3A45A

Crystal structure of mvnei1_2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formamidopyrimidine-DNA glycosylase
publication title Structural Characterization of a Viral NEIL1 Ortholog Unliganded and Bound to Abasic Site-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
total genus 81
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a45A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3a45A01
3U6EA 3U6SA 2UXBM 1N36M 1Z5CA 1R2YA 1TDZA 3SATA 5IT9S 4YHHM 2F5SA 4LFCM 4X64M 3DOAA 3U6MA 4DV6M 3J81S 1PJIA 4DR1M 4LF8M 5ITXA 3SAVA 5ITYA 4NXMM 3C58A 4G4NA 4JYAM 4PCZA 1N32M 1HNZM 4B3MM 4NXNM 2XZUA 2UU9M 1I94M 2ZBKB 4JI0M 4YY3M 1L2CA 4ITQA 4LF6M 3SAUA 4DR6M 4X66M 4LF5M 3SAWA 2EA0A 2Q2EB 2ZM6M 1N33M 1XMOM 4DV2M 1R2ZA 1Z59A 3GPYA 3GQ5A 1HR0M 1Z5AA 3J80S 3J7AS 3U6DA 2F5QA 4JI3M 4LFBM 1KFVA 2UXDM 3T1YM 4AQYM 4DR7M 3JAMS 3GPPA 3U6PA 4G4OA 4JI7M 3A42A 1MX0A 4MB7A 3TWMA 1IBLM 5LMUM 4DV1M 4DR3M 5A2QS 3VK8A 1TDHA 4DR2M 5FLXS 1J5EM 4DR5M 1HNWM 5LMNM 4PDIA 4JI5M 1Z5BA 4KHPM 4K0KM 4B3TM 5ITTA 4B3RM 4G4QA 1FJGM 3A46A 2F4VM 4DV0M 4CISA 4JI6M 4GKJM 3U6LA 4JI2M 1EE8A 3VK7A 3SASA 1PJJA 1K3WA 2F5NA 4NRVA 1Q3BA 5ITQA 5ITUA 2VQEM 1Q3CA 4JV5M 2F5OA 2VQFM 4X65M 1NNJA 3W0FA 3JR5A 1N34M 2E5LM 4DV3M 3GP1A 4DV7M 1L2DA 2UUAM 4OX9M 4JI8M 4PD2A 1Q39A 5IWAM 3GPUA 3GQ3A 2UUCM 4DV4M 3SARA 5ITRA 3SBJA 3JR4A 1IBKM 1IBMM 1L1ZA 1XMQM 4G4RA 2HKJA 1PM5A 4JI4M 3U6CA 4JI1M 3OTOM 4DUZM 4X62M 1K3XA 2F5PA 4DR4M 5ITXE 1L2BA 2UXCM 4LF4M 4GKKM 3TWKA 3U6OA 3U6QA 2OQ4A 4DUYM 4PDGA 1XC8A 4LF9M 4LFAM 1MU5A 4B3SM 1K82A 2OPFA 3T1HM 3GO8A 2UUBM 2HHHM 1XNQM 3GPXA 1XNRM 3GQ4A 3A45A 4LF7M 3TWLA 2XZFA 1L1TA 4DV5M 5BR8M 1HNXM 4NRWA
chains in the Genus database with same CATH superfamily
4DBGB 4NSOB 5L8RF 3K9PA 5KPRA 3PNYA 2AHMA 2EKFA 4LZZA 4GC9A 3L2AA 2F5SA 1F4IA 2K6BA 4WURA 2CV0A 2L4EA 1EFUB 2JWSA 3U61A 1IFYA 3PVSA 4LJAA 4CGYB 1QAQA 4DR1M 4LF8M 1QDRA 5ITYA 1V34A 4LRSA 3GLIA 3QWLA 5GKNA 1DGGA 1Y8GA 2QQ8A 2WSEF 3UMMA 2CWBA 2ZBKB 4LJ7A 4ITQA 2JY6B 3SMPA 4GHAA 1NNUC 1NV9A 2K47A 1D0MA 2Q2EB 3SMSA 4IBBA 3AOGA 1XMOM 2BJWA 2V6ZM 1R2ZA 4IIWA 3GQ5A 2HL7A 1HR0M 1UM8A 4MGYE 4P16A 3FUTA 2QBYA 3W67A 3UGJA 2O01F 2VF8A 2UXDM 2YNMD 4AQYM 1VEGA 3JAMS 2QSFX 2DWLA 1OJLA 3FD9A 2Z3XA 3A42A 1UFZA 2X4AA 3FRIA 3L26A 3E21A 2FE8A 3L27A 4DV1M 1IBLM 1E9SA 3VDPA 3KFUG 4QNMA 3K1JA 4DR2M 1NVMA 2LHGA 1HNWM 4AKGA 1VG5A 4WW0A 1TH4A 2Y0TA 4JI5M 2DNAA 4CIZA 4K0KM 4G4QA 2CHQA 1VDDA 1TH3A 2F4VM 4DV0M 2ZAMA 4CISA 3SYKA 4I4LA 4JI6M 1OFIA 3GRYA 1TF0B 1SXJE 2HCBA 1K3WA 4FW9A 1WR1B 3FTCA 3HHWA 4R7GA 1DGHA 1JQJC 3R9XB 2H5XA 3J27B 2LVAA 3KOXE 1JR3E 3GLHA 4MH0E 4QNRA 2KDLA 1EIJA 3W0FA 1IXSB 2GNOA 2WZJA 1E94E 4FWDA 1L2DA 1QDTA 4IBIA 2QHOB 2FS1A 3FKEA 1HJPA 3SC3A 5H37D 1Q39A 2ERCA 4QOZC 3QYEA 2JY8A 2DWMA 2XGNA 2LWXA 4HL4A 2J5YA 4IBFA 4GEWA 1GKIA 3JR4A 1WGNA 4G3OA 1A5TA 3SBJA 3PNVA 3KS8A 2VDBB 5E6JA 1TTEA 1IBMM 5FTJA 2O5RA 1QZMA 5C1BA 3FUWA 4LJ9A 1VQ1A 1ZMWA 1QAOA 3B7ZA 1N78A 4GMQA 1OFHA 1PRBA 3C3DA 3FUXA 2L7IA 3AJIB 2UXCM 4AW4A 1E9RA 5BPVA 2FNAA 3HY5A 3AFHA 3U6OA 2WSCF 3TQSA 2OQ4A 2O25A 2K0BX 4DUYM 3BOSA 1SXJD 1GO5A 1MU5A 4BBAA 3GO8A 2JXNA 3DFZA 3M6AA 1XNQM 3GPXA 2C5RA 3T38A 2Y0QA 3TWLA 1MN3A 1L1TA 3H4MA 2DI0A 2UUAM 3SFZA 2LTUA 1HQYE 4W5WA 3U6EA 2UXBM 2DWZB 3KVWA 4BB9A 1R2YA 2QNJA 1GJSA 1TDZA 2J7OA 3LQRA 4LFCM 3NWLA 4X64M 1ZMVA 3DOAA 3EIEA 3RGSA 2KRUA 3VKHA 1HT1E 4II7A 3E9SA 4DV6M 8CATA 1SG9A 2XSZA 2CUZA 2ZTCA 4F2LA 3C58A 4NXMM 4JYAM 1N32M 2YFQA 3HGIA 4PT5A 3NBIA 3AL0C 4LGMA 4S12A 2KW0A 2UU9M 1I94M 3J7BA 4LJ5A 2R4EA 3Q8XA 4LF5M 1G41A 3D8LA 4LJ8A 1YUBA 1W5SA 3SAWA 2EA0A 4AKIA 1OIZA 2DHRA 1IXSA 4IBKA 1Z59A 3B9PA 3J2PB 3GPYA 3GLFE 3J80S 4B7HA 1G8PA 1FNNA 4JI3M 2RGHA 4LFBM 4CHTB 4DR7M 4Z6YA 3U6PA 4G4OA 1IN7A 4MB7A 3TWMA 4Y28F 3FTEA 4B08A 3LVWA 5EQTA 3HHXA 3VK8A 1QZEA 2KNAA 2QPAA 5F3WA 2M5ZA 1GJTA 1WJ7A 1QYRA 3AV0A 4KT0F 2V1UA 4IJFA 2DENA 1V33A 3ILKA 1BVSA 3E46A 3F92A 1SXJB 