3A45A

Crystal structure of mvnei1_2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of a Viral NEIL1 Ortholog Unliganded and Bound to Abasic Site-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
molecule keywords Formamidopyrimidine-DNA glycosylase
total genus 81
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a45A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3a45A01
4DV3M 4KHPM 4K0KM 5LMUM 1K3WA 1L2DA 4DV0M 3GPPA 4YY3M 5ITRA 5BR8M 2OPFA 4GKKM 3SARA 4JI7M 4G4NA 4LFCM 5ITQA 5ITXE 4PD2A 4JI2M 3U6EA 4DR3M 4DV5M 2UUAM 1XNRM 2F5QA 2E5LM 2UXCM 5IWAM 1NNJA 3SAWA 3U6OA 4JI6M 2OQ4A 2XZFA 3GP1A 2Q2EB 3J81S 1R2ZA 5ITYA 2UU9M 2UUCM 4DUZM 1Q3CA 4X62M 4DV2M 4G4OA 3W0FA 3OTOM 1IBLM 4LF6M 3SATA 1MX0A 4B3MM 1XMOM 5ITTA 3A46A 2F5PA 3SBJA 1J5EM 2HKJA 3U6LA 1Z59A 3U6QA 5FLXS 3GQ4A 2VQEM 2HHHM 3GO8A 3U6SA 1L1ZA 3VK7A 4DR7M 1TDHA 1Z5CA 5ITUA 3T1HM 4JI1M 4B3SM 3GQ3A 4DR6M 3C58A 3J7AS 4JI0M 4JYAM 1PJIA 1I94M 4ITQA 4JI8M 3GPUA 4LF8M 1N32M 3TWMA 1TDZA 1IBMM 1R2YA 4X65M 2UXDM 1FJGM 3U6CA 2F5OA 1PJJA 4DR4M 3A42A 1Z5AA 3J80S 4G4QA 2ZBKB 4DUYM 4JI4M 4LF5M 1XC8A 4PCZA 2F4VM 1KFVA 3SAUA 4G4RA 4CISA 2UXBM 3TWLA 4OX9M 4DR5M 2XZUA 1N36M 3U6PA 4LF9M 5ITXA 1EE8A 3GPYA 1N33M 4JI3M 5A2QS 1IBKM 4LFAM 3JR5A 2F5NA 4NXMM 2F5SA 3DOAA 3SAVA 4DV1M 3T1YM 3TWKA 3SASA 4JI5M 4YHHM 2UUBM 1XMQM 1HNWM 1Q3BA 2VQFM 4LFBM 4NXNM 3GPXA 4NRVA 3GQ5A 3VK8A 4DV6M 4DR1M 4X66M 4DR2M 1Z5BA 5IT9S 1Q39A 2ZM6M 4B3TM 1K82A 4GKJM 4DV4M 4PDGA 4LF7M 4X64M 4DV7M 1N34M 4LF4M 4NRWA 1XNQM 4JV5M 1L2CA 1PM5A 1K3XA 4B3RM 4MB7A 4AQYM 3JR4A 2EA0A 3U6MA 1L1TA 1HNZM 3JAMS 1HNXM 4PDIA 1MU5A 1L2BA 5LMNM 3A45A 3U6DA 1HR0M
chains in the Genus database with same CATH superfamily
4DV3M 4KHPM 1N77A 2R65A 4GC5A 2HWJA 5ITRA 1OFHA 4GKKM 3U61B 1SG9A 4AZFA 4LGMA 1IN7A 5ITQA 1ORYB 4DV5M 1XNRM 3HGIA 3B7NA 2C9OA 4FWGA 1C1KA 2XFTA 3SMSA 4XK8F 4F2LA 3GLHB 4Q7JA 2D7HA 3SAWA 2OQ4A 2LVQD 2MH8A 2X4AA 2O5RA 3FUVA 4L8RC 2KXEA 4IBJA 1H6UA 4LJ4A 2DAMA 2J7NA 1IXZA 4MH0E 3J2PB 3J81S 5E26A 1PJSA 5ITYA 2BJWA 2X8AA 3ZH9B 2K0BX 2QBYB 4X62M 1IBLM 2Y0QA 4R7GA 2CHVA 2QPAA 1ZMWA 5ITTA 2MGWA 3KS4A 2V1UA 3AFHA 5FTJA 4GITA 3U6QA 3FE3A 1NVMA 5FLXS 2VQEM 2HHHM 2H5XA 3GLFE 1YSYA 2DZOB 3U6SA 4DR7M 3QAUA 1TDHA 1XXHB 3ILKA 1TH4A 2HCBA 1IN6A 2CP8A 4B3SM 3GQ3A 2K6BA 2ZAMA 4DR6M 2JY6B 2R4JA 2CV2A 1A5TA 1JR3D 4IBGA 4LGYA 4JI0M 1MN3A 2JWSA 4QNRA 1IN4A 3GPUA 1QAQA 1XWIA 3L28A 3KOYE 4L78A 4XBOA 3ZCBB 3TWMA 1NHWC 3K92A 2KA6B 4LY6A 1IBMM 1FJGM 2M60A 3U6CA 2FNAA 3HU1A 3A42A 2ZANA 4WURA 3R9XB 4AI6A 4I5SA 3J80S 4DUYM 1PJTA 4G3OA 2DHRA 3BXWA 3F92A 5EXSA 1TH2A 3HY5A 3I04M 1ZV1A 1QDTA 2C9CA 5KO3A 2UXBM 2D7GA 3U6PA 1NV9A 4ZPXA 2EUCA 4MGHA 4OVZA 4WW0A 4G6ZA 4LFAM 1C7YA 2Z3XA 4FVMA 3L27A 1GL6A 2EO2A 4I4LA 4CGYB 4YHHM 4JI5M 2VQFM 3HX3A 4B7GA 2ZAOA 1SXJD 4REZA 2JY5A 1J7KA 1V92A 2FOIC 3HJ8A 3T15A 1AUAA 2ZM6M 2WSEF 2JA2A 4FCTA 5BPVA 2DAEA 2N35A 3FUTA 2JUJA 3HHYA 1T3TA 4LF7M 1XNQM 3L25A 2Y20A 3AV0A 3R8FA 5JI3E 2L2DA 4IBKA 4IBFA 1J09A 4WP2A 3TQSA 1F4IA 2P5TA 4GIPA 3B89A 4AQYM 3Q8GA 4Y28F 3U6MA 2DXIA 2X49A 1HNZM 1ZMUA 4PDIA 3K8ZA 2XGNA 3M6AA 2W82A 2MJ5B 1JQJC 3A45A 3U6DA 2VIIA 4JXJA 3VDPA 3FTEA 3LQQA 4DV0M 3RE8A 1NO1A 3KVWA 1WGLA 2OPFA 2OOBA 4MGYE 4LFCM 2KZSA 3KP0E 3PFIA 3AL0C 2JZ1A 4DR3M 1OTRA 2JY8A 2Z8YM 2F5QA 2UXCM 1G71A 1P3QQ 1WHCA 2XH9A 3UZUA 2R6FA 2WSCF 3RFWA 3H4JA 4F1IA 3KP1E 2VF8A 1VQ1A 3MJ5A 3A98B 3CF0A 2DKLA 1HJPA 1SXJA 4M9SA 5EP4A 2ZTDA 2GQFA 1QZEA 3IG5A 3LCUA 3UMMA 1G4AE 2I7NA 2DWLA 4IBIA 2R4EA 4LF6M 3GRYA 5EP1A 1DO2A 2C96A 3PNVA 1XMOM 1KSFX 3KSXA 2Y21A 3NBXX 3GRVA 2F5PA 2BWEA 1N78A 1PRBA 3SBJA 1J5EM 3U6LA 3GQ4A 3FTCA 2C99A 3LVVA 4OW0A 1XXHA 1QUSA 3HJSA 4QHSA 4AG6A 3CF6E 1QUTA 5IREB 1GJTA 2DWMA 4QNMA 4Z8XA 2CHQA 3NWLA 4UN2B 1R4GA 4MGKE 1DO0A 1TH3A 1PJIA 1I94M 4ITQA 4W5WA 4P16A 2YQZA 4IJEA 1N32M 5FTKA 2L4FA 2CV0A 1OIPA 4KT0F 3HHXA 2EJSA 3U61A 2LVPC 2UXDM 2WZJA 3FYDA 3SFZA 3UK6A 1CUKA 4G4QA 