3A45A

Crystal structure of mvnei1_2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
b'PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase
publication title Structural Characterization of a Viral NEIL1 Ortholog Unliganded and Bound to Abasic Site-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
total genus 81
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a45A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3a45A01
3VK7A 3T1YM 1L1TA 1Z5CA 4DR1M 3SAUA 4YY3M 2F5QA 3TWLA 4B3SM 2F4VM 4B3TM 3TWMA 4DV0M 5FLXS 4DR6M 5ITRA 3GP1A 1HNZM 4LF5M 3U6MA 5ITQA 4LFAM 3GPPA 1Q3BA 1XNRM 1Z5BA 5LMNM 2UXCM 3JAMS 4DR2M 2ZBKB 2VQFM 3J81S 1MX0A 1L1ZA 3GO8A 4DR3M 1XNQM 2OQ4A 3U6DA 3SBJA 1L2DA 1HNWM 4G4RA 1IBLM 4KHPM 4K0KM 3W0FA 1TDZA 1K3WA 3U6PA 3GQ5A 4G4OA 4JI0M 1XMQM 3SARA 4PD2A 2OPFA 4NXMM 3J80S 5ITYA 1IBKM 4DV4M 4GKJM 4NXNM 3JR4A 4LF6M 4DR4M 2EA0A 4YHHM 5BR8M 1MU5A 2HKJA 5ITTA 2Q2EB 1L2BA 1N33M 4AQYM 1HNXM 3VK8A 1XMOM 4JI5M 1XC8A 4MB7A 4DV2M 4PDIA 2UXDM 4X65M 4B3RM 4G4QA 4DUZM 4X66M 1K3XA 4DR7M 4JYAM 2XZUA 1R2ZA 1PJJA 4ITQA 4DV3M 1NNJA 3U6EA 1L2CA 4NRVA 1R2YA 4LF7M 2UUBM 2UXBM 2E5LM 4JV5M 1J5EM 3A42A 5IWAM 3SAWA 4LFCM 4JI8M 5LMUM 4DV7M 4X64M 1N36M 4JI2M 4DV5M 4OX9M 2HHHM 1EE8A 1TDHA 3GPYA 3SASA 1I94M 4CISA 3GPXA 4DR5M 5ITXA 3U6OA 2F5PA 4LF4M 1FJGM 4PCZA 1KFVA 1Z59A 3U6QA 3C58A 1PJIA 4JI1M 3GQ4A 3A46A 2F5OA 3U6LA 1Q3CA 3J7AS 5ITXE 4X62M 3GQ3A 1N34M 2UUCM 3GPUA 1PM5A 4LF8M 4NRWA 4JI3M 4G4NA 3U6CA 2VQEM 4LF9M 3OTOM 4DUYM 2XZFA 3T1HM 5A2QS 2ZM6M 4JI4M 4PDGA 1K82A 1Q39A 1HR0M 2UUAM 1N32M 2UU9M 3U6SA 3TWKA 4DV1M 1IBMM 2F5SA 4JI7M 3JR5A 3A45A 4DV6M 1Z5AA 3SATA 5IT9S 3SAVA 4JI6M 5ITUA 3DOAA 2F5NA 4LFBM 4B3MM 4GKKM
chains in the Genus database with same CATH superfamily
1LTMA 3T1YM 2QSFX 4DR1M 3SAUA 4YY3M 1GLNA 3K1JA 2ZAOA 3TWMA 5FLXS 2R62A 3B74A 3L29A 1TH4A 1VEKA 4LFAM 5ITQA 5KPRA 1G4AE 5LMNM 2UXCM 5KPZA 5EJCA 2R18A 2ZBKB 2VQFM 2JZ1A 4HLQA 1MX0A 3U60B 1D0LA 2ZTDA 4QNMA 1L1ZA 2DWNA 2OQ4A 1GL6A 4MGHA 1HNWM 3FE3A 4G4RA 3LMMA 1VDLA 3FYCA 5JI3E 2JY6B 1K3WA 4G6ZA 1VEGA 2NQ8C 3U6PA 2LH0A 2QPAA 4AG6A 2R4EA 5JI2E 3SARA 1ZMVA 1R7RA 4NXMM 5ITYA 1C7YA 1IXSB 4GC5A 4Q7JA 2DVWB 4I4LA 5F3WA 2MROB 2APLA 1VG5A 3PNVA 1PJSA 2CFOA 1NJFA 2EA0A 2R45A 1XWIA 5BR8M 2KXEA 2C99A 2CE7A 5ITTA 1XHBA 2GNOA 4FCVA 1HNXM 2QBYB 2EKFA 3DFZA 2LVOC 3CF0A 4KODA 1NSFA 4QOSA 2DAMA 3WHLA 3CTWB 4IBCA 2UXDM 4LJAA 4F1IA 1G59A 2KEBA 4FWGA 1AIPC 1K3XA 1PGYA 2D7HA 1R4GA 1OQYA 1TGUA 2CRUA 2ERCA 1NNJA 3U6EA 1T43A 4LF7M 3AFHA 4LY6A 4NC6A 2UXBM 4M0WA 1UM8A 4IIWA 2XEPA 2XSZD 2BWEA 5DFLA 2C98A 4LFCM 2FOIC 2G8LA 2OOAA 1AUAA 2P5TA 1N36M 1C1KA 3VKHA 3HJ8A 3V76A 3HU1A 1NY6A 1DO2A 2ZTCA 1X37A 3VDPA 3F92A 3UJNA 1D2NA 3GPXA 2WSCF 5ITXA 4IBDA 5E6JA 1OFIA 1OFHA 4LJ8A 4B7GA 1KFVA 1PJQA 5L8RF 1NO1A 5C1BA 2JZ0A 4LRSA 3WHKA 1Q3CA 1E94E 3GRVA 5ITXE 4X62M 3GQ3A 4ANRA 4GMQA 3FUUA 1NVMA 4AKIA 2R44A 1PM5A 4AG5A 2V1CA 1OAOC 1QVRA 4NL4H 4JXJA 3LQQA 2D7EA 2W82A 5KPTA 2QP9X 1IN8A 1JR3D 2XSZA 3FUXA 1Q39A 3FYDA 4JI4M 4L8RC 1IY1A 5EP2A 3HJSA 1HR0M 2UUAM 1N32M 3QYEA 3U5ZA 3SMSA 1IBMM 3FUWA 3I04M 4KO8A 3Q8XA 4GHLA 3GRYA 1R6BX 4M9SA 3UK6A 1S3SA 4RNAA 4M9XA 1DO0A 4KLNA 1V34A 5ITUA 3CF6E 1HT1E 1XXHA 1HT2E 4D82A 2J7OA 3KVWA 4GKKM 4I8OA 3VK7A 5DYGA 1Z5CA 2XH9A 4LZZA 3W68A 3MJ5A 1WJ7A 4B3TM 2R6FA 2JY7A 4GH9A 4DR6M 1Q02A 4LF5M 3SFZA 2Y0QA 1R5LA 4IBGA 4R3DA 3GLFB 3I4YA 4XGIA 4AKHA 2GQFA 2WZJA 4L4UA 3K8ZA 3FTCA 1IM2A 4QOZC 3HJQA 1JR3A 3AKZA 2CV2A 1L8QA 3K9PA 5FTMA 1XNQM 4AI6A 3U6DA 4M0DA 3MK6A 2DNAA 3LQRA 1SXJC 3AOGA 4OVZA 2X8AA 1TDZA 3E4RA 5EP1A 2XLJA 1Y8GA 4JI0M 3ILKA 4PD2A 1QYRA 3VFDA 1E9SA 3R9XB 1VQ1A 4DV4M 4OU7A 4GKJM 2Z4SA 2JP7A 4LF6M 2MH8A 2FH0A 2OO9A 3J2PB 3HHZA 2HKJA 3FRHA 3LCUA 3HHWA 4EIWA 1L2BA 3E46A 4AQYM 3VK8A 2V1UA 4GRIA 1WR1B 4LGMA 4FCTA 2DWMA 4JI5M 4ZPXA 1XC8A 4MB7A 4DV2M 3VKGA 3L2AA 4I81A 4QHTA 3ZQJA 4X65M 2DZNB 4FD2A 4MGKE 2C9OA 3HKPA 2D7GA 2K47A 4DUZM 