2HWJA 3MHVC 4KHPM 1Z5BA 2K9DA 5ITTA 1KYIA 1Z6TA 2R46A 1PJQA 1IN6A 2XFTA 2XF3A 1R7RA 3UJNA 4NC6A 2X8AA 1OAOC 4MGZE 2KHHA 4FCTA 3SASA 2JUJA 3LVVA 3ZH9B 1PJJA 3MK6A 1QANA 4XGIA 4FWGA 5ITUA 2EO2A 3C9PA 3VLFB 2KNVA 2G3QA 2MR9A 4IBCA 3SHFA 5FTNA 3VDUA 4FCWA 3HHYA 3JR5A 2E5LM 5JI2E 3GP1A 3L25A 1GL6A 2Z4RA 4OX9M 4JI8M 3DA1A 5FSWA 3KXEC 3I4YA 3LMMA 3GQ3A 2UUCM 2DZOB 1X37A 4QOSA 3PFIA 3TE6A 5ITRA 2BWBA 5EJCA 2D7HA 2CHGA 4R71A 1IBKM 1GABA 2BJVA 1L1ZA 4G4RA 2HKJA 2G5GX 3LW5F 1R4GA 2LNHC 3UZUA 3U6CA 1OAIA 3CTWB 1PM5A 3FRHA 2DZNB 3OTOM 1E32A 1IN5A 1NJFA 1J09A 4IBEA 3TL4X 4M9XA 3ZC7B 4B7FA 1K3XA 2LBCA 1TGUA 1IY0A 3AKZA 2C98A 2R65A 2XFSA 4GRIA 4NL4H 5ITXE 1RU3A 1ZAEA 4D81A 2P5TA 1QUTA 2D7GA 4L15A 3U6QA 3I04M 1P3QQ 1G4AE 3LCUA 3FYCA 2DAIA 1XC8A 4LF9M 2C9CA 2DVWB 1C1KA 2OPFA 4AKHA 2XH9A 2B3TA 5JI3E 2HHHM 1R6BX 2JA2A 5KQDA 1XNRM 1LTMA 1L8QA 1PGYA 2A5YB 2L09A 3K2LA 4FD2A 4DV5M 5BR8M 2R44A 3HX3A 1Z5CA 1TR8A 2FFJA 2R62A 3D8BA 1OTRA 1QVRA 5DFLA 4NSRA 3SATA 4AI6A 4YHHM 5EP3A 4I81A 5FTMA 3U6MA 3TPZA 2Z4SA 1S3SA 5C18A 2LH0A 1G71A 4WP2A 1SXJA 2HAKA 2EKKA 3I01M 3RE8A 3ZCBB 3J81S 3MJ5A 5ITXA 3U5ZB 1ZV1A 4MGKE 4PCZA 3GLGB 1JR3A 1XXHB 4B3MM 4A3VB 4NXNM 2XZUA 4OU7A 4TUWA 3KSJA 2DZLA 4JI0M 4YY3M 3GLFB 2FOIC 3SAUA 1L2CA 4LF6M 2Z8YM 2FH0A 2R4JA 4X66M 4L6V6 1LV7A 1TH2A 2JP7A 4BLCA 5FTKA 2KZSA 4HLQA 1DGFA 5KPZA 3THGA 1G59A 1OIPA 2DAGA 1DV0A 3A98B 1XB2B 3B89A 4IBDA 2MJ5B 2DWNA 2H1RA 3T1YM 3R8FA 2GQFA 3GPPA 2CFOA 1CUKA 3K92A 5FTLA 4LG2A 1MX0A 3KP1E 2RKOA 3HJ8A 4DR3M 3I51A 4ZPXA 5A2QS 3LCVB 3BBZA 1DGBA 2LHCA 1TDHA 4GH9A 4LY6A 2JZ0A 5EXTA 3K8ZA 5FLXS 1NHWC 4L78A 4DR5M 1WIVA 3U60B 3KW6A 4RKUF 1XHBA 4D80A 5LMNM 4FVMA 1ORYB 4EIWA 4Q7JA 4B3TM 4B3RM 4LRTA 2G8LA 3WHLA 1ZQ9A 1FJGM 4B7GA 2VF7A 2KZUA 2ZANA 3GLGE 5EP2A 1XXHE 1GLNA 2KNZA 4NOOB 1I4WA 3VKGA 2F5NA 4NRVA 3IECA 2VQEM 1Q3CA 5EXSA 4JV5M 2F5OA 2C96A 4KODA 1NO1A 3GLIE 1N34M 1KSFX 4DV3M 1WXQA 1T43A 4L8RC 3M7GA 3I4VA 3FUUA 1IY1A 2APLA 3EIHA 4GHLA 2LVOC 2R18A 4PD2A 4G6ZA 1IQPA 1N75A 2JY7A 3GPUA 4Z8XA 2XSZD 3RGPA 1HT2E 1YE9A 4IBJA 4P17A 3SARA 2OOAA 4IJEA 2JY5A 3W0LB 4OW0A 4KLNA 2LVNC 1XMQM 1IM2A 2CE7A 4JI4M 2W82A 2KEBA 3FUVA 1OQYA 3HU1A 4DUZM 3HKPA 4X62M 2EJSA 3U5ZA 1D0LA 1QUSA 2F5PA 1W5TA 3GLGA 3IG8A 4AG6A 1XXHA 3L28A 4I5SA 2ZAOA 2LVQD 2DHYA 4JXJA 2LVPC 2MH8A 2QZ4A 2CRUA 1VDLA 2KA6B 5IREB 2Y20A 3B7QA 4GC5A 3GLFA 3TWKA 2JZ1A 2EUCA 4REZA 4QHSA 1YSYA 3CGWA 3ZQJA 4AZFA 1C7YA 3IG5A 2CP8A 4PDGA 2YR0A 3GRRA 3T1HM 3KDSE 2RGOA 2DXIA 1D2NA 1T6OA 1NY6A 1VEJA 3GQ4A 1J7KA 3AOEA 1VEKA 4LF7M 2Y21A 4B3SM 2WSFF 4JN6A 1HNXM 4NRWA 4M9SA 3GLHE 3U6SA 1N36M 4FWHA 2BWEA 3QYBA 4I8OA 3M0EA 2KXEA 1AUAA 7CATA 5IT9S 2D7EA 3HZJA 2QENA 2ZTDA 3U60A 1XWIA 4D82A 2M60A 1PJIA 3KOWE 3SAVA 3GRUA 2QP9X 2R0IA 4LZJA 5KPTA 2CEAA 4ANRA 4G4NA 1HNZM 4RNAA 3NBXX 2I7PA 2C9OA 1H6UA 1IN4A 4LJ4A 4OVZB 5DYIA 3Q8GA 4DR6M 4FCVA 3VFDA 2CV1A 2JNHA 3CF6E 1NHGC 2ZM6M 1N33M 4RF1A 1R5LA 4DV2M 3QAUA 4GIPA 3H4JA 5E26A 1Z5AA 3K9OA 3J7AS 3U6DA 2X49A 3DZDA 1D0KA 3HU2A 2Z7JA 2F5QA 2KRKA 1KFVA 1PJSA 4GITA 3WHKA 3V76A 1GVNA 3C3EA 3HU3A 4JI7M 1YLAA 1WHCA 1V92A 5LMUM 2YQZA 5EP1A 3FE3A 2R6FA 3B7NA 3KSXA 4LGYA 1J5EM 3FTFA 4L4UA 3CF0A 3U61B 3HWSA 2BNKA 2DAEA 1MJGM 2V1CA 3UK6A 2DAMA 4RF0A 4HEOA 4PDIA 3L29A 5KO3A 3B74A 2XLJA 1HQCA 2DAKA 2RRUA 2XEPA 3KOZE 4QHTA 3A46A 2L2DA 4CJ6A 1NJGA 1Q02A 3GLIB 4GKJM 3U6LA 4JI2M 1EE8A 1DO2A 3VK7A 3AOEC 1Q3BA 5ITQA 1G3IA 1ZMUA 4R3DA 4XK8F 1PJTA 1JB0F 4MGIE 3KS4A 3LQQA 2R45A 2VQFM 4X65M 1NNJA 2NQ8C 2DKLA 3BXWA 4DV7M 2MGWA 1N77A 1OKSA 3T6PA 4F1IA 1NV8A 2QBYB 1AIPC 2L7HA 4M9ZA 2QCUA 4M0WA 2OO9A 3PXGA 5IWAM 1QAMA 4DV4M 3T15A 4KO8A 5DYGA 1JR3D 4AG5A 3E4RA 2MROB 4MM3B 4XBOA 5EXPA 3SYLA 1IXZA 1T3TA 1IXRC 3RFWA 4JI1M 1WGLA 1DO0A 1GL7A 4UN2B 3HJSA 3HHZA 2L4FA 1IY2A 3IHPA 4LCBA 5EP4A 5KQ8A 1QQWA 4DR4M 5IZ7D 4LJ6A 3SHGB 3W68A 1L2BA 1NY5A 3MMPA 2CV2A 4LF4M 4OVZA 4GKKM 4L16A 4M0DA 2J7NA 1IN8A 2C99A 1DGHB 2N35A 3CF2A 4LFAM 5DNYA 1NSFA 1SXJC 3GLHB 1K82A 5EXXA 3FTDA 2L6OA 3FYDA 3KP0E 2UUBM 4IBGA 4MGHA 3GRVA 2I7NA 3A45A 3HJQA 2XZFA 3KOYE 2VIIA 2CHVA 2OOBA 2LXEA