4D82A 2QQ8A 4LF5M 1E32A 4PCZA 1WIVA 3B7ZA 2F4VM 2V6ZM 4GHLA 3LCVB 2XSZD 4D80A 3HJQA 1QQWA 2XZUA 3T38A 4A3VB 1R5LA 4GHAA 1OKSA 4TUWA 1EE8A 2KNAA 2LWXA 4LJAA 3VFDA 2HL7A 1V34A 3VKGA 2L7HA 2BNKA 1UFZA 5L8RF 1XB2B 3C3EA 4JI3M 5A2QS 2M5ZA 3L26A 4DBGB 3TPZA 3JR5A 1L8QA 3WHLA 3KXEC 2K9DA 3AOEA 4M0DA 3TWKA 3SASA 1HNWM 4NXNM 3GPXA 2KRUA 5KQDA 2FFJA 2C5RA 3W68A 2QP9X 3GQ5A 2DZNB 3VK8A 2LHGA 2G3QA 4DR1M 3SYLA 3I4VA 4LCBA 1Z5BA 3EIHA 5IT9S 2KDLA 1T43A 1NJGA 2RGHA 3V76A 1GABA 1Y8GA 3SHFA 5KQ8A 3RGSA 4DV4M 3GLIE 4X64M 4DV7M 1N34M 5KPTA 1IY0A 1G41A 1G3IA 2KNZA 3LQRA 2CFOA 3Q8XA 4P17A 3KSJA 1L2CA 4IBDA 3D8LA 1K3XA 2OO9A 4S12A 4MB7A 2LNHC 4GH9A 4D81A 1NV8A 1JR3E 3HU2A 2DAGA 3I51A 5GKNA 3VDUA 2LTUA 4AG5A 4B7FA 5JI2E 5LMNM 1L2BA 2L7IA 4DR4M 1HR0M 3PNYA 1BVSA 5LMUM 4M9XA 1K3WA 2D7EA 4FW9A 1DGGA 1D0LA 3W0LB 3HHZA 2QZ4A 4KO8A 4Z6YA 5BR8M 4JI7M 4IBEA 4G4NA 3GLGE 4II7A 4PD2A 4JI2M 3U6EA 3U60A 2UUAM 4AKGA 1VDDA 2EKKA 5C18A 3DFZA 5FTLA 5IWAM 3L29A 1HQYE 3FUWA 4QHTA 3SMPA 2O01F 3U6OA 4JI6M 1TR8A 4NL4H 4I8OA 3CTWB 2MROB 2RGOA 5EXPA 2XZFA 3IECA 3NBIA 1IN5A 2CHGA 2CWBA 1NJFA 2B3TA 3FUXA 2Q2EB 3KDSE 2VDBB 1R2ZA 3GLIA 1NHGC 2DAKA 2KHHA 4FD2A 4GMQA 2KZUA 3ZQJA 2DHYA 2UU9M 1Q3CA 1ZQ9A 2RKOA 4G4OA 1SXJC 3W0FA 3OTOM 1MX0A 4IBCA 4MGIE 4B3MM 2KRKA 1TF0B 2EKFA 1GL7A 1WJ7A 2QBYA 4QOZC 2XF3A 1WGNA 2QSFX 1UM8A 2HKJA 4KLNA 3MHVC 1HQCA 3UJNA 3DZDA 3K1JA 3GO8A 1L1ZA 2JP7A 4CIZA 3LVWA 3C3DA 1HT1E 4BLCA 2DNAA 3IG8A 3PVSA 2XLJA 3J7AS 3GLHE 1EFUB 1XHBA 3E4RA 3EIEA 3FRIA 4JYAM 1QYRA 1OAIA 2R18A 1WXQA 4LZJA 1IM2A 3CF2A 4L15A 2J5YA 1TDZA 3FKEA 3K2LA 4RF1A 3PXGA 1R2YA 1VDLA 2XEPA 2Y0TA 3FYCA 4JI4M 4IJFA 3AJIB 1D2NA 2KW0A 3HU3A 1KFVA 1GLNA 5EXXA 1SXJB 3FUUA 1ZMVA 3W67A 4CISA 8CATA 1IY1A 3KOZE 3TWLA 4OX9M 3WHKA 1GJSA 1N36M 4OU7A 4LF9M 1KYIA 7CATA 5F3WA 3FTDA 1DGBA 2MR9A 3BBZA 1YE9A 3MK6A 1NSFA 1N33M 1IBKM 2JNHA 2A5YB 5KPZA 5KPRA 4GRIA 5EQTA 1VEJA 3QYBA 2F5SA 3BOSA 3DOAA 5EXTA 1N75A 1Q3BA 2XFSA 3M0EA 1YUBA 2QENA 4LRSA 5C1BA 4RF0A 4NRVA 1PGYA 4DV6M 2XSZA 3H4MA 2DWZB 2LVAA 4LRTA 3K9PA 1RU3A 1Q39A 4B3TM 3KFUG 3GLHA 5DYGA 1JB0F 2DENA 4PDGA 3KW6A 1GVNA 2KEBA 4PT5A 1G8PA 3D8BA 4AW4A 1X37A 4I81A 2R62A 4OVZB 1LTMA 5H37D 4NOOB 2AHMA 4B3RM 1HT2E 4HL4A 2BWBA 2Z4SA 4HLQA 5DFLA 1IFYA 1AIPC 3HZJA 1HNXM 1GKIA 2ERCA 1XXHE 3M7GA 2CUZA 3LW5F 2KNVA 2R44A 1L1TA 3SC3A 3TE6A 4K0KM 3E21A 1L2DA 3GPPA 3QYEA 4YY3M 3U5ZB 1DGHB 4LJ8A 1NNUC 3SHGB 1QAMA 2DWNA 3I01M 3SARA 2DAIA 4QOSA 5IZ7D 5ITXE 3U60B 1VEGA 2FH0A 2E5LM 3KOWE 1IQPA 3GRRA 1W5SA 1D0MA 2LXEA 3E9SA 3GRUA 4R71A 2DVWB 1NNJA 4FCVA 2QNJA 1PJQA 2LVNC 1W5TA 1ZAEA 2DZLA 4NSOB 3B7QA 3KOXE 4LZZA 2H1RA 2G5GX 1IXRC 3GP1A 3T1YM 5E6JA 1I4WA 4NC6A 2L4EA 4EIWA 1Q02A 1LV7A 3QWLA 1OQYA 5DNYA 1E94E 4RKUF 2I7PA 1IY2A 1R7RA 2R46A 3SYKA 5FSWA 1OFIA 2UUCM 2R45A 1SXJE 2LH0A 4LJ6A 4DUZM 4DV2M 2LVOC 3IHPA 1OJLA 2WSFF 3SATA 3THGA 2JXNA 1VG5A 1QDRA 1Z6TA 3VLFB 3J7BA 4JN6A 3A46A 3LMMA 4MM3B 4KODA 1VEKA 4L4UA 1Z59A 2K47A 3ZC7B 3K9OA 4LJ5A 2R0IA 4LJ9A 2YNMD 3VK7A 3TL4X 2J7OA 1Z5CA 1TTEA 3DA1A 5ITUA 3T1HM 2HAKA 3MMPA 4LG2A 2LBCA 2RRUA 2Z4RA 4JI1M 1DV0A 1IN8A 5FTMA 2OOAA 3C58A 1OAOC 2LHCA 2Z7JA 4M9ZA 3RGPA 3GLFA 3C9PA 4JI8M 1E9SA 1V33A 3B9PA 3I4YA 4LF8M 1OIZA 4NSRA 2QHOB 1QAOA 2FE8A 3T6PA 4FWHA 4X65M 1YLAA 2YFQA 2ZTCA 3GLIB 1DGHA 4B7HA 1PJJA 2F5OA 1Z5AA 2L6OA 1QZMA 2V1CA 1JR3A 2CE7A 4R3DA 2ZBKB 2C98A 1XC8A 1D0KA 1GO5A 3HWSA 4XGIA 2CV1A 3SAUA 4G4RA 3VKHA 1T6OA 1MJGM 3B74A 3HHWA 4BBAA 3AOEC 3AOGA 4FWDA 4DR5M 1S3SA 4M0WA 4AKIA 4B08A 3GLGA 2GNOA 2YR0A 5ITXA 3CGWA 2O25A 2CEAA 2CRUA 2JY7A 4CJ6A 3GPYA 5EP3A 4GEWA 3GLFB 2G8LA 4HEOA 2F5NA 4NXMM 2FS1A 2VF7A 1NY5A 2BJVA 5FTNA 3GLGB 4DV1M 2NQ8C 1DGFA 1IXSB 3J27B 3SAVA 3FD9A 2L09A 3U5ZA 1XMQM 2UUBM 3FTFA 4LFBM 1QVRA 2APLA 3KS8A 3FRHA 2DI0A 4LJ7A 4BB9A 4X66M 4DR2M 4GC9A 1R6BX 5DYIA 3HKPA 1IXSA 4FCWA 1K82A 4GKJM 1EIJA 5EJCA 4L16A 4AKHA 1TGUA 4LF4M 1NY6A 4NRWA 2JZ0A 5EP2A 4JV5M 1FNNA 3E46A 1PM5A 1G59A 2QCUA 3L2AA 4ANRA 4IIWA 1WR1B 3UGJA 3JR4A 4CHTB 3AKZA 2EA0A 4IBBA 3JAMS 1MU5A 4MGZE 1QANA 1E9RA 4RNAA 4L6V6