4NSOB 4MM3B 4LJ4A 2XZUA 2CV1A 3KOZE 1I4WA 1PJJA 4DR7M 2Z7JA 3GLFA 3T15A 3FUVA 2UUBM 2DAGA 1ZAEA 2LBCA 1SXJD 2DI0A 3GLFE 2KHHA 2DWLA 2KDLA 3I51A 5IWAM 3KXEC 3SAWA 2ZAMA 4HL4A 4DV7M 4X64M 3M6AA 4OX9M 3KS4A 3CF2A 3RE8A 2KNAA 4NSRA 1DV0A 2X4AA 4IBBA 4A3VB 1A5TA 4GITA 2QHOB 4CISA 2DXIA 1OAIA 2LVAA 3U6OA 2DENA 2F5PA 1FJGM 4PCZA 3U6QA 1OTRA 1PJIA 2L4FA 2HCBA 2XFTA 3U61B 2FE8A 3A46A 3IG8A 1VDDA 2HL7A 1WXQA 2JNHA 3LVWA 4WP2A 5EP4A 5FSWA 1QUSA 3J7AS 1GJSA 3DA1A 1N34M 2M60A 3U5ZB 3NBXX 2MR9A 4NRWA 3E9SA 3AV0A 3IECA 3ZC7B 4LF9M 2YFQA 2BJWA 2CHGA 2R46A 3B89A 4GIPA 4DUYM 2RGOA 3MMPA 1XXHB 3QYBA 3T1HM 4II7A 3RGSA 4F2LA 2ZM6M 1OKSA 1SXJA 1DGGA 4NOOB 4BB9A 1K82A 1NV9A 5FTJA 3BXWA 4IBJA 4Z6YA 3TWKA 4JI7M 1WGNA 4B7HA 5KQ8A 4PT5A 2YNMD 2L7IA 1QQWA 2RRUA 3SATA 3SAVA 2L7HA 1JB0F 3TE6A 4LFBM 5C18A 4Z8XA 3KSXA 3GLIE 2DZLA 4QHSA 2H1RA 4LG2A 1W5SA 2K9DA 2F5QA 1P3QQ 1TH2A 5KQDA 3IG5A 4DV0M 4RF0A 1YSYA 1TH3A 3Q8GA 4OVZB 3GP1A 1HNZM 3KOYE 3GRRA 3B7ZA 4KT0F 1KYIA 3U6MA 5EXXA 1WIVA 1TF0B 4LZJA 1Q3BA 1ZQ9A 1BVSA 1Z5BA 2VDBB 3C3DA 4OW0A 3TPZA 4L78A 3U61A 3JAMS 3AL0C 4DR2M 3L25A 1EIJA 2FNAA 1QUTA 2J5YA 2VF8A 4DR3M 5KO3A 3SBJA 7CATA 3PFIA 4KHPM 4K0KM 3W0FA 3R8FA 2Z3XA 4BLCA 2BWBA 4WW0A 4BBAA 3HU3A 3M0EA 1YE9A 1GKIA 1YUBA 2OPFA 4IBKA 3J80S 1GJTA 1J09A 1XXHE 2LTUA 1N78A 3FD9A 2M5ZA 4LJ6A 4M9ZA 3I4VA 5FTLA 3JR4A 1H6UA 4DR4M 1LV7A 2CP8A 3CGWA 3LVVA 4YHHM 3SYLA 2MGWA 3C3EA 2HWJA 4Y28F 4R7GA 4B08A 1JQJC 4FWDA 4P17A 1XB2B 2RKOA 1NHGC 3NWLA 4FWHA 2I7NA 1QDTA 2Y21A 2DAKA 2KW0A 2Z4RA 3ZCBB 2EUCA 3THGA 4PDIA 1OIPA 2Z8YM 4LRTA 2CV0A 3HHXA 4B3RM 4L16A 4L6V6 5FTKA 1VEJA 4LGYA 5EP3A 2KNVA 4X66M 1JR3E 2JXNA 3UGJA 3UMMA 1QDRA 3EIEA 1E9RA 3GLGB 4JYAM 4ITQA 1ZMWA 4B7FA 3KSJA 3HU2A 1L2CA 2WSEF 1G3IA 2YR0A 4NRVA 3D8BA 3TQSA 2JWSA 3QAUA 1IN7A 4FW9A 2DZOB 3A98B 3HHYA 2QQ8A 4I5SA 5BPVA 4LJ5A 5DYIA 1IN6A 3J7BA 3KOXE 3A42A 3PXGA 3GLHA 4D81A 2DWZB 4JI8M 4JI2M 4DV5M 1MJGM 2KRUA 2HHHM 1EE8A 4LJ7A 1ZV1A 1TDHA 2B3TA 2DKLA 3GPYA 4P16A 4MGZE 1WGLA 2O25A 2VIIA 3GLHE 3K2LA 4GHAA 3K92A 1OJLA 2QENA 2KA6B 4JI1M 1ORYB 1D0KA 1Z59A 3TL4X 1DGHB 3D8LA 3GQ4A 3SYKA 2DHRA 4JN6A 1SXJB 3H4JA 2X49A 1NV8A 2EKKA 2CEAA 5IZ7D 3UZUA 3SHGB 3FRIA 2H5XA 1QAMA 1QANA 2QCUA 4LJ9A 1TTEA 5EXSA 2UUCM 4LF8M 4JI3M 4FCWA 3L27A 3U6CA 1UFZA 2WSFF 4L15A 2VQEM 2LVPC 2XZFA 2JA2A 4IBIA 3LW5F 3FUTA 1HJPA 3L28A 1IN4A 4PDGA 3B7NA 2K6BA 2LWXA 1DGBA 2Y0TA 5EXTA 2KNZA 3GLIA 3GLGA 2UU9M 2XFSA 3U6SA 3FTFA 2F5SA 3W67A 1G71A 1NHWC 2BJVA 2XGNA 3L26A 2CHVA 2CUZA 3HWSA 2O5RA 3GLGE 3A45A 1QAOA 5IT9S 2LVNC 2R4JA 1T6OA 2XF3A 3AJIB 2LNHC 3DOAA 4AW4A 4B3MM 2CHQA 1N33M 2YQZA 4QNRA 1L1TA 5E26A 3TWLA 2CWBA 2JUJA 4B3SM 1ZMUA 2F4VM 1IFYA 2KZUA 5DNYA 5ITRA 2FFJA 2L2DA 2L09A 1FNNA 2R0IA 3T38A 2DAIA 5EQTA 1HQCA 3GPPA 1XNRM 1DGHA 3HZJA 1E32A 2LHGA 1V33A 3DZDA 4RF1A 1DGFA 2EO2A 3C9PA 2Y20A 3J81S 2L4EA 3HGIA 1NJGA 4IBFA 2AHMA 3GO8A 3B9PA 2A5YB 1SXJE 1L2DA 5EXPA 1N77A 1IY2A 4CHTB 1IBLM 2C96A 3SMPA 4CJ6A 4HEOA 5H37D 3GQ5A 2LVQD 4G4OA 1N75A 3BOSA 4REZA 4IJFA 1XMQM 2BNKA 4D80A 2G3QA 1EFUB 2VF7A 5IREB 8CATA 1IBKM 2FS1A 3U60A 3AOEC 3SC3A 4NXNM 2QNJA 1KSFX 1G8PA 1WHCA 2C5RA 1MU5A 4FVMA 2JY8A 2Q2EB 1J7KA 2DHYA 2LXEA 1XMOM 3T6PA 2RGHA 2EJSA 1TR8A 1IXSA 3GRUA 3PVSA 1QAQA 2ZANA 3KDSE 2HAKA 3GLHB 3KP0E 1QZMA 4G4QA 3H4MA 3J27B 4MH0E 1YLAA 4CIZA 2MJ5B 3MHVC 1GABA 1R2ZA 4LCBA 4DV3M 1NY5A 4GC9A 1PJTA 3PNYA 2LHCA 1CUKA 1R2YA 2QBYA 3HY5A 2E5LM 4IBEA 1IQPA 2N35A 4IJEA 4DBGB 4MGIE 1J5EM 4JV5M 2G5GX 5LMUM 3IHPA 1IXRC 1HQYE 1MN3A 2C9CA 5FTNA 3FTDA 3RGPA 1SG9A 4RKUF 1W5TA 4TUWA 1G41A 3E21A 3SASA 4UN2B 4CGYB 3EIHA 4DR5M 1I94M 4LF4M 2O01F 1GL7A 4WURA 3VLFB 1PRBA 4AZFA 3C58A 3W0LB 2F5OA 2DAEA 3ZH9B 2I7PA 2QZ4A 3U6LA 3I01M 1IY0A 3GLIB 4W5WA 3BBZA 3VDUA 1V92A 2V6ZM 5GKNA 4R71A 1Z6TA 3GPUA 3LCVB 4GEWA 1GO5A 4G4NA 3HX3A 1NNUC 3RFWA 3OTOM 2OOBA 1D0MA 1GVNA 3KW6A 1RU3A 5A2QS 3KOWE 1OIZA 2R65A 3KS8A 1IN5A 3FKEA 3K9OA 2KZSA 3M7GA 2KRKA 4DV1M 4AKGA 3KP1E 1IXZA 3FTEA 3JR5A 3NBIA 4S12A 3KFUG 1F4IA 2J7NA 3B7QA 1Z5AA 4DV6M 3AOEA 4MGYE 4JI6M 1T3TA 4XBOA 2F5NA 4XK8F 2JY5A 4G3OA 3SHFA 1QZEA 2K0BX 3QWLA 2L6OA
