2LTUA

Solution structure of autoinhibitory domain of human amp-activated protein kinase catalytic subunit
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
GPHMSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-2
publication title Solution Structure of autoinhibitory domain of human AMP-activated protein kinase catalytic subunit
rcsb
source organism Homo sapiens
total genus 21
structure length 62
sequence length 62
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ltuA00
1HQYE 1AIPC 2DNAA 1A5TA 2DAEA 1CUKA 1T6OA 2JZ0A 1HT1E 2DZLA 2B3TA 1R4GA 2DI0A 2OOAA 4F1IA 1ZV1A 1XB2B 2DHYA 1IXSA 2KNAA 1G4AE 3FRHA 3GLIE 2HAKA 1G41A 2MROB 2QNJA 2JY6B 1WHCA 2DENA 1ZMWA 1G3IA 1PGYA 2LVPC 1KYIA 2ZTDA 1GO5A 5JI2E 1MN3A 1NV8A 1T43A 2OO9A 2DKLA 3K9OA 2K9DA 2CP8A 2MR9A 2DAGA 4Q7JA 2DAKA 1OAIA 2LTUA 1JR3E 2H5XA 3BBZA 2LBCA 2JY7A 2JNHA 3E46A 3IECA 2K0BX 3LCUA 2JZ1A 1DV0A 2JUJA 1OTRA 2LVQD 2QHOB 3E21A 1V92A 2CWBA 2R0IA 1TR8A 3MMPA 1DO0A 2LVNC 1TTEA 1IM2A 4WP2A 1Y8GA 2MJ5B 2EKFA 2DAMA 1OKSA 2BWEA 2HWJA 1WGLA 5DFLA 3GLGE 2KHHA 1P3QQ 1BVSA 1ZMVA 1NV9A 2G3QA 3F92A 3FE3A 2L2DA 4UN2B 1OQYA 1VEKA 1WR1B 2MGWA 4R71A 1UFZA 2LVAA 2EJSA 1WGNA 3GLFE 2LVOC 1Q02A 2ZTCA 1HJPA 2KNZA 1F4IA 2KNVA 4DBGB 1C7YA 1XXHE 2OOBA 1EFUB 4GEWA 1VG5A 1ZMUA 4G3OA 4F2LA 1E94E 1YLAA 3FRIA 1SG9A 3B89A 4HEOA 3T6PA 2L4EA 3GLHE 2JP7A 3K9PA 1VDLA 2BWBA 2QSFX 1VEGA 2WZJA 1WIVA 1QZEA 2JY8A 3IHPA 1IFYA 2DAIA 1DO2A 3LCVB 1HT2E 1VEJA 2RRUA 3H4JA 2JY5A 2O25A 2EKKA 2L4FA 1WJ7A 1VQ1A
chains in the Genus database with same CATH superfamily
1TH4A 2DWLA 1HQYE 2GNOA 4MGIE 1A5TA 4KT0F 3SYLA 3GLFB 3ZQJA 2BJVA 5FSWA 3IG8A 4JI2M 2B3TA 3GRYA 1R4GA 4BLCA 2OOAA 1QAQA 1IXZA 4LJ9A 1ZV1A 2EO2A 1YE9A 5EQTA 3Q8XA 4ANRA 2DWMA 2QBYB 2DHYA 1D0MA 2KNAA 1G4AE 5EP4A 2HAKA 1C1KA 3K92A 3NBXX 2KZUA 1NNUC 1IN4A 4JI8M 2RKOA 3CTWB 4DV2M 4K0KM 5ITRA 1HNXM 3B7QA 3W68A 4JYAM 3KOZE 2VDBB 2LVPC 4Z8XA 4DV3M 2ZTDA 3JAMS 4X62M 2RGOA 2LHGA 5JI2E 2JWSA 4LJ7A 1MN3A 4OU7A 3AOEC 3U6SA 2APLA 3RE8A 3I51A 5F3WA 4AKIA 3V76A 3GQ4A 3VKGA 2R6FA 3L26A 2J7OA 2K9DA 4PDIA 4JV5M 2CP8A 5GKNA 4OVZA 3MK6A 3AOEA 4GH9A 1JB0F 3J7AS 2O5RA 2UUAM 1G71A 4LF5M 2JXNA 2JY7A 2JNHA 2Z4RA 3GRVA 5DNYA 1ORYB 4MB7A 4CGYB 1GJTA 1D2NA 2Q2EB 5EXPA 4QOSA 2QHOB 3ZCBB 2JA2A 4LF7M 1V92A 3KOWE 2OPFA 3DZDA 2CHGA 4YHHM 3HU1A 3SAUA 4G4NA 4QHTA 2HWJA 4LJ5A 3GLGE 3GLFA 2I7PA 1ZMVA 4LGMA 4M0WA 2UU9M 3GQ3A 2L2DA 5E26A 3KXEC 4WURA 2D7HA 3A46A 2CRUA 1NJFA 1NHWC 1MJGM 3H4MA 4DV0M 4PT5A 4FWHA 4FCWA 3FTEA 1N33M 5H37D 4NXMM 4XBOA 1UM8A 3PVSA 3TWLA 5ITUA 4LY6A 2R44A 4IBIA 1C7YA 3SASA 2X4AA 3VKHA 3UGJA 4AW4A 2ZM6M 1K3WA 2OOBA 4G6ZA 4GEWA 3ZH9B 1W5TA 5L8RF 3LMMA 3C58A 