2LTUA

Solution structure of autoinhibitory domain of human amp-activated protein kinase catalytic subunit
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
GPHMSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-2
publication title Solution Structure of autoinhibitory domain of human AMP-activated protein kinase catalytic subunit
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 62
sequence length 62
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ltuA00
3FRHA 1F4IA 3B89A 3LCVB 1E94E 1IXSA 2KNAA 3K9PA 2L4FA 2HWJA 1DO0A 2LVNC 3E21A 2CP8A 2MR9A 1G3IA 1VEKA 1Y8GA 2RRUA 2MROB 3F92A 1G4AE 1NV8A 1DO2A 2B3TA 2JZ0A 4HEOA 1IM2A 1BVSA 2LBCA 1WGLA 3GLHE 2CWBA 2DZLA 2KNVA 4R71A 1UFZA 1VDLA 1AIPC 2LVOC 2LVPC 2OOAA 1HJPA 2LVAA 1ZMUA 1OKSA 4WP2A 1JR3E 1P3QQ 2R0IA 4Q7JA 2JY6B 3LCUA 1VEJA 2L4EA 1Q02A 1HQYE 1A5TA 2DI0A 1PGYA 1OTRA 2LTUA 1TTEA 2JUJA 1GO5A 3BBZA 5DFLA 2WZJA 3FRIA 1VQ1A 2HAKA 1WGNA 2BWBA 2DNAA 4F1IA 2EKKA 2KNZA 2OO9A 2JY7A 1YLAA 4UN2B 2MJ5B 4G3OA 1ZV1A 4GEWA 3T6PA 3GLFE 3IHPA 1T6OA 1V92A 2LVQD 2DHYA 1WR1B 3H4JA 2DAIA 2OOBA 2QSFX 1G41A 1WHCA 2QNJA 1QZEA 5JI2E 1ZMWA 3GLIE 1C7YA 2O25A 2K0BX 3MMPA 2DKLA 2JNHA 1VEGA 1OQYA 3IECA 1KYIA 4F2LA 1IFYA 2EJSA 2JZ1A 2QHOB 3GLGE 3K9OA 1ZMVA 1HT2E 1HT1E 1R4GA 1DV0A 1SG9A 2KHHA 1XXHE 1OAIA 2DAGA 3E46A 3FE3A 1CUKA 2JP7A 2ZTCA 1WJ7A 2MGWA 1WIVA 1VG5A 4DBGB 2K9DA 2BWEA 2JY8A 2EKFA 1EFUB 2DENA 2DAMA 2L2DA 2H5XA 2DAEA 2ZTDA 2DAKA 2G3QA 2JY5A 1XB2B 1TR8A 1T43A 1NV9A 1MN3A
chains in the Genus database with same CATH superfamily
3LCVB 3SYKA 4CJ6A 1E94E 1J09A 1Q3CA 2LHCA 4DR3M 3A42A 1OJLA 2DHRA 3AV0A 1DGBA 2Y20A 4WW0A 1WXQA 4JI0M 3VLFB 3GPYA 3U6LA 2JA2A 2Z4SA 2HWJA 3VK8A 2BJVA 4A3VB 2EO2A 2R18A 3FUWA 1NJFA 2MR9A 4FCWA 2OQ4A 1HR0M 2DWMA 1Y8GA 1J5EM 3DFZA 2MROB 2VDBB 4LJ6A 4ZPXA 3GRVA 1XXHB 1W5SA 3KSXA 4B3SM 1NNUC 4JV5M 2B3TA 1DO2A 4GRIA 1SXJE 1NY6A 2KW0A 2ZM6M 4B3RM 4LF8M 4D81A 5KPTA 1IQPA 2OPFA 4AI6A 1VDLA 2LVPC 2C9OA 1L2CA 2QBYA 3TQSA 2HL7A 1N34M 1OKSA 1XWIA 1PJJA 4AKIA 4M9XA 2GQFA 5E26A 3U6QA 3GQ4A 5EP2A 4X66M 1L1TA 4K0KM 5DYGA 4LJ9A 1AUAA 5GKNA 3LW5F 4JI5M 4R3DA 4G4RA 2DI0A 2LTUA 1OTRA 1R6BX 2LHGA 2Y0TA 2KZSA 3BBZA 1G59A 5DFLA 3FRIA 3KSJA 4JI1M 2P5TA 2HAKA 4B3MM 2QZ4A 4LJ7A 2HHHM 4DR5M 3KP0E 1XNQM 1C1KA 1QVRA 5EXTA 2FFJA 2KA6B 2QBYB 4GKKM 1G71A 2XGNA 4F1IA 5FSWA 1GABA 4LJ8A 1Q3BA 2LXEA 2HCBA 2OO9A 2XSZD 4MB7A 4DR1M 5IZ7D 2R45A 3FYCA 3ZH9B 1GL6A 3AOGA 1MX0A 4PDGA 4FCVA 3U6OA 3W67A 5FTMA 3CTWB 3B7ZA 4KODA 4M0DA 3RFWA 2UUBM 3FTCA 4IBKA 3ZC7B 1WR1B 2C5RA 2DAIA 5ITQA 4MGKE 4RNAA 3U6MA 2QNJA 4NSRA 2J7NA 3NBIA 3PNVA 4FW9A 2CHQA 3MMPA 4IIWA 2DKLA 3L27A 1ZAEA 2I7NA 4D80A 3IECA 3GPXA 