chains in the Genus database with same CATH topology
4NSOB 5KPRA 3PNYA 2AHMA 4LZZA 4GC9A 3L2AA 2F5SA 4WURA 2CV0A 3U61A 3PVSA 4LJAA 4CGYB 1QAQA 4DR1M 4LF8M 5ITYA 4LRSA 3GLIA 3QWLA 5GKNA 1DGGA 3UMMA 4LJ7A 2ZBKB 4GHAA 4ITQA 3SMPA 1NNUC 2K47A 2Q2EB 3SMSA 4IBBA 3AOGA 1XMOM 2BJWA 2V6ZM 1R2ZA 4IIWA 3GQ5A 2HL7A 1HR0M 1UM8A 4MGYE 4P16A 3FUTA 2QBYA 3UGJA 2UXDM 2YNMD 4AQYM 3JAMS 2DWLA 1OJLA 3FD9A 2Z3XA 3A42A 3L26A 2X4AA 1IBLM 3L27A 2FE8A 4DV1M 1E9SA 3VDPA 3KFUG 4QNMA 3K1JA 4DR2M 1NVMA 1HNWM 4AKGA 4WW0A 1TH4A 2Y0TA 4JI5M 4K0KM 4G4QA 2CHQA 1VDDA 1TH3A 2F4VM 4DV0M 2ZAMA 4CISA 3SYKA 4I4LA 4JI6M 1OFIA 3GRYA 1SXJE 2HCBA 1K3WA 4FW9A 3FTCA 4R7GA 3HHWA 1DGHA 1JQJC 3R9XB 3J27B 3KOXE 3GLHA 4MH0E 4QNRA 3W0FA 1IXSB 1E94E 4FWDA 1L2DA 4IBIA 3FKEA 3SC3A 5H37D 1Q39A 2ERCA 4QOZC 2DWMA 2XGNA 2LWXA 4HL4A 4IBFA 1GKIA 3JR4A 3SBJA 3PNVA 3KS8A 5E6JA 1IBMM 5FTJA 2O5RA 1QZMA 5C1BA 3FUWA 4LJ9A 1QAOA 1N78A 4GMQA 1OFHA 3FUXA 2L7IA 3AJIB 2UXCM 4AW4A 1E9RA 5BPVA 2FNAA 3AFHA 3U6OA 3TQSA 2OQ4A 4DUYM 3BOSA 1SXJD 1MU5A 4BBAA 3GO8A 3DFZA 3M6AA 1XNQM 3GPXA 2C5RA 3T38A 2Y0QA 3TWLA 1L1TA 3H4MA 2UUAM 3SFZA 4W5WA 1HQYE 3U6EA 2UXBM 2DWZB 3KVWA 4BB9A 1R2YA 1TDZA 2J7OA 3LQRA 4LFCM 3NWLA 4X64M 3DOAA 3EIEA 3RGSA 3VKHA 2KRUA 1HT1E 4II7A 3E9SA 4DV6M 8CATA 2XSZA 2CUZA 4NXMM 3C58A 4JYAM 1N32M 2YFQA 3HGIA 4PT5A 3NBIA 3AL0C 4LGMA 4S12A 2KW0A 2UU9M 1I94M 3J7BA 4LJ5A 2R4EA 3Q8XA 4LF5M 1G41A 3D8LA 4LJ8A 1YUBA 1W5SA 3SAWA 2EA0A 4AKIA 2DHRA 4IBKA 1Z59A 3B9PA 3J2PB 3GPYA 3J80S 4B7HA 1G8PA 1FNNA 4JI3M 2RGHA 4LFBM 4CHTB 4DR7M 4Z6YA 3U6PA 4G4OA 1IN7A 4MB7A 3TWMA 3FTEA 4B08A 3LVWA 5EQTA 3HHXA 3VK8A 2QPAA 5F3WA 2M5ZA 3AV0A 2V1UA 1QYRA 4IJFA 3ILKA 1SXJB 3MHVC 4KHPM 1Z5BA 5ITTA 1KYIA 1Z6TA 2R46A 1IN6A 2XFTA 2XF3A 1R7RA 3UJNA 2X8AA 4MGZE 3SASA 4FCTA 3LVVA 3ZH9B 1PJJA 3MK6A 1QANA 4XGIA 4FWGA 5ITUA 2EO2A 3VLFB 4IBCA 3SHFA 5FTNA 3VDUA 4FCWA 3HHYA 3JR5A 2E5LM 5JI2E 3GP1A 3L25A 1GL6A 2Z4RA 4OX9M 4JI8M 3DA1A 5FSWA 3KXEC 3I4YA 3LMMA 3GQ3A 2UUCM 2DZOB 1X37A 4QOSA 3PFIA 3TE6A 5ITRA 5EJCA 2D7HA 2CHGA 1IBKM 2BJVA 1L1ZA 4G4RA 2HKJA 2G5GX 1PM5A 2LNHC 3UZUA 3U6CA 3CTWB 3OTOM 2DZNB 1E32A 1IN5A 1NJFA 1J09A 4IBEA 3TL4X 4M9XA 3ZC7B 4B7FA 1K3XA 3AKZA 1TGUA 1IY0A 2C98A 2R65A 2XFSA 4GRIA 4NL4H 5ITXE 1ZAEA 4D81A 2P5TA 2D7GA 4L15A 3U6QA 1G4AE 3FYCA 1XC8A 4LF9M 2C9CA 2DVWB 1C1KA 2OPFA 4AKHA 2XH9A 5JI3E 2HHHM 1R6BX 2JA2A 5KQDA 1XNRM 1L8QA 4FD2A 2A5YB 3K2LA 2L09A 4DV5M 5BR8M 1Z5CA 3D8BA 2FFJA 2R62A 1QVRA 4NSRA 3SATA 4AI6A 4YHHM 5EP3A 4I81A 5FTMA 3U6MA 3TPZA 2Z4SA 1S3SA 5C18A 2LH0A 3ZCBB 1SXJA 3J81S 3RE8A 3MJ5A 5ITXA 3U5ZB 4MGKE 4PCZA 3GLGB 1JR3A 1XXHB 4B3MM 4A3VB 4NXNM 2XZUA 4OU7A 4TUWA 3KSJA 4JI0M 4YY3M 3GLFB 1L2CA 2FOIC 3SAUA 4LF6M 2R4JA 4X66M 1LV7A 1TH2A 4BLCA 5FTKA 2KZSA 4HLQA 1DGFA 5KPZA 3THGA 1G59A 3A98B 4IBDA 2DWNA 2H1RA 3T1YM 3R8FA 3GPPA 2CFOA 3K92A 5FTLA 4LG2A 1MX0A 3KP1E 2RKOA 3HJ8A 4DR3M 3I51A 4ZPXA 5A2QS 1DGBA 1TDHA 4GH9A 4LY6A 5EXTA 5FLXS 3K8ZA 4DR5M 1NHWC 4L78A 3U60B 3KW6A 4D80A 1XHBA 5LMNM 4FVMA 1ORYB 4EIWA 4B3TM 4B3RM 4LRTA 2G8LA 3WHLA 1ZQ9A 1FJGM 4B7GA 2KZUA 2ZANA 5EP2A 1GLNA 4NOOB 1I4WA 3VKGA 2F5NA 4NRVA 2VQEM 1Q3CA 5EXSA 4JV5M 2F5OA 2C96A 4KODA 1N34M 1KSFX 4DV3M 1WXQA 4L8RC 3M7GA 3I4VA 3FUUA 1IY1A 3EIHA 4GHLA 2R18A 4PD2A 4G6ZA 1IQPA 1N75A 3GPUA 4Z8XA 2XSZD 3RGPA 1HT2E 1YE9A 4IBJA 3SARA 4IJEA 3W0LB 4OW0A 4KLNA 1XMQM 1IM2A 2CE7A 4JI4M 2W82A 2KEBA 3FUVA 3HU1A 4DUZM 3HKPA 4X62M 3U5ZA 2F5PA 1W5TA 3GLGA 3IG8A 4AG6A 1XXHA 3L28A 4I5SA 2ZAOA 4JXJA 2QZ4A 5IREB 2KA6B 2Y20A 4GC5A 3GLFA 3TWKA 2EUCA 4REZA 4QHSA 1YSYA 4AZFA 3IG5A 4PDGA 2YR0A 3GRRA 3T1HM 3KDSE 2RGOA 2DXIA 1D2NA 1NY6A 3GQ4A 4LF7M 1J7KA 3AOEA 2Y21A 4B3SM 4JN6A 1HNXM 4NRWA 4M9SA 3U6SA 1N36M 4FWHA 4I8OA 3M0EA 2KXEA 7CATA 5IT9S 2D7EA 2QENA 3U60A 1XWIA 4D82A 2M60A 1PJIA 3KOWE 