chains in the Genus database with same CATH topology
3T1YM 4DR1M 3SAUA 4YY3M 1GLNA 3K1JA 2ZAOA 3TWMA 5FLXS 2R62A 3L29A 1TH4A 5ITQA 4LFAM 5KPRA 1G4AE 5LMNM 2UXCM 5KPZA 5EJCA 2R18A 2ZBKB 2VQFM 4HLQA 1MX0A 3U60B 1L1ZA 4QNMA 2DWNA 2OQ4A 1GL6A 4MGHA 1HNWM 4G4RA 3LMMA 3FYCA 5JI3E 1K3WA 4G6ZA 2NQ8C 3U6PA 2LH0A 2QPAA 4AG6A 2R4EA 5JI2E 3SARA 1R7RA 4NXMM 5ITYA 1IXSB 4GC5A 2DVWB 4I4LA 5F3WA 3PNVA 2CFOA 1NJFA 2EA0A 2R45A 1XWIA 5BR8M 2KXEA 2C99A 2CE7A 5ITTA 1XHBA 4FCVA 1HNXM 2QBYB 3DFZA 3CF0A 4KODA 1NSFA 4QOSA 3WHLA 3CTWB 4IBCA 2UXDM 4LJAA 1G59A 2KEBA 4FWGA 1K3XA 2D7HA 1TGUA 2ERCA 1NNJA 3U6EA 4LF7M 3AFHA 4LY6A 2UXBM 4M0WA 1UM8A 4IIWA 2XEPA 2XSZD 2C98A 4LFCM 2FOIC 2G8LA 2P5TA 1N36M 1C1KA 3VKHA 3HJ8A 3HU1A 1NY6A 1DO2A 1X37A 3VDPA 3UJNA 1D2NA 3GPXA 5ITXA 4IBDA 5E6JA 1OFIA 1OFHA 4LJ8A 4B7GA 1KFVA 5C1BA 4LRSA 3WHKA 1Q3CA 1E94E 3GRVA 5ITXE 4X62M 3GQ3A 4GMQA 3FUUA 1NVMA 4AKIA 1PM5A 4AG5A 2V1CA 1QVRA 4NL4H 4JXJA 3LQQA 2D7EA 2W82A 5KPTA 3FYDA 1IN8A 1JR3D 2QP9X 2XSZA 1Q39A 3FUXA 4JI4M 4L8RC 1IY1A 5EP2A 3HJSA 1HR0M 2UUAM 1N32M 3U5ZA 3SMSA 1IBMM 3FUWA 4KO8A 3Q8XA 4GHLA 3GRYA 1R6BX 4M9SA 3UK6A 1S3SA 4RNAA 4M9XA 1DO0A 4KLNA 5ITUA 3CF6E 1HT1E 1XXHA 1HT2E 4D82A 2J7OA 3KVWA 4GKKM 4I8OA 3VK7A 5DYGA 1Z5CA 2XH9A 4LZZA 3MJ5A 4B3TM 4GH9A 4DR6M 4LF5M 3SFZA 2Y0QA 4IBGA 4R3DA 3GLFB 3I4YA 4XGIA 4AKHA 4L4UA 3K8ZA 3FTCA 1IM2A 4QOZC 3HJQA 1JR3A 3AKZA 2CV2A 1L8QA 5FTMA 1XNQM 4AI6A 3U6DA 4M0DA 3MK6A 3LQRA 1SXJC 3AOGA 4OVZA 2X8AA 1TDZA 3E4RA 5EP1A 2XLJA 4JI0M 3ILKA 4PD2A 1QYRA 3VFDA 1E9SA 3R9XB 4DV4M 4OU7A 4GKJM 2Z4SA 4LF6M 3J2PB 3HHZA 2HKJA 3HHWA 4EIWA 1L2BA 4AQYM 3VK8A 2V1UA 4GRIA 4LGMA 4FCTA 2DWMA 4JI5M 4ZPXA 1XC8A 4MB7A 4DV2M 3VKGA 3L2AA 4I81A 4QHTA 4X65M 2DZNB 4FD2A 4MGKE 2C9OA 3HKPA 2D7GA 2K47A 4DUZM 4NSOB 2L6OA 4LJ4A 4MM3B 2XZUA 3KOZE 1I4WA 1PJJA 4DR7M 2Z7JA 3GLFA 3T15A 3FUVA 2UUBM 1ZAEA 1SXJD 2DWLA 3I51A 5IWAM 3KXEC 3SAWA 2ZAMA 4HL4A 4DV7M 4X64M 3M6AA 4OX9M 3KS4A 3CF2A 3RE8A 4NSRA 2X4AA 4IBBA 4A3VB 4GITA 4CISA 1FJGM 3U6OA 2F5PA 4PCZA 3U6QA 1PJIA 3U61B 2HCBA 2XFTA 2FE8A 3A46A 3IG8A 1VDDA 2HL7A 1WXQA 3LVWA 5EP4A 5FSWA 3J7AS 3DA1A 1N34M 2M60A 3U5ZB 4NRWA 3E9SA 3AV0A 3ZC7B 4LF9M 2YFQA 2BJWA 2CHGA 2R46A 4GIPA 4DUYM 2RGOA 1XXHB 3T1HM 4II7A 3RGSA 2ZM6M 1SXJA 1DGGA 4NOOB 4BB9A 1K82A 5FTJA 4IBJA 4Z6YA 3TWKA 4JI7M 4B7HA 5KQ8A 4PT5A 2YNMD 2L7IA 1QQWA 3SATA 3SAVA 2L7HA 3TE6A 4LFBM 5C18A 4Z8XA 3KSXA 4QHSA 2H1RA 4LG2A 1W5SA 2F5QA 1TH2A 5KQDA 3IG5A 4DV0M 4RF0A 2CV1A 1YSYA 1TH3A 4OVZB 3GP1A 1HNZM 3KOYE 3GRRA 1KYIA 3U6MA 5EXXA 4LZJA 1Q3BA 1ZQ9A 3U61A 1Z5BA 3TPZA 4OW0A 3AL0C 4L78A 3L25A 3JAMS 4DR2M 2FNAA 4DR3M 5KO3A 3SBJA 7CATA 3PFIA 4KHPM 4K0KM 3W0FA 3R8FA 2Z3XA 4BLCA 4WW0A 4BBAA 3HU3A 3M0EA 1YE9A 1GKIA 1YUBA 2OPFA 4IBKA 3J80S 1J09A 1N78A 3FD9A 2M5ZA 4LJ6A 4M9ZA 3I4VA 5FTLA 3JR4A 1H6UA 4DR4M 1LV7A 3LVVA 4YHHM 3SYLA 4R7GA 4B08A 1JQJC 4FWDA 2RKOA 1NHGC 3NWLA 4FWHA 2I7NA 2Y21A 2KW0A 2Z4RA 3ZCBB 2EUCA 3THGA 4PDIA 4LRTA 2CV0A 3HHXA 4B3RM 4L16A 5FTKA 4LGYA 5EP3A 4X66M 3GLGB 3UGJA 3UMMA 4JYAM 3EIEA 1E9RA 4ITQA 4B7FA 3KSJA 3HU2A 1L2CA 2YR0A 1G3IA 4NRVA 3D8BA 3TQSA 3QAUA 1IN7A 4FW9A 2DZOB 3A98B 3HHYA 4I5SA 5BPVA 4LJ5A 5DYIA 1IN6A 3J7BA 3KOXE 3A42A 3PXGA 3GLHA 4D81A 2DWZB 4JI8M 4JI2M 4DV5M 2KRUA 2HHHM 1EE8A 4LJ7A 1TDHA 3GPYA 4P16A 4MGZE 2VIIA 3K2LA 4GHAA 3K92A 1OJLA 2QENA 2KA6B 4JI1M 1ORYB 1Z59A 3TL4X 1DGHB 3D8LA 3GQ4A 3SYKA 2DHRA 4JN6A 1SXJB 2X49A 5IZ7D 2CEAA 3UZUA 3SHGB 1QAMA 1QANA 2QCUA 4LJ9A 5EXSA 2UUCM 4LF8M 4JI3M 4FCWA 3L27A 3U6CA 4L15A 2VQEM 2XZFA 2JA2A 4IBIA 3FUTA 3L28A 1IN4A 4PDGA 2LWXA 1DGBA 2Y0TA 5EXTA 3GLIA 3GLGA 2UU9M 2XFSA 3U6SA 3FTFA 2F5SA 1NHWC 2BJVA 2XGNA 3L26A 2CHVA 2CUZA 3HWSA 2O5RA 3A45A 1QAOA 5IT9S 2R4JA 2XF3A 3AJIB 2LNHC 3DOAA 4AW4A 4B3MM 2CHQA 1N33M 2YQZA 4QNRA 1L1TA 