1D2NA 5EJCA 3V76A 3CF2A 4CIZA 1D0MA 1HQCA 4F2LA 1JR3D 4B7FA 4P17A 4Z8XA 3TWKA 1Z5AA 3IG5A 4M9SA 5H37D 1IN4A 3GLGE 2XH9A 1NHGC 3AFHA 1QAOA 2KHHA 2FS1A 4NRWA 3OTOM 3JAMS 3E46A 1LV7A 4FCTA 1VG5A 4QNMA 2K9DA 3KW6A 4DV7M 3UZUA 1EFUB 1IY1A 2DAMA 1FNNA 2KRUA 3I4YA 3KOXE 4GITA 5EP3A 4NXNM 3TL4X 4YY3M 1IBMM 4DR4M 2DAEA 1L1ZA 2A5YB 2RGOA 2ZAMA 3FTFA 1D0KA 4BBAA 2G3QA 2JY5A 3D8BA 2VQFM 4MGZE 1TR8A 2F5SA 2KNVA 3T1HM 4QOZC 4XBOA 8CATA 4QHSA 3L26A 3GLIA 3SBJA 2Z8YM 1NSFA 5ITYA 4JI6M 3FUTA 3L28A 2L4FA 2YFQA 1XMOM 1E32A 3VKGA 2K6BA 1PM5A 2UUAM 1N32M 3VDPA 2RRUA 2M5ZA 4ANRA 4CHTB 1IXZA 5LMUM 4JI8M 3U6CA 3LQRA 4FVMA 2NQ8C 1NVMA 2R62A 4DV6M 3I4VA 1BVSA 2LBCA 3EIEA 5L8RF 4JI2M 2BNKA 3U6DA 1IY2A 1IN5A 1PJSA 1K3XA 5KQDA 4IBGA 4XK8F 4X64M 1UFZA 4JN6A 4IBDA 4QNRA 3FYDA 1HJPA 4IJFA 4IBJA 3GLIB 2VF7A 2DWLA 3GRYA 4NXMM 2QPAA 2R0IA 1VEJA 2L4EA 2RKOA 4FWGA 2CHGA 1Q02A 2VIIA 1QUTA 1TDZA 1ZQ9A 4L6V6 1N75A 3J27B 3SMSA 2R6FA 3QAUA 5JI3E 2WZJA 4GHLA 2DWZB 3J81S 3LQQA 4W5WA 3MK6A 1PJQA 4OX9M 1QAQA 3M7GA 3SC3A 4JI3M 2YNMD 3HJ8A 2JY7A 3U6EA 1Q39A 1FJGM 1ORYB 1OAOC 3QYEA 4LY6A 4G3OA 4WURA 5ITUA 4JI4M 2EUCA 4KT0F 2JWSA 4GEWA 3VDUA 2X8AA 3FTDA 3T6PA 3IHPA 4GKJM 1T6OA 3GLHA 3GRUA 4OVZA 3WHKA 4LF6M 2KZUA 2LVQD 3FUUA 4NOOB 2HKJA 2R65A 1IBKM 1JR3A 3E9SA 3K92A 1WHCA 5BR8M 3KFUG 3FUXA 1DGFA 2X49A 1ZMWA 1Z59A 3L25A 2O25A 4KHPM 3KS8A 1SXJD 2K0BX 3H4MA 3I51A 2JNHA 3TWLA 1OQYA 4G4OA 1KYIA 3MHVC 3SAUA 2C99A 2F5OA 1L8QA 1YE9A 2CRUA 2DZOB 4LF7M 5BPVA 3HJSA 4GC5A 5ITRA 4RF0A 2C9CA 2QHOB 3BXWA 3K9OA 5FLXS 4LG2A 3GLHB 4OVZB 2X4AA 1QDTA 2F5QA 4GH9A 2C96A 2D7HA 3GO8A 1OAIA 3FE3A 1CUKA 3I04M 2M60A 1QUSA 2ZTCA 1WIVA 1PRBA 3J7BA 2D7EA 2CE7A 5FTNA 1K82A 4CISA 2BWEA 3VKHA 3KVWA 1T3TA 1NHWC 2L2DA 2V1UA 3K2LA 2DXIA 2YQZA 1DGGA 3GLFA 2GNOA 3QWLA 4HLQA 3AKZA 1NJGA 3E4RA 3AL0C 2QP9X 4IJEA 3UMMA 4JXJA 1NV9A 4DR6M 1MN3A 2L09A 3FRHA 1QAMA 2LWXA 1F4IA 2Z4RA 3UGJA 3SAVA 4JI7M 3B74A 1IXSA 3SFZA 4L4UA 4G4QA 1EIJA 3LVVA 2EA0A 4MGIE 3HKPA 2Z3XA 1GVNA 3U60A 1TDHA 2QENA 5IT9S 1E9RA 1PJIA 2Y0QA 2CP8A 1V33A 1VEKA 4P16A 5A2QS 2BJWA 2ERCA 3PXGA 3GLFB 4LF9M 1TH4A 3F92A 1G4AE 2APLA 5FTJA 4AG5A 1JQJC 1NV8A 2JZ0A 2O01F 3AJIB 4FD2A 4HEOA 4D82A 1IM2A 4PDIA 4LF4M 2DZLA 4QOSA 3U61A 4II7A 4PT5A 5C18A 2LVOC 4B7HA 3K1JA 2C98A 2LVAA 4WP2A 3U5ZA 3HGIA 1IXSB 1P3QQ 3GQ3A 2R46A 2JY6B 3PVSA 2G5GX 1OFIA 2CV2A 3U60B 2F4VM 4AZFA 3CGWA 1KSFX 3VFDA 4TUWA 4G4NA 4IBCA 3DZDA 1HQYE 2VF8A 1A5TA 1XNRM 4RF1A 1PGYA 1GO5A 2XFTA 1RU3A 4LZZA 4DV2M 4JYAM 5LMNM 1VQ1A 3L29A 4LFAM 5F3WA 2UUCM 5FTKA 1HNZM 2FH0A 4YHHM 3PNYA 2VQEM 3U61B 2CV1A 1GKIA 3HZJA 1WGNA 3AOEA 2BWBA 3KXEC 4FWDA 3U5ZB 2G8LA 4DR2M 4Z6YA 4CGYB 1IN8A 4R7GA 2J5YA 2KRKA 