4G4RA 1HNZM 2CV0A 4MGZE 4LGYA 4F2LA 3FRIA 2CV2A 3U61A 2L4EA 2QCUA 3GLHE 4B7HA 2Z8YM 3RGPA 1IY2A 4DV1M 2WZJA 3AJIB 4DR7M 3W0LB 2I7NA 2AHMA 1R6BX 1IBLM 1HT2E 3GLGB 4B3SM 3H4JA 4LG2A 2O25A 4JI7M 2UXDM 1QDRA 2DVWB 3HHZA 1DGBA 4HL4A 5IREB 4GHLA 2W82A 4MGHA 5LMNM 3GPYA 1XNRM 1J09A 3M0EA 5FTJA 5DYIA 3RGSA 4DR4M 2JZ0A 4CISA 1HT1E 1L1ZA 2DI0A 1ZAEA 4DV6M 3KDSE 4JI4M 3HHYA 2HCBA 4P17A 3HJQA 1V33A 4GHAA 3DOAA 2E5LM 1G41A 1N36M 4IBGA 2ZANA 5C18A 4GKJM 2JY6B 1WHCA 4IJEA 2DXIA 1QQWA 1Q3CA 4R7GA 4GKKM 1N75A 1Q39A 3SAVA 3PFIA 1ZMWA 3U6EA 3KFUG 1NY5A 5FTMA 3GLHB 2C96A 1V34A 1KYIA 4FCVA 4B7FA 1QAMA 2BNKA 1K3XA 1D0KA 1NV8A 1T43A 2QPAA 3SARA 3FTCA 2A5YB 3U60B 1EE8A 2P5TA 2C98A 4LJ8A 2OO9A 2Y0QA 2GQFA 5LMUM 3M6AA 2X8AA 2VIIA 4RKUF 1OIPA 2M60A 2R18A 3VDPA 1OAIA 4GRIA 2LTUA 1JR3E 2M5ZA 2R45A 4LRSA 4DV7M 4L78A 3C3DA 2XH9A 4R3DA 4L4UA 4AZFA 3T1HM 3HHWA 1NO1A 1OIZA 3KSXA 1NSFA 2LNHC 4M9SA 5KQDA 3IECA 1R5LA 2JZ1A 3B74A 4LFAM 3GLGA 1XC8A 2JUJA 1OTRA 3KOXE 4A3VB 3J81S 5EP1A 5EXSA 4GC5A 3E21A 1J5EM 3KS8A 3A45A 2UUCM 1W5SA 2R62A 1TDHA 3MMPA 2ERCA 1IM2A 2DHRA 2K6BA 2LWXA 4QNMA 4W5WA 4WP2A 1Y8GA 3WHLA 5A2QS 2EKFA 2DAMA 2O01F 1OKSA 2LXEA 3GPPA 2F5NA 4AI6A 1Z59A 3KW6A 4KLNA 2UXCM 1BVSA 4L8RC 4JI0M 4I4LA 3FE3A 2KDLA 4IBBA 3SHGB 1NHGC 3HX3A 4NXNM 1VEKA 1F4IA 4R71A 1UFZA 3GRUA 2EJSA 2N35A 4LCBA 4M9XA 2KRKA 4M9ZA 3SHFA 3TE6A 2XFTA 1AUAA 2CEAA 4G4QA 4IBJA 4LF8M 1E9SA 1HJPA 2KNZA 3AFHA 4X65M 3GLHA 3UZUA 3QYBA 2MH8A 2KW0A 3MJ5A 5IWAM 2Z3XA 4B3MM 2HKJA 4XGIA 4PCZA 3FUXA 2DZOB 3R9XB 4B08A 1ZMUA 1FJGM 1OAOC 3GPUA 4BBAA 2CE7A 2JP7A 3KVWA 3UJNA 3K9PA 3U6OA 1HNWM 2D7EA 2L09A 3B7ZA 1OJLA 1VDLA 1SXJE 2BWBA 2FS1A 3THGA 3TQSA 3U6QA 1VEGA 2QBYA 1XXHB 4LZZA 3U6CA 1DO2A 3SMPA 4YY3M 2YQZA 4ITQA 1IN7A 3HKPA 2C9CA 3QWLA 1LTMA 4I8OA 3UK6A 1RU3A 3E9SA 3PNVA 3WHKA 1R2YA 3T15A 2L4FA 4L15A 4MM3B 1WJ7A 4II7A 3DA1A 3VFDA 1D0LA 1VQ1A 1YSYA 1GKIA 3SC3A 3CGWA 1L2DA 1KFVA 2G5GX 1AIPC 5ITXE 1CUKA 1T6OA 1YUBA 2DZLA 3CF0A 3FUWA 4FW9A 1GJSA 4LF6M 4F1IA 4OX9M 1XNQM 5BR8M 3Q8GA 3JR4A 4PD2A 1DGFA 4DUZM 3GLIE 3KOYE 4REZA 3SYKA 1IY1A 2XEPA 3HJSA 2QNJA 2CV1A 3B7NA 3T1YM 4IJFA 2UUBM 2FFJA 2DENA 1FNNA 1E9RA 1G3IA 1PGYA 3FUUA 4DUYM 1QYRA 1Z5CA 3KS4A 4FWGA 1SXJB 4QOZC 4RF0A 2KEBA 1GVNA 5FTLA 1Z5BA 4QNRA 3U6MA 4DR6M 2F5PA 2XFSA 3LVVA 2CUZA 8CATA 5EXXA 3KP1E 4DR5M 1N77A 4JN6A 2DWNA 3AOGA 2KZSA 4NOOB 2MR9A 1N32M 1XWIA 1MX0A 2H5XA 5E6JA 1PM5A 2LBCA 4RF1A 1Q3BA 1T3TA 3ZC7B 3E46A 1OFIA 1PJTA 1QANA 1WXQA 1S3SA 2BJWA 3D8LA 3SBJA 2K0BX 1DV0A 2OQ4A 1TGUA 4LJ6A 3BXWA 3JR5A 4LF4M 2FOIC 5EP3A 3L29A 2FH0A 2CWBA 2R0IA 3GLIB 2LVNC 1TTEA 1XHBA 1PJJA 4LRTA 2CFOA 4OW0A 5ITTA 2ZAOA 2XZFA 3J2PB 1GLNA 2BWEA 3J80S 1WGLA 