5E26A 3TWLA 4B3SM 2F4VM 2KZUA 5DNYA 5ITRA 2FFJA 2L09A 1FNNA 3T38A 5EQTA 1HQCA 3GPPA 1XNRM 1DGHA 1E32A 3DZDA 4RF1A 1DGFA 2EO2A 2Y20A 3J81S 3HGIA 1NJGA 4IBFA 2AHMA 3GO8A 3B9PA 2A5YB 1SXJE 1L2DA 5EXPA 1N77A 1IY2A 4CHTB 1IBLM 2C96A 3SMPA 5H37D 3GQ5A 4G4OA 1N75A 3BOSA 4REZA 4IJFA 1XMQM 2BNKA 4D80A 8CATA 1IBKM 5IREB 3U60A 3AOEC 3SC3A 4NXNM 1KSFX 1G8PA 2C5RA 1MU5A 4FVMA 2Q2EB 1J7KA 2LXEA 1XMOM 2RGHA 3PVSA 3GRUA 1QAQA 2ZANA 3KDSE 3KP0E 3GLHB 1QZMA 4G4QA 3H4MA 3J27B 4MH0E 3MHVC 1R2ZA 4LCBA 4DV3M 1NY5A 4GC9A 3PNYA 1R2YA 2QBYA 2E5LM 4IBEA 1IQPA 4IJEA 4JV5M 4MGIE 1J5EM 2G5GX 5LMUM 1IXRC 1HQYE 5FTNA 2C9CA 3RGPA 3FTDA 4TUWA 1W5TA 1G41A 3SASA 4CGYB 3EIHA 4DR5M 1I94M 4LF4M 1GL7A 4WURA 3VLFB 3C58A 4AZFA 3W0LB 2F5OA 3ZH9B 2I7PA 2QZ4A 3U6LA 3GLIB 1IY0A 4W5WA 3VDUA 2V6ZM 5GKNA 1Z6TA 3GPUA 4G4NA 1NNUC 3RFWA 3OTOM 1GVNA 3KW6A 5A2QS 2R65A 3KS8A 1IN5A 3FKEA 3M7GA 2KZSA 2KRKA 4DV1M 4AKGA 3KP1E 1IXZA 3FTEA 3JR5A 3NBIA 4S12A 3KFUG 2J7NA 4DV6M 1Z5AA 3AOEA 4MGYE 4JI6M 1T3TA 4XBOA 2F5NA 3SHFA 2DXIA 3QWLA 3KOWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VK7 A;  3T1Y M;  1L1T A;  1Z5C A;  4DR1 M;  3SAU A;  4YY3 M;  2F5Q A;  3TWL A;  4B3S M;  2F4V M;  4B3T M;  3TWM A;  4DV0 M;  5FLX S;  4DR6 M;  5ITR A;  3GP1 A;  1HNZ M;  4LF5 M;  3U6M A;  5ITQ A;  4LFA M;  3GPP A;  1Q3B A;  1XNR M;  1Z5B A;  5LMN M;  2UXC M;  3JAM S;  4DR2 M;  2ZBK B;  2VQF M;  3J81 S;  1MX0 A;  1L1Z A;  3GO8 A;  4DR3 M;  1XNQ M;  2OQ4 A;  3U6D A;  3SBJ A;  1L2D A;  1HNW M;  4G4R A;  1IBL M;  4KHP M;  4K0K M;  3W0F A;  1TDZ A;  1K3W A;  3U6P A;  3GQ5 A;  4G4O A;  4JI0 M;  1XMQ M;  3SAR A;  4PD2 A;  2OPF A;  4NXM M;  3J80 S;  5ITY A;  1IBK M;  4DV4 M;  4GKJ M;  4NXN M;  3JR4 A;  4LF6 M;  4DR4 M;  2EA0 A;  4YHH M;  5BR8 M;  1MU5 A;  2HKJ A;  5ITT A;  2Q2E B;  1L2B A;  1N33 M;  4AQY M;  1HNX M;  3VK8 A;  1XMO M;  4JI5 M;  1XC8 A;  4MB7 A;  4DV2 M;  4PDI A;  2UXD M;  4X65 M;  4B3R M;  4G4Q A;  4DUZ M;  4X66 M;  1K3X A;  4DR7 M;  4JYA M;  2XZU A;  1R2Z A;  1PJJ A;  4ITQ A;  4DV3 M;  1NNJ A;  3U6E A;  1L2C A;  4NRV A;  1R2Y A;  4LF7 M;  2UUB M;  2UXB M;  2E5L M;  4JV5 M;  1J5E M;  3A42 A;  5IWA M;  3SAW A;  4LFC M;  4JI8 M;  5LMU M;  4DV7 M;  4X64 M;  1N36 M;  4JI2 M;  4DV5 M;  4OX9 M;  2HHH M;  1EE8 A;  1TDH A;  3GPY A;  3SAS A;  1I94 M;  4CIS A;  3GPX A;  4DR5 M;  5ITX A;  3U6O A;  2F5P A;  4LF4 M;  1FJG M;  4PCZ A;  1KFV A;  1Z59 A;  3U6Q A;  3C58 A;  1PJI A;  4JI1 M;  3GQ4 A;  3A46 A;  2F5O A;  3U6L A;  1Q3C A;  3J7A S;  5ITX E;  4X62 M;  3GQ3 A;  1N34 M;  2UUC M;  3GPU A;  1PM5 A;  4LF8 M;  4NRW A;  4JI3 M;  4G4N A;  3U6C A;  2VQE M;  4LF9 M;  3OTO M;  4DUY M;  2XZF A;  3T1H M;  5A2Q S;  2ZM6 M;  4JI4 M;  4PDG A;  1K82 A;  1Q39 A;  1HR0 M;  2UUA M;  1N32 M;  2UU9 M;  3U6S A;  3TWK A;  4DV1 M;  1IBM M;  2F5S A;  4JI7 M;  3JR5 A;  3A45 A;  4DV6 M;  1Z5A A;  3SAT A;  5IT9 S;  3SAV A;  4JI6 M;  5ITU A;  3DOA A;  2F5N A;  4LFB M;  4B3M M;  4GKK M; 
#chains in the Genus database with same CATH topology
 1LTM A;  3T1Y M;  2QSF X;  4DR1 M;  3SAU A;  4YY3 M;  1GLN A;  3K1J A;  2ZAO A;  3TWM A;  5FLX S;  2R62 A;  3B74 A;  3L29 A;  1TH4 A;  1VEK A;  4LFA M;  5ITQ A;  5KPR A;  1G4A E;  5LMN M;  2UXC M;  5KPZ A;  5EJC A;  2R18 A;  2ZBK B;  2VQF M;  2JZ1 A;  4HLQ A;  1MX0 A;  3U60 B;  1D0L A;  2ZTD A;  4QNM A;  1L1Z A;  2DWN A;  2OQ4 A;  1GL6 A;  4MGH A;  1HNW M;  3FE3 A;  4G4R A;  3LMM A;  1VDL A;  3FYC A;  5JI3 E;  2JY6 B;  1K3W A;  4G6Z A;  1VEG A;  2NQ8 C;  3U6P A;  2LH0 A;  2QPA A;  4AG6 A;  2R4E A;  5JI2 E;  3SAR A;  1ZMV A;  1R7R A;  4NXM M;  5ITY A;  1C7Y A;  1IXS B;  4GC5 A;  4Q7J A;  2DVW B;  4I4L A;  5F3W A;  2MRO B;  2APL A;  1VG5 A;  3PNV A;  1PJS A;  2CFO A;  1NJF A;  2EA0 A;  2R45 A;  1XWI A;  5BR8 M;  2KXE A;  2C99 A;  2CE7 A;  5ITT A;  1XHB A;  2GNO A;  4FCV A;  1HNX M;  2QBY B;  2EKF A;  3DFZ A;  2LVO C;  3CF0 A;  4KOD A;  1NSF A;  