chains in the Genus database with same CATH topology
4DV3M 4KHPM 1N77A 2R65A 4GC5A 5ITRA 1OFHA 4GKKM 3U61B 4AZFA 4LGMA 1IN7A 5ITQA 1ORYB 4DV5M 1XNRM 3HGIA 2C9OA 4FWGA 1C1KA 2XFTA 3SMSA 3GLHB 2D7HA 3SAWA 2OQ4A 2X4AA 2O5RA 3FUVA 4L8RC 2KXEA 4IBJA 1H6UA 4LJ4A 2J7NA 1IXZA 4MH0E 3J2PB 3J81S 5E26A 5ITYA 2BJWA 2X8AA 3ZH9B 2QBYB 4X62M 1IBLM 2Y0QA 4R7GA 2CHVA 2QPAA 5ITTA 3KS4A 2V1UA 3AFHA 5FTJA 4GITA 3U6QA 1NVMA 5FLXS 2VQEM 2HHHM 1YSYA 2DZOB 3U6SA 4DR7M 3QAUA 1TDHA 1XXHB 3ILKA 1TH4A 2HCBA 1IN6A 4B3SM 3GQ3A 2ZAMA 4DR6M 2R4JA 2CV2A 1JR3D 4IBGA 4LGYA 4JI0M 4QNRA 1IN4A 3GPUA 1QAQA 1XWIA 3L28A 3KOYE 4L78A 4XBOA 3ZCBB 3TWMA 1NHWC 3K92A 2KA6B 4LY6A 1IBMM 1FJGM 2M60A 3U6CA 2FNAA 3HU1A 3A42A 2ZANA 4WURA 3R9XB 4AI6A 4I5SA 3J80S 4DUYM 2DHRA 5EXSA 1TH2A 2C9CA 5KO3A 2UXBM 2D7GA 3U6PA 4ZPXA 2EUCA 4MGHA 4OVZA 4WW0A 4G6ZA 4LFAM 2Z3XA 4FVMA 3L27A 1GL6A 2EO2A 4I4LA 4CGYB 4YHHM 4JI5M 2VQFM 4B7GA 2ZAOA 1SXJD 4REZA 1J7KA 2FOIC 3HJ8A 3T15A 2ZM6M 2JA2A 4FCTA 5BPVA 3FUTA 3HHYA 1T3TA 4LF7M 1XNQM 3L25A 2Y20A 3AV0A 3R8FA 5JI3E 4IBFA 4IBKA 1J09A 3TQSA 2P5TA 4GIPA 4AQYM 3U6MA 2DXIA 2X49A 1HNZM 4PDIA 3K8ZA 2XGNA 3M6AA 2W82A 3A45A 1JQJC 3U6DA 2VIIA 4JXJA 3VDPA 3FTEA 3LQQA 4DV0M 3RE8A 3KVWA 2OPFA 4MGYE 4LFCM 2KZSA 3KP0E 3PFIA 3AL0C 4DR3M 2F5QA 2UXCM 2XH9A 3UZUA 3RFWA 3KP1E 3MJ5A 3A98B 3CF0A 1SXJA 4M9SA 5EP4A 3IG5A 3UMMA 1G4AE 2I7NA 2DWLA 4IBIA 2R4EA 4LF6M 3GRYA 5EP1A 1DO2A 2C96A 3PNVA 1XMOM 1KSFX 3KSXA 2Y21A 3GRVA 2F5PA 1N78A 3SBJA 1J5EM 3U6LA 3GQ4A 3FTCA 2C99A 3LVVA 4OW0A 1XXHA 3HJSA 4QHSA 4AG6A 3CF6E 5IREB 2DWMA 4QNMA 4Z8XA 2CHQA 3NWLA 4MGKE 1DO0A 1TH3A 1PJIA 1I94M 4ITQA 4W5WA 4P16A 2YQZA 4IJEA 1N32M 5FTKA 2CV0A 3HHXA 3U61A 2UXDM 3FYDA 3SFZA 3UK6A 4G4QA 4D82A 4LF5M 2F4VM 1E32A 4PCZA 2V6ZM 4GHLA 4D80A 2XSZD 3HJQA 1QQWA 2XZUA 3T38A 4A3VB 4GHAA 4TUWA 1EE8A 2LWXA 4LJAA 3VFDA 2HL7A 3VKGA 2L7HA 2BNKA 4JI3M 5A2QS 2M5ZA 3L26A 3TPZA 3JR5A 1L8QA 3WHLA 3KXEC 3AOEA 4M0DA 3TWKA 3SASA 1HNWM 4NXNM 3GPXA 2KRUA 5KQDA 2FFJA 2C5RA 3GQ5A 2QP9X 3VK8A 2DZNB 4DR1M 3SYLA 3I4VA 4LCBA 1Z5BA 3EIHA 5IT9S 2RGHA 1NJGA 3SHFA 5KQ8A 3RGSA 4DV4M 4X64M 4DV7M 1N34M 5KPTA 1IY0A 1G41A 1G3IA 3LQRA 3Q8XA 2CFOA 3KSJA 1L2CA 4IBDA 3D8LA 1K3XA 4S12A 4MB7A 2LNHC 4GH9A 4D81A 3I51A 3HU2A 5GKNA 3VDUA 5JI2E 4AG5A 5LMNM 4B7FA 1L2BA 2L7IA 4DR4M 1HR0M 3PNYA 5LMUM 4M9XA 1K3WA 2D7EA 4FW9A 1DGGA 3W0LB 3HHZA 2QZ4A 4KO8A 4Z6YA 5BR8M 4JI7M 4IBEA 4G4NA 4II7A 4PD2A 4JI2M 3U6EA 3U60A 2UUAM 4AKGA 1VDDA 5C18A 3DFZA 5FTLA 5IWAM 3L29A 1HQYE 3FUWA 4QHTA 3SMPA 3U6OA 4JI6M 4NL4H 4I8OA 3CTWB 2RGOA 5EXPA 2XZFA 3NBIA 1IN5A 2CHGA 3KDSE 1NJFA 3FUXA 2Q2EB 1R2ZA 3GLIA 1NHGC 4FD2A 4GMQA 2KZUA 2UU9M 1Q3CA 1ZQ9A 2RKOA 4G4OA 1SXJC 3W0FA 3OTOM 1MX0A 4IBCA 4MGIE 4B3MM 2KRKA 1GL7A 2QBYA 4QOZC 2XF3A 1UM8A 2HKJA 4KLNA 3MHVC 1HQCA 3UJNA 3DZDA 3K1JA 3GO8A 1L1ZA 3LVWA 1HT1E 4BLCA 3IG8A 3PVSA 2XLJA 3J7AS 1XHBA 3E4RA 3EIEA 4JYAM 1QYRA 2R18A 1WXQA 4LZJA 1IM2A 3CF2A 4L15A 1TDZA 3FKEA 3K2LA 4RF1A 3PXGA 1R2YA 2XEPA 2Y0TA 3FYCA 4JI4M 4IJFA 3AJIB 1D2NA 2KW0A 3HU3A 1KFVA 1GLNA 5EXXA 1SXJB 3FUUA 4CISA 8CATA 1IY1A 3KOZE 3TWLA 4OX9M 3WHKA 1N36M 4OU7A 4LF9M 1KYIA 7CATA 5F3WA 3FTDA 1DGBA 1YE9A 3MK6A 1NSFA 1N33M 1IBKM 2A5YB 5KPZA 5KPRA 4GRIA 5EQTA 3BOSA 3DOAA 5EXTA 1N75A 1Q3BA 2XFSA 3M0EA 1YUBA 2QENA 4LRSA 5C1BA 4RF0A 4NRVA 4DV6M 2XSZA 3H4MA 2DWZB 4LRTA 1Q39A 4B3TM 3KFUG 3GLHA 5DYGA 4PDGA 3KW6A 1GVNA 2KEBA 4PT5A 1G8PA 3D8BA 4AW4A 1X37A 4I81A 2R62A 4OVZB 5H37D 4NOOB 2AHMA 4B3RM 1HT2E 4HL4A 2Z4SA 4HLQA 1HNXM 1GKIA 2ERCA 3M7GA 2CUZA 1L1TA 3SC3A 3TE6A 4K0KM 1L2DA 3GPPA 4YY3M 3U5ZB 1DGHB 4LJ8A 1NNUC 3SHGB 1QAMA 2DWNA 3SARA 4QOSA 5IZ7D 5ITXE 3U60B 2E5LM 3KOWE 1IQPA 3GRRA 1W5SA 2LXEA 3E9SA 3GRUA 1NNJA 2DVWB 4FCVA 1W5TA 1ZAEA 4NSOB 3KOXE 4LZZA 2H1RA 2G5GX 1IXRC 3GP1A 5E6JA 1I4WA 4EIWA 1LV7A 3QWLA 5DNYA 