3A45A

Crystal structure of mvnei1_2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase
publication title Structural Characterization of a Viral NEIL1 Ortholog Unliganded and Bound to Abasic Site-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
total genus 81
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a45A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3a45A01
3GQ3A 4B3SM 3GQ4A 5ITYA 5ITXA 4DR3M 2UUAM 2F5PA 1PJJA 3GO8A 4LF9M 1IBKM 4PDGA 5IT9S 4X66M 2HKJA 1R2ZA 4LF5M 1Z5BA 3A42A 3A46A 3U6CA 5LMUM 4JI6M 1R2YA 4JI7M 1PM5A 1KFVA 3W0FA 4B3RM 2XZFA 3JR5A 5ITRA 3TWKA 1Z59A 3J80S 1I94M 4DR4M 1Z5AA 3GPPA 4OX9M 4YHHM 1K82A 1HNWM 4DR1M 3SAUA 1XNQM 1FJGM 4NRVA 5IWAM 3J7AS 1NNJA 4CISA 1XMOM 2UU9M 4LF7M 2UXBM 4JI0M 1N36M 4X64M 4JI3M 4X65M 3JAMS 3TWMA 3VK7A 1L1ZA 1N32M 3GP1A 4PDIA 4DV5M 4AQYM 4JYAM 4DV6M 4DR7M 4JI2M 1XNRM 2F5SA 4B3TM 4JV5M 4NXNM 3SAVA 4DR5M 1K3WA 4G4RA 1HNXM 5BR8M 1TDHA 4G4OA 2Q2EB 4DV3M 4GKKM 4PCZA 3A45A 2VQFM 1Z5CA 1J5EM 4B3MM 1L2CA 2UUBM 1L2DA 4G4NA 1IBLM 3SARA 5ITXE 3U6MA 1PJIA 3SASA 2OPFA 2F5NA 3TWLA 2EA0A 4G4QA 3JR4A 2E5LM 3GPYA 4DUZM 5ITQA 4LFCM 1Q3BA 1N33M 2ZBKB 3OTOM 2UXDM 4DV7M 3VK8A 2VQEM 3U6QA 4DV0M 4JI1M 3SATA 1XMQM 2UXCM 5ITUA 5A2QS 3GPXA 4LFAM 3U6DA 3SAWA 1TDZA 1K3XA 4MB7A 2ZM6M 2F4VM 5ITTA 4GKJM 1HNZM 1EE8A 2F5QA 3GPUA 3T1YM 3GQ5A 4PD2A 4DR6M 3T1HM 1MX0A 4K0KM 4ITQA 4JI8M 2OQ4A 2XZUA 4X62M 2HHHM 4LF8M 2F5OA 3U6EA 5FLXS 3J81S 3SBJA 3U6LA 4DV1M 4DV4M 1IBMM 4DR2M 1MU5A 3U6PA 1L2BA 4LFBM 3C58A 4DUYM 1N34M 2UUCM 4LF6M 3DOAA 4NRWA 4DV2M 4JI4M 1HR0M 4JI5M 4LF4M 4NXMM 1Q39A 4YY3M 5LMNM 3U6OA 1Q3CA 1XC8A 1L1TA 4KHPM 3U6SA
chains in the Genus database with same CATH superfamily
3AOGA 2QP9X 7CATA 4B3SM 3GLHA 3GQ4A 1HT2E 3MHVC 5ITXA 1W5SA 4LY6A 2F5PA 3GO8A 4I81A 1DO2A 3FKEA 1E32A 1OKSA 4X66M 1WHCA 2D7HA 4B7GA 1OFHA 2R44A 3FTCA 2C5RA 1Z5BA 1Y8GA 3U6CA 3GLFE 4GEWA 1YUBA 2G8LA 4JI6M 1YLAA 1QDTA 1PM5A 2J7OA 2CHVA 4RKUF 4JI7M 4B3RM 4QOSA 3GLGB 2B3TA 2QCUA 2XZFA 2CE7A 2FFJA 2LNHC 3GRRA 2MH8A 4LRSA 4LZJA 3B9PA 3HY5A 4RF1A 4M0DA 4RNAA 3VLFB 1I94M 4HL4A 4QNMA 4KO8A 1GKIA 1XNQM 2O01F 3SFZA 4WW0A 1PJQA 1NJGA 2DAIA 3M6AA 4NRVA 3SC3A 5IWAM 2L4FA 3FTDA 3HU3A 4CGYB 4CISA 2BJVA 4NL4H 4QOZC 2UU9M 4I8OA 3KOWE 1NY6A 3GLGE 4JI3M 2KDLA 4JXJA 3TWMA 3VK7A 1ZV1A 1N32M 1A5TA 2XEPA 2BWEA 5EQTA 4AQYM 4JYAM 1IY2A 1H6UA 2W82A 3A98B 4L4UA 4LRTA 3VDPA 4DV6M 4JI2M 1E9RA 2I7PA 3VFDA 1MN3A 3M7GA 2R4EA 1WGLA 3B89A 3E4RA 4TUWA 4MGZE 4G4OA 1GJTA 1J09A 4R3DA 4IJFA 1IN8A 1IY1A 1GLNA 1VG5A 2WSFF 3QWLA 4PCZA 4IBCA 2MR9A 3V76A 2ZTCA 4KODA 1L2CA 1F4IA 3W67A 4Z8XA 4FWGA 4ANRA 4G4NA 3SARA 2Y20A 4HLQA 1PJIA 2F5NA 3GLFA 3JR4A 3GPYA 4LFCM 5E6JA 1N33M 2YFQA 2QZ4A 2D7EA 2ZBKB 3Q8XA 2J7NA 4FW9A 5FTLA 1TH4A 3HWSA 2EO2A 4B7HA 3K92A 5EXPA 1S3SA 1V34A 3T15A 4JI1M 2Y0QA 4LJ8A 4L16A 2XFSA 3I4YA 4A3VB 4QHTA 3U60B 1N77A 4MGIE 3VKGA 2LWXA 2DKLA 5FTKA 2AHMA 3HKPA 8CATA 2F4VM 3MJ5A 1DGBA 2DZNB 4GKJM 3GLGA 2F5QA 5EXTA 2HCBA 1QQWA 3B7ZA 4DR6M 4ITQA 2CFOA 2HHHM 4ZPXA 2DAKA 5EP3A 2DI0A 5FLXS 2BWBA 2C96A 4MGYE 3J81S 3BBZA 3THGA 4DV4M 3T6PA 1QZMA 3K9PA 3PNYA 4XGIA 1MU5A 2QPAA 3U6PA 3ZQJA 1L2BA 4I4LA 2OOAA 3C58A 2JP7A 1N34M 3LW5F 4NRWA 1VDLA 3I01M 1HT1E 4JI4M 3HJQA 4GHLA 1XXHB 1XC8A 1L1TA 1QANA 1T43A 3PFIA 4BB9A 4KHPM 3SYLA 2X4AA 1NY5A 2R4JA 3BXWA 2CWBA 3MK6A 3RFWA 3GQ3A 3U6SA 1VQ1A 2DENA 4M9ZA 1DGFA 2A5YB 2YR0A 4GC9A 3EIEA 5F3WA 1T3TA 2CP8A 3HHWA 4F1IA 5IT9S 3H4JA 5EP4A 2BNKA 2KRUA 1OFIA 3SHFA 4D82A 1R2ZA 2JUJA 3GRUA 4FCVA 3FRHA 3A46A 3TE6A 2C9CA 1XXHE 1R2YA 3L26A 2L6OA 4MH0E 1KFVA 3J2PB 3D8BA 2N35A 2RGOA 2QQ8A 5EJCA 4IBEA 1N75A 1V33A 2KRKA 3LCUA 3FTEA 1Z59A 5EXXA 2XSZD 1AUAA 2O25A 4OX9M 4YHHM 1K82A 1NV9A 5C18A 4LCBA 4LG2A 4DR1M 3SAUA 1ZMWA 3FE3A 4L6V6 3J7AS 4IBBA 3KP1E 5FTJA 1NNJA 2LVNC 2L2DA 1XMOM 4R71A 4LZZA 1N36M 2KNVA 2XGNA 4X64M 2EKKA 3JAMS 2DHRA 1NJFA 1TH2A 2C9OA 3FYCA 1SXJC 2JZ0A 4DV5M 1GL6A 1QDRA 