4QOS A;  2DAM A;  3WHL A;  3CTW B;  4IBC A;  2UXD M;  4LJA A;  4F1I A;  1G59 A;  2KEB A;  4FWG A;  1AIP C;  1K3X A;  1PGY A;  2D7H A;  1R4G A;  1OQY A;  1TGU A;  2CRU A;  2ERC A;  1NNJ A;  3U6E A;  1T43 A;  4LF7 M;  3AFH A;  4LY6 A;  4NC6 A;  2UXB M;  4M0W A;  1UM8 A;  4IIW A;  2XEP A;  2XSZ D;  2BWE A;  5DFL A;  2C98 A;  4LFC M;  2FOI C;  2G8L A;  2OOA A;  1AUA A;  2P5T A;  1N36 M;  1C1K A;  3VKH A;  3HJ8 A;  3V76 A;  3HU1 A;  1NY6 A;  1DO2 A;  2ZTC A;  1X37 A;  3VDP A;  3F92 A;  3UJN A;  1D2N A;  3GPX A;  2WSC F;  5ITX A;  4IBD A;  5E6J A;  1OFI A;  1OFH A;  4LJ8 A;  4B7G A;  1KFV A;  1PJQ A;  5L8R F;  1NO1 A;  5C1B A;  2JZ0 A;  4LRS A;  3WHK A;  1Q3C A;  1E94 E;  3GRV A;  5ITX E;  4X62 M;  3GQ3 A;  4ANR A;  4GMQ A;  3FUU A;  1NVM A;  4AKI A;  2R44 A;  1PM5 A;  4AG5 A;  2V1C A;  1OAO C;  1QVR A;  4NL4 H;  4JXJ A;  3LQQ A;  2D7E A;  2W82 A;  5KPT A;  2QP9 X;  1IN8 A;  1JR3 D;  2XSZ A;  3FUX A;  1Q39 A;  3FYD A;  4JI4 M;  4L8R C;  1IY1 A;  5EP2 A;  3HJS A;  1HR0 M;  2UUA M;  1N32 M;  3QYE A;  3U5Z A;  3SMS A;  1IBM M;  3FUW A;  3I04 M;  4KO8 A;  3Q8X A;  4GHL A;  3GRY A;  1R6B X;  4M9S A;  3UK6 A;  1S3S A;  4RNA A;  4M9X A;  1DO0 A;  4KLN A;  1V34 A;  5ITU A;  3CF6 E;  1HT1 E;  1XXH A;  1HT2 E;  4D82 A;  2J7O A;  3KVW A;  4GKK M;  4I8O A;  3VK7 A;  5DYG A;  1Z5C A;  2XH9 A;  4LZZ A;  3W68 A;  3MJ5 A;  1WJ7 A;  4B3T M;  2R6F A;  2JY7 A;  4GH9 A;  4DR6 M;  1Q02 A;  4LF5 M;  3SFZ A;  2Y0Q A;  1R5L A;  4IBG A;  4R3D A;  3GLF B;  3I4Y A;  4XGI A;  4AKH A;  2GQF A;  2WZJ A;  4L4U A;  3K8Z A;  3FTC A;  1IM2 A;  4QOZ C;  3HJQ A;  1JR3 A;  3AKZ A;  2CV2 A;  1L8Q A;  3K9P A;  5FTM A;  1XNQ M;  4AI6 A;  3U6D A;  4M0D A;  3MK6 A;  2DNA A;  3LQR A;  1SXJ C;  3AOG A;  4OVZ A;  2X8A A;  1TDZ A;  3E4R A;  5EP1 A;  2XLJ A;  1Y8G A;  4JI0 M;  3ILK A;  4PD2 A;  1QYR A;  3VFD A;  1E9S A;  3R9X B;  1VQ1 A;  4DV4 M;  4OU7 A;  4GKJ M;  2Z4S A;  2JP7 A;  4LF6 M;  2MH8 A;  2FH0 A;  2OO9 A;  3J2P B;  3HHZ A;  2HKJ A;  3FRH A;  3LCU A;  3HHW A;  4EIW A;  1L2B A;  3E46 A;  4AQY M;  3VK8 A;  2V1U A;  4GRI A;  1WR1 B;  4LGM A;  4FCT A;  2DWM A;  4JI5 M;  4ZPX A;  1XC8 A;  4MB7 A;  4DV2 M;  3VKG A;  3L2A A;  4I81 A;  4QHT A;  3ZQJ A;  4X65 M;  2DZN B;  4FD2 A;  4MGK E;  2C9O A;  3HKP A;  2D7G A;  2K47 A;  4DUZ M;  4NSO B;  4MM3 B;  4LJ4 A;  2XZU A;  2CV1 A;  3KOZ E;  1I4W A;  1PJJ A;  4DR7 M;  2Z7J A;  3GLF A;  3T15 A;  3FUV A;  2UUB M;  2DAG A;  1ZAE A;  2LBC A;  1SXJ D;  2DI0 A;  3GLF E;  2KHH A;  2DWL A;  2KDL A;  3I51 A;  5IWA M;  3KXE C;  3SAW A;  2ZAM A;  4HL4 A;  4DV7 M;  4X64 M;  3M6A A;  4OX9 M;  3KS4 A;  3CF2 A;  3RE8 A;  2KNA A;  4NSR A;  1DV0 A;  2X4A A;  4IBB A;  4A3V B;  1A5T A;  4GIT A;  2QHO B;  4CIS A;  2DXI A;  1OAI A;  2LVA A;  3U6O A;  2DEN A;  2F5P A;  1FJG M;  4PCZ A;  3U6Q A;  1OTR A;  1PJI A;  2L4F A;  2HCB A;  2XFT A;  3U61 B;  2FE8 A;  3A46 A;  3IG8 A;  1VDD A;  2HL7 A;  1WXQ A;  2JNH A;  3LVW A;  4WP2 A;  5EP4 A;  5FSW A;  1QUS A;  3J7A S;  1GJS A;  3DA1 A;  1N34 M;  2M60 A;  3U5Z B;  3NBX X;  2MR9 A;  4NRW A;  3E9S A;  3AV0 A;  3IEC A;  3ZC7 B;  4LF9 M;  2YFQ A;  2BJW A;  2CHG A;  2R46 A;  3B89 A;  4GIP A;  4DUY M;  2RGO A;  3MMP A;  1XXH B;  3QYB A;  3T1H M;  4II7 A;  3RGS A;  4F2L A;  2ZM6 M;  1OKS A;  1SXJ A;  1DGG A;  4NOO B;  4BB9 A;  1K82 A;  1NV9 A;  5FTJ A;  3BXW A;  4IBJ A;  4Z6Y A;  3TWK A;  4JI7 M;  1WGN A;  4B7H A;  5KQ8 A;  4PT5 A;  2YNM D;  2L7I A;  1QQW A;  2RRU A;  3SAT A;  3SAV A;  2L7H A;  1JB0 F;  3TE6 A;  4LFB M;  5C18 A;  4Z8X A;  3KSX A;  3GLI E;  2DZL A;  4QHS A;  2H1R A;  4LG2 A;  1W5S A;  2K9D A;  2F5Q A;  1P3Q Q;  1TH2 A;  5KQD A;  3IG5 A;  4DV0 M;  4RF0 A;  1YSY A;  1TH3 A;  3Q8G A;  4OVZ B;  3GP1 A;  1HNZ M;  3KOY E;  3GRR A;  3B7Z A;  4KT0 F;  1KYI A;  3U6M A;  5EXX A;  1WIV A;  1TF0 B;  4LZJ A;  1Q3B A;  1ZQ9 A;  1BVS A;  1Z5B A;  2VDB B;  3C3D A;  4OW0 