1I94M 2FE8A 4MM3B 5KPRA 4DV5M 3I01M 2MJ5B 2N35A 3T15A 4LGMA 5ITXE 1ZV1A 2LNHC 3CF6E 3NBXX 2CFOA 3GPUA 1SXJA 2ZANA 4I4LA 3W0FA 2L7IA 4FWHA 1TGUA 4G6ZA 4L16A 3HHWA 1V92A 4I8OA 3KOYE 3PFIA 3DOAA 3H4JA 1HNXM 2XSZA 4IBBA 2OOBA 4KO8A 1G41A 1XHBA 3C3EA 3NWLA 4X62M 4DUZM 3U6PA 1N77A 1QZEA 3UK6A 4IBEA 3GLIE 4LZJA 3RGPA 4B7GA 2UU9M 2E5LM 1QQWA 3SATA 2XEPA 1OIPA 1VEGA 3A98B 2XZFA 4MGHA 5EP4A 1GL7A 3KOWE 2F5NA 2XF3A 2Q2EB 5EQTA 1N36M 1JB0F 2KDLA 1HNWM 1IFYA 2EJSA 2JZ1A 1SXJB 2WSEF 4IBFA 3JR4A 1YSYA 3HJQA 3IG8A 1DV0A 3THGA 1XXHE 4MGYE 4X65M 1UM8A 3B7NA 4LJ4A 2XLJA 1NY5A 2QQ8A 1EE8A 7CATA 3K8ZA 3CF0A 2JP7A 4NC6A 1WJ7A 3GQ5A 2D7GA 4DBGB 1NNJA 1IBLM 2XFSA 2K47A 2JY8A 3R8FA 2EKFA 3HU2A 4NRVA 1YUBA 2H5XA 4NL4H 2WSFF 4GHAA 4LFCM 1GLNA 2ZTDA 1LTMA 2H1RA 3DA1A 3HHXA 2CHVA 3B7QA 1MU5A 3HU1A 3FUVA 2DAKA 3ZCBB 1R5LA 2ZBKB 2V6ZM 4QHTA 1IN7A 2CV0A 4GMQA 4LRTA 1T43A 5DYIA 3HHYA 4LF5M 4AG6A 1L2DA 3B89A 3SHGB 4L8RC 4PD2A 2KNAA 1VDDA 3K9PA 3FTEA 1DGHA 4I81A 5KQ8A 5KO3A 1IY0A 5EXSA 1OIZA 4LJ5A 2LH0A 5IREB 4LCBA 4BB9A 3M6AA 3SARA 2AHMA 1G8PA 2UXBM 1DO0A 2LVNC 3E21A 3J7AS 4DV3M 2WSCF 1G3IA 4I5SA 2CUZA 5FTLA 4AQYM 2XZUA 3GLGA 2R4JA 4AKGA 3KDSE 2KXEA 3W68A 3RGSA 1TF0B 2YR0A 2ZAOA 3HX3A 4NSOB 1Z5BA 1WGLA 2I7PA 3FKEA 2CWBA 3GLHE 3KOZE 1QYRA 4AKHA 4IBIA 1TH3A 4R71A 5IWAM 1AIPC 2OOAA 3HHZA 4OW0A 1ZMUA 1R7RA 1JR3E 3WHLA 1DGHB 1QDRA 4DV4M 4Q7JA 2DZNB 3FD9A 3GRRA 3LCUA 2J7OA 2R4EA 2UXCM 3HWSA 3R9XB 4Y28F 1OFHA 1V34A 3GLGB 1TTEA 2JUJA 3U6SA 4DR7M 1W5TA 3M0EA 1N78A 1D0LA 1NO1A 3ILKA 3KS4A 4AW4A 1QANA 3VK7A 4ITQA 4LGYA 3D8LA 2DNAA 3SMPA 1K3WA 2FOIC 2EKKA 2KNZA 3C9PA 3KP1E 4REZA 1Z5CA 3Q8GA 5C1BA 4OU7A 3GP1A 4DUYM 3ZQJA 2QCUA 3SAWA 3J2PB 5DNYA 3QYBA 1YLAA 1I4WA 2JXNA 4UN2B 4B08A 3T1YM 5EXPA 2R44A 3LVWA 3TWMA 4KLNA 3AOEC 1GJTA 3EIHA 5E6JA 3GLFE 3C3DA 1PJTA 1X37A 2MH8A 3J80S 3RE8A 1XMQM 2DHYA 3B9PA 2L7HA 5EP1A 3T38A 4DV0M 2QSFX 5ITXA 1KFVA 2W82A 2V1CA 1QZMA 4GC9A 4S12A 3SYLA 5JI2E 3C58A 1SXJC 1XC8A 1C7YA 2DVWB 2DWNA 3MJ5A 4B3TM 1E9SA 1IN6A 3SHFA 4PCZA 3LMMA 4RKUF 3HY5A 4M0WA 4LJAA 1GJSA 3JR5A 3A46A 5ITTA 2F5PA 2KEBA 1S3SA 1ZMVA 4M9ZA 1HT2E 2O5RA 3A45A 3L2AA 2RGHA 1J7KA 1HT1E 1R4GA 1SG9A 1N33M 3GPPA 3W0LB 3SASA 2DAGA 4GIPA 4XGIA 4EIWA 3BOSA 2Z7JA 3HU3A 4HL4A 2CEAA 2L6OA 2MGWA 4LRSA 3TPZA 1R2YA 2Y21A 2DENA 4DV1M 2UXDM 5KPZA 1XXHA 2FNAA 1MJGM 4L78A 3UJNA 1L2BA 1IXRC 4BLCA 1TH2A 1Z6TA 1XB2B 3Q8XA 5EXXA 1R2ZA 3TE6A 1H6UA 4LFBM 4L15A 4MH0E
chains in the Genus database with same CATH topology