1E94E 3SYKA 2I7PA 1R7RA 1IY2A 2R46A 5FSWA 1OFIA 2UUCM 2R45A 1SXJE 2LH0A 4LJ6A 4DUZM 4DV2M 1OJLA 3SATA 3THGA 1Z6TA 3VLFB 3J7BA 4JN6A 3A46A 3LMMA 4MM3B 4KODA 4L4UA 1Z59A 2K47A 3ZC7B 4LJ5A 4LJ9A 2YNMD 3VK7A 3TL4X 2J7OA 1Z5CA 5ITUA 3DA1A 3T1HM 4LG2A 4JI1M 2Z4RA 1IN8A 5FTMA 3C58A 3GLFA 2Z7JA 4M9ZA 3RGPA 4JI8M 1E9SA 3B9PA 3I4YA 4LF8M 4NSRA 1QAOA 2FE8A 4FWHA 4X65M 2YFQA 3GLIB 1DGHA 4B7HA 1PJJA 2F5OA 1Z5AA 2L6OA 1QZMA 2V1CA 1JR3A 2CE7A 4R3DA 2ZBKB 2C98A 1XC8A 3HWSA 4XGIA 2CV1A 3SAUA 4G4RA 3VKHA 3HHWA 4BBAA 3AOEC 3AOGA 4FWDA 4DR5M 1S3SA 4M0WA 4AKIA 4B08A 3GLGA 2YR0A 5ITXA 2CEAA 3GPYA 5EP3A 3GLFB 2G8LA 2F5NA 4NXMM 3GLGB 5FTNA 1NY5A 2BJVA 4DV1M 3SAVA 3T1YM 2NQ8C 3J27B 1DGFA 1IXSB 3U5ZA 3FD9A 2L09A 1XMQM 2UUBM 3FTFA 4LFBM 1QVRA 3KS8A 4BB9A 4LJ7A 4X66M 4DR2M 4GC9A 1R6BX 5DYIA 3HKPA 4FCWA 1K82A 4GKJM 5EJCA 4L16A 4AKHA 1TGUA 4LF4M 1NY6A 4NRWA 5EP2A 4JV5M 1FNNA 1PM5A 1G59A 2QCUA 3L2AA 4IIWA 3JR4A 3UGJA 2EA0A 4CHTB 3AKZA 4IBBA 3JAMS 1MU5A 4MGZE 1QANA 1E9RA 4RNAA 2F5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 M;  4KHP M;  4K0K M;  5LMU M;  1K3W A;  1L2D A;  4DV0 M;  3GPP A;  4YY3 M;  5ITR A;  5BR8 M;  2OPF A;  4GKK M;  3SAR A;  4JI7 M;  4G4N A;  4LFC M;  5ITQ A;  5ITX E;  4PD2 A;  4JI2 M;  3U6E A;  4DR3 M;  4DV5 M;  2UUA M;  1XNR M;  2F5Q A;  2E5L M;  2UXC M;  5IWA M;  1NNJ A;  3SAW A;  3U6O A;  4JI6 M;  2OQ4 A;  2XZF A;  3GP1 A;  2Q2E B;  3J81 S;  1R2Z A;  5ITY A;  2UU9 M;  2UUC M;  4DUZ M;  1Q3C A;  4X62 M;  4DV2 M;  4G4O A;  3W0F A;  3OTO M;  1IBL M;  4LF6 M;  3SAT A;  1MX0 A;  4B3M M;  1XMO M;  5ITT A;  3A46 A;  2F5P A;  3SBJ A;  1J5E M;  2HKJ A;  3U6L A;  1Z59 A;  3U6Q A;  5FLX S;  3GQ4 A;  2VQE M;  2HHH M;  3GO8 A;  3U6S A;  1L1Z A;  3VK7 A;  4DR7 M;  1TDH A;  1Z5C A;  5ITU A;  3T1H M;  4JI1 M;  4B3S M;  3GQ3 A;  4DR6 M;  3C58 A;  3J7A S;  4JI0 M;  4JYA M;  1PJI A;  1I94 M;  4ITQ A;  4JI8 M;  3GPU A;  4LF8 M;  1N32 M;  3TWM A;  1TDZ A;  1IBM M;  1R2Y A;  4X65 M;  2UXD M;  1FJG M;  3U6C A;  2F5O A;  1PJJ A;  4DR4 M;  3A42 A;  1Z5A A;  3J80 S;  4G4Q A;  2ZBK B;  4DUY M;  4JI4 M;  4LF5 M;  1XC8 A;  4PCZ A;  2F4V M;  1KFV A;  3SAU A;  4G4R A;  4CIS A;  2UXB M;  3TWL A;  4OX9 M;  4DR5 M;  2XZU A;  1N36 M;  3U6P A;  4LF9 M;  5ITX A;  1EE8 A;  3GPY A;  1N33 M;  4JI3 M;  5A2Q S;  1IBK M;  4LFA M;  3JR5 A;  2F5N A;  4NXM M;  2F5S A;  3DOA A;  3SAV A;  4DV1 M;  3T1Y M;  3TWK A;  3SAS A;  4JI5 M;  4YHH M;  2UUB M;  1XMQ M;  1HNW M;  1Q3B A;  2VQF M;  4LFB M;  4NXN M;  3GPX A;  4NRV A;  3GQ5 A;  3VK8 A;  4DV6 M;  4DR1 M;  4X66 M;  4DR2 M;  1Z5B A;  5IT9 S;  1Q39 A;  2ZM6 M;  4B3T M;  1K82 A;  4GKJ M;  4DV4 M;  4PDG A;  4LF7 M;  4X64 M;  4DV7 M;  1N34 M;  4LF4 M;  4NRW A;  1XNQ M;  4JV5 M;  1L2C A;  1PM5 A;  1K3X A;  4B3R M;  4MB7 A;  4AQY M;  3JR4 A;  2EA0 A;  3U6M A;  1L1T A;  1HNZ M;  3JAM S;  1HNX M;  4PDI A;  1MU5 A;  1L2B A;  5LMN M;  3A45 A;  3U6D A;  1HR0 M; 
#chains in the Genus database with same CATH topology
 4DV3 M;  4KHP M;  1N77 A;  2R65 A;  4GC5 A;  2HWJ A;  5ITR A;  1OFH A;  4GKK M;  3U61 B;  1SG9 A;  4AZF A;  4LGM A;  1IN7 A;  5ITQ A;  1ORY B;  4DV5 M;  1XNR M;  3HGI A;  3B7N A;  2C9O A;  4FWG A;  1C1K A;  2XFT A;  3SMS A;  4XK8 F;  4F2L A;  3GLH B;  4Q7J A;  2D7H A;  3SAW A;  2OQ4 A;  2LVQ D;  2MH8 A;  2X4A A;  2O5R A;  3FUV A;  4L8R C;  2KXE A;  4IBJ A;  1H6U A;  4LJ4 A;  2DAM A;  2J7N A;  1IXZ A;  4MH0 E;  3J2P B;  3J81 S;  5E26 A;  1PJS A;  5ITY A;  2BJW A;  2X8A A;  3ZH9 B;  2K0B X;  2QBY B;  4X62 M;  1IBL M;  2Y0Q A;  4R7G A;  2CHV A;  2QPA A;  1ZMW A;  5ITT A;  2MGW A;  3KS4 A;  2V1U A;  3AFH A;  5FTJ A;  4GIT A;  3U6Q A;  3FE3 A;  1NVM A;  5FLX S;  2VQE M;  2HHH M;  2H5X A;  3GLF E;  1YSY A;  2DZO B;  3U6S A;  4DR7 M;  3QAU A;  1TDH A;  1XXH B;  3ILK A;  1TH4 A;  2HCB A;  1IN6 A;  2CP8 A;  4B3S M;  3GQ3 A;  2K6B A;  2ZAM A;  4DR6 M;  2JY6 B;  2R4J A;  2CV2 A;  