2LXEA 4S12A 2H1RA 2P5TA 4DR7M 2FNAA 2RKOA 3RGSA 2F5SA 3QYBA 4FD2A 4LJ5A 1DGHB 2LHCA 3BOSA 1TTEA 4UN2B 2V6ZM 4NXNM 1K3WA 3J7BA 1DGGA 4MGKE 3AKZA 2VF8A 2DNAA 3I51A 1N78A 1OAIA 2ERCA 5EXSA 2C98A 4DV3M 3L2AA 3A45A 3L29A 3W0LB 2VQFM 2DWMA 2UUBM 2R0IA 1L2DA 1ZMVA 2WSCF 2X49A 1SXJD 2Z3XA 2OPFA 4IBIA 2GNOA 4G4QA 4GH9A 4NC6A 1NSFA 1XXHA 4NSOB 4DUZM 1GJSA 1Q02A 3PVSA 1KYIA 2CEAA 1IN6A 4CHTB 3F92A 3FD9A 4NOOB 3UGJA 5DNYA 3GLIB 2RGHA 1UM8A 3H4MA 3VK8A 3U6QA 1BVSA 2DVWB 1V92A 2FE8A 3HHZA 3KS8A 2DAEA 4MGHA 1XMQM 3SATA 1E94E 3KSXA 1MJGM 2OOBA 5ITUA 2WSEF 3D8LA 4M9XA 2R65A 2YNMD 2JXNA 5IREB 4RF0A 4MB7A 1DO0A 2QHOB 3FTFA 1YE9A 1NNUC 1IXRC 1SXJB 2JA2A 2G5GX 3AJIB 3T1YM 1X37A 4PD2A 1IM2A 2XH9A 3CGWA 4P16A 1MX0A 5BPVA 5IZ7D 5FSWA 1XB2B 3T1HM 4EIWA 3AV0A 1FNNA 3LQQA 3U6EA 4LJ4A 3W68A 4DBGB 3NWLA 4GHAA 3SBJA 3L27A 2APLA 5EP2A 3U6LA 2LBCA 1Z6TA 4I5SA 2QBYB 2DZLA 3LQRA 4LJ6A 1SXJE 4DV2M 3B7QA 4QNRA 3FUTA 4AZFA 2FH0A 4LF4M 1QAOA 5LMNM 2C99A 1TF0B 2R46A 3KSJA 1G4AE 2DXIA 3E21A 2DAGA 1SG9A 2CRUA 4IIWA 1DGHA 3ILKA 4LF9M 2LTUA 1C7YA 2ZAMA 1IBKM 2XFTA 1G3IA 2HKJA 3MMPA 4LF5M 3A42A 2R45A 2R62A 2VDBB 1VDDA 3TL4X 4IBKA 1L8QA 3R8FA 1R6BX 3HU2A 3SMPA 3AFHA 3IHPA 3HHYA 1QUSA 2L7HA 3JR5A 1R7RA 1TR8A 4M9SA 1IN5A 3DA1A 5ITRA 3GRYA 3CF0A 3CF6E 3HJ8A 4LGMA 3SYKA 3U5ZB 1HNWM 5GKNA 4JN6A 2KNAA 3LCVB 2KZSA 4B08A 3NBIA 2RRUA 3B74A 4GIPA 3KFUG 1IQPA 5FTNA 2ZAOA 1NHWC 1G59A 3FRIA 4JI0M 3GLIA 2ZANA 3KXEC 3QAUA 4D80A 2G3QA 3ZC7B 4X65M 2CHQA 2CV0A 3IG8A 3GP1A 1NV8A 2XF3A 4PDIA 3AL0C 1TGUA 2DAMA 1D0KA 1NHGC 2KA6B 4KLNA 4IBDA 3AOEC 2D7GA 3SMSA 4GRIA 2K47A 2XLJA 4II7A 1XNRM 2EUCA 1SXJA 3HZJA 4WURA 4Y28F 1R5LA 3DFZA 4DR5M 1JR3D 1D0LA 4P17A 5H37D 2J5YA 4IBJA 4REZA 1R4GA 5L8RF 1HQCA 2Q2EB 4G6ZA 5KQ8A 2KXEA 4GKKM 1IFYA 4KT0F 1PGYA 1XHBA 2QBYA 1ZMUA 3HJSA 2X8AA 2V1UA 1WJ7A 4FCTA 4OVZB 1IBLM 2FOIC 4HEOA 4R7GA 4BLCA 3CTWB 3LVWA 3U60A 3L25A 2KHHA 1Q3BA 2ZTDA 2L4EA 3K8ZA 1OJLA 3C9PA 3OTOM 4DV7M 3HGIA 1IN4A 4W5WA 4GMQA 3GLFB 4LJ9A 3B7NA 2KNZA 2UXCM 2V1CA 5A2QS 3GPXA 2JY8A 2KZUA 3UMMA 5EP1A 3U6DA 3E9SA 4IJEA 5ITTA 1HNZM 3ZH9B 1QVRA 1WXQA 4QHSA 3U5ZA 3VKHA 3KOYE 1JR3E 5DYIA 3UZUA 2MGWA 4LGYA 2OQ4A 2XZUA 4LF8M 3UK6A 1OTRA 2F5OA 2HL7A 1WR1B 4FCWA 2DWZB 2I7NA 1OIZA 4OW0A 2MJ5B 3K2LA 1PJTA 4CIZA 4L15A 1NO1A 1LV7A 3KS4A 1IXZA 3TQSA 4MM3B 2CV1A 4JI5M 4YY3M 3U6OA 1Q3CA 2Z7JA 3C3EA 3GRVA 2EJSA 2LVOC 1JQJC 4AG6A 2Z4SA 2KW0A 2HAKA 5ITYA 4DR3M 2UUAM 1T6OA 3HHXA 1UFZA 1EFUB 1PJJA 4B7FA 4L8RC 2MROB 4PDGA 2JY7A 2K0BX 3GLIE 2H5XA 3PXGA 3R9XB 4AW4A 5JI2E 5KO3A 5LMUM 3K1JA 3Q8GA 3KP0E 1IXSB 1OQYA 4NSRA 3T38A 3W0FA 1J7KA 5JI3E 4LJAA 2Z8YM 4OVZA 1TH3A 2K6BA 2M60A 3EIHA 2JY5A 3J80S 3SHGB 3TWKA 1Z5AA 3GPPA 4G3OA 2KEBA 4DR4M 2LVAA 4CJ6A 1VEKA 1VEGA 2LVQD 3UJNA 2OO9A 4FWHA 3KW6A 4OU7A 1FJGM 1JB0F 2WZJA 3LMMA 3NBXX 4PT5A 2L7IA 1LTMA 2K9DA 2QSFX 3E46A 4LF7M 2UXBM 4XBOA 3TPZA 1JR3A 1GVNA 2XSZA 4WP2A 5KPZA 4FWDA 3KVWA 2GQFA 1KSFX 1NVMA 4D81A 2QENA 3U61B 1L1ZA 4K0KM 4AKIA 1GL7A 2R6FA 5FTMA 2VF7A 3GLHB 3RGPA 3FYDA 4B3TM 4JV5M 1I4WA 2JZ1A 4AKGA 4M0WA 2DWLA 3KOZE 3CF2A 4XK8F 4IBGA 3WHKA 3SAVA 3AOEA 3M0EA 3WHLA 3FUWA 4G4RA 1DV0A 1QUTA 1HNXM 2CV2A 1GO5A 5BR8M 3J27B 1TDHA 1CUKA 3VDUA 5C1BA 2LH0A 1PJSA 5KPTA 3I4VA 1QAMA 1QZEA 1Z5CA 1D0MA 3PNVA 4FVMA 1J5EM 3GLHE 4F2LA 4B3MM 2JNHA 1OAOC 5ITXE 3U6MA 1C1KA 1PRBA 3SASA 3TWLA 2YQZA 2Y0TA 2EA0A 1G8PA 3RE8A 2M5ZA 2QNJA 2E5LM 1P3QQ 2Z4RA 4AKHA 3HX3A 5ITQA 2EKFA 3I04M 1ORYB 2FS1A 2HWJA 2UXDM 2DHYA 1VEJA 4AG5A 1GABA 2VQEM 4DV0M 3KOXE 1G41A 5KQDA 2NQ8C 1IY0A 1IN7A 1YSYA 4LFAM 4BBAA 3SAWA 1TDZA 1W5TA 2ZM6M 1K3XA 1IXSA 1WGNA 2R18A 4GC5A 1EE8A 2JWSA 4AI6A 2JY6B 2LVPC 3GPUA 3QYEA 3FUXA 3GQ5A 1AIPC 3C3DA 2VIIA 1OIPA 1WIVA 4JI8M 2Y21A 2BJWA 2CHGA 4Z6YA 1QYRA 4X62M 5DYGA 1ZQ9A 3DZDA 2DWNA 3FUVA 1QAQA 1ZAEA 4Q7JA 3K9OA 4GITA 3IG5A 3LVVA 3KDSE 3FUUA 5DFLA 3HU1A 4LJ7A 1HJPA 4DV1M 1HQYE 1IBMM 4DR2M 4L78A 3IECA 1E9SA 4LFBM 2CUZA 2L09A 4DUYM 2UUCM 4LF6M 3DOAA 2LHGA 2O5RA 3ZCBB 1D2NA 1EIJA 1RU3A 2DZOB 3U61A 1XWIA 4IBFA 5KPRA 1HR0M 4NXMM 1Q39A 5E26A 1G71A 3L28A