5DFLA 2K47A 2KHHA 1G59A 3W67A 1NV9A 3FUTA 2G3QA 3F92A 4OVZB 1TDZA 1IBMM 1IXSB 3L27A 4P16A 3L28A 2CHVA 1XMQM 1PRBA 3FD9A 4LJAA 2V6ZM 3KP0E 1L2CA 1I4WA 2KRUA 4BB9A 4LFBM 4JI5M 1SXJC 2VF8A 7CATA 1KSFX 1WR1B 2MGWA 2XZUA 2LVAA 2WSCF 5EJCA 1LV7A 1WGNA 2C5RA 3T38A 3DFZA 5ITQA 2HL7A 2ZTCA 4L6V6 2XGNA 3MHVC 2V1UA 4DR1M 4GMQA 1R7RA 3VLFB 4JXJA 2RGHA 2KNVA 3EIEA 4DBGB 4AQYM 1SXJA 3I04M 3HGIA 2YNMD 1QDTA 3GPXA 2EUCA 1R2ZA 1XXHE 1EFUB 3AKZA 3KSJA 3L25A 1IN8A 1SG9A 4IIWA 4LJ4A 1I94M 2HHHM 3FTFA 5ITYA 3T6PA 3K2LA 3TWKA 3E4RA 1QAOA 4Z6YA 3GO8A 3R8FA 2QSFX 3K1JA 2Y0TA 3IG5A 2Y20A 4I5SA 3HU3A 3FYDA 1X37A 1QZEA 3SFZA 2J7NA 2JY8A 3I01M 3IHPA 3UMMA 2QZ4A 2KA6B 1PJIA 4JI6M 3LCVB 1IFYA 1NY6A 1DGGA 5ITXA 4GIPA 1DGHB 2LHCA 4QHSA 4FD2A 3RFWA 4FCTA 1IQPA 4PDGA 1NNJA 1L2BA 4D80A 4LF9M 3U6LA 3W0FA 2ZAMA 4JI1M 1NVMA 4GC9A 4NL4H 4IBEA 2NQ8C 1L1TA 3GLIA 2DNAA 4NRVA 5KQ8A 2DAEA 3SAWA 3VK8A 2YR0A 3EIHA 3U61B 3VK7A 3J7BA 3U60A 2VF7A 3I4YA 1L8QA 4KODA 3HU2A 2L6OA 5DYGA 1XB2B 4CJ6A 1EIJA 4S12A 5JI3E 1IXSA 4AG5A 2D7GA 3FRHA 3K8ZA 3A98B 2MROB 2R46A 1SXJD 3C9PA 2QP9X 2EA0A 4KO8A 2FNAA 4X66M 4DR3M 4FWDA 3GP1A 1TH2A 5FLXS 4ZPXA 3C3EA 4FVMA 4MGYE 2VQFM 1GO5A 3HY5A 4KHPM 2C99A 4JI3M 4NSOB 3U5ZB 1JQJC 2YFQA 4DV5M 4Y28F 3K9OA 1H6UA 2DKLA 1IN6A 4L16A 4EIWA 4MH0E 1Z6TA 3OTOM 2F5SA 1QZMA 2WSEF 1Z5AA 2DAGA 1PJSA 2FE8A 4Q7JA 2Y21A 4I81A 2DAKA 1ZQ9A 2KXEA 3U6PA 2WSFF 3BBZA 2J5YA 3LVWA 5BPVA 4AKHA 3QYEA 1MU5A 1QVRA 2C9OA 2QENA 2XSZA 2XLJA 1K82A 3FUVA 4B3TM 1E32A 1QUTA 3LCUA 4RNAA 1XMOM 1DGHA 5KPZA 1IBKM 3LQRA 2LVQD 1N78A 3TPZA 4AKGA 1J7KA 1GL7A 1IY0A 1TH3A 2UXBM 1TR8A 3TWMA 1DO0A 3FKEA 3QAUA 2F5OA 4NRWA 3HZJA 5KPTA 5EP2A 1JR3A 2R65A 3SATA 2MJ5B 2DZNB 3CF6E 2Z7JA 3NBIA 4LFCM 3GRRA 1TF0B 3AV0A 4MGKE 3L2AA 1P3QQ 5KO3A 2LH0A 2R4EA 4D81A 4DV4M 3VDUA 4IBFA 3LQQA 3HWSA 2XF3A 4UN2B 4NC6A 1QUSA 5IZ7D 1OQYA 1GL6A 4LZJA 1GABA 3ILKA 4B7GA 4IBDA 2G8LA 2V1CA 1XXHA 4WW0A 5FTNA 3GLFE 5IT9S 2LVOC 4G4OA 1N34M 1Q02A 2QQ8A 2X49A 2ZBKB 3B9PA 3M7GA 4D82A 3U6DA 4NSRA 1HR0M 4CHTB 3AL0C 1G8PA 3PNYA 4X64M 2VQEM 3NWLA 1IN5A 3GQ5A 2R4JA 2F4VM 1VG5A 2XSZD 3U5ZA 4G3OA 1E94E 1YLAA 3B89A 3FYCA 1PJQA 3D8BA 4HEOA 5FTKA 1OFHA 3FTDA 4IBCA 2F5QA 3A42A 4HLQA 3I4VA 4AG6A 4B3RM 3BOSA 2L7HA 2DWZB 1WIVA 5EXTA 4TUWA 1IXRC 4DR2M 2DAIA 4GITA 1JR3D 4IBKA 4M0DA 1VEJA 3CF2A 3HJ8A 4CIZA 1HQCA 2L7IA 2RRUA 2Z4SA 2JY5A 5KPRA 1VDDA 1NJGA 2EKKA 2H1RA 3LW5F 3TL4X 3PXGA 5C1BA 4XK8F 3J27B 2CHQA 3HHXA 3SMSA
chains in the Genus database with same CATH topology