1A5T A;  1JR3 D;  4IBG A;  4LGY A;  4JI0 M;  1MN3 A;  2JWS A;  4QNR A;  1IN4 A;  3GPU A;  1QAQ A;  1XWI A;  3L28 A;  3KOY E;  4L78 A;  4XBO A;  3ZCB B;  3TWM A;  1NHW C;  3K92 A;  2KA6 B;  4LY6 A;  1IBM M;  1FJG M;  2M60 A;  3U6C A;  2FNA A;  3HU1 A;  3A42 A;  2ZAN A;  4WUR A;  3R9X B;  4AI6 A;  4I5S A;  3J80 S;  4DUY M;  1PJT A;  4G3O A;  2DHR A;  3BXW A;  3F92 A;  5EXS A;  1TH2 A;  3HY5 A;  3I04 M;  1ZV1 A;  1QDT A;  2C9C A;  5KO3 A;  2UXB M;  2D7G A;  3U6P A;  1NV9 A;  4ZPX A;  2EUC A;  4MGH A;  4OVZ A;  4WW0 A;  4G6Z A;  4LFA M;  1C7Y A;  2Z3X A;  4FVM A;  3L27 A;  1GL6 A;  2EO2 A;  4I4L A;  4CGY B;  4YHH M;  4JI5 M;  2VQF M;  3HX3 A;  4B7G A;  2ZAO A;  1SXJ D;  4REZ A;  2JY5 A;  1J7K A;  1V92 A;  2FOI C;  3HJ8 A;  3T15 A;  1AUA A;  2ZM6 M;  2WSE F;  2JA2 A;  4FCT A;  5BPV A;  2DAE A;  2N35 A;  3FUT A;  2JUJ A;  3HHY A;  1T3T A;  4LF7 M;  1XNQ M;  3L25 A;  2Y20 A;  3AV0 A;  3R8F A;  5JI3 E;  2L2D A;  4IBK A;  4IBF A;  1J09 A;  4WP2 A;  3TQS A;  1F4I A;  2P5T A;  4GIP A;  3B89 A;  4AQY M;  3Q8G A;  4Y28 F;  3U6M A;  2DXI A;  2X49 A;  1HNZ M;  1ZMU A;  4PDI A;  3K8Z A;  2XGN A;  3M6A A;  2W82 A;  2MJ5 B;  1JQJ C;  3A45 A;  3U6D A;  2VII A;  4JXJ A;  3VDP A;  3FTE A;  3LQQ A;  4DV0 M;  3RE8 A;  1NO1 A;  3KVW A;  1WGL A;  2OPF A;  2OOB A;  4MGY E;  4LFC M;  2KZS A;  3KP0 E;  3PFI A;  3AL0 C;  2JZ1 A;  4DR3 M;  1OTR A;  2JY8 A;  2Z8Y M;  2F5Q A;  2UXC M;  1G71 A;  1P3Q Q;  1WHC A;  2XH9 A;  3UZU A;  2R6F A;  2WSC F;  3RFW A;  3H4J A;  4F1I A;  3KP1 E;  2VF8 A;  1VQ1 A;  3MJ5 A;  3A98 B;  3CF0 A;  2DKL A;  1HJP A;  1SXJ A;  4M9S A;  5EP4 A;  2ZTD A;  2GQF A;  1QZE A;  3IG5 A;  3LCU A;  3UMM A;  1G4A E;  2I7N A;  2DWL A;  4IBI A;  2R4E A;  4LF6 M;  3GRY A;  5EP1 A;  1DO2 A;  2C96 A;  3PNV A;  1XMO M;  1KSF X;  3KSX A;  2Y21 A;  3NBX X;  3GRV A;  2F5P A;  2BWE A;  1N78 A;  1PRB A;  3SBJ A;  1J5E M;  3U6L A;  3GQ4 A;  3FTC A;  2C99 A;  3LVV A;  4OW0 A;  1XXH A;  1QUS A;  3HJS A;  4QHS A;  4AG6 A;  3CF6 E;  1QUT A;  5IRE B;  1GJT A;  2DWM A;  4QNM A;  4Z8X A;  2CHQ A;  3NWL A;  4UN2 B;  1R4G A;  4MGK E;  1DO0 A;  1TH3 A;  1PJI A;  1I94 M;  4ITQ A;  4W5W A;  4P16 A;  2YQZ A;  4IJE A;  1N32 M;  5FTK A;  2L4F A;  2CV0 A;  1OIP A;  4KT0 F;  3HHX A;  2EJS A;  3U61 A;  2LVP C;  2UXD M;  2WZJ A;  3FYD A;  3SFZ A;  3UK6 A;  1CUK A;  4G4Q A;  4D82 A;  2QQ8 A;  4LF5 M;  1E32 A;  4PCZ A;  1WIV A;  3B7Z A;  2F4V M;  2V6Z M;  4GHL A;  3LCV B;  2XSZ D;  4D80 A;  3HJQ A;  1QQW A;  2XZU A;  3T38 A;  4A3V B;  1R5L A;  4GHA A;  1OKS A;  4TUW A;  1EE8 A;  2KNA A;  2LWX A;  4LJA A;  3VFD A;  2HL7 A;  1V34 A;  3VKG A;  2L7H A;  2BNK A;  1UFZ A;  5L8R F;  1XB2 B;  3C3E A;  4JI3 M;  5A2Q S;  2M5Z A;  3L26 A;  4DBG B;  3TPZ A;  3JR5 A;  1L8Q A;  3WHL A;  3KXE C;  2K9D A;  3AOE A;  4M0D A;  3TWK A;  3SAS A;  1HNW M;  4NXN M;  3GPX A;  2KRU A;  5KQD A;  2FFJ A;  2C5R A;  3W68 A;  2QP9 X;  3GQ5 A;  2DZN B;  3VK8 A;  2LHG A;  2G3Q A;  4DR1 M;  3SYL A;  3I4V A;  4LCB A;  1Z5B A;  3EIH A;  5IT9 S;  2KDL A;  1T43 A;  1NJG A;  2RGH A;  3V76 A;  1GAB A;  1Y8G A;  3SHF A;  5KQ8 A;  3RGS A;  4DV4 M;  3GLI E;  4X64 M;  4DV7 M;  1N34 M;  5KPT A;  1IY0 A;  1G41 A;  1G3I A;  2KNZ A;  3LQR A;  2CFO A;  3Q8X A;  4P17 A;  3KSJ A;  1L2C A;  4IBD A;  3D8L A;  1K3X A;  2OO9 A;  4S12 A;  4MB7 A;  2LNH C;  4GH9 A;  4D81 A;  1NV8 A;  1JR3 E;  3HU2 A;  2DAG A;  3I51 A;  5GKN A;  3VDU A;  2LTU A;  4AG5 A;  4B7F A;  5JI2 E;  5LMN M;  1L2B A;  2L7I A;  4DR4 M;  1HR0 M;  3PNY A;  1BVS A;  5LMU M;  4M9X A;  1K3W A;  2D7E A;  4FW9 A;  1DGG A;  1D0L A;  3W0L B;  3HHZ A;  2QZ4 A;  4KO8 A;  4Z6Y A;  5BR8 M;  4JI7 M;  4IBE A;  4G4N A;  3GLG E;  4II7 A;  4PD2 A;  4JI2 M;  3U6E A;  3U60 A;  2UUA M;  4AKG A;  1VDD A;  2EKK A;  5C18 A;  3DFZ A;  5FTL A;  5IWA M;  3L29 A;  1HQY E;  3FUW A;  4QHT A;  3SMP A;  2O01 F;  3U6O A;  4JI6 M;  1TR8 