3A45A

Crystal structure of mvnei1_2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Formamidopyrimidine-DNA glycosylase
publication title Structural Characterization of a Viral NEIL1 Ortholog Unliganded and Bound to Abasic Site-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 81
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3a45A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3a45A01
1N36M 4JI0M 4JI4M 4JI8M 1L2DA 4DV2M 2HHHM 4B3SM 2XZFA 5ITXE 1NNJA 1L2CA 2F4VM 3U6PA 3VK7A 1K3XA 4JYAM 1L2BA 4DR7M 3U6LA 2UXCM 3A42A 4NXNM 3JR4A 4DV0M 4K0KM 2UUCM 4JI5M 2ZBKB 3GQ5A 4MB7A 5LMNM 5ITYA 4DUZM 4DR4M 3TWMA 3GPXA 2F5OA 1J5EM 4DV5M 1KFVA 3VK8A 4JI6M 1N32M 5ITXA 3GQ4A 2UUBM 1R2ZA 1MX0A 4AQYM 4GKJM 3TWLA 4LFAM 1FJGM 4NXMM 3DOAA 3A46A 1Q3BA 1L1ZA 3GO8A 1Z59A 2EA0A 3U6OA 3SAUA 1TDZA 4ITQA 3T1HM 3T1YM 4DV4M 1HNZM 1TDHA 4B3MM 2VQEM 1K3WA 3GQ3A 1IBLM 4DR3M 4G4NA 2F5NA 3GPYA 1IBKM 5ITQA 5ITUA 3U6QA 1Q3CA 2XZUA 1EE8A 3U6DA 5ITRA 5BR8M 4DR1M 2VQFM 4OX9M 4LF7M 2UUAM 4G4RA 1XMQM 4B3RM 2OQ4A 4G4QA 3U6CA 4LF6M 4PDIA 4JV5M 4GKKM 3GP1A 3JAMS 3SATA 1R2YA 1HR0M 4LF8M 4DR2M 4LFCM 4LFBM 4PCZA 4JI2M 4CISA 2E5LM 2F5QA 4B3TM 3SARA 4X66M 1Q39A 3J81S 4JI7M 2HKJA 3U6EA 1Z5BA 3A45A 4NRWA 3U6MA 3JR5A 3SAVA 2ZM6M 3GPUA 1HNWM 1MU5A 3W0FA 3SAWA 4DV7M 4KHPM 4X62M 4LF5M 1L1TA 5IT9S 4G4OA 4PD2A 4PDGA 1XNQM 3TWKA 1N34M 1N33M 3J7AS 4DV6M 4LF9M 5IWAM 4DV3M 1XMOM 4LF4M 5ITTA 2OPFA 4YY3M 5FLXS 3U6SA 2F5PA 5A2QS 1XNRM 4DR5M 3SBJA 2Q2EB 1HNXM 1K82A 4DR6M 2UXBM 1XC8A 3OTOM 3SASA 4YHHM 2UU9M 2F5SA 1IBMM 3J80S 3C58A 1Z5AA 1Z5CA 1PJIA 4DUYM 4NRVA 4DV1M 4JI1M 5LMUM 3GPPA 4JI3M 4X65M 1I94M 4X64M 1PM5A 1PJJA 2UXDM
chains in the Genus database with same CATH superfamily
2DAEA 5FSWA 3AOEA 4B3SM 3LW5F 2VF8A 1A5TA 3KXEC 1XXHA 3K2LA 1L2CA 1WJ7A 1OAOC 2ZAOA 4GITA 2FE8A 2QP9X 3HZJA 2DWLA 1SXJE 3QYBA 2DAMA 3CF0A 4ANRA 4OU7A 1SG9A 1IXSA 2C9OA 1TH4A 4JN6A 1XXHB 3C9PA 3KOXE 4MB7A 4AG5A 2CHQA 3UK6A 5LMNM 5ITYA 1QDTA 2X49A 3HKPA 3KSXA 4NL4H 1IXSB 3PXGA 1GVNA 1J5EM 4MGHA 2XF3A 3VK8A 5IREB 2K47A 5ITXA 2C5RA 2DI0A 4IBGA 4LCBA 2R62A 4AQYM 1FJGM 1E94E 1TGUA 2ERCA 2DENA 2XSZD 3J27B 5EXPA 3KS4A 1EFUB 2RRUA 1Q3BA 1WGLA 3M7GA 3KW6A 1L1ZA 1PJQA 4MGYE 3KSJA 3ZCBB 3SHGB 4ITQA 1FNNA 2APLA 1JB0F 5KQDA 4LJ5A 4IIWA 1HNZM 2CE7A 1J7KA 1HT2E 2ZTDA 3K92A 4B3MM 5C18A 3HHYA 3ZH9B 1IM2A 1NNUC 4LJ7A 3GPYA 3U5ZA 1IBKM 3M6AA 1WHCA 1PJTA 2M60A 4LZZA 1GLNA 1XWIA 4BBAA 1AIPC 5BR8M 3U6DA 2YR0A 4IBIA 5L8RF 2AHMA 1QAOA 4GHLA 2Y0TA 4XBOA 3WHKA 2OQ4A 4G4QA 2M5ZA 3U6CA 3GRYA 3F92A 1ZMUA 1TR8A 2VDBB 2ZAMA 3AFHA 2C96A 3ILKA 3LQQA 4JXJA 3HHZA 1QANA 4L78A 2CUZA 4BLCA 4JV5M 3JAMS 4LZJA 3SATA 1R2YA 4LF8M 4QHTA 4D80A 2XFSA 3NBXX 4IBJA 2H1RA 5JI3E 4DR2M 2RKOA 3U60A 3IG8A 2L6OA 2JXNA 1MN3A 1X37A 1ORYB 