU A;  1NSF A;  2UXB M;  3KS8 A;  3SFZ A;  1Y8G A;  4LRT A;  4YY3 M;  2BWB A;  3HJQ A;  1OFI A;  1HT1 E;  3FUU A;  3FYC A;  4B7F A;  3KOZ E;  1IXR C;  3B7Z A;  4PCZ A;  4LF4 M;  1ZMW A;  2DHY A;  3J81 S;  3B7Q A;  5DNY A;  4CHT B;  3AL0 C;  3FRI A;  3FYD A;  1NV9 A;  4LCB A;  1DV0 A;  4MH0 E;  4G4O A;  2H5X A;  3FUV A;  4AZF A;  2CEA A;  3U6C A;  3W67 A;  2OPF A;  1WHC A;  3TWL A;  3GPP A;  4IIW A;  1N36 M;  2QQ8 A;  1PJT A;  2A5Y B;  5F3W A;  1UM8 A;  1QUS A;  1OAI A;  4MB7 A;  4EIW A;  2YFQ A;  2QNJ A;  1VEK A;  5IZ7 D;  4LJ8 A;  1V33 A;  1C1K A;  1CUK A;  4FCW A;  1GJT A;  2QEN A;  4LFA M;  2MRO B;  2VQF M;  3U60 A;  1GLN A;  4LF7 M;  5EXX A;  4IBF A;  2ZAN A;  4LJ6 A;  4B3S M;  1V34 A;  3UJN A;  3C9P A;  2EJS A;  1N77 A;  1PM5 A;  3KOX E;  1IXZ A;  1Z5B A;  3MK6 A;  4RF0 A;  5EQT A;  4DV6 M;  2G5G X;  4OW0 A;  4DUY M;  2L2D A;  2CP8 A;  4IBJ A;  1QDT A;  2BWE A;  4I81 A;  3UZU A;  4ANR A;  1C7Y A;  3TPZ A;  3L25 A;  3V76 A;  1MN3 A;  3FUW A;  3KDS E;  4GH9 A;  2KA6 B;  5FTK A;  1XWI A;  3JR4 A;  4G4Q A;  1I4W A;  4FVM A;  5ITT A;  3HKP A;  1ZMU A;  2QP9 X;  4DBG B;  3GLF B;  4DR6 M;  1WGN A;  3FUX A;  3GPU A;  1EFU B;  1OAO C;  3SHG B;  2UU9 M;  2FS1 A;  4GIT A;  2KRU A;  1A5T A;  2R18 A;  2R65 A;  3OTO M;  4NSO B;  3SAR A;  1F4I A;  4JYA M;  4X66 M;  4B3M M;  2FE8 A;  4I4L A;  3E21 A;  2KDL A;  4F2L A;  1DGF A;  1T6O A;  4OVZ B;  1G8P A;  1EE8 A;  4LF8 M;  4B08 A;  2DWL A;  3HJS A;  1HQC A;  3K2L A;  3HHZ A;  4JI5 M;  3QAU A;  4Z6Y A;  4LJA A;  1GVN A;  2DAM A;  8CAT A;  4QOZ C;  3L29 A;  1PJJ A;  1IY0 A;  4B3R M;  1Q3B A;  4FCT A;  4MGY E;  2J7O A;  1XC8 A;  2EUC A;  2MGW A;  3HU3 A;  2W82 A;  3PVS A;  7CAT A;  4LJ7 A;  2UUB M;  3HHY A;  5FTL A;  3KXE C;  2WSF F;  4L8R C;  4XK8 F;  3QYB A;  3DA1 A;  5H37 D;  5ITR A;  2X49 A;  3VKG A;  3IEC A;  1NVM A;  1HNW M;  2RGO A;  4QHS A;  1TGU A;  3UGJ A;  1NJG A;  1IBM M;  3GRU A;  3Q8G A;  1G71 A;  4FW9 A;  1GAB A;  1VDL A;  5KQ8 A;  4DV5 M;  1K82 A;  1HT2 E;  3FKE A;  1KFV A;  3R9X B;  3PXG A;  3T15 A;  4GKJ M;  1PJS A;  3GQ5 A;  2LVQ D;  4GC5 A;  1MJG M;  2G3Q A;  2DWZ B;  2YQZ A;  3LVV A;  4D82 A;  4OVZ A;  2XZF A;  1DO0 A;  2QSF X;  3L27 A;  3B74 A;  1TR8 A;  2HKJ A;  1R2Y A;  1IBK M;  2XH9 A;  1ZQ9 A;  1T3T A;  1N33 M;  3SHF A;  2LBC A;  3U5Z B;  3B7N A;  4IBI A;  4BLC A;  3U6E A;  3VK8 A;  4JI4 M;  2M60 A;  2FH0 A;  2F5S A;  4JN6 A;  4R7G A;  5ITY A;  2L4F A;  1PJQ A;  5LMU M;  5EP4 A;  2XSZ A;  5KPR A;  3SBJ A;  4R71 A;  1GKI A;  1E9S A;  3VKH A;  1K3X A;  2C9O A;  4S12 A;  3T6P A;  1QYR A;  5KPT A;  2MJ5 B;  2LNH C;  1OKS A;  3U6Q A;  1IBL M;  4JI3 M;  1NHW C;  3IG5 A;  5JI3 E;  2QCU A;  2XF3 A;  1QVR A;  4AKG A;  2FOI C;  2KW0 A;  1Z5C A;  4FWD A;  1Z6T A;  5EXS A;  3KFU G;  1VEG A;  