3FRHA 1F4IA 3B89A 3LCVB 1E94E 1IXSA 2KNAA 3K9PA 2L4FA 2HWJA 1DO0A 2LVNC 3E21A 2CP8A 2MR9A 1G3IA 1VEKA 1Y8GA 2RRUA 2MROB 3F92A 1G4AE 1NV8A 1DO2A 2B3TA 2JZ0A 4HEOA 1IM2A 1BVSA 2LBCA 1WGLA 3GLHE 2CWBA 2DZLA 2KNVA 4R71A 1UFZA 1VDLA 1AIPC 2LVOC 2LVPC 2OOAA 1HJPA 2LVAA 1ZMUA 1OKSA 4WP2A 1JR3E 1P3QQ 2R0IA 4Q7JA 2JY6B 3LCUA 1VEJA 2L4EA 1Q02A 1HQYE 1A5TA 2DI0A 1PGYA 1OTRA 2LTUA 1TTEA 2JUJA 1GO5A 3BBZA 5DFLA 2WZJA 3FRIA 1VQ1A 2HAKA 1WGNA 2BWBA 2DNAA 4F1IA 2EKKA 2KNZA 2OO9A 2JY7A 1YLAA 4UN2B 2MJ5B 4G3OA 1ZV1A 4GEWA 3T6PA 3GLFE 3IHPA 1T6OA 1V92A 2LVQD 2DHYA 1WR1B 3H4JA 2DAIA 2OOBA 2QSFX 1G41A 1WHCA 2QNJA 1QZEA 5JI2E 1ZMWA 3GLIE 1C7YA 2O25A 2K0BX 3MMPA 2DKLA 2JNHA 1VEGA 1OQYA 3IECA 1KYIA 4F2LA 1IFYA 2EJSA 2JZ1A 2QHOB 3GLGE 3K9OA 1ZMVA 1HT2E 1HT1E 1R4GA 1DV0A 1SG9A 2KHHA 1XXHE 1OAIA 2DAGA 3E46A 3FE3A 1CUKA 2JP7A 2ZTCA 1WJ7A 2MGWA 1WIVA 1VG5A 4DBGB 2K9DA 2BWEA 2JY8A 2EKFA 1EFUB 2DENA 2DAMA 2L2DA 2H5XA 2DAEA 2ZTDA 2DAKA 2G3QA 2JY5A 1XB2B 1TR8A 1T43A 1NV9A 1MN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FRH A;  1F4I A;  3B89 A;  3LCV B;  1E94 E;  1IXS A;  2KNA A;  3K9P A;  2L4F A;  2HWJ A;  1DO0 A;  2LVN C;  3E21 A;  2CP8 A;  2MR9 A;  1G3I A;  1VEK A;  1Y8G A;  2RRU A;  2MRO B;  3F92 A;  1G4A E;  1NV8 A;  1DO2 A;  2B3T A;  2JZ0 A;  4HEO A;  1IM2 A;  1BVS A;  2LBC A;  1WGL A;  3GLH E;  2CWB A;  2DZL A;  2KNV A;  4R71 A;  1UFZ A;  1VDL A;  1AIP C;  2LVO C;  2LVP C;  2OOA A;  1HJP A;  2LVA A;  1ZMU A;  1OKS A;  4WP2 A;  1JR3 E;  1P3Q Q;  2R0I A;  4Q7J A;  2JY6 B;  3LCU A;  1VEJ A;  2L4E A;  1Q02 A;  1HQY E;  1A5T A;  2DI0 A;  1PGY A;  1OTR A;  2LTU A;  1TTE A;  2JUJ A;  1GO5 A;  3BBZ A;  5DFL A;  2WZJ A;  3FRI A;  1VQ1 A;  2HAK A;  1WGN A;  2BWB A;  2DNA A;  4F1I A;  2EKK A;  2KNZ A;  2OO9 A;  2JY7 A;  1YLA A;  4UN2 B;  2MJ5 B;  4G3O A;  1ZV1 A;  4GEW A;  3T6P A;  3GLF E;  3IHP A;  1T6O A;  1V92 A;  2LVQ D;  2DHY A;  1WR1 B;  3H4J A;  2DAI A;  2OOB A;  2QSF X;  1G41 A;  1WHC A;  2QNJ A;  1QZE A;  5JI2 E;  1ZMW A;  3GLI E;  1C7Y A;  2O25 A;  2K0B X;  3MMP A;  2DKL A;  2JNH A;  1VEG A;  1OQY A;  3IEC A;  1KYI A;  4F2L A;  1IFY A;  2EJS A;  2JZ1 A;  2QHO B;  3GLG E;  3K9O A;  1ZMV A;  1HT2 E;  1HT1 E;  1R4G A;  1DV0 A;  1SG9 A;  2KHH A;  1XXH E;  1OAI A;  2DAG A;  3E46 A;  3FE3 A;  1CUK A;  2JP7 A;  2ZTC A;  1WJ7 A;  2MGW A;  1WIV A;  1VG5 A;  4DBG B;  2K9D A;  2BWE A;  2JY8 A;  2EKF A;  1EFU B;  2DEN A;  2DAM A;  2L2D A;  2H5X A;  2DAE A;  2ZTD A;  2DAK A;  2G3Q A;  2JY5 A;  1XB2 B;  1TR8 A;  1T43 A;  1NV9 A;  1MN3 A; 
#chains in the Genus database with same CATH topology