2FNAA 2HKJA 2LXEA 3U6EA 2WZJA 3A45A 3J2PB 3U60B 1IN8A 2BWBA 2DAIA 3U6MA 3U61A 4OVZB 3FYCA 3JR5A 2KDLA 4OW0A 3GLGA 2ZM6M 1C1KA 4I8OA 3SAVA 1IN6A 1MU5A 3LVWA 4B7FA 3SAWA 4DV7M 2G8LA 4LF5M 4KHPM 4GMQA 3T6PA 3GLIB 5IT9S 2XLJA 3U61B 1WGNA 3GLIE 4Z8XA 1N75A 2KZUA 5KPZA 1ZQ9A 4Z6YA 2DHYA 3GLGB 1NVMA 1N33M 1NY6A 3FTFA 4DV6M 3BOSA 1QVRA 3PNYA 3GLGE 4LF9M 2O01F 4CJ6A 3VDPA 4MGZE 2BJVA 1XMOM 1IY2A 5ITTA 1D2NA 2ZANA 3WHLA 2QPAA 4LF4M 2G5GX 5DYIA 4YY3M 1XNRM 4DR5M 3SBJA 2Q2EB 1HNXM 2MJ5B 2JY5A 1VDLA 4G6ZA 3SASA 1UFZA 3BBZA 1MJGM 3AOGA 2BNKA 3ZQJA 4F1IA 2D7EA 1Z5AA 2Y0QA 5C1BA 1Z5CA 1NSFA 3FTDA 4DUYM 2V1UA 2CHVA 1GJSA 3VLFB 4DV1M 2DVWB 3E46A 4JI1M 4QNMA 5LMUM 2KXEA 5EP1A 2XGNA 2X8AA 2O25A 5DFLA 4X65M 2LH0A 3A98B 1I94M 4X64M 2QENA 2K0BX 1S3SA 2UXDM 1VEKA 4JI8M 1L2DA 2CV2A 2YFQA 4MGKE 3RFWA 2YNMD 2JY8A 4NSOB 4FW9A 4GC5A 2LVOC 4LRTA 3U6PA 2QBYB 4RKUF 2HAKA 2I7NA 2MGWA 3LMMA 3VKGA 2UXCM 1GO5A 3KDSE 4RF1A 4DV0M 1L8QA 3W68A 1ZV1A 3PVSA 2ZBKB 4R7GA 4XK8F 1HQYE 3BXWA 1HT1E 4DUZM 2MROB 3DZDA 3GPXA 3TWMA 1F4IA 3E4RA 1KFVA 3TE6A 2QNJA 4LJ6A 4F2LA 2EUCA 3UJNA 1N32M 3GQ4A 1T6OA 2JNHA 4PT5A 1MX0A 4REZA 4GKJM 1SXJA 4NXMM 1OAIA 1QDRA 3MJ5A 4MH0E 3AKZA 1J09A 2EA0A 3U6OA 2R45A 4B08A 3FTEA 2LHGA 1N78A 2CRUA 3HJSA 3LQRA 1SXJB 4DV4M 1W5SA 4XGIA 2DWZB 5FTMA 4HL4A 3GQ3A 2VQEM 1IBLM 4DR3M 4G4NA 4QNRA 4FWDA 5ITQA 1IXRC 4GHAA 1JR3D 3B7ZA 2LNHC 3AOEC 4II7A 5ITRA 1PJSA 4DBGB 3SYLA 3SMSA 2JA2A 4B3RM 4LF6M 3HJ8A 1DO0A 3HGIA 2L09A 3AJIB 3VKHA 4IBCA 4GRIA 4EIWA 3GP1A 1YSYA 4M0DA 1HR0M 4LFCM 1QAQA 4IBDA 1VG5A 2JY7A 2LBCA 4L6V6 2E5LM 4CISA 1I4WA 1HJPA 4B3TM 3SARA 2FOIC 3J81S 4AI6A 4B7GA 3T38A 2FH0A 2KNVA 3HHWA 1QAMA 3KP0E 4JI7M 1T3TA 1Z5BA 2DNAA 3H4JA 1QYRA 1YUBA 2DZLA 1XHBA 3FYDA 3RGPA 2LVQD 4NC6A 1ZMWA 5EP2A 4MGIE 3EIHA 2R4EA 4GC9A 1L1TA 1QZEA 2R44A 2LVPC 4IBEA 2C98A 2O5RA 4G4OA 3L25A 4PDGA 2Z4SA 3TWKA 2Z4RA 3E9SA 3K1JA 2EO2A 3FRIA 5IWAM 2DWMA 3L26A 4TUWA 3HU1A 1TTEA 2LVAA 2C99A 3L28A 4I4LA 5FLXS 1VEGA 2F5PA 5FTLA 5EQTA 3FUUA 1G4AE 1K82A 2UXBM 2JZ0A 1PGYA 2XH9A 4OVZA 3IECA 4L4UA 4LJ9A 2F5SA 1IBMM 2JWSA 3FUXA 3J80S 3L2AA 3GLIA 1IFYA 2OOBA 3LCUA 2EJSA 4KODA 4AKIA 5DNYA 1V34A 3GLHE 4Y28F 1IXZA 2RGHA 5F3WA 1IY0A 2X4AA 3GPPA 4KLNA 1IY1A 1P3QQ 2VF7A 1OIPA 5EJCA 3HHXA 2EKKA 2R4JA 2R65A 4BB9A 1N36M 4JI4M 4DV2M 1V92A 3PFIA 4FD2A 3ZC7B 2HHHM 1D0KA 3TL4X 2XZFA 3FRHA 4KO8A 3SYKA 5EXTA 1GL7A 2EKFA 2K6BA 2DAKA 4L8RC 3THGA 1WR1B 4CIZA 3RE8A 3VK7A 3Q8XA 1K3XA 2DWNA 4AKGA 3QWLA 3A42A 1OQYA 3JR4A 3V76A 4K0KM 1XB2B 2DXIA 4JI5M 4FWHA 2KHHA 3HX3A 2ZTCA 3GQ5A 1TH2A 2N35A 3MMPA 2F5OA 3VFDA 4WURA 2BJWA 3L27A 3I51A 1WIVA 4JI6M 1EIJA 3I04M 5FTNA 4HEOA 4AG6A 3MHVC 4W5WA 2UUBM 3KP1E 3TWLA 2QBYA 5KPTA 2L4EA 4QOSA 2OOAA 1G59A 3FE3A 5IZ7D 1HQCA 3A46A 3GO8A 2WSEF 3K9PA 4ZPXA 3SAUA 2Z3XA 