3SAVA 3GRUA 2QP9X 5KPTA 4LZJA 4G4NA 2CEAA 1HNZM 4RNAA 2I7PA 2C9OA 1H6UA 1IN4A 4LJ4A 4OVZB 5DYIA 4DR6M 4FCVA 3VFDA 2CV1A 3CF6E 1NHGC 2ZM6M 1N33M 4RF1A 4DV2M 3QAUA 4GIPA 5E26A 1Z5AA 3J7AS 3U6DA 2X49A 3DZDA 3HU2A 2F5QA 2Z7JA 2KRKA 1KFVA 3WHKA 4GITA 1GVNA 3HU3A 4JI7M 5LMUM 2YQZA 5EP1A 3KSXA 4LGYA 1J5EM 3FTFA 4L4UA 3CF0A 3U61B 3HWSA 2BNKA 2V1CA 3UK6A 4RF0A 4PDIA 3L29A 5KO3A 2XLJA 1HQCA 2XEPA 3KOZE 4QHTA 3A46A 1NJGA 3GLIB 4GKJM 3U6LA 4JI2M 1EE8A 1DO2A 3VK7A 3AOEC 1Q3BA 5ITQA 1G3IA 4R3DA 4MGIE 3KS4A 3LQQA 2R45A 2VQFM 4X65M 1NNJA 2NQ8C 4DV7M 1N77A 2QBYB 2L7HA 4M9ZA 2QCUA 4M0WA 5IWAM 3PXGA 1QAMA 4DV4M 3T15A 4KO8A 5DYGA 1JR3D 4AG5A 3E4RA 4MM3B 4XBOA 5EXPA 3SYLA 1IXZA 1T3TA 1IXRC 3RFWA 4JI1M 1DO0A 1GL7A 3HJSA 3HHZA 1IY2A 4LCBA 5EP4A 5KQ8A 1QQWA 4DR4M 5IZ7D 4LJ6A 3SHGB 1L2BA 2CV2A 1NY5A 4LF4M 4OVZA 4GKKM 4L16A 4M0DA 2J7NA 1IN8A 2C99A 1DGHB 3CF2A 4LFAM 5DNYA 1NSFA 1SXJC 3GLHB 1K82A 5EXXA 3FTDA 2L6OA 3FYDA 3KP0E 2UUBM 4IBGA 4MGHA 3GRVA 2I7NA 3A45A 3HJQA 2XZFA 3KOYE 2VIIA 2CHVA 2LXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6E A;  3U6S A;  2UXB M;  1N36 M;  1Z5C A;  1R2Y A;  1TDZ A;  3SAT A;  5IT9 S;  4YHH M;  2F5S A;  4LFC M;  4X64 M;  3DOA A;  3U6M A;  4DV6 M;  3J81 S;  1PJI A;  4DR1 M;  4LF8 M;  5ITX A;  3SAV A;  5ITY A;  4NXM M;  3C58 A;  4G4N A;  4JYA M;  4PCZ A;  1N32 M;  1HNZ M;  4B3M M;  4NXN M;  2XZU A;  2UU9 M;  1I94 M;  2ZBK B;  4JI0 M;  4YY3 M;  1L2C A;  4ITQ A;  4LF6 M;  3SAU A;  4DR6 M;  4X66 M;  4LF5 M;  3SAW A;  2EA0 A;  2Q2E B;  2ZM6 M;  1N33 M;  1XMO M;  4DV2 M;  1R2Z A;  1Z59 A;  3GPY A;  3GQ5 A;  1HR0 M;  1Z5A A;  3J80 S;  3J7A S;  3U6D A;  2F5Q A;  4JI3 M;  4LFB M;  1KFV A;  2UXD M;  3T1Y M;  4AQY M;  4DR7 M;  3JAM S;  3GPP A;  3U6P A;  4G4O A;  4JI7 M;  3A42 A;  1MX0 A;  4MB7 A;  3TWM A;  1IBL M;  5LMU M;  4DV1 M;  4DR3 M;  5A2Q S;  3VK8 A;  1TDH A;  4DR2 M;  5FLX S;  1J5E M;  4DR5 M;  1HNW M;  5LMN M;  4PDI A;  4JI5 M;  1Z5B A;  4KHP M;  4K0K M;  4B3T M;  5ITT A;  4B3R M;  4G4Q A;  1FJG M;  3A46 A;  2F4V M;  4DV0 M;  4CIS A;  4JI6 M;  4GKJ M;  3U6L A;  4JI2 M;  1EE8 A;  3VK7 A;  3SAS A;  1PJJ A;  1K3W A;  2F5N A;  4NRV A;  1Q3B A;  5ITQ A;  5ITU A;  2VQE M;  1Q3C A;  4JV5 M;  2F5O A;  2VQF M;  4X65 M;  1NNJ A;  3W0F A;  3JR5 A;  1N34 M;  2E5L M;  4DV3 M;  3GP1 A;  4DV7 M;  1L2D A;  2UUA M;  4OX9 M;  4JI8 M;  4PD2 A;  1Q39 A;  5IWA M;  3GPU A;  3GQ3 A;  2UUC M;  4DV4 M;  3SAR A;  5ITR A;  3SBJ A;  3JR4 A;  1IBK M;  1IBM M;  1L1Z A;  1XMQ M;  4G4R A;  2HKJ A;  1PM5 A;  4JI4 M;  3U6C A;  4JI1 M;  3OTO M;  4DUZ M;  4X62 M;  1K3X A;  2F5P A;  4DR4 M;  5ITX E;  1L2B A;  2UXC M;  4LF4 M;  4GKK M;  3TWK A;  3U6O A;  3U6Q A;  2OQ4 A;  4DUY M;  4PDG A;  1XC8 A;  4LF9 M;  4LFA M;  1MU5 A;  4B3S M;  1K82 A;  2OPF A;  3T1H M;  3GO8 A;  2UUB M;  2HHH M;  1XNQ M;  3GPX A;  1XNR M;  3GQ4 A;  3A45 A;  4LF7 M;  3TWL A;  2XZF A;  1L1T A;  4DV5 M;  5BR8 M;  1HNX M;  4NRW A; 
#chains in the Genus database with same CATH topology
 4DBG B;  4NSO B;  5L8R F;  3K9P A;  5KPR A;  3PNY A;  2AHM A;  2EKF A;  4LZZ A;  4GC9 A;  3L2A A;  2F5S A;  1F4I A;  2K6B A;  4WUR A;  2CV0 A;  2L4E A;  1EFU B;  2JWS A;  3U61 A;  1IFY A;  3PVS A;  4LJA A;  4CGY B;  1QAQ A;  4DR1 M;  4LF8 M;  1QDR A;  5ITY A;  1V34 A;  4LRS A;  3GLI A;  3QWL A;  5GKN A;  1DGG A;  1Y8G A;  2QQ8 A;  2WSE F;  3UMM A;  2CWB A;  2ZBK B;  4LJ7 A;  4ITQ A;  2JY6 B;  3SMP A;  4GHA A;  1NNU C;  1NV9 A;  2K47 A;  1D0M A;  2Q2E B;  3SMS A;  4IBB A;  3AOG A;  1XMO M;  2BJW A;  2V6Z M;  1R2Z A;  4IIW A;  3GQ5 A;  2HL7 A;  1HR0 M;  1UM8 A;  4MGY E;  4P16 A;  3FUT A;  2QBY A;  3W67 A;  3UGJ A;  2O01 F;  2VF8 A;  2UXD M;  2YNM D;  4AQY M;  1VEG A;  3JAM S;  2QSF X;  2DWL A;  1OJL A;  3FD9 A;  2Z3X A;  3A42 A;  1UFZ A;  2X4A A;  3FRI A;  3L26 A;  3E21 A;  2FE8 A;  3L27 A;  4DV1 M;  1IBL M;  1E9S A;  3VDP A;  3KFU G;  4QNM A;  3K1J A;  4DR2 