 3LCV B;  3SYK A;  4CJ6 A;  1E94 E;  1J09 A;  1Q3C A;  2LHC A;  4DR3 M;  3A42 A;  1OJL A;  2DHR A;  3AV0 A;  1DGB A;  2Y20 A;  4WW0 A;  1WXQ A;  4JI0 M;  3VLF B;  3GPY A;  3U6L A;  2JA2 A;  2Z4S A;  2HWJ A;  3VK8 A;  2BJV A;  4A3V B;  2EO2 A;  2R18 A;  3FUW A;  1NJF A;  2MR9 A;  4FCW A;  2OQ4 A;  1HR0 M;  2DWM A;  1Y8G A;  1J5E M;  3DFZ A;  2MRO B;  2VDB B;  4LJ6 A;  4ZPX A;  3GRV A;  1XXH B;  1W5S A;  3KSX A;  4B3S M;  1NNU C;  4JV5 M;  2B3T A;  1DO2 A;  4GRI A;  1SXJ E;  1NY6 A;  2KW0 A;  2ZM6 M;  4B3R M;  4LF8 M;  4D81 A;  5KPT A;  1IQP A;  2OPF A;  4AI6 A;  1VDL A;  2LVP C;  2C9O A;  1L2C A;  2QBY A;  3TQS A;  2HL7 A;  1N34 M;  1OKS A;  1XWI A;  1PJJ A;  4AKI A;  4M9X A;  2GQF A;  5E26 A;  3U6Q A;  3GQ4 A;  5EP2 A;  4X66 M;  1L1T A;  4K0K M;  5DYG A;  4LJ9 A;  1AUA A;  5GKN A;  3LW5 F;  4JI5 M;  4R3D A;  4G4R A;  2DI0 A;  2LTU A;  1OTR A;  1R6B X;  2LHG A;  2Y0T A;  2KZS A;  3BBZ A;  1G59 A;  5DFL A;  3FRI A;  3KSJ A;  4JI1 M;  2P5T A;  2HAK A;  4B3M M;  2QZ4 A;  4LJ7 A;  2HHH M;  4DR5 M;  3KP0 E;  1XNQ M;  1C1K A;  1QVR A;  5EXT A;  2FFJ A;  2KA6 B;  2QBY B;  4GKK M;  1G71 A;  2XGN A;  4F1I A;  5FSW A;  1GAB A;  4LJ8 A;  1Q3B A;  2LXE A;  2HCB A;  2OO9 A;  2XSZ D;  4MB7 A;  4DR1 M;  5IZ7 D;  2R45 A;  3FYC A;  3ZH9 B;  1GL6 A;  3AOG A;  1MX0 A;  4PDG A;  4FCV A;  3U6O A;  3W67 A;  5FTM A;  3CTW B;  3B7Z A;  4KOD A;  4M0D A;  3RFW A;  2UUB M;  3FTC A;  4IBK A;  3ZC7 B;  1WR1 B;  2C5R A;  2DAI A;  5ITQ A;  4MGK E;  4RNA A;  3U6M A;  2QNJ A;  4NSR A;  2J7N A;  3NBI A;  3PNV A;  4FW9 A;  2CHQ A;  3MMP A;  4IIW A;  2DKL A;  3L27 A;  1ZAE A;  2I7N A;  4D80 A;  3IEC A;  3GPX A;  1D2N A;  5EJC A;  3V76 A;  3CF2 A;  4CIZ A;  1D0M A;  1HQC A;  4F2L A;  1JR3 D;  4B7F A;  4P17 A;  4Z8X A;  3TWK A;  1Z5A A;  3IG5 A;  4M9S A;  5H37 D;  1IN4 A;  3GLG E;  2XH9 A;  1NHG C;  3AFH A;  1QAO A;  2KHH A;  2FS1 A;  4NRW A;  3OTO M;  3JAM S;  3E46 A;  1LV7 A;  4FCT A;  1VG5 A;  4QNM A;  2K9D A;  3KW6 A;  4DV7 M;  3UZU A;  1EFU B;  1IY1 A;  2DAM A;  1FNN A;  2KRU A;  3I4Y A;  3KOX E;  4GIT A;  5EP3 A;  4NXN M;  3TL4 X;  4YY3 M;  1IBM M;  4DR4 M;  2DAE A;  1L1Z A;  2A5Y B;  2RGO A;  2ZAM A;  3FTF A;  1D0K A;  4BBA A;  2G3Q A;  2JY5 A;  3D8B A;  2VQF M;  4MGZ E;  1TR8 A;  2F5S A;  2KNV A;  3T1H M;  4QOZ C;  4XBO A;  8CAT A;  4QHS A;  3L26 A;  3GLI A;  3SBJ A;  2Z8Y M;  1NSF A;  5ITY A;  4JI6 M;  3FUT A;  3L28 A;  2L4F A;  2YFQ A;  1XMO M;  1E32 A;  3VKG A;  2K6B A;  1PM5 A;  2UUA M;  1N32 M;  3VDP A;  2RRU A;  2M5Z A;  4ANR A;  4CHT B;  1IXZ A;  5LMU M;  4JI8 M;  3U6C A;  3LQR A;  4FVM A;  2NQ8 C;  1NVM A;  2R62 A;  4DV6 M;  3I4V A;  1BVS A;  2LBC A;  3EIE A;  5L8R F;  4JI2 M;  2BNK A;  3U6D A;  1IY2 A;  1IN5 A;  1PJS A;  1K3X A;  5KQD A;  4IBG A;  4XK8 F;  4X64 M;  1UFZ A;  4JN6 A;  4IBD A;  4QNR A;  3FYD A;  1HJP A;  4IJF A;  4IBJ A;  3GLI B;  2VF7 A;  2DWL A;  3GRY A;  