1TDZA 4M9SA 3T1YM 1QQWA 1TDHA 1JR3E 3FD9A 3I4YA 4GH9A 4MM3B 2XSZA 3IG5A 1K3WA 1E9SA 4M9XA 5E26A 2F5NA 1D0MA 1DGGA 5ITUA 4FCWA 4IBKA 3FUWA 3U6QA 1VQ1A 4FWGA 1Q3CA 1R7RA 3B74A 2XZUA 1EE8A 2XEPA 3UZUA 4DR1M 1QZMA 2BWEA 1NO1A 1TH3A 3GRUA 4B7HA 4LY6A 1R4GA 5KQ8A 2VQFM 4G4RA 3E21A 3KOZE 2UUAM 4FCVA 4LF7M 2JY6B 1IN5A 4RNAA 4PDIA 4GIPA 4GEWA 5EP4A 2DHRA 2CWBA 1DV0A 2KRKA 3I4VA 3HWSA 3D8BA 1T43A 2LTUA 1NHGC 1OKSA 3NWLA 2HWJA 3W0LB 2HL7A 3M0EA 2L2DA 1LTMA 3QYEA 1E9RA 1QUSA 3DFZA 4CGYB 2V1CA 3L29A 2CV1A 4NRWA 2Z7JA 3UMMA 2R6FA 4L15A 3IHPA 1SXJC 4LJ8A 5EP3A 5H37D 4LJ4A 3TPZA 1NV8A 1UM8A 3K8ZA 7CATA 4X62M 3KOWE 3B9PA 4IBBA 4FCTA 4KT0F 2DZOB 1G41A 3FUVA 3KVWA 1OFIA 3J7AS 3GLFB 4P16A 4DV3M 2L7IA 3PNVA 3Q8GA 1JQJC 3GLFE 3SMPA 3FTCA 2OPFA 8CATA 1G3IA 2W82A 3HU2A 5JI2E 1XC8A 3CGWA 1LV7A 2L7HA 4YHHM 2UU9M 3VDUA 2J7NA 1GL6A 3W67A 1XXHE 4CHTB 4Q7JA 3KFUG 4A3VB 1G71A 4NRVA 3HJQA 1E32A 2KNAA 1OJLA 2FS1A 2CV0A 1R5LA 4R3DA 2L4FA 5BPVA 2HCBA 2CEAA 2KW0A 2D7GA 3C3EA 3NBIA 2LVNC 1AUAA 1Q02A 3C3DA 1PJJA 1OFHA 4JI0M 4WP2A 1NHWC 2JP7A 1KYIA 2JUJA 5ITXE 1NNJA 4LG2A 2F4VM 4IJEA 5EXSA 3TQSA 1IN4A 1TF0B 2R18A 3CF6E 4JYAM 1ZMVA 4AW4A 2WSFF 1ZAEA 1L2BA 3SHFA 3CTWB 4QHSA 3U6LA 4DR7M 3GLHA 2R0IA 4NXNM 1DGBA 1DGHA 4R71A 3I01M 1C7YA 2CHGA 2V6ZM 1SXJD 2UUCM 2D7HA 2KZSA 1W5TA 2JZ1A 4DR4M 3QAUA 3GLHB 2GNOA 5KPRA 1DGHB 4DV5M 1CUKA 1OTRA 2C9CA 2QZ4A 1R2ZA 2QHOB 1IN7A 4D81A 4LFAM 4IBFA 3DOAA 2WSCF 1Z59A 2KEBA 3KOYE 1DO2A 2LWXA 1H6UA 1YLAA 3H4MA 4UN2B 3HU3A 5DYGA 3T1HM 4G3OA 5EXXA 3R9XB 3SC3A 2A5YB 1N77A 3T15A 4L16A 4NOOB 1IQPA 3B89A 4LJAA 1YE9A 2Y21A 2LHCA 2OO9A 2GQFA 4OX9M 1XMQM 2KRUA 3AL0C 1DGFA 2NQ8C 4LGMA 4GKKM 1NJFA 4M9ZA 3LCVB 1JR3A 3DA1A 2RGOA 2G3QA 4IJFA 2FFJA 4LFBM 4PCZA 4JI2M 2QCUA 2DAGA 1OIZA 3SFZA 2F5QA 1QUTA 2QQ8A 4P17A 4X66M 1Q39A 1R6BX 3FKEA 4WW0A 3RGSA 4AZFA 3KS8A 2I7PA 4HLQA 3LVVA 5FTKA 3R8FA 2XFTA 4NSRA 2MH8A 3EIEA 1Z6TA 2Y20A 2QSFX 3MK6A 3FUTA 1GKIA 5E6JA 3GPUA 1HNWM 2CFOA 3U5ZB 1GJTA 3W0FA 4I81A 2R46A 4QOZC 3GRVA 1V33A 3J7BA 3AV0A 4PD2A 1XNQM 1N34M 4LRSA 2VIIA 1RU3A 1KSFX 2MR9A 4M0WA 3GRRA 5KO3A 4FVMA 5GKNA 1WXQA 3U6SA 2J5YA 5A2QS 1BVSA 2DKLA 2H5XA 1D0LA 3UGJA 4DR6M 1Y8GA 2KA6B 3HY5A 1VEJA 3OTOM 2B3TA 1VDDA 4RF0A 3CF2A 2CP8A 2P5TA 2Z8YM 3C58A 3D8LA 4I5SA 2DZNB 1PJIA 5FTJA 1G8PA 2K9DA 2KNZA 4D82A 2J7OA 4AKHA 3GLFA 2YQZA 1NV9A 1NJGA 3B7NA 4S12A 1PRBA 4JI3M 1NY5A 1GABA 4LGYA 3B7QA 1PM5A 3K9OA
chains in the Genus database with same CATH topology