A;  4NL4 H;  4I8O A;  3CTW B;  2MRO B;  2RGO A;  5EXP A;  2XZF A;  3IEC A;  3NBI A;  1IN5 A;  2CHG A;  2CWB A;  1NJF A;  2B3T A;  3FUX A;  2Q2E B;  3KDS E;  2VDB B;  1R2Z A;  3GLI A;  1NHG C;  2DAK A;  2KHH A;  4FD2 A;  4GMQ A;  2KZU A;  3ZQJ A;  2DHY A;  2UU9 M;  1Q3C A;  1ZQ9 A;  2RKO A;  4G4O A;  1SXJ C;  3W0F A;  3OTO M;  1MX0 A;  4IBC A;  4MGI E;  4B3M M;  2KRK A;  1TF0 B;  2EKF A;  1GL7 A;  1WJ7 A;  2QBY A;  4QOZ C;  2XF3 A;  1WGN A;  2QSF X;  1UM8 A;  2HKJ A;  4KLN A;  3MHV C;  1HQC A;  3UJN A;  3DZD A;  3K1J A;  3GO8 A;  1L1Z A;  2JP7 A;  4CIZ A;  3LVW A;  3C3D A;  1HT1 E;  4BLC A;  2DNA A;  3IG8 A;  3PVS A;  2XLJ A;  3J7A S;  3GLH E;  1EFU B;  1XHB A;  3E4R A;  3EIE A;  3FRI A;  4JYA M;  1QYR A;  1OAI A;  2R18 A;  1WXQ A;  4LZJ A;  1IM2 A;  3CF2 A;  4L15 A;  2J5Y A;  1TDZ A;  3FKE A;  3K2L A;  4RF1 A;  3PXG A;  1R2Y A;  1VDL A;  2XEP A;  2Y0T A;  3FYC A;  4JI4 M;  4IJF A;  3AJI B;  1D2N A;  2KW0 A;  3HU3 A;  1KFV A;  1GLN A;  5EXX A;  1SXJ B;  3FUU A;  1ZMV A;  3W67 A;  4CIS A;  8CAT A;  1IY1 A;  3KOZ E;  3TWL A;  4OX9 M;  3WHK A;  1GJS A;  1N36 M;  4OU7 A;  4LF9 M;  1KYI A;  7CAT A;  5F3W A;  3FTD A;  1DGB A;  2MR9 A;  3BBZ A;  1YE9 A;  3MK6 A;  1NSF A;  1N33 M;  1IBK M;  2JNH A;  2A5Y B;  5KPZ A;  5KPR A;  4GRI A;  5EQT A;  1VEJ A;  3QYB A;  2F5S A;  3BOS A;  3DOA A;  5EXT A;  1N75 A;  1Q3B A;  2XFS A;  3M0E A;  1YUB A;  2QEN A;  4LRS A;  5C1B A;  4RF0 A;  4NRV A;  1PGY A;  4DV6 M;  2XSZ A;  3H4M A;  2DWZ B;  2LVA A;  4LRT A;  3K9P A;  1RU3 A;  1Q39 A;  4B3T M;  3KFU G;  3GLH A;  5DYG A;  1JB0 F;  2DEN A;  4PDG A;  3KW6 A;  1GVN A;  2KEB A;  4PT5 A;  1G8P A;  3D8B A;  4AW4 A;  1X37 A;  4I81 A;  2R62 A;  4OVZ B;  1LTM A;  5H37 D;  4NOO B;  2AHM A;  4B3R M;  1HT2 E;  4HL4 A;  2BWB A;  2Z4S A;  4HLQ A;  5DFL A;  1IFY A;  1AIP C;  3HZJ A;  1HNX M;  1GKI A;  2ERC A;  1XXH E;  3M7G A;  2CUZ A;  3LW5 F;  2KNV A;  2R44 A;  1L1T A;  3SC3 A;  3TE6 A;  4K0K M;  3E21 A;  1L2D A;  3GPP A;  3QYE A;  4YY3 M;  3U5Z B;  1DGH B;  4LJ8 A;  1NNU C;  3SHG B;  1QAM A;  2DWN A;  3I01 M;  3SAR A;  2DAI A;  4QOS A;  5IZ7 D;  5ITX E;  3U60 B;  1VEG A;  2FH0 A;  2E5L M;  3KOW E;  1IQP A;  3GRR A;  1W5S A;  1D0M A;  2LXE A;  3E9S A;  3GRU A;  4R71 A;  2DVW B;  1NNJ A;  4FCV A;  2QNJ A;  1PJQ A;  2LVN C;  1W5T A;  1ZAE A;  2DZL A;  4NSO B;  3B7Q A;  3KOX E;  4LZZ A;  2H1R A;  2G5G X;  1IXR C;  3GP1 A;  3T1Y M;  5E6J A;  1I4W A;  4NC6 A;  2L4E A;  4EIW A;  1Q02 A;  1LV7 A;  3QWL A;  1OQY A;  5DNY A;  1E94 E;  4RKU F;  2I7P A;  1IY2 A;  1R7R A;  2R46 A;  3SYK A;  5FSW A;  1OFI A;  2UUC M;  2R45 A;  1SXJ E;  2LH0 A;  4LJ6 A;  4DUZ M;  4DV2 M;  2LVO C;  3IHP A;  1OJL A;  2WSF F;  3SAT A;  3THG A;  2JXN A;  1VG5 A;  1QDR A;  1Z6T A;  3VLF B;  3J7B A;  4JN6 A;  3A46 A;  3LMM A;  4MM3 B;  4KOD A;  1VEK A;  4L4U A;  1Z59 A;  2K47 A;  3ZC7 B;  3K9O A;  4LJ5 A;  2R0I A;  4LJ9 A;  2YNM D;  3VK7 A;  3TL4 X;  2J7O A;  1Z5C A;  1TTE A;  3DA1 A;  5ITU A;  3T1H M;  2HAK A;  3MMP A;  4LG2 A;  2LBC A;  2RRU A;  2Z4R A;  4JI1 M;  1DV0 A;  1IN8 A;  5FTM A;  2OOA A;  3C58 A;  1OAO C;  2LHC A;  2Z7J A;  4M9Z A;  3RGP A;  3GLF A;  3C9P A;  4JI8 M;  1E9S A;  1V33 A;  3B9P A;  3I4Y A;  4LF8 M;  1OIZ A;  4NSR A;  2QHO B;  1QAO A;  2FE8 A;  3T6P A;  4FWH A;  4X65 M;  1YLA A;  2YFQ A;  2ZTC A;  3GLI B;  1DGH A;  4B7H A;  1PJJ A;  2F5O A;  1Z5A A;  2L6O A;  1QZM A;  2V1C A;  1JR3 A;  2CE7 A;  4R3D A;  2ZBK B;  2C98 A;  1XC8 A;  1D0K A;  1GO5 A;  3HWS A;  4XGI A;  2CV1 A;  3SAU A;  4G4R A;  3VKH A;  1T6O A;  1MJG M;  3B74 A;  3HHW A;  4BBA A;  3AOE C;  3AOG A;  4FWD A;  4DR5 M;  1S3S A;  4M0W A;  4AKI A;  4B08 A;  3GLG A;  2GNO A;  2YR0 A;  5ITX A;  3CGW A;  2O25 A;  2CEA A;  2CRU A;  2JY7 A;  4CJ6 A;  3GPY A;  5EP3 A;  4GEW A;  3GLF B;  2G8L A;  4HEO A;  2F5N A;  4NXM M;  2FS1 A;  2VF7 A;  1NY5 A;  2BJV A;  5FTN A;  3GLG