A;  3TPZ A;  4L78 A;  3U61 A;  3JAM S;  3AL0 C;  4DR2 M;  3L25 A;  1EIJ A;  2FNA A;  1QUT A;  2J5Y A;  2VF8 A;  4DR3 M;  5KO3 A;  3SBJ A;  7CAT A;  3PFI A;  4KHP M;  4K0K M;  3W0F A;  3R8F A;  2Z3X A;  4BLC A;  2BWB A;  4WW0 A;  4BBA A;  3HU3 A;  3M0E A;  1YE9 A;  1GKI A;  1YUB A;  2OPF A;  4IBK A;  3J80 S;  1GJT A;  1J09 A;  1XXH E;  2LTU A;  1N78 A;  3FD9 A;  2M5Z A;  4LJ6 A;  4M9Z A;  3I4V A;  5FTL A;  3JR4 A;  1H6U A;  4DR4 M;  1LV7 A;  2CP8 A;  3CGW A;  3LVV A;  4YHH M;  3SYL A;  2MGW A;  3C3E A;  2HWJ A;  4Y28 F;  4R7G A;  4B08 A;  1JQJ C;  4FWD A;  4P17 A;  1XB2 B;  2RKO A;  1NHG C;  3NWL A;  4FWH A;  2I7N A;  1QDT A;  2Y21 A;  2DAK A;  2KW0 A;  2Z4R A;  3ZCB B;  2EUC A;  3THG A;  4PDI A;  1OIP A;  2Z8Y M;  4LRT A;  2CV0 A;  3HHX A;  4B3R M;  4L16 A;  4L6V 6;  5FTK A;  1VEJ A;  4LGY A;  5EP3 A;  2KNV A;  4X66 M;  1JR3 E;  2JXN A;  3UGJ A;  3UMM A;  1QDR A;  3EIE A;  1E9R A;  3GLG B;  4JYA M;  4ITQ A;  1ZMW A;  4B7F A;  3KSJ A;  3HU2 A;  1L2C A;  2WSE F;  1G3I A;  2YR0 A;  4NRV A;  3D8B A;  3TQS A;  2JWS A;  3QAU A;  1IN7 A;  4FW9 A;  2DZO B;  3A98 B;  3HHY A;  2QQ8 A;  4I5S A;  5BPV A;  4LJ5 A;  5DYI A;  1IN6 A;  3J7B A;  3KOX E;  3A42 A;  3PXG A;  3GLH A;  4D81 A;  2DWZ B;  4JI8 M;  4JI2 M;  4DV5 M;  1MJG M;  2KRU A;  2HHH M;  1EE8 A;  4LJ7 A;  1ZV1 A;  1TDH A;  2B3T A;  2DKL A;  3GPY A;  4P16 A;  4MGZ E;  1WGL A;  2O25 A;  2VII A;  3GLH E;  3K2L A;  4GHA A;  3K92 A;  1OJL A;  2QEN A;  2KA6 B;  4JI1 M;  1ORY B;  1D0K A;  1Z59 A;  3TL4 X;  1DGH B;  3D8L A;  3GQ4 A;  3SYK A;  2DHR A;  4JN6 A;  1SXJ B;  3H4J A;  2X49 A;  1NV8 A;  2EKK A;  2CEA A;  5IZ7 D;  3UZU A;  3SHG B;  3FRI A;  2H5X A;  1QAM A;  1QAN A;  2QCU A;  4LJ9 A;  1TTE A;  5EXS A;  2UUC M;  4LF8 M;  4JI3 M;  4FCW A;  3L27 A;  3U6C A;  1UFZ A;  2WSF F;  4L15 A;  2VQE M;  2LVP C;  2XZF A;  2JA2 A;  4IBI A;  3LW5 F;  3FUT A;  1HJP A;  3L28 A;  1IN4 A;  4PDG A;  3B7N A;  2K6B A;  2LWX A;  1DGB A;  2Y0T A;  5EXT A;  2KNZ A;  3GLI A;  3GLG A;  2UU9 M;  2XFS A;  3U6S A;  3FTF A;  2F5S A;  3W67 A;  1G71 A;  1NHW C;  2BJV A;  2XGN A;  3L26 A;  2CHV A;  2CUZ A;  3HWS A;  2O5R A;  3GLG E;  3A45 A;  1QAO A;  5IT9 S;  2LVN C;  2R4J A;  1T6O A;  2XF3 A;  3AJI B;  2LNH C;  3DOA A;  4AW4 A;  4B3M M;  2CHQ A;  1N33 M;  2YQZ A;  4QNR A;  1L1T A;  5E26 A;  3TWL A;  2CWB A;  2JUJ A;  4B3S M;  1ZMU A;  2F4V M;  1IFY A;  2KZU A;  5DNY A;  5ITR A;  2FFJ A;  2L2D A;  2L09 A;  1FNN A;  2R0I A;  3T38 A;  2DAI A;  5EQT A;  1HQC A;  3GPP A;  1XNR M;  1DGH A;  3HZJ A;  1E32 A;  2LHG A;  1V33 A;  3DZD A;  4RF1 A;  1DGF A;  2EO2 A;  3C9P A;  2Y20 A;  3J81 S;  2L4E A;  3HGI A;  1NJG A;  4IBF A;  2AHM A;  3GO8 A;  3B9P A;  2A5Y B;  1SXJ E;  1L2D A;  5EXP A;  1N77 A;  1IY2 A;  4CHT B;  1IBL M;  2C96 A;  3SMP A;  4CJ6 A;  4HEO A;  5H37 D;  3GQ5 A;  2LVQ D;  4G4O A;  1N75 A;  3BOS A;  4REZ A;  4IJF A;  1XMQ M;  2BNK A;  4D80 A;  2G3Q A;  1EFU B;  2VF7 A;  5IRE B;  8CAT A;  1IBK M;  2FS1 A;  3U60 A;  3AOE C;  3SC3 A;  4NXN M;  2QNJ A;  1KSF X;  1G8P A;  1WHC A;  2C5R A;  1MU5 A;  4FVM A;  2JY8 A;  2Q2E B;  1J7K A;  2DHY A;  2LXE A;  1XMO M;  3T6P A;  2RGH A;  2EJS A;  1TR8 A;  1IXS A;  3GRU A;  3PVS A;  1QAQ A;  2ZAN A;  3KDS E;  2HAK A;  3GLH B;  3KP0 E;  1QZM A;  4G4Q A;  3H4M A;  3J27 B;  4MH0 E;  1YLA A;  4CIZ A;  2MJ5 B;  3MHV C;  1GAB A;  1R2Z A;  4LCB A;  4DV3 M;  1NY5 A;  4GC9 A;  1PJT A;  3PNY A;  2LHC A;  1CUK A;  1R2Y A;  2QBY A;  3HY5 A;  2E5L M;  4IBE A;  1IQP A;  2N35 A;  4IJE A;  4DBG B;  4MGI E;  1J5E M;  4JV5 M;  2G5G X;  5LMU M;  3IHP A;  1IXR C;  1HQY E;  1MN3 A;  2C9C A;  5FTN A;  3FTD A;  3RGP A;  1SG9 A;  4RKU F;  1W5T A;  4TUW A;  1G41 A;  3E21 A;  3SAS A;  4UN2 B;  4CGY B;  3EIH A;  4DR5 M;  1I94 M;  4LF4 M;  2O01 F;  1GL7 A;  4WUR A;  3VLF B;  1PRB A;  4AZF A;  3C58 A;  3W0L B;  2F5O A;  2DAE A;  3ZH9 B;  2I7P A;  2QZ4 A;  