1HQYE 1AIPC 2DNAA 1A5TA 2DAEA 1CUKA 1T6OA 2JZ0A 1HT1E 2DZLA 2B3TA 1R4GA 2DI0A 2OOAA 4F1IA 1ZV1A 1XB2B 2DHYA 1IXSA 2KNAA 1G4AE 3FRHA 3GLIE 2HAKA 1G41A 2MROB 2QNJA 2JY6B 1WHCA 2DENA 1ZMWA 1G3IA 1PGYA 2LVPC 1KYIA 2ZTDA 1GO5A 5JI2E 1MN3A 1NV8A 1T43A 2OO9A 2DKLA 3K9OA 2K9DA 2CP8A 2MR9A 2DAGA 4Q7JA 2DAKA 1OAIA 2LTUA 1JR3E 2H5XA 3BBZA 2LBCA 2JY7A 2JNHA 3E46A 3IECA 2K0BX 3LCUA 2JZ1A 1DV0A 2JUJA 1OTRA 2LVQD 2QHOB 3E21A 1V92A 2CWBA 2R0IA 1TR8A 3MMPA 1DO0A 2LVNC 1TTEA 1IM2A 4WP2A 1Y8GA 2MJ5B 2EKFA 2DAMA 1OKSA 2BWEA 2HWJA 1WGLA 5DFLA 3GLGE 2KHHA 1P3QQ 1BVSA 1ZMVA 1NV9A 2G3QA 3F92A 3FE3A 2L2DA 4UN2B 1OQYA 1VEKA 1WR1B 2MGWA 4R71A 1UFZA 2LVAA 2EJSA 1WGNA 3GLFE 2LVOC 1Q02A 2ZTCA 1HJPA 2KNZA 1F4IA 2KNVA 4DBGB 1C7YA 1XXHE 2OOBA 1EFUB 4GEWA 1VG5A 1ZMUA 4G3OA 4F2LA 1E94E 1YLAA 3FRIA 1SG9A 3B89A 4HEOA 3T6PA 2L4EA 3GLHE 2JP7A 3K9PA 1VDLA 2BWBA 2QSFX 1VEGA 2WZJA 1WIVA 1QZEA 2JY8A 3IHPA 1IFYA 2DAIA 1DO2A 3LCVB 1HT2E 1VEJA 2RRUA 3H4JA 2JY5A 2O25A 2EKKA 2L4FA 1WJ7A 1VQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQY E;  1AIP C;  2DNA A;  1A5T A;  2DAE A;  1CUK A;  1T6O A;  2JZ0 A;  1HT1 E;  2DZL A;  2B3T A;  1R4G A;  2DI0 A;  2OOA A;  4F1I A;  1ZV1 A;  1XB2 B;  2DHY A;  1IXS A;  2KNA A;  1G4A E;  3FRH A;  3GLI E;  2HAK A;  1G41 A;  2MRO B;  2QNJ A;  2JY6 B;  1WHC A;  2DEN A;  1ZMW A;  1G3I A;  1PGY A;  2LVP C;  1KYI A;  2ZTD A;  1GO5 A;  5JI2 E;  1MN3 A;  1NV8 A;  1T43 A;  2OO9 A;  2DKL A;  3K9O A;  2K9D A;  2CP8 A;  2MR9 A;  2DAG A;  4Q7J A;  2DAK A;  1OAI A;  2LTU A;  1JR3 E;  2H5X A;  3BBZ A;  2LBC A;  2JY7 A;  2JNH A;  3E46 A;  3IEC A;  2K0B X;  3LCU A;  2JZ1 A;  1DV0 A;  2JUJ A;  1OTR A;  2LVQ D;  2QHO B;  3E21 A;  1V92 A;  2CWB A;  2R0I A;  1TR8 A;  3MMP A;  1DO0 A;  2LVN C;  1TTE A;  1IM2 A;  4WP2 A;  1Y8G A;  2MJ5 B;  2EKF A;  2DAM A;  1OKS A;  2BWE A;  2HWJ A;  1WGL A;  5DFL A;  3GLG E;  2KHH A;  1P3Q Q;  1BVS A;  1ZMV A;  1NV9 A;  2G3Q A;  3F92 A;  3FE3 A;  2L2D A;  4UN2 B;  1OQY A;  1VEK A;  1WR1 B;  2MGW A;  4R71 A;  1UFZ A;  2LVA A;  2EJS A;  1WGN A;  3GLF E;  2LVO C;  1Q02 A;  2ZTC A;  1HJP A;  2KNZ A;  1F4I A;  2KNV A;  4DBG B;  1C7Y A;  1XXH E;  2OOB A;  1EFU B;  4GEW A;  1VG5 A;  1ZMU A;  4G3O A;  4F2L A;  1E94 E;  1YLA A;  3FRI A;  1SG9 A;  3B89 A;  4HEO A;  3T6P A;  2L4E A;  3GLH E;  2JP7 A;  3K9P A;  1VDL A;  2BWB A;  2QSF X;  1VEG A;  2WZJ A;  1WIV A;  1QZE A;  2JY8 A;  3IHP A;  1IFY A;  2DAI A;  1DO2 A;  3LCV B;  1HT2 E;  1VEJ A;  2RRU A;  3H4J A;  2JY5 A;  2O25 A;  2EKK A;  2L4F A;  1WJ7 A;  1VQ1 A; 
#chains in the Genus database with same CATH topology