5FSWA 3AOEA 4B3SM 1L2CA 3KXEC 1XXHA 3K2LA 2ZAOA 4GITA 2FE8A 2QP9X 2DWLA 1SXJE 3CF0A 4OU7A 2C9OA 1TH4A 4JN6A 1XXHB 3KOXE 4MB7A 4AG5A 2CHQA 3UK6A 5LMNM 5ITYA 2X49A 3HKPA 3KSXA 4NL4H 1IXSB 3PXGA 1GVNA 1J5EM 4MGHA 2XF3A 3VK8A 5IREB 2K47A 5ITXA 2C5RA 4IBGA 4LCBA 2R62A 4AQYM 1FJGM 1E94E 1TGUA 2ERCA 2XSZD 3J27B 5EXPA 3KS4A 1Q3BA 1L1ZA 3M7GA 3KW6A 4MGYE 3KSJA 3ZCBB 3SHGB 4ITQA 1FNNA 5KQDA 4LJ5A 4IIWA 1HNZM 2CE7A 1J7KA 1HT2E 3K92A 4B3MM 5C18A 3HHYA 3ZH9B 1IM2A 1NNUC 4LJ7A 3GPYA 3U5ZA 1IBKM 3M6AA 2M60A 4LZZA 1GLNA 1XWIA 4BBAA 3U6DA 5BR8M 2YR0A 4IBIA 2AHMA 1QAOA 4GHLA 2Y0TA 4XBOA 3WHKA 2OQ4A 4G4QA 2M5ZA 3U6CA 3GRYA 4JXJA 3U5ZB 2ZAMA 3LQQA 3AFHA 2C96A 3ILKA 3HHZA 4JV5M 1QANA 4L78A 2CUZA 4BLCA 3JAMS 4LZJA 3SATA 1R2YA 4LF8M 4QHTA 4D80A 2XFSA 4IBJA 2H1RA 5JI3E 4DR2M 2RKOA 3U60A 3IG8A 2L6OA 1X37A 1ORYB 2FNAA 2HKJA 2LXEA 3U6EA 3A45A 3U60B 3J2PB 1IN8A 3U6MA 3U61A 4OVZB 3FYCA 3JR5A 4OW0A 2ZM6M 3GLGA 3SAVA 1C1KA 4I8OA 1IN6A 1MU5A 3LVWA 4B7FA 3SAWA 4DV7M 2G8LA 4LF5M 4KHPM 4GMQA 3GLIB 5IT9S 2XLJA 3U61B 4Z8XA 1N75A 2KZUA 5KPZA 1ZQ9A 4Z6YA 3GLGB 1N33M 1NVMA 1NY6A 3FTFA 4DV6M 3BOSA 1QVRA 3PNYA 4LF9M 3VDPA 4MGZE 2BJVA 1XMOM 1IY2A 5ITTA 1D2NA 2ZANA 3WHLA 2QPAA 4LF4M 2G5GX 5DYIA 4YY3M 1XNRM 4DR5M 3SBJA 2Q2EB 1HNXM 4G6ZA 3SASA 3AOGA 2BNKA 2D7EA 1Z5AA 2Y0QA 5C1BA 1Z5CA 1NSFA 3FTDA 4DUYM 2V1UA 2CHVA 3VLFB 4DV1M 2DVWB 4JI1M 4QNMA 5LMUM 2KXEA 5EP1A 2XGNA 2X8AA 4X65M 2LH0A 3A98B 1I94M 4X64M 2QENA 1S3SA 2UXDM 4JI8M 1L2DA 2CV2A 2YFQA 4MGKE 3RFWA 2YNMD 4NSOB 4FW9A 4GC5A 4LRTA 3U6PA 2QBYB 2I7NA 3LMMA 3VKGA 2UXCM 3KDSE 4RF1A 4DV0M 1L8QA 3PVSA 2ZBKB 4R7GA 1HQYE 1HT1E 4DUZM 3DZDA 3GPXA 3TWMA 3E4RA 1KFVA 3TE6A 4LJ6A 2EUCA 3UJNA 1N32M 3GQ4A 4PT5A 4REZA 1MX0A 4GKJM 1SXJA 4NXMM 3MJ5A 4MH0E 3AKZA 1J09A 2EA0A 3U6OA 2R45A 4B08A 3FTEA 1N78A 3HJSA 3LQRA 1SXJB 4DV4M 1W5SA 4XGIA 2DWZB 5FTMA 4HL4A 3GQ3A 2VQEM 1IBLM 4DR3M 4G4NA 4QNRA 4FWDA 5ITQA 1IXRC 4GHAA 1JR3D 2LNHC 3AOEC 4II7A 5ITRA 3SYLA 3SMSA 2JA2A 4B3RM 4LF6M 3HJ8A 1DO0A 3HGIA 2L09A 3AJIB 3VKHA 4IBCA 4GRIA 4EIWA 3GP1A 1YSYA 4M0DA 1HR0M 4LFCM 1QAQA 4IBDA 4CISA 2E5LM 1I4WA 4B3TM 3SARA 2FOIC 3J81S 4AI6A 4B7GA 3T38A 3HHWA 1QAMA 3KP0E 4JI7M 1T3TA 1Z5BA 1QYRA 1YUBA 1XHBA 3FYDA 3RGPA 5EP2A 4MGIE 3EIHA 2R4EA 4GC9A 1L1TA 4IBEA 2C98A 2O5RA 4G4OA 3L25A 4PDGA 2Z4SA 3TWKA 2Z4RA 3E9SA 3K1JA 2EO2A 5IWAM 2DWMA 3L26A 4TUWA 3HU1A 2C99A 3L28A 4I4LA 5FLXS 2F5PA 5FTLA 5EQTA 3FUUA 1G4AE 1K82A 2UXBM 2XH9A 4OVZA 4L4UA 4LJ9A 2F5SA 1IBMM 3FUXA 3J80S 3L2AA 3GLIA 4KODA 4AKIA 5DNYA 1IXZA 2RGHA 5F3WA 1IY0A 2X4AA 3GPPA 4KLNA 1IY1A 5EJCA 3HHXA 2R4JA 1N36M 2R65A 4BB9A 4JI4M 4DV2M 3PFIA 4FD2A 3ZC7B 2HHHM 3TL4X 2XZFA 4KO8A 3SYKA 5EXTA 1GL7A 4L8RC 3THGA 3VK7A 1K3XA 3RE8A 3Q8XA 2DWNA 4AKGA 3QWLA 3A42A 3JR4A 4K0KM 2DXIA 4JI5M 4FWHA 3GQ5A 1TH2A 2F5OA 3VFDA 4WURA 2BJWA 3L27A 3I51A 4JI6M 5FTNA 4AG6A 3MHVC 4W5WA 2UUBM 3KP1E 3TWLA 2QBYA 5KPTA 4QOSA 1G59A 5IZ7D 1HQCA 3A46A 3GO8A 4ZPXA 3SAUA 2Z3XA 1TDZA 4M9SA 3T1YM 1QQWA 1TDHA 3FD9A 3I4YA 4GH9A 4MM3B 2XSZA 3IG5A 1K3WA 1E9SA 4M9XA 5E26A 2F5NA 1DGGA 5ITUA 4FCWA 4IBKA 3FUWA 3U6QA 4FWGA 1Q3CA 