3U6L A;  3I01 M;  1IY0 A;  3GLI B;  4W5W A;  3BBZ A;  3VDU A;  1V92 A;  2V6Z M;  5GKN A;  4R71 A;  1Z6T A;  3GPU A;  3LCV B;  4GEW A;  1GO5 A;  4G4N A;  3HX3 A;  1NNU C;  3RFW A;  3OTO M;  2OOB A;  1D0M A;  1GVN A;  3KW6 A;  1RU3 A;  5A2Q S;  3KOW E;  1OIZ A;  2R65 A;  3KS8 A;  1IN5 A;  3FKE A;  3K9O A;  2KZS A;  3M7G A;  2KRK A;  4DV1 M;  4AKG A;  3KP1 E;  1IXZ A;  3FTE A;  3JR5 A;  3NBI A;  4S12 A;  3KFU G;  1F4I A;  2J7N A;  3B7Q A;  1Z5A A;  4DV6 M;  3AOE A;  4MGY E;  4JI6 M;  1T3T A;  4XBO A;  2F5N A;  4XK8 F;  2JY5 A;  4G3O A;  3SHF A;  1QZE A;  2K0B X;  3QWL A;  2L6O A; 
#chains in the Genus database with same CATH homology
 3T1Y M;  4DR1 M;  3SAU A;  4YY3 M;  1GLN A;  3K1J A;  2ZAO A;  3TWM A;  5FLX S;  2R62 A;  3L29 A;  1TH4 A;  5ITQ A;  4LFA M;  5KPR A;  1G4A E;  5LMN M;  2UXC M;  5KPZ A;  5EJC A;  2R18 A;  2ZBK B;  2VQF M;  4HLQ A;  1MX0 A;  3U60 B;  1L1Z A;  4QNM A;  2DWN A;  2OQ4 A;  1GL6 A;  4MGH A;  1HNW M;  4G4R A;  3LMM A;  3FYC A;  5JI3 E;  1K3W A;  4G6Z A;  2NQ8 C;  3U6P A;  2LH0 A;  2QPA A;  4AG6 A;  2R4E A;  5JI2 E;  3SAR A;  1R7R A;  4NXM M;  5ITY A;  1IXS B;  4GC5 A;  2DVW B;  4I4L A;  5F3W A;  3PNV A;  2CFO A;  1NJF A;  2EA0 A;  2R45 A;  1XWI A;  5BR8 M;  2KXE A;  2C99 A;  2CE7 A;  5ITT A;  1XHB A;  4FCV A;  1HNX M;  2QBY B;  3DFZ A;  3CF0 A;  4KOD A;  1NSF A;  4QOS A;  3WHL A;  3CTW B;  4IBC A;  2UXD M;  4LJA A;  1G59 A;  2KEB A;  4FWG A;  1K3X A;  2D7H A;  1TGU A;  2ERC A;  1NNJ A;  3U6E A;  4LF7 M;  3AFH A;  4LY6 A;  2UXB M;  4M0W A;  1UM8 A;  4IIW A;  2XEP A;  2XSZ D;  2C98 A;  4LFC M;  2FOI C;  2G8L A;  2P5T A;  1N36 M;  1C1K A;  3VKH A;  3HJ8 A;  3HU1 A;  1NY6 A;  1DO2 A;  1X37 A;  3VDP A;  3UJN A;  1D2N A;  3GPX A;  5ITX A;  4IBD A;  5E6J A;  1OFI A;  1OFH A;  4LJ8 A;  4B7G A;  1KFV A;  5C1B A;  4LRS A;  3WHK A;  1Q3C A;  1E94 E;  3GRV A;  5ITX E;  4X62 M;  3GQ3 A;  4GMQ A;  3FUU A;  1NVM A;  4AKI A;  1PM5 A;  4AG5 A;  2V1C A;  1QVR A;  4NL4 H;  4JXJ A;  3LQQ A;  2D7E A;  2W82 A;  5KPT A;  3FYD A;  1IN8 A;  1JR3 D;  2QP9 X;  2XSZ A;  1Q39 A;  3FUX A;  4JI4 M;  4L8R C;  1IY1 A;  5EP2 A;  3HJS A;  1HR0 M;  2UUA M;  1N32 M;  3U5Z A;  3SMS A;  1IBM M;  3FUW A;  4KO8 A;  3Q8X A;  4GHL A;  3GRY A;  1R6B X;  4M9S A;  3UK6 A;  1S3S A;  4RNA A;  4M9X A;  1DO0 A;  4KLN A;  5ITU A;  3CF6 E;  1HT1 E;  1XXH A;  1HT2 E;  4D82 A;  2J7O A;  3KVW A;  4GKK M;  4I8O A;  3VK7 A;  5DYG A;  1Z5C A;  2XH9 A;  4LZZ A;  3MJ5 A;  4B3T M;  4GH9 A;  4DR6 M;  4LF5 M;  3SFZ A;  2Y0Q A;  4IBG A;  4R3D A;  3GLF B;  3I4Y A;  4XGI A;  4AKH A;  4L4U A;  3K8Z A;  3FTC A;  1IM2 A;  4QOZ C;  3HJQ A;  1JR3 A;  3AKZ A;  2CV2 A;  1L8Q A;  5FTM A;  1XNQ M;  4AI6 A;  3U6D A;  4M0D A;  3MK6 A;  3LQR A;  1SXJ C;  3AOG A;  4OVZ A;  2X8A A;  1TDZ A;  3E4R A;  5EP1 A;  2XLJ A;  4JI0 M;  3ILK A;  4PD2 A;  1QYR A;  3VFD A;  1E9S A;  3R9X B;  4DV4 M;  4OU7 A;  4GKJ M;  2Z4S A;  4LF6 M;  3J2P B;  3HHZ A;  2HKJ A;  3HHW A;  4EIW A;  1L2B A;  4AQY M;  3VK8 A;  2V1U A;  4GRI A;  4LGM A;  4FCT A;  2DWM A;  4JI5 M;  4ZPX A;  1XC8 A;  4MB7 A;  4DV2 M;  3VKG A;  3L2A A;  4I81 A;  4QHT A;  4X65 M;  2DZN B;  4FD2 A;  4MGK E;  2C9O A;  3HKP A;  2D7G A;  2K47 A;  4DUZ M;  4NSO B;  2L6O A;  4LJ4 A;  4MM3 B;  2XZU A;  3KOZ E;  1I4W A;  1PJJ A;  4DR7 M;  2Z7J A;  3GLF A;  3T15 A;  3FUV A;  2UUB M;  1ZAE A;  1SXJ D;  2DWL A;  3I51 A;  5IWA M;  3KXE C;  3SAW A;  2ZAM A;  4HL4 A;  4DV7 M;  4X64 M;  3M6A A;  4OX9 M;  3KS4 A;  3CF2 A;  3RE8 A;  4NSR A;  2X4A A;  4IBB A;  4A3V B;  4GIT A;  4CIS A;  1FJG M;  3U6O A;  2F5P A;  4PCZ A;  3U6Q A;  1PJI A;  3U61 B;  2HCB A;  2XFT A;  2FE8 A;  3A46 A;  3IG8 A;  1VDD A;  2HL7 A;  1WXQ A;  3LVW A;  5EP4 A;  5FSW A;  3J7A S;  3DA1 A;  1N34 M;  2M60 A;  3U5Z B;  4NRW A;  3E9S A;  3AV0 A;  3ZC7 B;  4LF9 M;  2YFQ A;  2BJW A;  2CHG A;  2R46 A;  4GIP A;  4DUY M;  2RGO A;  1XXH B;  