 1TH4 A;  2DWL A;  1HQY E;  2GNO A;  4MGI E;  1A5T A;  4KT0 F;  3SYL A;  3GLF B;  3ZQJ A;  2BJV A;  5FSW A;  3IG8 A;  4JI2 M;  2B3T A;  3GRY A;  1R4G A;  4BLC A;  2OOA A;  1QAQ A;  1IXZ A;  4LJ9 A;  1ZV1 A;  2EO2 A;  1YE9 A;  5EQT A;  3Q8X A;  4ANR A;  2DWM A;  2QBY B;  2DHY A;  1D0M A;  2KNA A;  1G4A E;  5EP4 A;  2HAK A;  1C1K A;  3K92 A;  3NBX X;  2KZU A;  1NNU C;  1IN4 A;  4JI8 M;  2RKO A;  3CTW B;  4DV2 M;  4K0K M;  5ITR A;  1HNX M;  3B7Q A;  3W68 A;  4JYA M;  3KOZ E;  2VDB B;  2LVP C;  4Z8X A;  4DV3 M;  2ZTD A;  3JAM S;  4X62 M;  2RGO A;  2LHG A;  5JI2 E;  2JWS A;  4LJ7 A;  1MN3 A;  4OU7 A;  3AOE C;  3U6S A;  2APL A;  3RE8 A;  3I51 A;  5F3W A;  4AKI A;  3V76 A;  3GQ4 A;  3VKG A;  2R6F A;  3L26 A;  2J7O A;  2K9D A;  4PDI A;  4JV5 M;  2CP8 A;  5GKN A;  4OVZ A;  3MK6 A;  3AOE A;  4GH9 A;  1JB0 F;  3J7A S;  2O5R A;  2UUA M;  1G71 A;  4LF5 M;  2JXN A;  2JY7 A;  2JNH A;  2Z4R A;  3GRV A;  5DNY A;  1ORY B;  4MB7 A;  4CGY B;  1GJT A;  1D2N A;  2Q2E B;  5EXP A;  4QOS A;  2QHO B;  3ZCB B;  2JA2 A;  4LF7 M;  1V92 A;  3KOW E;  2OPF A;  3DZD A;  2CHG A;  4YHH M;  3HU1 A;  3SAU A;  4G4N A;  4QHT A;  2HWJ A;  4LJ5 A;  3GLG E;  3GLF A;  2I7P A;  1ZMV A;  4LGM A;  4M0W A;  2UU9 M;  3GQ3 A;  2L2D A;  5E26 A;  3KXE C;  4WUR A;  2D7H A;  3A46 A;  2CRU A;  1NJF A;  1NHW C;  1MJG M;  3H4M A;  4DV0 M;  4PT5 A;  4FWH A;  4FCW A;  3FTE A;  1N33 M;  5H37 D;  4NXM M;  4XBO A;  1UM8 A;  3PVS A;  3TWL A;  5ITU A;  4LY6 A;  2R44 A;  4IBI A;  1C7Y A;  3SAS A;  2X4A A;  3VKH A;  3UGJ A;  4AW4 A;  2ZM6 M;  1K3W A;  2OOB A;  4G6Z A;  4GEW A;  3ZH9 B;  1W5T A;  5L8R F;  3LMM A;  3C58 A;  4G4R A;  1HNZ M;  2CV0 A;  4MGZ E;  4LGY A;  4F2L A;  3FRI A;  2CV2 A;  3U61 A;  2L4E A;  2QCU A;  3GLH E;  4B7H A;  2Z8Y M;  3RGP A;  1IY2 A;  4DV1 M;  2WZJ A;  3AJI B;  4DR7 M;  3W0L B;  2I7N A;  2AHM A;  1R6B X;  1IBL M;  1HT2 E;  3GLG B;  4B3S M;  3H4J A;  4LG2 A;  2O25 A;  4JI7 M;  2UXD M;  1QDR A;  2DVW B;  3HHZ A;  1DGB A;  4HL4 A;  5IRE B;  4GHL A;  2W82 A;  4MGH A;  5LMN M;  3GPY A;  1XNR M;  1J09 A;  3M0E A;  5FTJ A;  5DYI A;  3RGS A;  4DR4 M;  2JZ0 A;  4CIS A;  1HT1 E;  1L1Z A;  2DI0 A;  1ZAE A;  4DV6 M;  3KDS E;  4JI4 M;  3HHY A;  2HCB A;  4P17 A;  3HJQ A;  1V33 A;  4GHA A;  3DOA A;  2E5L M;  1G41 A;  1N36 M;  4IBG A;  2ZAN A;  5C18 A;  4GKJ M;  2JY6 B;  1WHC A;  4IJE A;  2DXI A;  1QQW A;  1Q3C A;  4R7G A;  4GKK M;  1N75 A;  1Q39 A;  3SAV A;  3PFI A;  1ZMW A;  3U6E A;  3KFU G;  1NY5 A;  5FTM A;  3GLH B;  2C96 A;  1V34 A;  1KYI A;  4FCV A;  4B7F A;  1QAM A;  2BNK A;  1K3X A;  1D0K A;  1NV8 A;  1T43 A;  2QPA A;  3SAR A;  3FTC A;  2A5Y B;  3U60 B;  1EE8 A;  2P5T A;  2C98 A;  4LJ8 A;  2OO9 A;  2Y0Q A;  2GQF A;  5LMU M;  3M6A A;  2X8A A;  2VII A;  4RKU F;  1OIP A;  2M60 A;  2R18 A;  3VDP A;  1OAI A;  4GRI A;  2LTU A;  1JR3 E;  2M5Z A;  2R45 A;  4LRS A;  4DV7 M;  4L78 A;  3C3D A;  2XH9 