1JR3 D;  3MMP A;  4I5S A;  4CJ6 A;  5ITU A;  3U6D A;  4BB9 A;  1R5L A;  1XHB A;  2CV1 A;  2DHR A;  4DR3 M;  1XNQ M;  4AI6 A;  4XGI A;  3RFW A;  3QYE A;  5FTN A;  4GRI A;  2JZ0 A;  2Y0Q A;  4IBC A;  5EP2 A;  3AOE A;  3LW5 F;  3ZQJ A;  1QZM A;  3HU1 A;  1VG5 A;  3GLG A;  4GKK M;  2J5Y A;  1N32 M;  4X64 M;  4DV7 M;  3RGS A;  2XSZ D;  3MJ5 A;  2JP7 A;  4LGY A;  3CF2 A;  1DGG A;  1T43 A;  3HHW A;  3I4Y A;  4JI0 M;  1OTR A;  3GLI E;  1TTE A;  3A98 B;  4L6V 6;  4MGH A;  4L16 A;  3H4J A;  3GLG E;  4DV1 M;  4NL4 H;  2CE7 A;  4WP2 A;  4GIP A;  2VF7 A;  4MM3 B;  1TDZ A;  1IN8 A;  1GL6 A;  2UUA M;  1OFH A;  2ZAO A;  3EIH A;  4LJ4 A;  2KNA A;  2D7G A;  4DR4 M;  1NNU C;  3C58 A;  4GHA A;  2V6Z M;  2Y0T A;  4KLN A;  3E46 A;  3NWL A;  3DOA A;  3FD9 A;  1Z5A A;  4XBO A;  4CIZ A;  4JI2 M;  2EKK A;  1TDH A;  4QHT A;  3KOY E;  1QUT A;  2VQE M;  1WXQ A;  3SAT A;  2ZTD A;  2QBY A;  1TF0 B;  5GKN A;  5IWA M;  2Z7J A;  3J27 B;  1W5T A;  1AIP C;  3LQR A;  2HCB A;  1R7R A;  3MHV C;  1WIV A;  3SMP A;  2F5Q A;  2KXE A;  1P3Q Q;  2JY5 A;  3U60 B;  4IBG A;  2J7N A;  4NSR A;  4WW0 A;  3GQ3 A;  3SC3 A;  2Y20 A;  1IN4 A;  1AUA A;  4M9S A;  5FSW A;  1ZAE A; 
#chains in the Genus database with same CATH homology
 1HQY E;  2LVP C;  2DAG A;  1JR3 E;  2DAM A;  2OOB A;  3IHP A;  1UFZ A;  2KHH A;  3LCU A;  1G4A E;  2DAE A;  1YLA A;  2MGW A;  1OQY A;  2K0B X;  2HWJ A;  2DEN A;  2LVN C;  2K9D A;  3K9P A;  1VEJ A;  2JY8 A;  3IEC A;  2HAK A;  2EKF A;  2DAI A;  3LCV B;  1VQ1 A;  2KNV A;  2JY6 B;  2WZJ A;  1VDL A;  1HT2 E;  2OOA A;  1E94 E;  2ZTC A;  2OO9 A;  2LVO C;  2CWB A;  2DNA A;  2LVQ D;  2KNZ A;  2G3Q A;  2L4E A;  4GEW A;  2JNH A;  1DO0 A;  2QSF X;  1TR8 A;  4G3O A;  2LBC A;  1KYI A;  1QZE A;  1G41 A;  2JY7 A;  2R0I A;  4F1I A;  1GO5 A;  1Y8G A;  3BBZ A;  2BWB A;  1G3I A;  1HT1 E;  2L4F A;  5DFL A;  1ZMW A;  4R71 A;  2DHY A;  2QHO B;  2O25 A;  1WR1 B;  3T6P A;  2MJ5 B;  3FRI A;  2JUJ A;  1OKS A;  2DKL A;  1NV9 A;  1HJP A;  1DV0 A;  2H5X A;  1XB2 B;  1WHC A;  1ZMV A;  1VEG A;  3MMP A;  1OAI A;  2QNJ A;  1VEK A;  2DZL A;  1CUK A;  1R4G A;  2DI0 A;  2JZ0 A;  3FE3 A;  2RRU A;  1VG5 A;  2MRO B;  1BVS A;  2B3T A;  2JP7 A;  3GLI E;  1T43 A;  1DO2 A;  2EJS A;  2LTU A;  1OTR A;  1TTE A;  3GLF E;  3H4J A;  1XXH E;  3GLG E;  5JI2 E;  4WP2 A;  1V92 A;  2CP8 A;  2L2D A;  2MR9 A;  2KNA A;  1IXS A;  1Q02 A;  3GLH E;  2BWE A;  1WJ7 A;  3F92 A;  1WGL A;  3E46 A;  1C7Y A;  1MN3 A;  2EKK A;  2DAK A;  4Q7J A;  1ZV1 A;  3K9O A;  1ZMU A;  2ZTD A;  4DBG B;  1WGN A;  1IM2 A;  1EFU B;  2LVA A;  4HEO A;  1AIP C;  1A5T A;  1PGY A;  1WIV A;  1F4I A;  4UN2 B;  1SG9 A;  1NV8 A;  3E21 A;  1P3Q Q;  2JY5 A;  2JZ1 A;  3B89 A;  4F2L A;  1T6O A;  1IFY A;  3FRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...