M;  1NVM A;  2LHG A;  1HNW M;  4AKG A;  1VG5 A;  4WW0 A;  1TH4 A;  2Y0T A;  4JI5 M;  2DNA A;  4CIZ A;  4K0K M;  4G4Q A;  2CHQ A;  1VDD A;  1TH3 A;  2F4V M;  4DV0 M;  2ZAM A;  4CIS A;  3SYK A;  4I4L A;  4JI6 M;  1OFI A;  3GRY A;  1TF0 B;  1SXJ E;  2HCB A;  1K3W A;  4FW9 A;  1WR1 B;  3FTC A;  3HHW A;  4R7G A;  1DGH A;  1JQJ C;  3R9X B;  2H5X A;  3J27 B;  2LVA A;  3KOX E;  1JR3 E;  3GLH A;  4MH0 E;  4QNR A;  2KDL A;  1EIJ A;  3W0F A;  1IXS B;  2GNO A;  2WZJ A;  1E94 E;  4FWD A;  1L2D A;  1QDT A;  4IBI A;  2QHO B;  2FS1 A;  3FKE A;  1HJP A;  3SC3 A;  5H37 D;  1Q39 A;  2ERC A;  4QOZ C;  3QYE A;  2JY8 A;  2DWM A;  2XGN A;  2LWX A;  4HL4 A;  2J5Y A;  4IBF A;  4GEW A;  1GKI A;  3JR4 A;  1WGN A;  4G3O A;  1A5T A;  3SBJ A;  3PNV A;  3KS8 A;  2VDB B;  5E6J A;  1TTE A;  1IBM M;  5FTJ A;  2O5R A;  1QZM A;  5C1B A;  3FUW A;  4LJ9 A;  1VQ1 A;  1ZMW A;  1QAO A;  3B7Z A;  1N78 A;  4GMQ A;  1OFH A;  1PRB A;  3C3D A;  3FUX A;  2L7I A;  3AJI B;  2UXC M;  4AW4 A;  1E9R A;  5BPV A;  2FNA A;  3HY5 A;  3AFH A;  3U6O A;  2WSC F;  3TQS A;  2OQ4 A;  2O25 A;  2K0B X;  4DUY M;  3BOS A;  1SXJ D;  1GO5 A;  1MU5 A;  4BBA A;  3GO8 A;  2JXN A;  3DFZ A;  3M6A A;  1XNQ M;  3GPX A;  2C5R A;  3T38 A;  2Y0Q A;  3TWL A;  1MN3 A;  1L1T A;  3H4M A;  2DI0 A;  2UUA M;  3SFZ A;  2LTU A;  1HQY E;  4W5W A;  3U6E A;  2UXB M;  2DWZ B;  3KVW A;  4BB9 A;  1R2Y A;  2QNJ A;  1GJS A;  1TDZ A;  2J7O A;  3LQR A;  4LFC M;  3NWL A;  4X64 M;  1ZMV A;  3DOA A;  3EIE A;  3RGS A;  2KRU A;  3VKH A;  1HT1 E;  4II7 A;  3E9S A;  4DV6 M;  8CAT A;  1SG9 A;  2XSZ A;  2CUZ A;  2ZTC A;  4F2L A;  3C58 A;  4NXM M;  4JYA M;  1N32 M;  2YFQ A;  3HGI A;  4PT5 A;  3NBI A;  3AL0 C;  4LGM A;  4S12 A;  2KW0 A;  2UU9 M;  1I94 M;  3J7B A;  4LJ5 A;  2R4E A;  3Q8X A;  4LF5 M;  1G41 A;  3D8L A;  4LJ8 A;  1YUB A;  1W5S A;  3SAW A;  2EA0 A;  4AKI A;  1OIZ A;  2DHR A;  1IXS A;  4IBK A;  1Z59 A;  3B9P A;  3J2P B;  3GPY A;  3GLF E;  3J80 S;  4B7H A;  1G8P A;  1FNN A;  4JI3 M;  2RGH A;  4LFB M;  4CHT B;  4DR7 M;  4Z6Y A;  3U6P A;  4G4O A;  1IN7 A;  4MB7 A;  3TWM A;  4Y28 F;  3FTE A;  4B08 A;  3LVW A;  5EQT A;  3HHX A;  3VK8 A;  1QZE A;  2KNA A;  2QPA A;  5F3W A;  2M5Z A;  1GJT A;  1WJ7 A;  1QYR A;  3AV0 A;  4KT0 F;  2V1U A;  4IJF A;  2DEN A;  1V33 A;  3ILK A;  1BVS A;  3E46 A;  3F92 A;  1SXJ B;  2HWJ A;  3MHV C;  4KHP M;  1Z5B A;  2K9D A;  5ITT A;  1KYI A;  1Z6T A;  2R46 A;  1PJQ A;  1IN6 A;  2XFT A;  2XF3 A;  1R7R A;  3UJN A;  4NC6 A;  2X8A A;  1OAO C;  4MGZ E;  2KHH A;  4FCT A;  3SAS A;  2JUJ A;  3LVV A;  3ZH9 B;  1PJJ A;  3MK6 A;  1QAN A;  4XGI A;  4FWG A;  5ITU A;  2EO2 A;  3C9P A;  3VLF B;  2KNV A;  2G3Q A;  2MR9 A;  4IBC A;  3SHF A;  5FTN A;  3VDU A;  4FCW A;  3HHY A;  3JR5 A;  2E5L M;  5JI2 E;  3GP1 A;  3L25 A;  1GL6 A;  2Z4R A;  4OX9 M;  4JI8 M;  3DA1 A;  5FSW A;  3KXE C;  3I4Y A;  3LMM A;  3GQ3 A;  2UUC M;  2DZO B;  1X37 A;  4QOS A;  3PFI A;  3TE6 A;  5ITR A;  2BWB A;  5EJC A;  2D7H A;  2CHG A;  4R71 A;  1IBK M;  1GAB A;  2BJV A;  1L1Z A;  4G4R A;  2HKJ A;  2G5G X;  3LW5 F;  1R4G A;  2LNH C;  3UZU A;  3U6C A;  1OAI A;  3CTW B;  1PM5 A;  3FRH A;  2DZN B;  3OTO M;  1E32 A;  1IN5 A;  1NJF A;  1J09 A;  4IBE A;  3TL4 X;  4M9X A;  3ZC7 B;  4B7F A;  1K3X A;  2LBC A;  1TGU A;  1IY0 A;  3AKZ A;  2C98 A;  2R65 A;  2XFS A;  4GRI A;  4NL4 H;  5ITX E;  1RU3 A;  1ZAE A;  4D81 A;  2P5T A;  1QUT A;  2D7G A;  4L15 A;  3U6Q A;  3I04 M;  1P3Q Q;  1G4A E;  3LCU A;  3FYC A;  2DAI A;  1XC8 A;  4LF9 M;  2C9C A;  2DVW B;  1C1K A;  2OPF A;  4AKH A;  2XH9 A;  2B3T A;  5JI3 E;  2HHH M;  1R6B X;  2JA2 A;  5KQD A;  1XNR M;  1LTM A;  1L8Q A;  1PGY A;  2A5Y B;  2L09 A;  3K2L A;  4FD2 A;  4DV5 M;  5BR8 M;  2R44 A;  3HX3 A;  1Z5C A;  1TR8 A;  2FFJ A;  2R62 A;  3D8B A;  1OTR A;  1QVR A;  5DFL A;  4NSR A;  3SAT A;  4AI6 A;  4YHH M;  5EP3 A;  4I81 A;  5FTM A;  3U6M A;  3TPZ A;  2Z4S A;  1S3S