chains in the Genus database with same CATH topology
3AOGA 2QP9X 7CATA 4B3SM 3GLHA 3GQ4A 1HT2E 3MHVC 5ITXA 1W5SA 4LY6A 2F5PA 3GO8A 4I81A 1DO2A 3FKEA 1E32A 4X66M 2D7HA 4B7GA 1OFHA 2C5RA 3FTCA 1Z5BA 3U6CA 1YUBA 2G8LA 4JI6M 4JI7M 1PM5A 2J7OA 2CHVA 4B3RM 4QOSA 3GLGB 2XZFA 2QCUA 2CE7A 2FFJA 2LNHC 3GRRA 4RNAA 4LZJA 3B9PA 4RF1A 3VLFB 4M0DA 1I94M 4HL4A 4QNMA 4KO8A 1GKIA 1XNQM 3SFZA 4WW0A 1NJGA 4NRVA 3M6AA 3SC3A 5IWAM 3FTDA 3HU3A 4CGYB 4CISA 2BJVA 4NL4H 4QOZC 2UU9M 4I8OA 3KOWE 1NY6A 4JI3M 4JXJA 3TWMA 3VK7A 1N32M 2XEPA 5EQTA 4AQYM 4JYAM 1IY2A 1H6UA 2W82A 3A98B 4L4UA 4LRTA 3VDPA 4DV6M 4JI2M 1E9RA 2I7PA 3VFDA 3M7GA 2R4EA 3E4RA 4TUWA 4MGZE 4G4OA 1J09A 4R3DA 4IJFA 1IN8A 1IY1A 1GLNA 3QWLA 4PCZA 4IBCA 4KODA 1L2CA 3SARA 4Z8XA 4FWGA 4G4NA 2Y20A 4HLQA 1PJIA 2F5NA 3GLFA 3JR4A 3GPYA 4LFCM 5E6JA 1N33M 2YFQA 2QZ4A 2D7EA 2ZBKB 3Q8XA 2J7NA 4FW9A 5FTLA 1TH4A 3HWSA 2EO2A 4B7HA 3K92A 5EXPA 1S3SA 3T15A 4JI1M 2Y0QA 4LJ8A 4L16A 2XFSA 3I4YA 4A3VB 4QHTA 3U60B 1N77A 4MGIE 3VKGA 2LWXA 5FTKA 2AHMA 3HKPA 8CATA 2F4VM 3MJ5A 1DGBA 2DZNB 4GKJM 3GLGA 2F5QA 5EXTA 2HCBA 1QQWA 4DR6M 4ITQA 2CFOA 2HHHM 4ZPXA 5EP3A 5FLXS 2C96A 4MGYE 3J81S 3THGA 4DV4M 1QZMA 4XGIA 3PNYA 3U6PA 1MU5A 2QPAA 2DWLA 1L2BA 4I4LA 3C58A 1N34M 4NRWA 1HT1E 4JI4M 3HJQA 4GHLA 1XXHB 1XC8A 1L1TA 1QANA 3PFIA 4BB9A 4KHPM 3SYLA 2X4AA 1NY5A 2R4JA 3MK6A 3GQ3A 3RFWA 3U6SA 4M9ZA 1DGFA 2A5YB 2YR0A 4GC9A 3EIEA 5F3WA 1T3TA 3HHWA 5IT9S 5EP4A 2BNKA 2KRUA 1OFIA 3SHFA 4D82A 1R2ZA 3GRUA 4FCVA 3A46A 3TE6A 2C9CA 1R2YA 3L26A 2L6OA 4MH0E 1KFVA 3J2PB 3D8BA 2RGOA 5EJCA 4IBEA 1N75A 2KRKA 3FTEA 1Z59A 5EXXA 2XSZD 4OX9M 4YHHM 1K82A 5C18A 4LCBA 4LG2A 4DR1M 3SAUA 3J7AS 4IBBA 3KP1E 5FTJA 1NNJA 1XMOM 4LZZA 1N36M 2XGNA 4X64M 3JAMS 2DHRA 1NJFA 1TH2A 2C9OA 3FYCA 1SXJC 4DV5M 1GL6A 2LXEA 4S12A 2H1RA 2P5TA 4DR7M 2FNAA 2RKOA 3RGSA 2F5SA 4FD2A 4LJ5A 1DGHB 3BOSA 2V6ZM 4NXNM 1K3WA 3J7BA 1DGGA 4MGKE 3AKZA 3I51A 1N78A 2ERCA 5EXSA 2C98A 4DV3M 3L2AA 3A45A 3L29A 3W0LB 2VQFM 2DWMA 2UUBM 1L2DA 2X49A 1SXJD 2Z3XA 2OPFA 4IBIA 4G4QA 4GH9A 1NSFA 1XXHA 4NSOB 4DUZM 3PVSA 1KYIA 2CEAA 1IN6A 4CHTB 3FD9A 4NOOB 3UGJA 5DNYA 3GLIB 2RGHA 1UM8A 3H4MA 3VK8A 3U6QA 2DVWB 2FE8A 3HHZA 3KS8A 4MGHA 1XMQM 3SATA 1E94E 3KSXA 5ITUA 3D8LA 4M9XA 2R65A 2YNMD 5IREB 4RF0A 4MB7A 1DO0A 3FTFA 1YE9A 1NNUC 1IXRC 1SXJB 2JA2A 2G5GX 3AJIB 3T1YM 1X37A 4PD2A 1IM2A 2XH9A 4P16A 5BPVA 1MX0A 5FSWA 5IZ7D 3T1HM 4EIWA 3AV0A 1FNNA 3LQQA 3U6EA 4LJ4A 3NWLA 4GHAA 3SBJA 3L27A 5EP2A 3U6LA 1Z6TA 4I5SA 2QBYB 3LQRA 4LJ6A 1SXJE 4DV2M 4QNRA 3FUTA 4AZFA 4LF4M 1QAOA 5LMNM 2C99A 2R46A 3KSJA 1G4AE 2DXIA 4IIWA 1DGHA 3ILKA 4LF9M 2ZAMA 1IBKM 2XFTA 1G3IA 2HKJA 4LF5M 3A42A 2R45A 2R62A 1VDDA 3TL4X 4IBKA 1L8QA 3R8FA 1R6BX 3HU2A 3SMPA 3AFHA 3HHYA 3JR5A 2L7HA 1R7RA 4M9SA 1IN5A 3DA1A 5ITRA 3GRYA 3CF0A 3CF6E 3HJ8A 4LGMA 3SYKA 3U5ZB 1HNWM 5GKNA 4JN6A 2KZSA 4B08A 3NBIA 4GIPA 3KFUG 1IQPA 5FTNA 2ZAOA 1NHWC 1G59A 4JI0M 3GLIA 2ZANA 3KXEC 3QAUA 4D80A 3ZC7B 4X65M 2CHQA 2CV0A 3IG8A 3GP1A 4PDIA 2XF3A 3AL0C 1TGUA 1NHGC 2KA6B 4KLNA 4IBDA 3AOEC 2D7GA 3SMSA 4GRIA 2K47A 2XLJA 4II7A 1XNRM 2EUCA 1SXJA 4WURA 3DFZA 4DR5M 1JR3D 5H37D 4IBJA 4REZA 1HQCA 2Q2EB 4G6ZA 5KQ8A 2KXEA 4GKKM 1XHBA 2QBYA 3HJSA 2X8AA 2V1UA 4FCTA 4OVZB 1IBLM 2FOIC 4R7GA 4BLCA 3CTWB 3LVWA 3U60A 3L25A 1Q3BA 3K8ZA 1OJLA 3OTOM 4DV7M 3HGIA 1IN4A 4W5WA 4GMQA 3GLFB 4LJ9A 2UXCM 2V1CA 5A2QS 3GPXA 2KZUA 3UMMA 5EP1A 3U6DA 3E9SA 4IJEA 5ITTA 1HNZM 3ZH9B 1QVRA 1WXQA 4QHSA 3U5ZA 3VKHA 3KOYE 5DYIA 2OQ4A 3UZUA 2XZUA 4LGYA 4LF8M 3UK6A 2F5OA 2HL7A 4FCWA 2DWZB 2I7NA 4OW0A 3K2LA 4L15A 1LV7A 3KS4A 1IXZA 3TQSA 4MM3B 2CV1A 4JI5M 4YY3M 3U6OA 1Q3CA 2Z7JA 3GRVA 4AG6A 1JQJC 2Z4SA 2KW0A 5ITYA 4DR3M 2UUAM 4L8RC 3HHXA 1PJJA 4B7FA 4PDGA 3PXGA 3R9XB 4AW4A 5JI2E 5KO3A 5LMUM 3K1JA 3KP0E 1IXSB 4NSRA 3T38A 3W0FA 1J7KA 5JI3E 4LJAA 4OVZA 1TH3A 2M60A 