3T1H M;  4II7 A;  3RGS A;  2ZM6 M;  1SXJ A;  1DGG A;  4NOO B;  4BB9 A;  1K82 A;  5FTJ A;  4IBJ A;  4Z6Y A;  3TWK A;  4JI7 M;  4B7H A;  5KQ8 A;  4PT5 A;  2YNM D;  2L7I A;  1QQW A;  3SAT A;  3SAV A;  2L7H A;  3TE6 A;  4LFB M;  5C18 A;  4Z8X A;  3KSX A;  4QHS A;  2H1R A;  4LG2 A;  1W5S A;  2F5Q A;  1TH2 A;  5KQD A;  3IG5 A;  4DV0 M;  4RF0 A;  2CV1 A;  1YSY A;  1TH3 A;  4OVZ B;  3GP1 A;  1HNZ M;  3KOY E;  3GRR A;  1KYI A;  3U6M A;  5EXX A;  4LZJ A;  1Q3B A;  1ZQ9 A;  3U61 A;  1Z5B A;  3TPZ A;  4OW0 A;  3AL0 C;  4L78 A;  3L25 A;  3JAM S;  4DR2 M;  2FNA A;  4DR3 M;  5KO3 A;  3SBJ A;  7CAT A;  3PFI A;  4KHP M;  4K0K M;  3W0F A;  3R8F A;  2Z3X A;  4BLC A;  4WW0 A;  4BBA A;  3HU3 A;  3M0E A;  1YE9 A;  1GKI A;  1YUB A;  2OPF A;  4IBK A;  3J80 S;  1J09 A;  1N78 A;  3FD9 A;  2M5Z A;  4LJ6 A;  4M9Z A;  3I4V A;  5FTL A;  3JR4 A;  1H6U A;  4DR4 M;  1LV7 A;  3LVV A;  4YHH M;  3SYL A;  4R7G A;  4B08 A;  1JQJ C;  4FWD A;  2RKO A;  1NHG C;  3NWL A;  4FWH A;  2I7N A;  2Y21 A;  2KW0 A;  2Z4R A;  3ZCB B;  2EUC A;  3THG A;  4PDI A;  4LRT A;  2CV0 A;  3HHX A;  4B3R M;  4L16 A;  5FTK A;  4LGY A;  5EP3 A;  4X66 M;  3GLG B;  3UGJ A;  3UMM A;  4JYA M;  3EIE A;  1E9R A;  4ITQ A;  4B7F A;  3KSJ A;  3HU2 A;  1L2C A;  2YR0 A;  1G3I A;  4NRV A;  3D8B A;  3TQS A;  3QAU A;  1IN7 A;  4FW9 A;  2DZO B;  3A98 B;  3HHY A;  4I5S A;  5BPV A;  4LJ5 A;  5DYI A;  1IN6 A;  3J7B A;  3KOX E;  3A42 A;  3PXG A;  3GLH A;  4D81 A;  2DWZ B;  4JI8 M;  4JI2 M;  4DV5 M;  2KRU A;  2HHH M;  1EE8 A;  4LJ7 A;  1TDH A;  3GPY A;  4P16 A;  4MGZ E;  2VII A;  3K2L A;  4GHA A;  3K92 A;  1OJL A;  2QEN A;  2KA6 B;  4JI1 M;  1ORY B;  1Z59 A;  3TL4 X;  1DGH B;  3D8L A;  3GQ4 A;  3SYK A;  2DHR A;  4JN6 A;  1SXJ B;  2X49 A;  5IZ7 D;  2CEA A;  3UZU A;  3SHG B;  1QAM A;  1QAN A;  2QCU A;  4LJ9 A;  5EXS A;  2UUC M;  4LF8 M;  4JI3 M;  4FCW A;  3L27 A;  3U6C A;  4L15 A;  2VQE M;  2XZF A;  2JA2 A;  4IBI A;  3FUT A;  3L28 A;  1IN4 A;  4PDG A;  2LWX A;  1DGB A;  2Y0T A;  5EXT A;  3GLI A;  3GLG A;  2UU9 M;  2XFS A;  3U6S A;  3FTF A;  2F5S A;  1NHW C;  2BJV A;  2XGN A;  3L26 A;  2CHV A;  2CUZ A;  3HWS A;  2O5R A;  3A45 A;  1QAO A;  5IT9 S;  2R4J A;  2XF3 A;  3AJI B;  2LNH C;  3DOA A;  4AW4 A;  4B3M M;  2CHQ A;  1N33 M;  2YQZ A;  4QNR A;  1L1T A;  5E26 A;  3TWL A;  4B3S M;  2F4V M;  2KZU A;  5DNY A;  5ITR A;  2FFJ A;  2L09 A;  1FNN A;  3T38 A;  5EQT A;  1HQC A;  3GPP A;  1XNR M;  1DGH A;  1E32 A;  3DZD A;  4RF1 A;  1DGF A;  2EO2 A;  2Y20 A;  3J81 S;  3HGI A;  1NJG A;  4IBF A;  2AHM A;  3GO8 A;  3B9P A;  2A5Y B;  1SXJ E;  1L2D A;  5EXP A;  1N77 A;  1IY2 A;  4CHT B;  1IBL M;  2C96 A;  3SMP A;  5H37 D;  3GQ5 A;  4G4O A;  1N75 A;  3BOS A;  4REZ A;  4IJF A;  1XMQ M;  2BNK A;  4D80 A;  8CAT A;  1IBK M;  5IRE B;  3U60 A;  3AOE C;  3SC3 A;  4NXN M;  1KSF X;  1G8P A;  2C5R A;  1MU5 A;  4FVM A;  2Q2E B;  1J7K A;  2LXE A;  1XMO M;  2RGH A;  3PVS A;  3GRU A;  1QAQ A;  2ZAN A;  3KDS E;  3KP0 E;  3GLH B;  1QZM A;  4G4Q A;  3H4M A;  3J27 B;  4MH0 E;  3MHV C;  1R2Z A;  4LCB A;  4DV3 M;  1NY5 A;  4GC9 A;  3PNY A;  1R2Y A;  2QBY A;  2E5L M;  4IBE A;  1IQP A;  4IJE A;  4JV5 M;  4MGI E;  1J5E M;  2G5G X;  5LMU M;  1IXR C;  1HQY E;  5FTN A;  2C9C A;  3RGP A;  3FTD A;  4TUW A;  1W5T A;  1G41 A;  3SAS A;  4CGY B;  3EIH A;  4DR5 M;  1I94 M;  4LF4 M;  1GL7 A;  4WUR A;  3VLF B;  3C58 A;  4AZF A;  3W0L B;  2F5O A;  3ZH9 B;  2I7P A;  2QZ4 A;  3U6L A;  3GLI B;  1IY0 A;  4W5W A;  3VDU A;  2V6Z M;  5GKN A;  1Z6T A;  3GPU A;  4G4N A;  1NNU C;  3RFW A;  3OTO M;  1GVN A;  3KW6 A;  5A2Q S;  2R65 A;  3KS8 A;  1IN5 A;  3FKE A;  3M7G A;  2KZS A;  2KRK A;  4DV1 M;  4AKG A;  3KP1 E;  1IXZ A;  3FTE A;  3JR5 A;  3NBI A;  4S12 A;  3KFU G;  2J7N A;  4DV6 M;  1Z5A A;  3AOE A;  4MGY E;  4JI6 M;  1T3T A;  4XBO A;  2F5N A;  3SHF A;  2DXI A;  3QWL A;  3KOW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...