A;  5C18 A;  2LH0 A;  1G71 A;  4WP2 A;  1SXJ A;  2HAK A;  2EKK A;  3I01 M;  3RE8 A;  3ZCB B;  3J81 S;  3MJ5 A;  5ITX A;  3U5Z B;  1ZV1 A;  4MGK E;  4PCZ A;  3GLG B;  1JR3 A;  1XXH B;  4B3M M;  4A3V B;  4NXN M;  2XZU A;  4OU7 A;  4TUW A;  3KSJ A;  2DZL A;  4JI0 M;  4YY3 M;  3GLF B;  2FOI C;  3SAU A;  1L2C A;  4LF6 M;  2Z8Y M;  2FH0 A;  2R4J A;  4X66 M;  4L6V 6;  1LV7 A;  1TH2 A;  2JP7 A;  4BLC A;  5FTK A;  2KZS A;  4HLQ A;  1DGF A;  5KPZ A;  3THG A;  1G59 A;  1OIP A;  2DAG A;  1DV0 A;  3A98 B;  1XB2 B;  3B89 A;  4IBD A;  2MJ5 B;  2DWN A;  2H1R A;  3T1Y M;  3R8F A;  2GQF A;  3GPP A;  2CFO A;  1CUK A;  3K92 A;  5FTL A;  4LG2 A;  1MX0 A;  3KP1 E;  2RKO A;  3HJ8 A;  4DR3 M;  3I51 A;  4ZPX A;  5A2Q S;  3LCV B;  3BBZ A;  1DGB A;  2LHC A;  1TDH A;  4GH9 A;  4LY6 A;  2JZ0 A;  5EXT A;  3K8Z A;  5FLX S;  1NHW C;  4L78 A;  4DR5 M;  1WIV A;  3U60 B;  3KW6 A;  4RKU F;  1XHB A;  4D80 A;  5LMN M;  4FVM A;  1ORY B;  4EIW A;  4Q7J A;  4B3T M;  4B3R M;  4LRT A;  2G8L A;  3WHL A;  1ZQ9 A;  1FJG M;  4B7G A;  2VF7 A;  2KZU A;  2ZAN A;  3GLG E;  5EP2 A;  1XXH E;  1GLN A;  2KNZ A;  4NOO B;  1I4W A;  3VKG A;  2F5N A;  4NRV A;  3IEC A;  2VQE M;  1Q3C A;  5EXS A;  4JV5 M;  2F5O A;  2C96 A;  4KOD A;  1NO1 A;  3GLI E;  1N34 M;  1KSF X;  4DV3 M;  1WXQ A;  1T43 A;  4L8R C;  3M7G A;  3I4V A;  3FUU A;  1IY1 A;  2APL A;  3EIH A;  4GHL A;  2LVO C;  2R18 A;  4PD2 A;  4G6Z A;  1IQP A;  1N75 A;  2JY7 A;  3GPU A;  4Z8X A;  2XSZ D;  3RGP A;  1HT2 E;  1YE9 A;  4IBJ A;  4P17 A;  3SAR A;  2OOA A;  4IJE A;  2JY5 A;  3W0L B;  4OW0 A;  4KLN A;  2LVN C;  1XMQ M;  1IM2 A;  2CE7 A;  4JI4 M;  2W82 A;  2KEB A;  3FUV A;  1OQY A;  3HU1 A;  4DUZ M;  3HKP A;  4X62 M;  2EJS A;  3U5Z A;  1D0L A;  1QUS A;  2F5P A;  1W5T A;  3GLG A;  3IG8 A;  4AG6 A;  1XXH A;  3L28 A;  4I5S A;  2ZAO A;  2LVQ D;  2DHY A;  4JXJ A;  2LVP C;  2MH8 A;  2QZ4 A;  2CRU A;  1VDL A;  2KA6 B;  5IRE B;  2Y20 A;  3B7Q A;  4GC5 A;  3GLF A;  3TWK A;  2JZ1 A;  2EUC A;  4REZ A;  4QHS A;  1YSY A;  3CGW A;  3ZQJ A;  4AZF A;  1C7Y A;  3IG5 A;  2CP8 A;  4PDG A;  2YR0 A;  3GRR A;  3T1H M;  3KDS E;  2RGO A;  2DXI A;  1D2N A;  1T6O A;  1NY6 A;  1VEJ A;  3GQ4 A;  1J7K A;  3AOE A;  1VEK A;  4LF7 M;  2Y21 A;  4B3S M;  2WSF F;  4JN6 A;  1HNX M;  4NRW A;  4M9S A;  3GLH E;  3U6S A;  1N36 M;  4FWH A;  2BWE A;  3QYB A;  4I8O A;  3M0E A;  2KXE A;  1AUA A;  7CAT A;  5IT9 S;  2D7E A;  3HZJ A;  2QEN A;  2ZTD A;  3U60 A;  1XWI A;  4D82 A;  2M60 A;  1PJI A;  3KOW E;  3SAV A;  3GRU A;  2QP9 X;  2R0I A;  4LZJ A;  5KPT A;  2CEA A;  4ANR A;  4G4N A;  1HNZ M;  4RNA A;  3NBX X;  2I7P A;  2C9O A;  1H6U A;  1IN4 A;  4LJ4 A;  4OVZ B;  5DYI A;  3Q8G A;  4DR6 M;  4FCV A;  3VFD A;  2CV1 A;  2JNH A;  3CF6 E;  1NHG C;  2ZM6 M;  1N33 M;  4RF1 A;  1R5L A;  4DV2 M;  3QAU A;  4GIP A;  3H4J A;  5E26 A;  1Z5A A;  3K9O A;  3J7A S;  3U6D A;  2X49 A;  3DZD A;  1D0K A;  3HU2 A;  2Z7J A;  2F5Q A;  2KRK A;  1KFV A;  1PJS A;  4GIT A;  3WHK A;  3V76 A;  1GVN A;  3C3E A;  3HU3 A;  4JI7 M;  1YLA A;  1WHC A;  1V92 A;  5LMU M;  2YQZ A;  5EP1 A;  3FE3 A;  2R6F A;  3B7N A;  3KSX A;  4LGY A;  1J5E M;  3FTF A;  4L4U A;  3CF0 A;  3U61 B;  3HWS A;  2BNK A;  2DAE A;  1MJG M;  2V1C A;  3UK6 A;  2DAM A;  4RF0 A;  4HEO A;  4PDI A;  3L29 A;  5KO3 A;  3B74 A;  2XLJ A;  1HQC A;  2DAK A;  2RRU A;  2XEP A;  3KOZ E;  4QHT A;  3A46 A;  2L2D A;  4CJ6 A;  1NJG A;  1Q02 A;  3GLI B;  4GKJ M;  3U6L A;  4JI2 M;  1EE8 A;  1DO2 A;  3VK7 A;  3AOE C;  1Q3B A;  5ITQ A;  1G3I A;  1ZMU A;  4R3D A;  4XK8 F;  1PJT A;  1JB0 F;  4MGI E;  3KS4 A;  3LQQ A;  2R45 A;  2VQF M;  4X65 M;  1NNJ A;  2NQ8 C;  2DKL A;  3BXW A;  4DV7 M;  2MGW A;  1N77 A;  1OKS A;  3T6P A;  4F1I A;  1NV8 A;  2QBY B;  1AIP C;  2L7H A;  4M9Z A;  2QCU A;  4M0W A;  2OO9 A;  3PXG A;  5IWA M;  1QAM A;  4DV4 M;  3T15 A;  4KO8 A;  5DYG A;  1JR3 D;  4AG5 A;  3E4R A;  2MRO B;  4MM3 B;  4XBO