B;  4DV1 M;  2NQ8 C;  1DGF A;  1IXS B;  3J27 B;  3SAV A;  3FD9 A;  2L09 A;  3U5Z A;  1XMQ M;  2UUB M;  3FTF A;  4LFB M;  1QVR A;  2APL A;  3KS8 A;  3FRH A;  2DI0 A;  4LJ7 A;  4BB9 A;  4X66 M;  4DR2 M;  4GC9 A;  1R6B X;  5DYI A;  3HKP A;  1IXS A;  4FCW A;  1K82 A;  4GKJ M;  1EIJ A;  5EJC A;  4L16 A;  4AKH A;  1TGU A;  4LF4 M;  1NY6 A;  4NRW A;  2JZ0 A;  5EP2 A;  4JV5 M;  1FNN A;  3E46 A;  1PM5 A;  1G59 A;  2QCU A;  3L2A A;  4ANR A;  4IIW A;  1WR1 B;  3UGJ A;  3JR4 A;  4CHT B;  3AKZ A;  2EA0 A;  4IBB A;  3JAM S;  1MU5 A;  4MGZ E;  1QAN A;  1E9R A;  4RNA A;  4L6V 6; 
#chains in the Genus database with same CATH homology
 4DV3 M;  4KHP M;  1N77 A;  2R65 A;  4GC5 A;  5ITR A;  1OFH A;  4GKK M;  3U61 B;  4AZF A;  4LGM A;  1IN7 A;  5ITQ A;  1ORY B;  4DV5 M;  1XNR M;  3HGI A;  2C9O A;  4FWG A;  1C1K A;  2XFT A;  3SMS A;  3GLH B;  2D7H A;  3SAW A;  2OQ4 A;  2X4A A;  2O5R A;  3FUV A;  4L8R C;  2KXE A;  4IBJ A;  1H6U A;  4LJ4 A;  2J7N A;  1IXZ A;  4MH0 E;  3J2P B;  3J81 S;  5E26 A;  5ITY A;  2BJW A;  2X8A A;  3ZH9 B;  2QBY B;  4X62 M;  1IBL M;  2Y0Q A;  4R7G A;  2CHV A;  2QPA A;  5ITT A;  3KS4 A;  2V1U A;  3AFH A;  5FTJ A;  4GIT A;  3U6Q A;  1NVM A;  5FLX S;  2VQE M;  2HHH M;  1YSY A;  2DZO B;  3U6S A;  4DR7 M;  3QAU A;  1TDH A;  1XXH B;  3ILK A;  1TH4 A;  2HCB A;  1IN6 A;  4B3S M;  3GQ3 A;  2ZAM A;  4DR6 M;  2R4J A;  2CV2 A;  1JR3 D;  4IBG A;  4LGY A;  4JI0 M;  4QNR A;  1IN4 A;  3GPU A;  1QAQ A;  1XWI A;  3L28 A;  3KOY E;  4L78 A;  4XBO A;  3ZCB B;  3TWM A;  1NHW C;  3K92 A;  2KA6 B;  4LY6 A;  1IBM M;  1FJG M;  2M60 A;  3U6C A;  2FNA A;  3HU1 A;  3A42 A;  2ZAN A;  4WUR A;  3R9X B;  4AI6 A;  4I5S A;  3J80 S;  4DUY M;  2DHR A;  5EXS A;  1TH2 A;  2C9C A;  5KO3 A;  2UXB M;  2D7G A;  3U6P A;  4ZPX A;  2EUC A;  4MGH A;  4OVZ A;  4WW0 A;  4G6Z A;  4LFA M;  2Z3X A;  4FVM A;  3L27 A;  1GL6 A;  2EO2 A;  4I4L A;  4CGY B;  4YHH M;  4JI5 M;  2VQF M;  4B7G A;  2ZAO A;  1SXJ D;  4REZ A;  1J7K A;  2FOI C;  3HJ8 A;  3T15 A;  2ZM6 M;  2JA2 A;  4FCT A;  5BPV A;  3FUT A;  3HHY A;  1T3T A;  4LF7 M;  1XNQ M;  3L25 A;  2Y20 A;  3AV0 A;  3R8F A;  5JI3 E;  4IBF A;  4IBK A;  1J09 A;  3TQS A;  2P5T A;  4GIP A;  4AQY M;  3U6M A;  2DXI A;  2X49 A;  1HNZ M;  4PDI A;  3K8Z A;  2XGN A;  3M6A A;  2W82 A;  3A45 A;  1JQJ C;  3U6D A;  2VII A;  4JXJ A;  3VDP A;  3FTE A;  3LQQ A;  4DV0 M;  3RE8 A;  3KVW A;  2OPF A;  4MGY E;  4LFC M;  2KZS A;  3KP0 E;  3PFI A;  3AL0 C;  4DR3 M;  2F5Q A;  2UXC M;  2XH9 A;  3UZU A;  3RFW A;  3KP1 E;  3MJ5 A;  3A98 B;  3CF0 A;  1SXJ A;  4M9S A;  5EP4 A;  3IG5 A;  3UMM A;  1G4A E;  2I7N A;  2DWL A;  4IBI A;  2R4E A;  4LF6 M;  3GRY A;  5EP1 A;  1DO2 A;  2C96 A;  3PNV A;  1XMO M;  1KSF X;  3KSX A;  2Y21 A;  3GRV A;  2F5P A;  1N78 A;  3SBJ A;  1J5E M;  3U6L A;  3GQ4 A;  3FTC A;  2C99 A;  3LVV A;  4OW0 A;  1XXH A;  3HJS A;  4QHS A;  4AG6 A;  3CF6 E;  5IRE B;  2DWM A;  4QNM A;  4Z8X A;  2CHQ A;  3NWL A;  4MGK E;  1DO0 A;  1TH3 A;  1PJI A;  1I94 M;  4ITQ A;  4W5W A;  4P16 A;  2YQZ A;  4IJE A;  1N32 M;  5FTK A;  2CV0 A;  3HHX A;  3U61 A;  2UXD M;  3FYD A;  3SFZ A;  3UK6 A;  4G4Q A;  4D82 A;  4LF5 M;  2F4V M;  1E32 A;  4PCZ A;  2V6Z M;  4GHL A;  4D80 A;  2XSZ D;  3HJQ A;  1QQW A;  2XZU A;  3T38 A;  4A3V B;  4GHA A;  4TUW A;  1EE8 A;  2LWX A;  4LJA A;  3VFD A;  2HL7 A;  3VKG A;  2L7H A;  2BNK A;  4JI3 M;  5A2Q S;  2M5Z A;  3L26 A;  3TPZ A;  3JR5 A;  1L8Q A;  3WHL A;  3KXE C;  3AOE A;  4M0D A;  3TWK A;  3SAS A;  1HNW M;  4NXN M;  3GPX A;  2KRU A;  5KQD A;  2FFJ A;  2C5R A;  3GQ5 A;  2QP9 X;  3VK8 A;  2DZN B;  4DR1 M;  3SYL A;  3I4V A;  4LCB A;  1Z5B A;  3EIH A;  5IT9 S;  2RGH A;  1NJG A;  3SHF A;  5KQ8 A;  3RGS A;  4DV4 M;  4X64 M;  4DV7 M;  1N34 M;  5KPT A;  1IY0 A;  1G41 A;  1G3I A;  3LQR A;  3Q8X A;  2CFO A;  3KSJ A;  1L2C A;  4IBD A;  3D8L A;  1K3X A;  4S12 A;  4MB7 A;  2LNH C;  4GH9 A;  4D81 A;  