3EIHA 3SHGB 3J80S 3TWKA 4DR4M 1Z5AA 3GPPA 2KEBA 3UJNA 4FWHA 3KW6A 4OU7A 1FJGM 3LMMA 4PT5A 2L7IA 2UXBM 4LF7M 4XBOA 3TPZA 1JR3A 1GVNA 2XSZA 5KPZA 4FWDA 3KVWA 1KSFX 1NVMA 4D81A 2QENA 3U61B 1L1ZA 4AKIA 1GL7A 5FTMA 3GLHB 3RGPA 3FYDA 4B3TM 4JV5M 1I4WA 4AKGA 4M0WA 3KOZE 3CF2A 4IBGA 3WHKA 3SAVA 3AOEA 3M0EA 3WHLA 3FUWA 4G4RA 1HNXM 2CV2A 5BR8M 3J27B 1TDHA 3VDUA 5C1BA 2LH0A 5KPTA 3I4VA 1QAMA 3PNVA 1Z5CA 4FVMA 1J5EM 4B3MM 5ITXE 3U6MA 3SASA 1C1KA 3TWLA 2YQZA 2Y0TA 2EA0A 1G8PA 3RE8A 2M5ZA 2E5LM 4AKHA 2Z4RA 5ITQA 1ORYB 2UXDM 4AG5A 2VQEM 4DV0M 3KOXE 1G41A 5KQDA 2NQ8C 1IY0A 1IN7A 1YSYA 4LFAM 4BBAA 3SAWA 1TDZA 1W5TA 2ZM6M 1K3XA 2R18A 4GC5A 1EE8A 4AI6A 3GPUA 3FUXA 3GQ5A 2VIIA 4K0KM 4JI8M 2Y21A 2BJWA 2CHGA 4Z6YA 1QYRA 4X62M 5DYGA 1ZQ9A 3DZDA 2DWNA 3FUVA 1QAQA 1ZAEA 4GITA 3IG5A 3LVVA 3KDSE 3FUUA 3HU1A 4LJ7A 4DV1M 1HQYE 1IBMM 4DR2M 4L78A 1E9SA 4LFBM 2CUZA 2L09A 4DUYM 2UUCM 4LF6M 3DOAA 2O5RA 3ZCBB 1D2NA 2DZOB 3U61A 1XWIA 4IBFA 5KPRA 1HR0M 4NXMM 1Q39A 5E26A 4LRSA 3L28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ3 A;  4B3S M;  3GQ4 A;  5ITY A;  5ITX A;  4DR3 M;  2UUA M;  2F5P A;  1PJJ A;  3GO8 A;  4LF9 M;  1IBK M;  4PDG A;  5IT9 S;  4X66 M;  2HKJ A;  1R2Z A;  4LF5 M;  1Z5B A;  3A42 A;  3A46 A;  3U6C A;  5LMU M;  4JI6 M;  1R2Y A;  4JI7 M;  1PM5 A;  1KFV A;  3W0F A;  4B3R M;  2XZF A;  3JR5 A;  5ITR A;  3TWK A;  1Z59 A;  3J80 S;  1I94 M;  4DR4 M;  1Z5A A;  3GPP A;  4OX9 M;  4YHH M;  1K82 A;  1HNW M;  4DR1 M;  3SAU A;  1XNQ M;  1FJG M;  4NRV A;  5IWA M;  3J7A S;  1NNJ A;  4CIS A;  1XMO M;  2UU9 M;  4LF7 M;  2UXB M;  4JI0 M;  1N36 M;  4X64 M;  4JI3 M;  4X65 M;  3JAM S;  3TWM A;  3VK7 A;  1L1Z A;  1N32 M;  3GP1 A;  4PDI A;  4DV5 M;  4AQY M;  4JYA M;  4DV6 M;  4DR7 M;  4JI2 M;  1XNR M;  2F5S A;  4B3T M;  4JV5 M;  4NXN M;  3SAV A;  4DR5 M;  1K3W A;  4G4R A;  1HNX M;  5BR8 M;  1TDH A;  4G4O A;  2Q2E B;  4DV3 M;  4GKK M;  4PCZ A;  3A45 A;  2VQF M;  1Z5C A;  1J5E M;  4B3M M;  1L2C A;  2UUB M;  1L2D A;  4G4N A;  1IBL M;  3SAR A;  5ITX E;  3U6M A;  1PJI A;  3SAS A;  2OPF A;  2F5N A;  3TWL A;  2EA0 A;  4G4Q A;  3JR4 A;  2E5L M;  3GPY A;  4DUZ M;  5ITQ A;  4LFC M;  1Q3B A;  1N33 M;  2ZBK B;  3OTO M;  2UXD M;  4DV7 M;  3VK8 A;  2VQE M;  3U6Q A;  4DV0 M;  4JI1 M;  3SAT A;  1XMQ M;  2UXC M;  5ITU A;  5A2Q S;  3GPX A;  4LFA M;  3U6D A;  3SAW A;  1TDZ A;  1K3X A;  4MB7 A;  2ZM6 M;  2F4V M;  5ITT A;  4GKJ M;  1HNZ M;  1EE8 A;  2F5Q A;  3GPU A;  3T1Y M;  3GQ5 A;  4PD2 A;  4DR6 M;  3T1H M;  1MX0 A;  4K0K M;  4ITQ A;  4JI8 M;  2OQ4 A;  2XZU A;  4X62 M;  2HHH M;  4LF8 M;  2F5O A;  3U6E A;  5FLX S;  3J81 S;  3SBJ A;  3U6L A;  4DV1 M;  4DV4 M;  1IBM M;  4DR2 M;  1MU5 A;  3U6P A;  1L2B A;  4LFB M;  3C58 A;  4DUY M;  1N34 M;  2UUC M;  4LF6 M;  3DOA A;  4NRW A;  4DV2 M;  4JI4 M;  1HR0 M;  4JI5 M;  4LF4 M;  4NXM M;  1Q39 A;  4YY3 M;  5LMN M;  3U6O A;  1Q3C A;  1XC8 A;  1L1T A;  4KHP M;  3U6S A; 
#chains in the Genus database with same CATH topology
 3AOG A;  2QP9 X;  7CAT A;  4B3S M;  3GLH A;  3GQ4 A;  1HT2 E;  3MHV C;  5ITX A;  1W5S A;  4LY6 A;  2F5P A;  3GO8 A;  4I81 A;  1DO2 A;  3FKE A;  1E32 A;  1OKS A;  4X66 M;  1WHC A;  2D7H A;  4B7G A;  1OFH A;  2R44 A;  3FTC A;  2C5R A;  1Z5B A;  1Y8G A;  3U6C A;  3GLF E;  4GEW A;  1YUB A;  2G8L A;  4JI6 M;  1YLA A;  1QDT A;  1PM5 A;  2J7O A;  2CHV A;  4RKU F;  4JI7 M;  4B3R M;  4QOS A;  3GLG B;  2B3T A;  2QCU A;  2XZF A;  2CE7 A;  2FFJ A;  2LNH C;  3GRR A;  2MH8 A;  4LRS A;  4LZJ A;  3B9P A;  3HY5 A;  4RF1 A;  4M0D A;  4RNA A;  3VLF B;  1I94 M;  4HL4 A;  4QNM A;  4KO8 A;  1GKI A;  1XNQ M;  2O01 F;  3SFZ A;  4WW0 A;  1PJQ A;  1NJG A;  2DAI A;  3M6A A;  4NRV A;  3SC3 A;  5IWA M;  2L4F A;  3FTD A;  3HU3 A;  4CGY B;  4CIS A;  2BJV A;  4NL4 H;  4QOZ C;  2UU9 M;  4I8O A;  3KOW E;  1NY6 A;  3GLG E;  4JI3 M;  2KDL A;  4JXJ A;  3TWM A;  3VK7 A;  1ZV1 A;  1N32 M;  1A5T A;  2XEP A;  