4NXM M;  2QPA A;  2R0I A;  1VEJ A;  2L4E A;  2RKO A;  4FWG A;  2CHG A;  1Q02 A;  2VII A;  1QUT A;  1TDZ A;  1ZQ9 A;  4L6V 6;  1N75 A;  3J27 B;  3SMS A;  2R6F A;  3QAU A;  5JI3 E;  2WZJ A;  4GHL A;  2DWZ B;  3J81 S;  3LQQ A;  4W5W A;  3MK6 A;  1PJQ A;  4OX9 M;  1QAQ A;  3M7G A;  3SC3 A;  4JI3 M;  2YNM D;  3HJ8 A;  2JY7 A;  3U6E A;  1Q39 A;  1FJG M;  1ORY B;  1OAO C;  3QYE A;  4LY6 A;  4G3O A;  4WUR A;  5ITU A;  4JI4 M;  2EUC A;  4KT0 F;  2JWS A;  4GEW A;  3VDU A;  2X8A A;  3FTD A;  3T6P A;  3IHP A;  4GKJ M;  1T6O A;  3GLH A;  3GRU A;  4OVZ A;  3WHK A;  4LF6 M;  2KZU A;  2LVQ D;  3FUU A;  4NOO B;  2HKJ A;  2R65 A;  1IBK M;  1JR3 A;  3E9S A;  3K92 A;  1WHC A;  5BR8 M;  3KFU G;  3FUX A;  1DGF A;  2X49 A;  1ZMW A;  1Z59 A;  3L25 A;  2O25 A;  4KHP M;  3KS8 A;  1SXJ D;  2K0B X;  3H4M A;  3I51 A;  2JNH A;  3TWL A;  1OQY A;  4G4O A;  1KYI A;  3MHV C;  3SAU A;  2C99 A;  2F5O A;  1L8Q A;  1YE9 A;  2CRU A;  2DZO B;  4LF7 M;  5BPV A;  3HJS A;  4GC5 A;  5ITR A;  4RF0 A;  2C9C A;  2QHO B;  3BXW A;  3K9O A;  5FLX S;  4LG2 A;  3GLH B;  4OVZ B;  2X4A A;  1QDT A;  2F5Q A;  4GH9 A;  2C96 A;  2D7H A;  3GO8 A;  1OAI A;  3FE3 A;  1CUK A;  3I04 M;  2M60 A;  1QUS A;  2ZTC A;  1WIV A;  1PRB A;  3J7B A;  2D7E A;  2CE7 A;  5FTN A;  1K82 A;  4CIS A;  2BWE A;  3VKH A;  3KVW A;  1T3T A;  1NHW C;  2L2D A;  2V1U A;  3K2L A;  2DXI A;  2YQZ A;  1DGG A;  3GLF A;  2GNO A;  3QWL A;  4HLQ A;  3AKZ A;  1NJG A;  3E4R A;  3AL0 C;  2QP9 X;  4IJE A;  3UMM A;  4JXJ A;  1NV9 A;  4DR6 M;  1MN3 A;  2L09 A;  3FRH A;  1QAM A;  2LWX A;  1F4I A;  2Z4R A;  3UGJ A;  3SAV A;  4JI7 M;  3B74 A;  1IXS A;  3SFZ A;  4L4U A;  4G4Q A;  1EIJ A;  3LVV A;  2EA0 A;  4MGI E;  3HKP A;  2Z3X A;  1GVN A;  3U60 A;  1TDH A;  2QEN A;  5IT9 S;  1E9R A;  1PJI A;  2Y0Q A;  2CP8 A;  1V33 A;  1VEK A;  4P16 A;  5A2Q S;  2BJW A;  2ERC A;  3PXG A;  3GLF B;  4LF9 M;  1TH4 A;  3F92 A;  1G4A E;  2APL A;  5FTJ A;  4AG5 A;  1JQJ C;  1NV8 A;  2JZ0 A;  2O01 F;  3AJI B;  4FD2 A;  4HEO A;  4D82 A;  1IM2 A;  4PDI A;  4LF4 M;  2DZL A;  4QOS A;  3U61 A;  4II7 A;  4PT5 A;  5C18 A;  2LVO C;  4B7H A;  3K1J A;  2C98 A;  2LVA A;  4WP2 A;  3U5Z A;  3HGI A;  1IXS B;  1P3Q Q;  3GQ3 A;  2R46 A;  2JY6 B;  3PVS A;  2G5G X;  1OFI A;  2CV2 A;  3U60 B;  2F4V M;  4AZF A;  3CGW A;  1KSF X;  3VFD A;  4TUW A;  4G4N A;  4IBC A;  3DZD A;  1HQY E;  2VF8 A;  1A5T A;  1XNR M;  4RF1 A;  1PGY A;  1GO5 A;  2XFT A;  1RU3 A;  4LZZ A;  4DV2 M;  4JYA M;  5LMN M;  1VQ1 A;  3L29 A;  4LFA M;  5F3W A;  2UUC M;  5FTK A;  1HNZ M;  2FH0 A;  4YHH M;  3PNY A;  2VQE M;  3U61 B;  2CV1 A;  1GKI A;  3HZJ A;  1WGN A;  3AOE A;  2BWB A;  3KXE C;  4FWD