1R7RA 2XZUA 1EE8A 2XEPA 3UZUA 4DR1M 1QZMA 1TH3A 3GRUA 4B7HA 4LY6A 5KQ8A 2VQFM 2UUAM 4G4RA 3KOZE 4LF7M 4FCVA 1IN5A 4RNAA 4PDIA 4GIPA 5EP4A 2DHRA 2KRKA 3I4VA 3HWSA 3D8BA 1NHGC 3NWLA 3W0LB 2HL7A 3M0EA 1E9RA 3DFZA 4CGYB 2V1CA 3L29A 2CV1A 4NRWA 2Z7JA 3UMMA 4L15A 4LJ8A 1SXJC 5EP3A 5H37D 4LJ4A 3TPZA 1UM8A 3K8ZA 7CATA 4X62M 3KOWE 3B9PA 4IBBA 4FCTA 2DZOB 1G41A 3FUVA 3KVWA 1OFIA 3J7AS 3GLFB 4P16A 4DV3M 2L7IA 3PNVA 1JQJC 3SMPA 3FTCA 2OPFA 8CATA 1G3IA 2W82A 3HU2A 5JI2E 1XC8A 1LV7A 2L7HA 4YHHM 2UU9M 3VDUA 2J7NA 1GL6A 4CHTB 3KFUG 4A3VB 4NRVA 3HJQA 1E32A 1OJLA 2CV0A 4R3DA 5BPVA 2HCBA 2CEAA 2KW0A 2D7GA 3NBIA 1PJJA 1OFHA 4JI0M 1NHWC 1KYIA 5ITXE 1NNJA 4LG2A 2F4VM 4IJEA 5EXSA 3TQSA 1IN4A 2R18A 3CF6E 4JYAM 4AW4A 1L2BA 1ZAEA 3SHFA 3CTWB 4QHSA 3U6LA 4DR7M 3GLHA 4NXNM 1DGBA 1DGHA 2CHGA 2V6ZM 1SXJD 2UUCM 2D7HA 2KZSA 1W5TA 4DR4M 3QAUA 3GLHB 5KPRA 1DGHB 4DV5M 2C9CA 2QZ4A 1R2ZA 1IN7A 4D81A 4LFAM 4IBFA 3DOAA 1Z59A 2KEBA 3KOYE 1DO2A 2LWXA 1H6UA 3H4MA 3T1HM 3HU3A 5DYGA 5EXXA 3R9XB 3SC3A 2A5YB 1N77A 3T15A 4L16A 4NOOB 1IQPA 4LJAA 1YE9A 2Y21A 4OX9M 1XMQM 2KRUA 3AL0C 1DGFA 2NQ8C 4LGMA 4GKKM 1NJFA 4M9ZA 1JR3A 3DA1A 2RGOA 4IJFA 2FFJA 4LFBM 4PCZA 4JI2M 2QCUA 3SFZA 2F5QA 3KS8A 4X66M 1Q39A 3FKEA 1R6BX 4WW0A 3RGSA 4AZFA 2I7PA 4HLQA 3LVVA 5FTKA 3R8FA 2XFTA 4NSRA 3EIEA 1Z6TA 2Y20A 3MK6A 3FUTA 1GKIA 5E6JA 3GPUA 1HNWM 2CFOA 3W0FA 4I81A 2R46A 4QOZC 3GRVA 3J7BA 3AV0A 4PD2A 1XNQM 1N34M 4LRSA 2VIIA 1KSFX 4M0WA 3GRRA 5KO3A 4FVMA 5GKNA 1WXQA 3U6SA 5A2QS 4DR6M 3UGJA 2KA6B 3OTOM 1VDDA 4RF0A 3CF2A 2P5TA 3C58A 3D8LA 4I5SA 2DZNB 1PJIA 5FTJA 1G8PA 4D82A 2J7OA 4AKHA 3GLFA 2YQZA 1NJGA 4S12A 4JI3M 1NY5A 4LGYA 1PM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 M;  4JI0 M;  4JI4 M;  4JI8 M;  1L2D A;  4DV2 M;  2HHH M;  4B3S M;  2XZF A;  5ITX E;  1NNJ A;  1L2C A;  2F4V M;  3U6P A;  3VK7 A;  1K3X A;  4JYA M;  1L2B A;  4DR7 M;  3U6L A;  2UXC M;  3A42 A;  4NXN M;  3JR4 A;  4DV0 M;  4K0K M;  2UUC M;  4JI5 M;  2ZBK B;  3GQ5 A;  4MB7 A;  5LMN M;  5ITY A;  4DUZ M;  4DR4 M;  3TWM A;  3GPX A;  2F5O A;  1J5E M;  4DV5 M;  1KFV A;  3VK8 A;  4JI6 M;  1N32 M;  5ITX A;  3GQ4 A;  2UUB M;  1R2Z A;  1MX0 A;  4AQY M;  4GKJ M;  3TWL A;  4LFA M;  1FJG M;  4NXM M;  3DOA A;  3A46 A;  1Q3B A;  1L1Z A;  3GO8 A;  1Z59 A;  2EA0 A;  3U6O A;  3SAU A;  1TDZ A;  4ITQ A;  3T1H M;  3T1Y M;  4DV4 M;  1HNZ M;  1TDH A;  4B3M M;  2VQE M;  1K3W A;  3GQ3 A;  1IBL M;  4DR3 M;  4G4N A;  2F5N A;  3GPY A;  1IBK M;  5ITQ A;  5ITU A;  3U6Q A;  1Q3C A;  2XZU A;  1EE8 A;  3U6D A;  5ITR A;  5BR8 M;  4DR1 M;  2VQF M;  4OX9 M;  4LF7 M;  2UUA M;  4G4R A;  1XMQ M;  4B3R M;  2OQ4 A;  4G4Q A;  3U6C A;  4LF6 M;  4PDI A;  4JV5 M;  4GKK M;  3GP1 A;  3JAM S;  3SAT A;  1R2Y A;  1HR0 M;  4LF8 M;  4DR2 M;  4LFC M;  4LFB M;  