A;  4R3D A;  4L4U A;  4AZF A;  3T1H M;  3HHW A;  1NO1 A;  1OIZ A;  3KSX A;  1NSF A;  2LNH C;  4M9S A;  5KQD A;  3IEC A;  1R5L A;  2JZ1 A;  3B74 A;  4LFA M;  3GLG A;  1XC8 A;  2JUJ A;  1OTR A;  3KOX E;  4A3V B;  3J81 S;  5EP1 A;  5EXS A;  4GC5 A;  3E21 A;  1J5E M;  3KS8 A;  3A45 A;  2UUC M;  1W5S A;  2R62 A;  1TDH A;  3MMP A;  2ERC A;  1IM2 A;  2DHR A;  2K6B A;  2LWX A;  4QNM A;  4W5W A;  4WP2 A;  1Y8G A;  3WHL A;  5A2Q S;  2EKF A;  2DAM A;  2O01 F;  1OKS A;  2LXE A;  3GPP A;  2F5N A;  4AI6 A;  1Z59 A;  3KW6 A;  4KLN A;  2UXC M;  1BVS A;  4L8R C;  4JI0 M;  4I4L A;  3FE3 A;  2KDL A;  4IBB A;  3SHG B;  1NHG C;  3HX3 A;  4NXN M;  1VEK A;  1F4I A;  4R71 A;  1UFZ A;  3GRU A;  2EJS A;  2N35 A;  4LCB A;  4M9X A;  2KRK A;  4M9Z A;  3SHF A;  3TE6 A;  2XFT A;  1AUA A;  2CEA A;  4G4Q A;  4IBJ A;  4LF8 M;  1E9S A;  1HJP A;  2KNZ A;  3AFH A;  4X65 M;  3GLH A;  3UZU A;  3QYB A;  2MH8 A;  2KW0 A;  3MJ5 A;  5IWA M;  2Z3X A;  4B3M M;  2HKJ A;  4XGI A;  4PCZ A;  3FUX A;  2DZO B;  3R9X B;  4B08 A;  1ZMU A;  1FJG M;  1OAO C;  3GPU A;  4BBA A;  2CE7 A;  2JP7 A;  3KVW A;  3UJN A;  3K9P A;  3U6O A;  1HNW M;  2D7E A;  2L09 A;  3B7Z A;  1OJL A;  1VDL A;  1SXJ E;  2BWB A;  2FS1 A;  3THG A;  3TQS A;  3U6Q A;  1VEG A;  2QBY A;  1XXH B;  4LZZ A;  3U6C A;  1DO2 A;  3SMP A;  4YY3 M;  2YQZ A;  4ITQ A;  1IN7 A;  3HKP A;  2C9C A;  3QWL A;  1LTM A;  4I8O A;  3UK6 A;  1RU3 A;  3E9S A;  3PNV A;  3WHK A;  1R2Y A;  3T15 A;  2L4F A;  4L15 A;  4MM3 B;  1WJ7 A;  4II7 A;  3DA1 A;  3VFD A;  1D0L A;  1VQ1 A;  1YSY A;  1GKI A;  3SC3 A;  3CGW A;  1L2D A;  1KFV A;  2G5G X;  1AIP C;  5ITX E;  1CUK A;  1T6O A;  1YUB A;  2DZL A;  3CF0 A;  3FUW A;  4FW9 A;  1GJS A;  4LF6 M;  4F1I A;  4OX9 M;  1XNQ M;  5BR8 M;  3Q8G A;  3JR4 A;  4PD2 A;  1DGF A;  4DUZ M;  3GLI E;  3KOY E;  4REZ A;  3SYK A;  1IY1 A;  2XEP A;  3HJS A;  2QNJ A;  2CV1 A;  3B7N A;  3T1Y M;  4IJF A;  2UUB M;  2FFJ A;  2DEN A;  1FNN A;  1E9R A;  1G3I A;  1PGY A;  3FUU A;  4DUY M;  1QYR A;  1Z5C A;  3KS4 A;  4FWG A;  1SXJ B;  4QOZ C;  4RF0 A;  2KEB A;  1GVN A;  5FTL A;  1Z5B A;  4QNR A;  3U6M A;  4DR6 M;  2F5P A;  2XFS A;  3LVV A;  2CUZ A;  8CAT A;  5EXX A;  3KP1 E;  4DR5 M;  1N77 A;  4JN6 A;  2DWN A;  3AOG A;  2KZS A;  4NOO B;  2MR9 A;  1N32 M;  1XWI A;  1MX0 A;  2H5X A;  5E6J A;  1PM5 A;  2LBC A;  4RF1 A;  1Q3B A;  1T3T A;  3ZC7 B;  3E46 A;  1OFI A;  1PJT A;  1QAN A;  1WXQ A;  1S3S A;  2BJW A;  3D8L A;  3SBJ A;  2K0B X;  1DV0 A;  2OQ4 A;  1TGU A;  4LJ6 A;  3BXW A;  3JR5 A;  4LF4 M;  2FOI C;  5EP3 A;  3L29 A;  2FH0 A;  2CWB A;  2R0I A;  3GLI B;  2LVN C;  1TTE A;  1XHB A;  1PJJ A;  4LRT A;  2CFO A;  4OW0 A;  