A;  3U5Z B;  2G8L A;  4DR2 M;  4Z6Y A;  4CGY B;  1IN8 A;  4R7G A;  2J5Y A;  2KRK A;  1I94 M;  2FE8 A;  4MM3 B;  5KPR A;  4DV5 M;  3I01 M;  2MJ5 B;  2N35 A;  3T15 A;  4LGM A;  5ITX E;  1ZV1 A;  2LNH C;  3CF6 E;  3NBX X;  2CFO A;  3GPU A;  1SXJ A;  2ZAN A;  4I4L A;  3W0F A;  2L7I A;  4FWH A;  1TGU A;  4G6Z A;  4L16 A;  3HHW A;  1V92 A;  4I8O A;  3KOY E;  3PFI A;  3DOA A;  3H4J A;  1HNX M;  2XSZ A;  4IBB A;  2OOB A;  4KO8 A;  1G41 A;  1XHB A;  3C3E A;  3NWL A;  4X62 M;  4DUZ M;  3U6P A;  1N77 A;  1QZE A;  3UK6 A;  4IBE A;  3GLI E;  4LZJ A;  3RGP A;  4B7G A;  2UU9 M;  2E5L M;  1QQW A;  3SAT A;  2XEP A;  1OIP A;  1VEG A;  3A98 B;  2XZF A;  4MGH A;  5EP4 A;  1GL7 A;  3KOW E;  2F5N A;  2XF3 A;  2Q2E B;  5EQT A;  1N36 M;  1JB0 F;  2KDL A;  1HNW M;  1IFY A;  2EJS A;  2JZ1 A;  1SXJ B;  2WSE F;  4IBF A;  3JR4 A;  1YSY A;  3HJQ A;  3IG8 A;  1DV0 A;  3THG A;  1XXH E;  4MGY E;  4X65 M;  1UM8 A;  3B7N A;  4LJ4 A;  2XLJ A;  1NY5 A;  2QQ8 A;  1EE8 A;  7CAT A;  3K8Z A;  3CF0 A;  2JP7 A;  4NC6 A;  1WJ7 A;  3GQ5 A;  2D7G A;  4DBG B;  1NNJ A;  1IBL M;  2XFS A;  2K47 A;  2JY8 A;  3R8F A;  2EKF A;  3HU2 A;  4NRV A;  1YUB A;  2H5X A;  4NL4 H;  2WSF F;  4GHA A;  4LFC M;  1GLN A;  2ZTD A;  1LTM A;  2H1R A;  3DA1 A;  3HHX A;  2CHV A;  3B7Q A;  1MU5 A;  3HU1 A;  3FUV A;  2DAK A;  3ZCB B;  1R5L A;  2ZBK B;  2V6Z M;  4QHT A;  1IN7 A;  2CV0 A;  4GMQ A;  4LRT A;  1T43 A;  5DYI A;  3HHY A;  4LF5 M;  4AG6 A;  1L2D A;  3B89 A;  3SHG B;  4L8R C;  4PD2 A;  2KNA A;  1VDD A;  3K9P A;  3FTE A;  1DGH A;  4I81 A;  5KQ8 A;  5KO3 A;  1IY0 A;  5EXS A;  1OIZ A;  4LJ5 A;  2LH0 A;  5IRE B;  4LCB A;  4BB9 A;  3M6A A;  3SAR A;  2AHM A;  1G8P A;  2UXB M;  1DO0 A;  2LVN C;  3E21 A;  3J7A S;  4DV3 M;  2WSC F;  1G3I A;  4I5S A;  2CUZ A;  5FTL A;  4AQY M;  2XZU A;  3GLG A;  2R4J A;  4AKG A;  3KDS E;  2KXE A;  3W68 A;  3RGS A;  1TF0 B;  2YR0 A;  2ZAO A;  3HX3 A;  4NSO B;  1Z5B A;  1WGL A;  2I7P A;  3FKE A;  2CWB A;  3GLH E;  3KOZ E;  1QYR A;  4AKH A;  4IBI A;  1TH3 A;  4R71 A;  5IWA M;  1AIP C;  2OOA A;  3HHZ A;  4OW0 A;  1ZMU A;  1R7R A;  1JR3 E;  3WHL A;  1DGH B;  1QDR A;  4DV4 M;  4Q7J A;  2DZN B;  3FD9 A;  3GRR A;  3LCU A;  2J7O A;  2R4E A;  2UXC M;  3HWS A;  3R9X B;  4Y28 F;  1OFH A;  1V34 A;  3GLG B;  1TTE A;  2JUJ A;  3U6S A;  4DR7 M;  1W5T A;  3M0E A;  1N78 A;  1D0L A;  1NO1 A;  3ILK A;  3KS4 A;  4AW4 A;  1QAN A;  3VK7 A;  4ITQ A;  4LGY A;  3D8L A;  2DNA A;  3SMP A;  1K3W A;  2FOI C;  2EKK A;  2KNZ A;  3C9P A;  3KP1 E;  4REZ A;  1Z5C A;  3Q8G A;  5C1B A;  4OU7 A;  3GP1 A;  4DUY M;  3ZQJ A;  2QCU A;  3SAW A;  3J2P B;  5DNY A;  3QYB A;  1YLA A;  1I4W A;  2JXN A;  