4PCZ A;  4JI2 M;  4CIS A;  2E5L M;  2F5Q A;  4B3T M;  3SAR A;  4X66 M;  1Q39 A;  3J81 S;  4JI7 M;  2HKJ A;  3U6E A;  1Z5B A;  3A45 A;  4NRW A;  3U6M A;  3JR5 A;  3SAV A;  2ZM6 M;  3GPU A;  1HNW M;  1MU5 A;  3W0F A;  3SAW A;  4DV7 M;  4KHP M;  4X62 M;  4LF5 M;  1L1T A;  5IT9 S;  4G4O A;  4PD2 A;  4PDG A;  1XNQ M;  3TWK A;  1N34 M;  1N33 M;  3J7A S;  4DV6 M;  4LF9 M;  5IWA M;  4DV3 M;  1XMO M;  4LF4 M;  5ITT A;  2OPF A;  4YY3 M;  5FLX S;  3U6S A;  2F5P A;  5A2Q S;  1XNR M;  4DR5 M;  3SBJ A;  2Q2E B;  1HNX M;  1K82 A;  4DR6 M;  2UXB M;  1XC8 A;  3OTO M;  3SAS A;  4YHH M;  2UU9 M;  2F5S A;  1IBM M;  3J80 S;  3C58 A;  1Z5A A;  1Z5C A;  1PJI A;  4DUY M;  4NRV A;  4DV1 M;  4JI1 M;  5LMU M;  3GPP A;  4JI3 M;  4X65 M;  1I94 M;  4X64 M;  1PM5 A;  1PJJ A;  2UXD M; 
#chains in the Genus database with same CATH topology
 2DAE A;  5FSW A;  3AOE A;  4B3S M;  3LW5 F;  2VF8 A;  1A5T A;  3KXE C;  1XXH A;  3K2L A;  1L2C A;  1WJ7 A;  1OAO C;  2ZAO A;  4GIT A;  2FE8 A;  2QP9 X;  3HZJ A;  2DWL A;  1SXJ E;  3QYB A;  2DAM A;  3CF0 A;  4ANR A;  4OU7 A;  1SG9 A;  1IXS A;  2C9O A;  1TH4 A;  4JN6 A;  1XXH B;  3C9P A;  3KOX E;  4MB7 A;  4AG5 A;  2CHQ A;  3UK6 A;  5LMN M;  5ITY A;  1QDT A;  2X49 A;  3HKP A;  3KSX A;  4NL4 H;  1IXS B;  3PXG A;  1GVN A;  1J5E M;  4MGH A;  2XF3 A;  3VK8 A;  5IRE B;  2K47 A;  5ITX A;  2C5R A;  2DI0 A;  4IBG A;  4LCB A;  2R62 A;  4AQY M;  1FJG M;  1E94 E;  1TGU A;  2ERC A;  2DEN A;  2XSZ D;  3J27 B;  5EXP A;  3KS4 A;  1EFU B;  2RRU A;  1Q3B A;  1WGL A;  3M7G A;  3KW6 A;  1L1Z A;  1PJQ A;  4MGY E;  3KSJ A;  3ZCB B;  3SHG B;  4ITQ A;  1FNN A;  2APL A;  1JB0 F;  5KQD A;  4LJ5 A;  4IIW A;  1HNZ M;  2CE7 A;  1J7K A;  1HT2 E;  2ZTD A;  3K92 A;  4B3M M;  5C18 A;  3HHY A;  3ZH9 B;  1IM2 A;  1NNU C;  4LJ7 A;  3GPY A;  3U5Z A;  1IBK M;  3M6A A;  1WHC A;  1PJT A;  2M60 A;  4LZZ A;  1GLN A;  1XWI A;  4BBA A;  1AIP C;  5BR8 M;  3U6D A;  2YR0 A;  4IBI A;  5L8R F;  2AHM A;  1QAO A;  4GHL A;  2Y0T A;  4XBO A;  3WHK A;  2OQ4 A;  4G4Q A;  2M5Z A;  3U6C A;  3GRY A;  3F92 A;  1ZMU A;  1TR8 A;  2VDB B;  2ZAM A;  3AFH A;  2C96 A;  3ILK A;  3LQQ A;  4JXJ A;  3HHZ A;  1QAN A;  4L78 A;  2CUZ A;  4BLC A;  4JV5 M;  3JAM S;  4LZJ A;  3SAT A;  1R2Y A;  4LF8 M;  4QHT A;  4D80 A;  2XFS A;  3NBX X;  4IBJ A;  2H1R A;  5JI3 E;  4DR2 M;  2RKO A;  3U60 A;  3IG8 A;  2L6O A;  2JXN A;  1MN3 A;  1X37 A;  1ORY B;  2FNA A;  2HKJ A;  2LXE A;  3U6E A;  2WZJ A;  3A45 A;  3J2P B;  3U60 B;  1IN8 A;  2BWB A;  2DAI A;  3U6M A;  3U61 A;  4OVZ B;  3FYC A;  3JR5 A;  2KDL A;  4OW0 A;  3GLG A;  2ZM6 M;  1C1K A;  4I8O A;  3SAV A;  1IN6 A;  1MU5 A;  3LVW A;  4B7F A;  3SAW A;  4DV7 M;  2G8L A;  4LF5 M;  4KHP M;  4GMQ A;  3T6P A;  3GLI B;  5IT9 S;  2XLJ A;  3U61 