3I51 A;  3HU2 A;  5GKN A;  3VDU A;  5JI2 E;  4AG5 A;  5LMN M;  4B7F A;  1L2B A;  2L7I A;  4DR4 M;  1HR0 M;  3PNY A;  5LMU M;  4M9X A;  1K3W A;  2D7E A;  4FW9 A;  1DGG A;  3W0L B;  3HHZ A;  2QZ4 A;  4KO8 A;  4Z6Y A;  5BR8 M;  4JI7 M;  4IBE A;  4G4N A;  4II7 A;  4PD2 A;  4JI2 M;  3U6E A;  3U60 A;  2UUA M;  4AKG A;  1VDD A;  5C18 A;  3DFZ A;  5FTL A;  5IWA M;  3L29 A;  1HQY E;  3FUW A;  4QHT A;  3SMP A;  3U6O A;  4JI6 M;  4NL4 H;  4I8O A;  3CTW B;  2RGO A;  5EXP A;  2XZF A;  3NBI A;  1IN5 A;  2CHG A;  3KDS E;  1NJF A;  3FUX A;  2Q2E B;  1R2Z A;  3GLI A;  1NHG C;  4FD2 A;  4GMQ A;  2KZU A;  2UU9 M;  1Q3C A;  1ZQ9 A;  2RKO A;  4G4O A;  1SXJ C;  3W0F A;  3OTO M;  1MX0 A;  4IBC A;  4MGI E;  4B3M M;  2KRK A;  1GL7 A;  2QBY A;  4QOZ C;  2XF3 A;  1UM8 A;  2HKJ A;  4KLN A;  3MHV C;  1HQC A;  3UJN A;  3DZD A;  3K1J A;  3GO8 A;  1L1Z A;  3LVW A;  1HT1 E;  4BLC A;  3IG8 A;  3PVS A;  2XLJ A;  3J7A S;  1XHB A;  3E4R A;  3EIE A;  4JYA M;  1QYR A;  2R18 A;  1WXQ A;  4LZJ A;  1IM2 A;  3CF2 A;  4L15 A;  1TDZ A;  3FKE A;  3K2L A;  4RF1 A;  3PXG A;  1R2Y A;  2XEP A;  2Y0T A;  3FYC A;  4JI4 M;  4IJF A;  3AJI B;  1D2N A;  2KW0 A;  3HU3 A;  1KFV A;  1GLN A;  5EXX A;  1SXJ B;  3FUU A;  4CIS A;  8CAT A;  1IY1 A;  3KOZ E;  3TWL A;  4OX9 M;  3WHK A;  1N36 M;  4OU7 A;  4LF9 M;  1KYI A;  7CAT A;  5F3W A;  3FTD A;  1DGB A;  1YE9 A;  3MK6 A;  1NSF A;  1N33 M;  1IBK M;  2A5Y B;  5KPZ A;  5KPR A;  4GRI A;  5EQT A;  3BOS A;  3DOA A;  5EXT A;  1N75 A;  1Q3B A;  2XFS A;  3M0E A;  1YUB A;  2QEN A;  4LRS A;  5C1B A;  4RF0 A;  4NRV A;  4DV6 M;  2XSZ A;  3H4M A;  2DWZ B;  4LRT A;  1Q39 A;  4B3T M;  3KFU G;  3GLH A;  5DYG A;  4PDG A;  3KW6 A;  1GVN A;  2KEB A;  4PT5 A;  1G8P A;  3D8B A;  4AW4 A;  1X37 A;  4I81 A;  2R62 A;  4OVZ B;  5H37 D;  4NOO B;  2AHM A;  4B3R M;  1HT2 E;  4HL4 A;  2Z4S A;  4HLQ A;  1HNX M;  1GKI A;  2ERC A;  3M7G A;  2CUZ A;  1L1T A;  3SC3 A;  3TE6 A;  4K0K M;  1L2D A;  3GPP A;  4YY3 M;  3U5Z B;  1DGH B;  4LJ8 A;  1NNU C;  3SHG B;  1QAM A;  2DWN A;  3SAR A;  4QOS A;  5IZ7 D;  5ITX E;  3U60 B;  2E5L M;  3KOW E;  1IQP A;  3GRR A;  1W5S A;  2LXE A;  3E9S A;  3GRU A;  1NNJ A;  2DVW B;  4FCV A;  1W5T A;  1ZAE A;  4NSO B;  3KOX E;  4LZZ A;  2H1R A;  2G5G X;  1IXR C;  3GP1 A;  5E6J A;  1I4W A;  4EIW A;  1LV7 A;  3QWL A;  5DNY A;  1E94 E;  3SYK A;  2I7P A;  1R7R A;  1IY2 A;  2R46 A;  5FSW A;  1OFI A;  2UUC M;  2R45 A;  1SXJ E;  2LH0 A;  4LJ6 A;  4DUZ M;  4DV2 M;  1OJL A;  3SAT A;  3THG A;  1Z6T A;  3VLF B;  3J7B A;  4JN6 A;  3A46 A;  3LMM A;  4MM3 B;  4KOD A;  4L4U A;  1Z59 A;  2K47 A;  3ZC7 B;  4LJ5 A;  4LJ9 A;  2YNM D;  3VK7 A;  3TL4 X;  2J7O A;  1Z5C A;  5ITU A;  3DA1 A;  3T1H M;  4LG2 A;  4JI1 M;  2Z4R A;  1IN8 A;  5FTM A;  3C58 A;  3GLF A;  2Z7J A;  4M9Z A;  3RGP A;  4JI8 M;  1E9S A;  3B9P A;  3I4Y A;  4LF8 M;  4NSR A;  1QAO A;  2FE8 A;  4FWH A;  4X65 M;  2YFQ A;  3GLI B;  1DGH A;  4B7H A;  1PJJ A;  2F5O A;  1Z5A A;  2L6O A;  1QZM A;  2V1C A;  1JR3 A;  2CE7 A;  4R3D A;  2ZBK B;  2C98 A;  1XC8 A;  3HWS A;  4XGI A;  2CV1 A;  3SAU A;  4G4R A;  3VKH A;  3HHW A;  4BBA A;  3AOE C;  3AOG A;  4FWD A;  4DR5 M;  1S3S A;  4M0W A;  4AKI A;  4B08 A;  3GLG A;  2YR0 A;  5ITX A;  2CEA A;  3GPY A;  5EP3 A;  3GLF B;  2G8L A;  2F5N A;  4NXM M;  3GLG B;  5FTN A;  1NY5 A;  2BJV A;  4DV1 M;  3SAV A;  3T1Y M;  2NQ8 C;  3J27 B;  1DGF A;  1IXS B;  3U5Z A;  3FD9 A;  2L09 A;  1XMQ M;  2UUB M;  3FTF A;  4LFB M;  1QVR A;  3KS8 A;  4BB9 A;  4LJ7 A;  4X66 M;  4DR2 M;  4GC9 A;  1R6B X;  5DYI A;  3HKP A;  4FCW A;  1K82 A;  4GKJ M;  5EJC A;  4L16 A;  4AKH A;  1TGU A;  4LF4 M;  1NY6 A;  4NRW A;  5EP2 A;  4JV5 M;  1FNN A;  1PM5 A;  1G59 A;  2QCU A;  3L2A A;  4IIW A;  3JR4 A;  3UGJ A;  2EA0 A;  4CHT B;  3AKZ A;  4IBB A;  3JAM S;  1MU5 A;  4MGZ E;  1QAN A;  1E9R A;  4RNA A;  2F5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...