2BWE A;  5EQT A;  4AQY M;  4JYA M;  1IY2 A;  1H6U A;  2W82 A;  3A98 B;  4L4U A;  4LRT A;  3VDP A;  4DV6 M;  4JI2 M;  1E9R A;  2I7P A;  3VFD A;  1MN3 A;  3M7G A;  2R4E A;  1WGL A;  3B89 A;  3E4R A;  4TUW A;  4MGZ E;  4G4O A;  1GJT A;  1J09 A;  4R3D A;  4IJF A;  1IN8 A;  1IY1 A;  1GLN A;  1VG5 A;  2WSF F;  3QWL A;  4PCZ A;  4IBC A;  2MR9 A;  3V76 A;  2ZTC A;  4KOD A;  1L2C A;  1F4I A;  3W67 A;  4Z8X A;  4FWG A;  4ANR A;  4G4N A;  3SAR A;  2Y20 A;  4HLQ A;  1PJI A;  2F5N A;  3GLF A;  3JR4 A;  3GPY A;  4LFC M;  5E6J A;  1N33 M;  2YFQ A;  2QZ4 A;  2D7E A;  2ZBK B;  3Q8X A;  2J7N A;  4FW9 A;  5FTL A;  1TH4 A;  3HWS A;  2EO2 A;  4B7H A;  3K92 A;  5EXP A;  1S3S A;  1V34 A;  3T15 A;  4JI1 M;  2Y0Q A;  4LJ8 A;  4L16 A;  2XFS A;  3I4Y A;  4A3V B;  4QHT A;  3U60 B;  1N77 A;  4MGI E;  3VKG A;  2LWX A;  2DKL A;  5FTK A;  2AHM A;  3HKP A;  8CAT A;  2F4V M;  3MJ5 A;  1DGB A;  2DZN B;  4GKJ M;  3GLG A;  2F5Q A;  5EXT A;  2HCB A;  1QQW A;  3B7Z A;  4DR6 M;  4ITQ A;  2CFO A;  2HHH M;  4ZPX A;  2DAK A;  5EP3 A;  2DI0 A;  5FLX S;  2BWB A;  2C96 A;  4MGY E;  3J81 S;  3BBZ A;  3THG A;  4DV4 M;  3T6P A;  1QZM A;  3K9P A;  3PNY A;  4XGI A;  1MU5 A;  2QPA A;  3U6P A;  3ZQJ A;  1L2B A;  4I4L A;  2OOA A;  3C58 A;  2JP7 A;  1N34 M;  3LW5 F;  4NRW A;  1VDL A;  3I01 M;  1HT1 E;  4JI4 M;  3HJQ A;  4GHL A;  1XXH B;  1XC8 A;  1L1T A;  1QAN A;  1T43 A;  3PFI A;  4BB9 A;  4KHP M;  3SYL A;  2X4A A;  1NY5 A;  2R4J A;  3BXW A;  2CWB A;  3MK6 A;  3RFW A;  3GQ3 A;  3U6S A;  1VQ1 A;  2DEN A;  4M9Z A;  1DGF A;  2A5Y B;  2YR0 A;  4GC9 A;  3EIE A;  5F3W A;  1T3T A;  2CP8 A;  3HHW A;  4F1I A;  5IT9 S;  3H4J A;  5EP4 A;  2BNK A;  2KRU A;  1OFI A;  3SHF A;  4D82 A;  1R2Z A;  2JUJ A;  3GRU A;  4FCV A;  3FRH A;  3A46 A;  3TE6 A;  2C9C A;  1XXH E;  1R2Y A;  3L26 A;  2L6O A;  4MH0 E;  1KFV A;  3J2P B;  3D8B A;  2N35 A;  2RGO A;  2QQ8 A;  5EJC A;  4IBE A;  1N75 A;  1V33 A;  2KRK A;  3LCU A;  3FTE A;  1Z59 A;  5EXX A;  2XSZ D;  1AUA A;  2O25 A;  4OX9 M;  4YHH M;  1K82 A;  1NV9 A;  5C18 A;  4LCB A;  4LG2 A;  4DR1 M;  3SAU A;  1ZMW A;  3FE3 A;  4L6V 6;  3J7A S;  4IBB A;  3KP1 E;  5FTJ A;  1NNJ A;  2LVN C;  2L2D A;  1XMO M;  4R71 A;  4LZZ A;  1N36 M;  2KNV A;  2XGN A;  4X64 M;  2EKK A;  3JAM S;  2DHR A;  1NJF A;  1TH2 A;  2C9O A;  3FYC A;  1SXJ C;  2JZ0 A;  4DV5 M;  1GL6 A;  1QDR A;  2LXE A;  4S12 A;  2H1R A;  2P5T A;  4DR7 M;  2FNA A;  2RKO A;  3RGS A;  2F5S A;  3QYB A;  4FD2 A;  4LJ5 A;  1DGH B;  2LHC A;  3BOS A;  1TTE A;  4UN2 B;  2V6Z M;  4NXN M;  1K3W A;  3J7B A;  1DGG A;  4MGK E;  3AKZ A;  2VF8 A;  2DNA A;  3I51 A;  1N78 A;  1OAI A;  2ERC A;  5EXS A;  2C98 A;  4DV3 M;  3L2A A;  3A45 A;  3L29 A;  3W0L B;  2VQF M;  2DWM A;  2UUB M;  2R0I A;  1L2D A;  1ZMV A;  2WSC F;  2X49 A;  1SXJ D;  2Z3X A;  2OPF A;  4IBI A;  2GNO A;  4G4Q A;  4GH9 A;  4NC6 A;  1NSF A;  1XXH A;  4NSO B;  4DUZ M;  1GJS A;  1Q02 A;  3PVS A;  1KYI A;  2CEA A;  1IN6 A;  4CHT B;  3F92 A;  3FD9 A;  4NOO B;  3UGJ A;  5DNY A;  3GLI B;  2RGH A;  1UM8 A;  3H4M A;  3VK8 A;  3U6Q A;  1BVS A;  2DVW B;  1V92 A;  2FE8 A;  3HHZ A;  3KS8 A;  2DAE A;  4MGH A;  1XMQ M;  3SAT A;  1E94 E;  3KSX A;  1MJG M;  2OOB A;  5ITU A;  2WSE F;  3D8L A;  4M9X A;  2R65 A;  2YNM D;  2JXN A;  5IRE B;  4RF0 A;  4MB7 A;  1DO0 A;  2QHO B;  3FTF A;  1YE9 A;  1NNU C;  1IXR C;  1SXJ B;  2JA2 A;  2G5G X;  3AJI B;  3T1Y M;  1X37 A;  4PD2 A;  1IM2 A;  2XH9 A;  3CGW A;  4P16 A;  1MX0 A;  5BPV A;  5IZ7 D;  5FSW A;  1XB2 B;  3T1H M;  4EIW A;  3AV0 A;  1FNN A;  3LQQ A;  3U6E A;  4LJ4 A;  3W68 A;  4DBG B;  3NWL A;  4GHA A;  3SBJ A;  3L27 A;  2APL A;  5EP2 A;  3U6L A;  2LBC A;  1Z6T A;  4I5S A;  2QBY B;  2DZL A;  3LQR A;  4LJ6 A;  1SXJ E;  4DV2 M;  3B7Q A;  4QNR A;  3FUT A;  4AZF A;  2FH0 A;  4LF4 M;  1QAO A;  5LMN M;  2C99 A;  1TF0 B;  2R46 A;  3KSJ A;  1G4A E;  2DXI A;  3E21 A;  2DAG A;  1SG9 A;  2CRU A;  