B;  1WGN A;  3GLI E;  4Z8X A;  1N75 A;  2KZU A;  5KPZ A;  1ZQ9 A;  4Z6Y A;  2DHY A;  3GLG B;  1NVM A;  1N33 M;  1NY6 A;  3FTF A;  4DV6 M;  3BOS A;  1QVR A;  3PNY A;  3GLG E;  4LF9 M;  2O01 F;  4CJ6 A;  3VDP A;  4MGZ E;  2BJV A;  1XMO M;  1IY2 A;  5ITT A;  1D2N A;  2ZAN A;  3WHL A;  2QPA A;  4LF4 M;  2G5G X;  5DYI A;  4YY3 M;  1XNR M;  4DR5 M;  3SBJ A;  2Q2E B;  1HNX M;  2MJ5 B;  2JY5 A;  1VDL A;  4G6Z A;  3SAS A;  1UFZ A;  3BBZ A;  1MJG M;  3AOG A;  2BNK A;  3ZQJ A;  4F1I A;  2D7E A;  1Z5A A;  2Y0Q A;  5C1B A;  1Z5C A;  1NSF A;  3FTD A;  4DUY M;  2V1U A;  2CHV A;  1GJS A;  3VLF B;  4DV1 M;  2DVW B;  3E46 A;  4JI1 M;  4QNM A;  5LMU M;  2KXE A;  5EP1 A;  2XGN A;  2X8A A;  2O25 A;  5DFL A;  4X65 M;  2LH0 A;  3A98 B;  1I94 M;  4X64 M;  2QEN A;  2K0B X;  1S3S A;  2UXD M;  1VEK A;  4JI8 M;  1L2D A;  2CV2 A;  2YFQ A;  4MGK E;  3RFW A;  2YNM D;  2JY8 A;  4NSO B;  4FW9 A;  4GC5 A;  2LVO C;  4LRT A;  3U6P A;  2QBY B;  4RKU F;  2HAK A;  2I7N A;  2MGW A;  3LMM A;  3VKG A;  2UXC M;  1GO5 A;  3KDS E;  4RF1 A;  4DV0 M;  1L8Q A;  3W68 A;  1ZV1 A;  3PVS A;  2ZBK B;  4R7G A;  4XK8 F;  1HQY E;  3BXW A;  1HT1 E;  4DUZ M;  2MRO B;  3DZD A;  3GPX A;  3TWM A;  1F4I A;  3E4R A;  1KFV A;  3TE6 A;  2QNJ A;  4LJ6 A;  4F2L A;  2EUC A;  3UJN A;  1N32 M;  3GQ4 A;  1T6O A;  2JNH A;  4PT5 A;  1MX0 A;  4REZ A;  4GKJ M;  1SXJ A;  4NXM M;  1OAI A;  1QDR A;  3MJ5 A;  4MH0 E;  3AKZ A;  1J09 A;  2EA0 A;  3U6O A;  2R45 A;  4B08 A;  3FTE A;  2LHG A;  1N78 A;  2CRU A;  3HJS A;  3LQR A;  1SXJ B;  4DV4 M;  1W5S A;  4XGI A;  2DWZ B;  5FTM A;  4HL4 A;  3GQ3 A;  2VQE M;  1IBL M;  4DR3 M;  4G4N A;  4QNR A;  4FWD A;  5ITQ A;  1IXR C;  4GHA A;  1JR3 D;  3B7Z A;  2LNH C;  3AOE C;  4II7 A;  5ITR A;  1PJS A;  4DBG B;  3SYL A;  3SMS A;  2JA2 A;  4B3R M;  4LF6 M;  3HJ8 A;  1DO0 A;  3HGI A;  2L09 A;  3AJI B;  3VKH A;  4IBC A;  4GRI A;  4EIW A;  3GP1 A;  1YSY A;  4M0D A;  1HR0 M;  4LFC M;  1QAQ A;  4IBD A;  1VG5 A;  2JY7 A;  2LBC A;  4L6V 6;  2E5L M;  4CIS A;  1I4W A;  1HJP A;  4B3T M;  3SAR A;  2FOI C;  3J81 S;  4AI6 A;  4B7G A;  3T38 A;  2FH0 A;  2KNV A;  3HHW A;  1QAM A;  3KP0 E;  4JI7 M;  1T3T A;  1Z5B A;  2DNA A;  3H4J A;  1QYR A;  1YUB A;  2DZL A;  1XHB A;  3FYD A;  3RGP A;  2LVQ D;  4NC6 A;  1ZMW A;  5EP2 A;  4MGI E;  3EIH A;  2R4E A;  4GC9 A;  1L1T A;  1QZE A;  2R44 A;  2LVP C;  4IBE A;  2C98 A;  2O5R A;  4G4O A;  3L25 A;  4PDG A;  2Z4S A;  3TWK A;  2Z4R A;  3E9S A;  3K1J A;  2EO2 A;  3FRI A;  5IWA M;  2DWM A;  3L26 A;  4TUW A;  3HU1 A;  1TTE A;  2LVA A;  2C99 A;  3L28 A;  4I4L A;  5FLX S;  1VEG A;  2F5P A;  5FTL A;  5EQT A;  3FUU A;  1G4A E;  1K82 A;  2UXB M;  2JZ0 A;  1PGY A;  2XH9 A;  4OVZ A;  3IEC A;  4L4U A;  4LJ9 A;  2F5S A;  1IBM M;  2JWS A;  3FUX