5ITT A;  2ZAO A;  2XZF A;  3J2P B;  1GLN A;  2BWE A;  3J80 S;  1WGL A;  5DFL A;  2K47 A;  2KHH A;  1G59 A;  3W67 A;  1NV9 A;  3FUT A;  2G3Q A;  3F92 A;  4OVZ B;  1TDZ A;  1IBM M;  1IXS B;  3L27 A;  4P16 A;  3L28 A;  2CHV A;  1XMQ M;  1PRB A;  3FD9 A;  4LJA A;  2V6Z M;  3KP0 E;  1L2C A;  1I4W A;  2KRU A;  4BB9 A;  4LFB M;  4JI5 M;  1SXJ C;  2VF8 A;  7CAT A;  1KSF X;  1WR1 B;  2MGW A;  2XZU A;  2LVA A;  2WSC F;  5EJC A;  1LV7 A;  1WGN A;  2C5R A;  3T38 A;  3DFZ A;  5ITQ A;  2HL7 A;  2ZTC A;  4L6V 6;  2XGN A;  3MHV C;  2V1U A;  4DR1 M;  4GMQ A;  1R7R A;  3VLF B;  4JXJ A;  2RGH A;  2KNV A;  3EIE A;  4DBG B;  4AQY M;  1SXJ A;  3I04 M;  3HGI A;  2YNM D;  1QDT A;  3GPX A;  2EUC A;  1R2Z A;  1XXH E;  1EFU B;  3AKZ A;  3KSJ A;  3L25 A;  1IN8 A;  1SG9 A;  4IIW A;  4LJ4 A;  1I94 M;  2HHH M;  3FTF A;  5ITY A;  3T6P A;  3K2L A;  3TWK A;  3E4R A;  1QAO A;  4Z6Y A;  3GO8 A;  3R8F A;  2QSF X;  3K1J A;  2Y0T A;  3IG5 A;  2Y20 A;  4I5S A;  3HU3 A;  3FYD A;  1X37 A;  1QZE A;  3SFZ A;  2J7N A;  2JY8 A;  3I01 M;  3IHP A;  3UMM A;  2QZ4 A;  2KA6 B;  1PJI A;  4JI6 M;  3LCV B;  1IFY A;  1NY6 A;  1DGG A;  5ITX A;  4GIP A;  1DGH B;  2LHC A;  4QHS A;  4FD2 A;  3RFW A;  4FCT A;  1IQP A;  4PDG A;  1NNJ A;  1L2B A;  4D80 A;  4LF9 M;  3U6L A;  3W0F A;  2ZAM A;  4JI1 M;  1NVM A;  4GC9 A;  4NL4 H;  4IBE A;  2NQ8 C;  1L1T A;  3GLI A;  2DNA A;  4NRV A;  5KQ8 A;  2DAE A;  3SAW A;  3VK8 A;  2YR0 A;  3EIH A;  3U61 B;  3VK7 A;  3J7B A;  3U60 A;  2VF7 A;  3I4Y A;  1L8Q A;  4KOD A;  3HU2 A;  2L6O A;  5DYG A;  1XB2 B;  4CJ6 A;  1EIJ A;  4S12 A;  5JI3 E;  1IXS A;  4AG5 A;  2D7G A;  3FRH A;  3K8Z A;  3A98 B;  2MRO B;  2R46 A;  1SXJ D;  3C9P A;  2QP9 X;  2EA0 A;  4KO8 A;  2FNA A;  4X66 M;  4DR3 M;  4FWD A;  3GP1 A;  1TH2 A;  5FLX S;  4ZPX A;  3C3E A;  4FVM A;  4MGY E;  2VQF M;  1GO5 A;  3HY5 A;  4KHP M;  2C99 A;  4JI3 M;  4NSO B;  3U5Z B;  1JQJ C;  2YFQ A;  4DV5 M;  4Y28 F;  3K9O A;  1H6U A;  2DKL A;  1IN6 A;  4L16 A;  4EIW A;  4MH0 E;  1Z6T A;  3OTO M;  2F5S A;  1QZM A;  2WSE F;  1Z5A A;  2DAG A;  1PJS A;  2FE8 A;  4Q7J A;  2Y21 A;  4I81 A;  2DAK A;  1ZQ9 A;  2KXE A;  3U6P A;  2WSF F;  3BBZ A;  2J5Y A;  3LVW A;  5BPV A;  4AKH A;  3QYE A;  1MU5 A;  1QVR A;  2C9O A;  2QEN A;  2XSZ A;  2XLJ A;  1K82 A;  3FUV A;  4B3T M;  1E32 A;  1QUT A;  3LCU A;  4RNA A;  1XMO M;  1DGH A;  5KPZ A;  1IBK M;  3LQR A;  2LVQ D;  1N78 A;  3TPZ A;  4AKG A;  1J7K A;  1GL7 A;  1IY0 A;  1TH3 A;  2UXB M;  1TR8 A;  3TWM A;  1DO0 A;  3FKE A;  3QAU A;  2F5O A;  4NRW A;  3HZJ A;  5KPT A;  5EP2 A;  1JR3 A;  2R65 A;  3SAT A;  2MJ5 B;  2DZN B;  3CF6 E;  2Z7J A;  3NBI A;  4LFC M;  3GRR A;  1TF0 B;  