4IIW A;  1DGH A;  3ILK A;  4LF9 M;  2LTU A;  1C7Y A;  2ZAM A;  1IBK M;  2XFT A;  1G3I A;  2HKJ A;  3MMP A;  4LF5 M;  3A42 A;  2R45 A;  2R62 A;  2VDB B;  1VDD A;  3TL4 X;  4IBK A;  1L8Q A;  3R8F A;  1R6B X;  3HU2 A;  3SMP A;  3AFH A;  3IHP A;  3HHY A;  1QUS A;  2L7H A;  3JR5 A;  1R7R A;  1TR8 A;  4M9S A;  1IN5 A;  3DA1 A;  5ITR A;  3GRY A;  3CF0 A;  3CF6 E;  3HJ8 A;  4LGM A;  3SYK A;  3U5Z B;  1HNW M;  5GKN A;  4JN6 A;  2KNA A;  3LCV B;  2KZS A;  4B08 A;  3NBI A;  2RRU A;  3B74 A;  4GIP A;  3KFU G;  1IQP A;  5FTN A;  2ZAO A;  1NHW C;  1G59 A;  3FRI A;  4JI0 M;  3GLI A;  2ZAN A;  3KXE C;  3QAU A;  4D80 A;  2G3Q A;  3ZC7 B;  4X65 M;  2CHQ A;  2CV0 A;  3IG8 A;  3GP1 A;  1NV8 A;  2XF3 A;  4PDI A;  3AL0 C;  1TGU A;  2DAM A;  1D0K A;  1NHG C;  2KA6 B;  4KLN A;  4IBD A;  3AOE C;  2D7G A;  3SMS A;  4GRI A;  2K47 A;  2XLJ A;  4II7 A;  1XNR M;  2EUC A;  1SXJ A;  3HZJ A;  4WUR A;  4Y28 F;  1R5L A;  3DFZ A;  4DR5 M;  1JR3 D;  1D0L A;  4P17 A;  5H37 D;  2J5Y A;  4IBJ A;  4REZ A;  1R4G A;  5L8R F;  1HQC A;  2Q2E B;  4G6Z A;  5KQ8 A;  2KXE A;  4GKK M;  1IFY A;  4KT0 F;  1PGY A;  1XHB A;  2QBY A;  1ZMU A;  3HJS A;  2X8A A;  2V1U A;  1WJ7 A;  4FCT A;  4OVZ B;  1IBL M;  2FOI C;  4HEO A;  4R7G A;  4BLC A;  3CTW B;  3LVW A;  3U60 A;  3L25 A;  2KHH A;  1Q3B A;  2ZTD A;  2L4E A;  3K8Z A;  1OJL A;  3C9P A;  3OTO M;  4DV7 M;  3HGI A;  1IN4 A;  4W5W A;  4GMQ A;  3GLF B;  4LJ9 A;  3B7N A;  2KNZ A;  2UXC M;  2V1C A;  5A2Q S;  3GPX A;  2JY8 A;  2KZU A;  3UMM A;  5EP1 A;  3U6D A;  3E9S A;  4IJE A;  5ITT A;  1HNZ M;  3ZH9 B;  1QVR A;  1WXQ A;  4QHS A;  3U5Z A;  3VKH A;  3KOY E;  1JR3 E;  5DYI A;  3UZU A;  2MGW A;  4LGY A;  2OQ4 A;  2XZU A;  4LF8 M;  3UK6 A;  1OTR A;  2F5O A;  2HL7 A;  1WR1 B;  4FCW A;  2DWZ B;  2I7N A;  1OIZ A;  4OW0 A;  2MJ5 B;  3K2L A;  1PJT A;  4CIZ A;  4L15 A;  1NO1 A;  1LV7 A;  3KS4 A;  1IXZ A;  3TQS A;  4MM3 B;  2CV1 A;  4JI5 M;  4YY3 M;  3U6O A;  1Q3C A;  2Z7J A;  3C3E A;  3GRV A;  2EJS A;  2LVO C;  1JQJ C;  4AG6 A;  2Z4S A;  2KW0 A;  2HAK A;  5ITY A;  4DR3 M;  2UUA M;  1T6O A;  3HHX A;  1UFZ A;  1EFU B;  1PJJ A;  4B7F A;  4L8R C;  2MRO B;  4PDG A;  2JY7 A;  2K0B X;  3GLI E;  2H5X A;  3PXG A;  3R9X B;  4AW4 A;  5JI2 E;  5KO3 A;  5LMU M;  3K1J A;  3Q8G A;  3KP0 E;  1IXS B;  1OQY A;  4NSR A;  3T38 A;  3W0F A;  1J7K A;  5JI3 E;  4LJA A;  2Z8Y M;  4OVZ A;  1TH3 A;  2K6B A;  2M60 A;  3EIH A;  2JY5 A;  3J80 S;  3SHG B;  3TWK A;  1Z5A A;  3GPP A;  4G3O A;  2KEB A;  4DR4 M;  2LVA A;  4CJ6 A;  1VEK A;  1VEG A;  2LVQ D;  3UJN A;  2OO9 A;  4FWH A;  3KW6 A;  4OU7 A;  1FJG M;  1JB0 F;  2WZJ A;  3LMM A;  3NBX X;  4PT5 A;  2L7I A;  1LTM A;  2K9D A;  2QSF X;  3E46 A;  4LF7 M;  2UXB M;  4XBO A;  3TPZ A;  1JR3 A;  1GVN A;  2XSZ A;  4WP2 A;  5KPZ A;  4FWD A;  3KVW A;  2GQF A;  1KSF X;  1NVM A;  4D81 A;  2QEN A;  3U61 B;  1L1Z A;  4K0K M;  4AKI A;  1GL7 A;  2R6F A;  5FTM A;  2VF7 A;  3GLH B;  3RGP A;  3FYD A;  4B3T M;  4JV5 M;  1I4W A;  2JZ1 A;  4AKG A;  4M0W A;  2DWL A;  3KOZ E;  3CF2 A;  4XK8 F;  4IBG A;  3WHK A;  3SAV A;  3AOE A;  3M0E A;  3WHL A;  3FUW A;  4G4R A;  1DV0 A;  1QUT A;  1HNX M;  2CV2 A;  1GO5 A;  5BR8 M;  3J27 B;  1TDH A;  1CUK A;  3VDU A;  5C1B A;  2LH0 A;  1PJS A;  5KPT A;  3I4V A;  1QAM A;  1QZE A;  1Z5C A;  1D0M A;  3PNV A;  4FVM A;  1J5E M;  3GLH E;  4F2L A;  4B3M M;  2JNH A;  1OAO C;  5ITX E;  3U6M A;  1C1K A;  1PRB A;  3SAS A;  3TWL A;  2YQZ A;  2Y0T A;  2EA0 A;  1G8P A;  3RE8 A;  2M5Z A;  2QNJ A;  2E5L M;  1P3Q Q;  2Z4R A;  4AKH A;  3HX3 A;  5ITQ A;  2EKF A;  3I04 M;  1ORY B;  2FS1 A;  2HWJ A;  2UXD M;  2DHY A;  1VEJ A;  4AG5 A;  1GAB A;  2VQE M;  4DV0 M;  3KOX E;  1G41 A;  5KQD A;  2NQ8 C;  1IY0 A;  1IN7 A;  1YSY A;  4LFA M;  4BBA A;  3SAW A;  1TDZ A;  1W5T A;  2ZM6 M;  1K3X A;  1IXS A;  1WGN A;  2R18 A;  4GC5 A;  1EE8 A;  2JWS A;  4AI6 A;  2JY6 B;  2LVP C;  3GPU A;  3QYE