A;  5EXP A;  3SYL A;  1IXZ A;  1T3T A;  1IXR C;  3RFW A;  4JI1 M;  1WGL A;  1DO0 A;  1GL7 A;  4UN2 B;  3HJS A;  3HHZ A;  2L4F A;  1IY2 A;  3IHP A;  4LCB A;  5EP4 A;  5KQ8 A;  1QQW A;  4DR4 M;  5IZ7 D;  4LJ6 A;  3SHG B;  3W68 A;  1L2B A;  1NY5 A;  3MMP A;  2CV2 A;  4LF4 M;  4OVZ A;  4GKK M;  4L16 A;  4M0D A;  2J7N A;  1IN8 A;  2C99 A;  1DGH B;  2N35 A;  3CF2 A;  4LFA M;  5DNY A;  1NSF A;  1SXJ C;  3GLH B;  1K82 A;  5EXX A;  3FTD A;  2L6O A;  3FYD A;  3KP0 E;  2UUB M;  4IBG A;  4MGH A;  3GRV A;  2I7N A;  3A45 A;  3HJQ A;  2XZF A;  3KOY E;  2VII A;  2CHV A;  2OOB A;  2LXE A; 
#chains in the Genus database with same CATH homology
 4NSO B;  5KPR A;  3PNY A;  2AHM A;  4LZZ A;  4GC9 A;  3L2A A;  2F5S A;  4WUR A;  2CV0 A;  3U61 A;  3PVS A;  4LJA A;  4CGY B;  1QAQ A;  4DR1 M;  4LF8 M;  5ITY A;  4LRS A;  3GLI A;  3QWL A;  5GKN A;  1DGG A;  3UMM A;  4LJ7 A;  2ZBK B;  4GHA A;  4ITQ A;  3SMP A;  1NNU C;  2K47 A;  2Q2E B;  3SMS A;  4IBB A;  3AOG A;  1XMO M;  2BJW A;  2V6Z M;  1R2Z A;  4IIW A;  3GQ5 A;  2HL7 A;  1HR0 M;  1UM8 A;  4MGY E;  4P16 A;  3FUT A;  2QBY A;  3UGJ A;  2UXD M;  2YNM D;  4AQY M;  3JAM S;  2DWL A;  1OJL A;  3FD9 A;  2Z3X A;  3A42 A;  3L26 A;  2X4A A;  1IBL M;  3L27 A;  2FE8 A;  4DV1 M;  1E9S A;  3VDP A;  3KFU G;  4QNM A;  3K1J A;  4DR2 M;  1NVM A;  1HNW M;  4AKG A;  4WW0 A;  1TH4 A;  2Y0T A;  4JI5 M;  4K0K M;  4G4Q A;  2CHQ A;  1VDD A;  1TH3 A;  2F4V M;  4DV0 M;  2ZAM A;  4CIS A;  3SYK A;  4I4L A;  4JI6 M;  1OFI A;  3GRY A;  1SXJ E;  2HCB A;  1K3W A;  4FW9 A;  3FTC A;  4R7G A;  3HHW A;  1DGH A;  1JQJ C;  3R9X B;  3J27 B;  3KOX E;  3GLH A;  4MH0 E;  4QNR A;  3W0F A;  1IXS B;  1E94 E;  4FWD A;  1L2D A;  4IBI A;  3FKE A;  3SC3 A;  5H37 D;  1Q39 A;  2ERC A;  4QOZ C;  2DWM A;  2XGN A;  2LWX A;  4HL4 A;  4IBF A;  1GKI A;  3JR4 A;  3SBJ A;  3PNV A;  3KS8 A;  5E6J A;  1IBM M;  5FTJ A;  2O5R A;  1QZM A;  5C1B A;  3FUW A;  4LJ9 A;  1QAO A;  1N78 A;  4GMQ A;  1OFH A;  3FUX A;  2L7I A;  3AJI B;  2UXC M;  4AW4 A;  1E9R A;  5BPV A;  2FNA A;  3AFH A;  3U6O A;  3TQS A;  2OQ4 A;  4DUY M;  3BOS A;  1SXJ D;  1MU5 A;  4BBA A;  3GO8 A;  3DFZ A;  3M6A A;  1XNQ M;  3GPX A;  2C5R A;  3T38 A;  2Y0Q A;  3TWL A;  1L1T A;  3H4M A;  2UUA M;  3SFZ A;  4W5W A;  1HQY E;  3U6E A;  2UXB M;  2DWZ B;  3KVW A;  4BB9 A;  1R2Y A;  1TDZ A;  2J7O A;  3LQR A;  4LFC M;  3NWL A;  4X64 M;  3DOA A;  3EIE A;  3RGS A;  3VKH A;  2KRU A;  1HT1 E;  4II7 A;  3E9S A;  4DV6 M;  8CAT A;  2XSZ A;  2CUZ A;  4NXM M;  3C58 A;  4JYA M;  1N32 M;  2YFQ A;  3HGI A;  4PT5 A;  3NBI A;  3AL0 C;  4LGM A;  4S12 A;  2KW0 A;  2UU9 M;  1I94 M;  3J7B A;  4LJ5 A;  2R4E A;  3Q8X A;  4LF5 M;  1G41 A;  3D8L A;  4LJ8 A;  1YUB A;  1W5S A;  3SAW A;  2EA0 A;  4AKI A;  2DHR A;  4IBK A;  1Z59 A;  3B9P A;  3J2P B;  3GPY A;  3J80 S;  4B7H A;  1G8P A;  1FNN A;  4JI3 M;  2RGH A;  4LFB M;  4CHT B;  4DR7 M;  4Z6Y A;  3U6P A;  4G4O A;  1IN7 A;  4MB7 A;  3TWM A;  3FTE A;  4B08 A;  3LVW A;  5EQT A;  3HHX A;  3VK8 A;  2QPA A;  5F3W A;  2M5Z A;  3AV0 A;  2V1U A;  1QYR A;  4IJF A;  3ILK A;  1SXJ B;  3MHV C;  4KHP M;  1Z5B A;  5ITT A;  1KYI A;  1Z6T A;  2R46 A;  1IN6 A;  2XFT A;  2XF3 A;  1R7R A;  3UJN A;  2X8A A;  4MGZ E;  3SAS A;  4FCT A;  3LVV A;  3ZH9 B;  1PJJ A;  3MK6 A;  1QAN A;  4XGI A;  4FWG A;  5ITU A;  2EO2 A;  3VLF B;  4IBC A;  3SHF A;  5FTN A;  3VDU A;  4FCW A;  3HHY A;  3JR5 A;  2E5L M;  5JI2 E;  3GP1 A;  3L25 A;  1GL6 A;  2Z4R A;  4OX9 M;  4JI8 M;  3DA1 A;  5FSW A;  3KXE C;  3I4Y A;  3LMM A;  3GQ3 A;  2UUC M;  2DZO B;  1X37 A;  4QOS A;  3PFI A;  3TE6 A;  5ITR A;  5EJC A;  2D7H A;  2CHG A;  1IBK M;  2BJV A;  1L1Z A;  4G4R A;  2HKJ A;  2G5G X;  1PM5 A;  2LNH C;  3UZU A;  3U6C A;  3CTW B;  3OTO M;  2DZN B;  1E32 A;  1IN5 A;  1NJF A;  1J09 A;  4IBE A;  3TL4 X;  4M9X A;  3ZC7 B;  4B7F A;  1K3X A;  3AKZ A;  1TGU A;  1IY0 A;  2C98 A;  2R65 A;  2XFS A;  4GRI