3AV0 A;  4MGK E;  3L2A A;  1P3Q Q;  5KO3 A;  2LH0 A;  2R4E A;  4D81 A;  4DV4 M;  3VDU A;  4IBF A;  3LQQ A;  3HWS A;  2XF3 A;  4UN2 B;  4NC6 A;  1QUS A;  5IZ7 D;  1OQY A;  1GL6 A;  4LZJ A;  1GAB A;  3ILK A;  4B7G A;  4IBD A;  2G8L A;  2V1C A;  1XXH A;  4WW0 A;  5FTN A;  3GLF E;  5IT9 S;  2LVO C;  4G4O A;  1N34 M;  1Q02 A;  2QQ8 A;  2X49 A;  2ZBK B;  3B9P A;  3M7G A;  4D82 A;  3U6D A;  4NSR A;  1HR0 M;  4CHT B;  3AL0 C;  1G8P A;  3PNY A;  4X64 M;  2VQE M;  3NWL A;  1IN5 A;  3GQ5 A;  2R4J A;  2F4V M;  1VG5 A;  2XSZ D;  3U5Z A;  4G3O A;  1E94 E;  1YLA A;  3B89 A;  3FYC A;  1PJQ A;  3D8B A;  4HEO A;  5FTK A;  1OFH A;  3FTD A;  4IBC A;  2F5Q A;  3A42 A;  4HLQ A;  3I4V A;  4AG6 A;  4B3R M;  3BOS A;  2L7H A;  2DWZ B;  1WIV A;  5EXT A;  4TUW A;  1IXR C;  4DR2 M;  2DAI A;  4GIT A;  1JR3 D;  4IBK A;  4M0D A;  1VEJ A;  3CF2 A;  3HJ8 A;  4CIZ A;  1HQC A;  2L7I A;  2RRU A;  2Z4S A;  2JY5 A;  5KPR A;  1VDD A;  1NJG A;  2EKK A;  2H1R A;  3LW5 F;  3TL4 X;  3PXG A;  5C1B A;  4XK8 F;  3J27 B;  2CHQ A;  3HHX A;  3SMS A; 
#chains in the Genus database with same CATH homology
 1HQY E;  1AIP C;  2DNA A;  1A5T A;  2DAE A;  1CUK A;  1T6O A;  2JZ0 A;  1HT1 E;  2DZL A;  2B3T A;  1R4G A;  2DI0 A;  2OOA A;  4F1I A;  1ZV1 A;  1XB2 B;  2DHY A;  1IXS A;  2KNA A;  1G4A E;  3FRH A;  3GLI E;  2HAK A;  1G41 A;  2MRO B;  2QNJ A;  2JY6 B;  1WHC A;  2DEN A;  1ZMW A;  1G3I A;  1PGY A;  2LVP C;  1KYI A;  2ZTD A;  1GO5 A;  5JI2 E;  1MN3 A;  1NV8 A;  1T43 A;  2OO9 A;  2DKL A;  3K9O A;  2K9D A;  2CP8 A;  2MR9 A;  2DAG A;  4Q7J A;  2DAK A;  1OAI A;  2LTU A;  1JR3 E;  2H5X A;  3BBZ A;  2LBC A;  2JY7 A;  2JNH A;  3E46 A;  3IEC A;  2K0B X;  3LCU A;  2JZ1 A;  1DV0 A;  2JUJ A;  1OTR A;  2LVQ D;  2QHO B;  3E21 A;  1V92 A;  2CWB A;  2R0I A;  1TR8 A;  3MMP A;  1DO0 A;  2LVN C;  1TTE A;  1IM2 A;  4WP2 A;  1Y8G A;  2MJ5 B;  2EKF A;  2DAM A;  1OKS A;  2BWE A;  2HWJ A;  1WGL A;  5DFL A;  3GLG E;  2KHH A;  1P3Q Q;  1BVS A;  1ZMV A;  1NV9 A;  2G3Q A;  3F92 A;  3FE3 A;  2L2D A;  4UN2 B;  1OQY A;  1VEK A;  1WR1 B;  2MGW A;  4R71 A;  1UFZ A;  2LVA A;  2EJS A;  1WGN A;  3GLF E;  2LVO C;  1Q02 A;  2ZTC A;  1HJP A;  2KNZ A;  1F4I A;  2KNV A;  4DBG B;  1C7Y A;  1XXH E;  2OOB A;  1EFU B;  4GEW A;  1VG5 A;  1ZMU A;  4G3O A;  4F2L A;  1E94 E;  1YLA A;  3FRI A;  1SG9 A;  3B89 A;  4HEO A;  3T6P A;  2L4E A;  3GLH E;  2JP7 A;  3K9P A;  1VDL A;  2BWB A;  2QSF X;  1VEG A;  2WZJ A;  1WIV A;  1QZE A;  2JY8 A;  3IHP A;  1IFY A;  2DAI A;  1DO2 A;  3LCV B;  1HT2 E;  1VEJ A;  2RRU A;  3H4J A;  2JY5 A;  2O25 A;  2EKK A;  2L4F A;  1WJ7 A;  1VQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...