A;  3FUX A;  3GQ5 A;  1AIP C;  3C3D A;  2VII A;  1OIP A;  1WIV A;  4JI8 M;  2Y21 A;  2BJW A;  2CHG A;  4Z6Y A;  1QYR A;  4X62 M;  5DYG A;  1ZQ9 A;  3DZD A;  2DWN A;  3FUV A;  1QAQ A;  1ZAE A;  4Q7J A;  3K9O A;  4GIT A;  3IG5 A;  3LVV A;  3KDS E;  3FUU A;  5DFL A;  3HU1 A;  4LJ7 A;  1HJP A;  4DV1 M;  1HQY E;  1IBM M;  4DR2 M;  4L78 A;  3IEC A;  1E9S A;  4LFB M;  2CUZ A;  2L09 A;  4DUY M;  2UUC M;  4LF6 M;  3DOA A;  2LHG A;  2O5R A;  3ZCB B;  1D2N A;  1EIJ A;  1RU3 A;  2DZO B;  3U61 A;  1XWI A;  4IBF A;  5KPR A;  1HR0 M;  4NXM M;  1Q39 A;  5E26 A;  1G71 A;  3L28 A; 
#chains in the Genus database with same CATH homology
 3AOG A;  2QP9 X;  7CAT A;  4B3S M;  3GLH A;  3GQ4 A;  1HT2 E;  3MHV C;  5ITX A;  1W5S A;  4LY6 A;  2F5P A;  3GO8 A;  4I81 A;  1DO2 A;  3FKE A;  1E32 A;  4X66 M;  2D7H A;  4B7G A;  1OFH A;  2C5R A;  3FTC A;  1Z5B A;  3U6C A;  1YUB A;  2G8L A;  4JI6 M;  4JI7 M;  1PM5 A;  2J7O A;  2CHV A;  4B3R M;  4QOS A;  3GLG B;  2XZF A;  2QCU A;  2CE7 A;  2FFJ A;  2LNH C;  3GRR A;  4RNA A;  4LZJ A;  3B9P A;  4RF1 A;  3VLF B;  4M0D A;  1I94 M;  4HL4 A;  4QNM A;  4KO8 A;  1GKI A;  1XNQ M;  3SFZ A;  4WW0 A;  1NJG A;  4NRV A;  3M6A A;  3SC3 A;  5IWA M;  3FTD A;  3HU3 A;  4CGY B;  4CIS A;  2BJV A;  4NL4 H;  4QOZ C;  2UU9 M;  4I8O A;  3KOW E;  1NY6 A;  4JI3 M;  4JXJ A;  3TWM A;  3VK7 A;  1N32 M;  2XEP A;  5EQT A;  4AQY M;  4JYA M;  1IY2 A;  1H6U A;  2W82 A;  3A98 B;  4L4U A;  4LRT A;  3VDP A;  4DV6 M;  4JI2 M;  1E9R A;  2I7P A;  3VFD A;  3M7G A;  2R4E A;  3E4R A;  4TUW A;  4MGZ E;  4G4O A;  1J09 A;  4R3D A;  4IJF A;  1IN8 A;  1IY1 A;  1GLN A;  3QWL A;  4PCZ A;  4IBC A;  4KOD A;  1L2C A;  3SAR A;  4Z8X A;  4FWG A;  4G4N A;  2Y20 A;  4HLQ A;  1PJI A;  2F5N A;  3GLF A;  3JR4 A;  3GPY A;  4LFC M;  5E6J A;  1N33 M;  2YFQ A;  2QZ4 A;  2D7E A;  2ZBK B;  3Q8X A;  2J7N A;  4FW9 A;  5FTL A;  1TH4 A;  3HWS A;  2EO2 A;  4B7H A;  3K92 A;  5EXP A;  1S3S A;  3T15 A;  4JI1 M;  2Y0Q A;  4LJ8 A;  4L16 A;  2XFS A;  3I4Y A;  4A3V B;  4QHT A;  3U60 B;  1N77 A;  4MGI E;  3VKG A;  2LWX A;  5FTK A;  2AHM A;  3HKP A;  8CAT A;  2F4V M;  3MJ5 A;  1DGB A;  2DZN B;  4GKJ M;  3GLG A;  2F5Q A;  5EXT A;  2HCB A;  1QQW A;  4DR6 M;  4ITQ A;  2CFO A;  2HHH M;  4ZPX A;  5EP3 A;  5FLX S;  2C96 A;  4MGY E;  3J81 S;  3THG A;  4DV4 M;  1QZM A;  4XGI A;  3PNY A;  3U6P A;  1MU5 A;  2QPA A;  2DWL A;  1L2B A;  4I4L A;  3C58 A;  1N34 M;  4NRW A;  1HT1 E;  4JI4 M;  3HJQ A;  4GHL A;  1XXH B;  1XC8 A;  1L1T A;  1QAN A;  3PFI A;  4BB9 A;  4KHP M;  3SYL A;  2X4A A;  1NY5 A;  2R4J A;  3MK6 A;  3GQ3 A;  3RFW A;  3U6S A;  4M9Z A;  1DGF A;  2A5Y B;  2YR0 A;  4GC9 A;  3EIE A;  5F3W A;  1T3T A;  3HHW A;  5IT9 S;  5EP4 A;  2BNK A;  2KRU A;  1OFI A;  3SHF A;  4D82 A;  1R2Z A;  3GRU A;  4FCV A;  3A46 A;  3TE6 A;  2C9C A;  1R2Y A;  3L26 A;  2L6O A;  4MH0 E;  1KFV A;  3J2P B;  3D8B A;  2RGO A;  5EJC A;  4IBE A;  1N75 A;  2KRK A;  3FTE A;  1Z59 A;  5EXX A;  2XSZ D;  4OX9 M;  4YHH M;  1K82 A;  5C18 A;  4LCB A;  4LG2 A;  4DR1 M;  3SAU A;  3J7A S;  4IBB A;  3KP1 E;  5FTJ A;  1NNJ A;  1XMO M;  4LZZ A;  1N36 M;  2XGN A;  4X64 M;  3JAM S;  2DHR A;  1NJF A;  1TH2 A;  2C9O A;  3FYC A;  1SXJ C;  4DV5 M;  1GL6 A;  2LXE A;  4S12 A;  2H1R A;  2P5T A;  4DR7 M;  2FNA A;  2RKO A;  3RGS A;  2F5S A;  4FD2 A;  4LJ5 A;  1DGH B;  3BOS A;  2V6Z M;  4NXN M;  1K3W A;  3J7B A;  1DGG A;  4MGK E;  3AKZ A;  3I51 A;  1N78 A;  2ERC A;  5EXS A;  2C98 A;  4DV3 M;  3L2A A;  3A45 A;  3L29 A;  3W0L B;  2VQF M;  2DWM A;  2UUB M;  1L2D A;  2X49 A;  1SXJ D;  2Z3X A;  2OPF A;  4IBI A;  4G4Q A;  4GH9 A;  1NSF A;  1XXH A;  4NSO B;  4DUZ M;  3PVS A;  1KYI A;  2CEA A;  1IN6 A;  4CHT B;  3FD9 A;  4NOO B;  3UGJ A;  5DNY A;  3GLI B;  2RGH A;  1UM8 A;  3H4M A;  3VK8 A;  3U6Q A;  2DVW B;  2FE8 A;  3HHZ A;  3KS8 A;  4MGH A;  1XMQ M;  3SAT A;  1E94 E;  3KSX A;  5ITU A;  3D8L A;  4M9X A;  