4UN2 B;  4B08 A;  3T1Y M;  5EXP A;  2R44 A;  3LVW A;  3TWM A;  4KLN A;  3AOE C;  1GJT A;  3EIH A;  5E6J A;  3GLF E;  3C3D A;  1PJT A;  1X37 A;  2MH8 A;  3J80 S;  3RE8 A;  1XMQ M;  2DHY A;  3B9P A;  2L7H A;  5EP1 A;  3T38 A;  4DV0 M;  2QSF X;  5ITX A;  1KFV A;  2W82 A;  2V1C A;  1QZM A;  4GC9 A;  4S12 A;  3SYL A;  5JI2 E;  3C58 A;  1SXJ C;  1XC8 A;  1C7Y A;  2DVW B;  2DWN A;  3MJ5 A;  4B3T M;  1E9S A;  1IN6 A;  3SHF A;  4PCZ A;  3LMM A;  4RKU F;  3HY5 A;  4M0W A;  4LJA A;  1GJS A;  3JR5 A;  3A46 A;  5ITT A;  2F5P A;  2KEB A;  1S3S A;  1ZMV A;  4M9Z A;  1HT2 E;  2O5R A;  3A45 A;  3L2A A;  2RGH A;  1J7K A;  1HT1 E;  1R4G A;  1SG9 A;  1N33 M;  3GPP A;  3W0L B;  3SAS A;  2DAG A;  4GIP A;  4XGI A;  4EIW A;  3BOS A;  2Z7J A;  3HU3 A;  4HL4 A;  2CEA A;  2L6O A;  2MGW A;  4LRS A;  3TPZ A;  1R2Y A;  2Y21 A;  2DEN A;  4DV1 M;  2UXD M;  5KPZ A;  1XXH A;  2FNA A;  1MJG M;  4L78 A;  3UJN A;  1L2B A;  1IXR C;  4BLC A;  1TH2 A;  1Z6T A;  1XB2 B;  3Q8X A;  5EXX A;  1R2Z A;  3TE6 A;  1H6U A;  4LFB M;  4L15 A;  4MH0 E; 
#chains in the Genus database with same CATH homology
 3FRH A;  1F4I A;  3B89 A;  3LCV B;  1E94 E;  1IXS A;  2KNA A;  3K9P A;  2L4F A;  2HWJ A;  1DO0 A;  2LVN C;  3E21 A;  2CP8 A;  2MR9 A;  1G3I A;  1VEK A;  1Y8G A;  2RRU A;  2MRO B;  3F92 A;  1G4A E;  1NV8 A;  1DO2 A;  2B3T A;  2JZ0 A;  4HEO A;  1IM2 A;  1BVS A;  2LBC A;  1WGL A;  3GLH E;  2CWB A;  2DZL A;  2KNV A;  4R71 A;  1UFZ A;  1VDL A;  1AIP C;  2LVO C;  2LVP C;  2OOA A;  1HJP A;  2LVA A;  1ZMU A;  1OKS A;  4WP2 A;  1JR3 E;  1P3Q Q;  2R0I A;  4Q7J A;  2JY6 B;  3LCU A;  1VEJ A;  2L4E A;  1Q02 A;  1HQY E;  1A5T A;  2DI0 A;  1PGY A;  1OTR A;  2LTU A;  1TTE A;  2JUJ A;  1GO5 A;  3BBZ A;  5DFL A;  2WZJ A;  3FRI A;  1VQ1 A;  2HAK A;  1WGN A;  2BWB A;  2DNA A;  4F1I A;  2EKK A;  2KNZ A;  2OO9 A;  2JY7 A;  1YLA A;  4UN2 B;  2MJ5 B;  4G3O A;  1ZV1 A;  4GEW A;  3T6P A;  3GLF E;  3IHP A;  1T6O A;  1V92 A;  2LVQ D;  2DHY A;  1WR1 B;  3H4J A;  2DAI A;  2OOB A;  2QSF X;  1G41 A;  1WHC A;  2QNJ A;  1QZE A;  5JI2 E;  1ZMW A;  3GLI E;  1C7Y A;  2O25 A;  2K0B X;  3MMP A;  2DKL A;  2JNH A;  1VEG A;  1OQY A;  3IEC A;  1KYI A;  4F2L A;  1IFY A;  2EJS A;  2JZ1 A;  2QHO B;  3GLG E;  3K9O A;  1ZMV A;  1HT2 E;  1HT1 E;  1R4G A;  1DV0 A;  1SG9 A;  2KHH A;  1XXH E;  1OAI A;  2DAG A;  3E46 A;  3FE3 A;  1CUK A;  2JP7 A;  2ZTC A;  1WJ7 A;  2MGW A;  1WIV A;  1VG5 A;  4DBG B;  2K9D A;  2BWE A;  2JY8 A;  2EKF A;  1EFU B;  2DEN A;  2DAM A;  2L2D A;  2H5X A;  2DAE A;  2ZTD A;  2DAK A;  2G3Q A;  2JY5 A;  1XB2 B;  1TR8 A;  1T43 A;  1NV9 A;  1MN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...