A;  4NL4 H;  5ITX E;  1ZAE A;  4D81 A;  2P5T A;  2D7G A;  4L15 A;  3U6Q A;  1G4A E;  3FYC A;  1XC8 A;  4LF9 M;  2C9C A;  2DVW B;  1C1K A;  2OPF A;  4AKH A;  2XH9 A;  5JI3 E;  2HHH M;  1R6B X;  2JA2 A;  5KQD A;  1XNR M;  1L8Q A;  4FD2 A;  2A5Y B;  3K2L A;  2L09 A;  4DV5 M;  5BR8 M;  1Z5C A;  3D8B A;  2FFJ A;  2R62 A;  1QVR A;  4NSR A;  3SAT A;  4AI6 A;  4YHH M;  5EP3 A;  4I81 A;  5FTM A;  3U6M A;  3TPZ A;  2Z4S A;  1S3S A;  5C18 A;  2LH0 A;  3ZCB B;  1SXJ A;  3J81 S;  3RE8 A;  3MJ5 A;  5ITX A;  3U5Z B;  4MGK E;  4PCZ A;  3GLG B;  1JR3 A;  1XXH B;  4B3M M;  4A3V B;  4NXN M;  2XZU A;  4OU7 A;  4TUW A;  3KSJ A;  4JI0 M;  4YY3 M;  3GLF B;  1L2C A;  2FOI C;  3SAU A;  4LF6 M;  2R4J A;  4X66 M;  1LV7 A;  1TH2 A;  4BLC A;  5FTK A;  2KZS A;  4HLQ A;  1DGF A;  5KPZ A;  3THG A;  1G59 A;  3A98 B;  4IBD A;  2DWN A;  2H1R A;  3T1Y M;  3R8F A;  3GPP A;  2CFO A;  3K92 A;  5FTL A;  4LG2 A;  1MX0 A;  3KP1 E;  2RKO A;  3HJ8 A;  4DR3 M;  3I51 A;  4ZPX A;  5A2Q S;  1DGB A;  1TDH A;  4GH9 A;  4LY6 A;  5EXT A;  5FLX S;  3K8Z A;  4DR5 M;  1NHW C;  4L78 A;  3U60 B;  3KW6 A;  4D80 A;  1XHB A;  5LMN M;  4FVM A;  1ORY B;  4EIW A;  4B3T M;  4B3R M;  4LRT A;  2G8L A;  3WHL A;  1ZQ9 A;  1FJG M;  4B7G A;  2KZU A;  2ZAN A;  5EP2 A;  1GLN A;  4NOO B;  1I4W A;  3VKG A;  2F5N A;  4NRV A;  2VQE M;  1Q3C A;  5EXS A;  4JV5 M;  2F5O A;  2C96 A;  4KOD A;  1N34 M;  1KSF X;  4DV3 M;  1WXQ A;  4L8R C;  3M7G A;  3I4V A;  3FUU A;  1IY1 A;  3EIH A;  4GHL A;  2R18 A;  4PD2 A;  4G6Z A;  1IQP A;  1N75 A;  3GPU A;  4Z8X A;  2XSZ D;  3RGP A;  1HT2 E;  1YE9 A;  4IBJ A;  3SAR A;  4IJE A;  3W0L B;  4OW0 A;  4KLN A;  1XMQ M;  1IM2 A;  2CE7 A;  4JI4 M;  2W82 A;  2KEB A;  3FUV A;  3HU1 A;  4DUZ M;  3HKP A;  4X62 M;  3U5Z A;  2F5P A;  1W5T A;  3GLG A;  3IG8 A;  4AG6 A;  1XXH A;  3L28 A;  4I5S A;  2ZAO A;  4JXJ A;  2QZ4 A;  5IRE B;  2KA6 B;  2Y20 A;  4GC5 A;  3GLF A;  3TWK A;  2EUC A;  4REZ A;  4QHS A;  1YSY A;  4AZF A;  3IG5 A;  4PDG A;  2YR0 A;  3GRR A;  3T1H M;  3KDS E;  2RGO A;  2DXI A;  1D2N A;  1NY6 A;  3GQ4 A;  4LF7 M;  1J7K A;  3AOE A;  2Y21 A;  4B3S M;  4JN6 A;  1HNX M;  4NRW A;  4M9S A;  3U6S A;  1N36 M;  4FWH A;  4I8O A;  3M0E A;  2KXE A;  7CAT A;  5IT9 S;  2D7E A;  2QEN A;  3U60 A;  1XWI A;  4D82 A;  2M60 A;  1PJI A;  3KOW E;  3SAV A;  3GRU A;  2QP9 X;  5KPT A;  4LZJ A;  4G4N A;  2CEA A;  1HNZ M;  4RNA A;  2I7P A;  2C9O A;  1H6U A;  1IN4 A;  4LJ4 A;  4OVZ B;  5DYI A;  4DR6 M;  4FCV A;  3VFD A;  2CV1 A;  3CF6 E;  1NHG C;  2ZM6 M;  1N33 M;  4RF1 A;  4DV2 M;  3QAU A;  4GIP A;  5E26 A;  1Z5A A;  3J7A S;  3U6D A;  2X49 A;  3DZD A;  3HU2 A;  2F5Q A;  2Z7J A;  2KRK A;  1KFV A;  3WHK A;  4GIT A;  1GVN A;  3HU3 A;  4JI7 M;  5LMU M;  2YQZ A;  5EP1 A;  3KSX A;  4LGY A;  1J5E M;  3FTF A;  4L4U A;  3CF0 A;  3U61 B;  3HWS A;  2BNK A;  2V1C A;  3UK6 A;  4RF0 A;  4PDI A;  3L29 A;  5KO3 A;  2XLJ A;  1HQC A;  2XEP A;  3KOZ E;  4QHT A;  3A46 A;  1NJG A;  3GLI B;  4GKJ M;  3U6L A;  4JI2 M;  1EE8 A;  1DO2 A;  3VK7 A;  3AOE C;  1Q3B A;  5ITQ A;  1G3I A;  4R3D A;  4MGI E;  3KS4 A;  3LQQ A;  2R45 A;  2VQF M;  4X65 M;  1NNJ A;  2NQ8 C;  4DV7 M;  1N77 A;  2QBY B;  2L7H A;  4M9Z A;  2QCU A;  4M0W A;  5IWA M;  3PXG A;  1QAM A;  4DV4 M;  3T15 A;  4KO8 A;  5DYG A;  1JR3 D;  4AG5 A;  3E4R A;  4MM3 B;  4XBO A;  5EXP A;  3SYL A;  1IXZ A;  1T3T A;  1IXR C;  3RFW A;  4JI1 M;  1DO0 A;  1GL7 A;  3HJS A;  3HHZ A;  1IY2 A;  4LCB A;  5EP4 A;  5KQ8 A;  1QQW A;  4DR4 M;  5IZ7 D;  4LJ6 A;  3SHG B;  1L2B A;  2CV2 A;  1NY5 A;  4LF4 M;  4OVZ A;  4GKK M;  4L16 A;  4M0D A;  2J7N A;  1IN8 A;  2C99 A;  1DGH B;  3CF2 A;  4LFA M;  5DNY A;  1NSF A;  1SXJ C;  3GLH B;  1K82 A;  5EXX A;  3FTD A;  2L6O A;  3FYD A;  3KP0 E;  2UUB M;  4IBG A;  4MGH A;  3GRV A;  2I7N A;  3A45 A;  3HJQ A;  2XZF A;  3KOY E;  2VII A;  2CHV A;  2LXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...