2R65 A;  2YNM D;  5IRE B;  4RF0 A;  4MB7 A;  1DO0 A;  3FTF A;  1YE9 A;  1NNU C;  1IXR C;  1SXJ B;  2JA2 A;  2G5G X;  3AJI B;  3T1Y M;  1X37 A;  4PD2 A;  1IM2 A;  2XH9 A;  4P16 A;  5BPV A;  1MX0 A;  5FSW A;  5IZ7 D;  3T1H M;  4EIW A;  3AV0 A;  1FNN A;  3LQQ A;  3U6E A;  4LJ4 A;  3NWL A;  4GHA A;  3SBJ A;  3L27 A;  5EP2 A;  3U6L A;  1Z6T A;  4I5S A;  2QBY B;  3LQR A;  4LJ6 A;  1SXJ E;  4DV2 M;  4QNR A;  3FUT A;  4AZF A;  4LF4 M;  1QAO A;  5LMN M;  2C99 A;  2R46 A;  3KSJ A;  1G4A E;  2DXI A;  4IIW A;  1DGH A;  3ILK A;  4LF9 M;  2ZAM A;  1IBK M;  2XFT A;  1G3I A;  2HKJ A;  4LF5 M;  3A42 A;  2R45 A;  2R62 A;  1VDD A;  3TL4 X;  4IBK A;  1L8Q A;  3R8F A;  1R6B X;  3HU2 A;  3SMP A;  3AFH A;  3HHY A;  3JR5 A;  2L7H A;  1R7R A;  4M9S A;  1IN5 A;  3DA1 A;  5ITR A;  3GRY A;  3CF0 A;  3CF6 E;  3HJ8 A;  4LGM A;  3SYK A;  3U5Z B;  1HNW M;  5GKN A;  4JN6 A;  2KZS A;  4B08 A;  3NBI A;  4GIP A;  3KFU G;  1IQP A;  5FTN A;  2ZAO A;  1NHW C;  1G59 A;  4JI0 M;  3GLI A;  2ZAN A;  3KXE C;  3QAU A;  4D80 A;  3ZC7 B;  4X65 M;  2CHQ A;  2CV0 A;  3IG8 A;  3GP1 A;  4PDI A;  2XF3 A;  3AL0 C;  1TGU A;  1NHG C;  2KA6 B;  4KLN A;  4IBD A;  3AOE C;  2D7G A;  3SMS A;  4GRI A;  2K47 A;  2XLJ A;  4II7 A;  1XNR M;  2EUC A;  1SXJ A;  4WUR A;  3DFZ A;  4DR5 M;  1JR3 D;  5H37 D;  4IBJ A;  4REZ A;  1HQC A;  2Q2E B;  4G6Z A;  5KQ8 A;  2KXE A;  4GKK M;  1XHB A;  2QBY A;  3HJS A;  2X8A A;  2V1U A;  4FCT A;  4OVZ B;  1IBL M;  2FOI C;  4R7G A;  4BLC A;  3CTW B;  3LVW A;  3U60 A;  3L25 A;  1Q3B A;  3K8Z A;  1OJL A;  3OTO M;  4DV7 M;  3HGI A;  1IN4 A;  4W5W A;  4GMQ A;  3GLF B;  4LJ9 A;  2UXC M;  2V1C A;  5A2Q S;  3GPX A;  2KZU A;  3UMM A;  5EP1 A;  3U6D A;  3E9S A;  4IJE A;  5ITT A;  1HNZ M;  3ZH9 B;  1QVR A;  1WXQ A;  4QHS A;  3U5Z A;  3VKH A;  3KOY E;  5DYI A;  2OQ4 A;  3UZU A;  2XZU A;  4LGY A;  4LF8 M;  3UK6 A;  2F5O A;  2HL7 A;  4FCW A;  2DWZ B;  2I7N A;  4OW0 A;  3K2L A;  4L15 A;  1LV7 A;  3KS4 A;  1IXZ A;  3TQS A;  4MM3 B;  2CV1 A;  4JI5 M;  4YY3 M;  3U6O A;  1Q3C A;  2Z7J A;  3GRV A;  4AG6 A;  1JQJ C;  2Z4S A;  2KW0 A;  5ITY A;  4DR3 M;  2UUA M;  4L8R C;  3HHX A;  1PJJ A;  4B7F A;  4PDG A;  3PXG A;  3R9X B;  4AW4 A;  5JI2 E;  5KO3 A;  5LMU M;  3K1J A;  3KP0 E;  1IXS B;  4NSR A;  3T38 A;  3W0F A;  1J7K A;  5JI3 E;  4LJA A;  4OVZ A;  1TH3 A;  2M60 A;  3EIH A;  3SHG B;  3J80 S;  3TWK A;  4DR4 M;  1Z5A A;  3GPP A;  2KEB A;  3UJN A;  4FWH A;  3KW6 A;  4OU7 A;  1FJG M;  3LMM A;  4PT5 A;  2L7I A;  2UXB M;  4LF7 M;  4XBO A;  3TPZ A;  1JR3 A;  1GVN A;  2XSZ A;  5KPZ A;  4FWD A;  3KVW A;  1KSF X;  1NVM A;  4D81 A;  2QEN A;  3U61 B;  1L1Z A;  4AKI A;  1GL7 A;  5FTM A;  3GLH B;  3RGP A;  3FYD A;  4B3T M;  4JV5 M;  1I4W A;  4AKG A;  4M0W A;  3KOZ E;  3CF2 A;  4IBG A;  3WHK A;  3SAV A;  3AOE A;  3M0E A;  3WHL A;  3FUW A;  4G4R A;  1HNX M;  2CV2 A;  5BR8 M;  3J27 B;  1TDH A;  3VDU A;  5C1B A;  2LH0 A;  5KPT A;  3I4V A;  1QAM A;  3PNV A;  1Z5C A;  4FVM A;  1J5E M;  4B3M M;  5ITX E;  3U6M A;  3SAS A;  1C1K A;  3TWL A;  2YQZ A;  2Y0T A;  2EA0 A;  1G8P A;  3RE8 A;  2M5Z A;  2E5L M;  4AKH A;  2Z4R A;  5ITQ A;  1ORY B;  2UXD M;  4AG5 A;  2VQE M;  4DV0 M;  3KOX E;  1G41 A;  5KQD A;  2NQ8 C;  1IY0 A;  1IN7 A;  1YSY A;  4LFA M;  4BBA A;  3SAW A;  1TDZ A;  1W5T A;  2ZM6 M;  1K3X A;  2R18 A;  4GC5 A;  1EE8 A;  4AI6 A;  3GPU A;  3FUX A;  3GQ5 A;  2VII A;  4K0K M;  4JI8 M;  2Y21 A;  2BJW A;  2CHG A;  4Z6Y A;  1QYR A;  4X62 M;  5DYG A;  1ZQ9 A;  3DZD A;  2DWN A;  3FUV A;  1QAQ A;  1ZAE A;  4GIT A;  3IG5 A;  3LVV A;  3KDS E;  3FUU A;  3HU1 A;  4LJ7 A;  4DV1 M;  1HQY E;  1IBM M;  4DR2 M;  4L78 A;  1E9S A;  4LFB M;  2CUZ A;  2L09 A;  4DUY M;  2UUC M;  4LF6 M;  3DOA A;  2O5R A;  3ZCB B;  1D2N A;  2DZO B;  3U61 A;  1XWI A;  4IBF A;  5KPR A;  1HR0 M;  4NXM M;  1Q39 A;  5E26 A;  4LRS A;  3L28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...