A;  3J80 S;  3L2A A;  3GLI A;  1IFY A;  2OOB A;  3LCU A;  2EJS A;  4KOD A;  4AKI A;  5DNY A;  1V34 A;  3GLH E;  4Y28 F;  1IXZ A;  2RGH A;  5F3W A;  1IY0 A;  2X4A A;  3GPP A;  4KLN A;  1IY1 A;  1P3Q Q;  2VF7 A;  1OIP A;  5EJC A;  3HHX A;  2EKK A;  2R4J A;  2R65 A;  4BB9 A;  1N36 M;  4JI4 M;  4DV2 M;  1V92 A;  3PFI A;  4FD2 A;  3ZC7 B;  2HHH M;  1D0K A;  3TL4 X;  2XZF A;  3FRH A;  4KO8 A;  3SYK A;  5EXT A;  1GL7 A;  2EKF A;  2K6B A;  2DAK A;  4L8R C;  3THG A;  1WR1 B;  4CIZ A;  3RE8 A;  3VK7 A;  3Q8X A;  1K3X A;  2DWN A;  4AKG A;  3QWL A;  3A42 A;  1OQY A;  3JR4 A;  3V76 A;  4K0K M;  1XB2 B;  2DXI A;  4JI5 M;  4FWH A;  2KHH A;  3HX3 A;  2ZTC A;  3GQ5 A;  1TH2 A;  2N35 A;  3MMP A;  2F5O A;  3VFD A;  4WUR A;  2BJW A;  3L27 A;  3I51 A;  1WIV A;  4JI6 M;  1EIJ A;  3I04 M;  5FTN A;  4HEO A;  4AG6 A;  3MHV C;  4W5W A;  2UUB M;  3KP1 E;  3TWL A;  2QBY A;  5KPT A;  2L4E A;  4QOS A;  2OOA A;  1G59 A;  3FE3 A;  5IZ7 D;  1HQC A;  3A46 A;  3GO8 A;  2WSE F;  3K9P A;  4ZPX A;  3SAU A;  2Z3X A;  1TDZ A;  4M9S A;  3T1Y M;  1QQW A;  1TDH A;  1JR3 E;  3FD9 A;  3I4Y A;  4GH9 A;  4MM3 B;  2XSZ A;  3IG5 A;  1K3W A;  1E9S A;  4M9X A;  5E26 A;  2F5N A;  1D0M A;  1DGG A;  5ITU A;  4FCW A;  4IBK A;  3FUW A;  3U6Q A;  1VQ1 A;  4FWG A;  1Q3C A;  1R7R A;  3B74 A;  2XZU A;  1EE8 A;  2XEP A;  3UZU A;  4DR1 M;  1QZM A;  2BWE A;  1NO1 A;  1TH3 A;  3GRU A;  4B7H A;  4LY6 A;  1R4G A;  5KQ8 A;  2VQF M;  4G4R A;  3E21 A;  3KOZ E;  2UUA M;  4FCV A;  4LF7 M;  2JY6 B;  1IN5 A;  4RNA A;  4PDI A;  4GIP A;  4GEW A;  5EP4 A;  2DHR A;  2CWB A;  1DV0 A;  2KRK A;  3I4V A;  3HWS A;  3D8B A;  1T43 A;  2LTU A;  1NHG C;  1OKS A;  3NWL A;  2HWJ A;  3W0L B;  2HL7 A;  3M0E A;  2L2D A;  1LTM A;  3QYE A;  1E9R A;  1QUS A;  3DFZ A;  4CGY B;  2V1C A;  3L29 A;  2CV1 A;  4NRW A;  2Z7J A;  3UMM A;  2R6F A;  4L15 A;  3IHP A;  1SXJ C;  4LJ8 A;  5EP3 A;  5H37 D;  4LJ4 A;  3TPZ A;  1NV8 A;  1UM8 A;  3K8Z A;  7CAT A;  4X62 M;  3KOW E;  3B9P A;  4IBB A;  4FCT A;  4KT0 F;  2DZO B;  1G41 A;  3FUV A;  3KVW A;  1OFI A;  3J7A S;  3GLF B;  4P16 A;  4DV3 M;  2L7I A;  3PNV A;  3Q8G A;  1JQJ C;  3GLF E;  3SMP A;  3FTC A;  2OPF A;  8CAT A;  1G3I A;  2W82 A;  3HU2 A;  5JI2 E;  1XC8 A;  3CGW A;  1LV7 A;  2L7H A;  4YHH M;  2UU9 M;  3VDU A;  2J7N A;  1GL6 A;  3W67 A;  1XXH E;  4CHT B;  4Q7J A;  3KFU G;  4A3V B;  1G71 A;  4NRV A;  3HJQ A;  1E32 A;  2KNA A;  1OJL A;  2FS1 A;  2CV0 A;  1R5L A;  4R3D A;  2L4F A;  5BPV A;  2HCB A;  2CEA A;  2KW0 A;  2D7G A;  3C3E A;  3NBI A;  2LVN C;  1AUA A;  1Q02 A;  3C3D A;  1PJJ A;  1OFH A;  4JI0 M;  4WP2 A;  1NHW C;  2JP7 A;  1KYI A;  2JUJ A;  5ITX E;  1NNJ A;  4LG2 A;  2F4V M;  4IJE A;  5EXS A;  3TQS A;  1IN4 A;  1TF0 B;  2R18 A;  3CF6 E;  4JYA M;  1ZMV A;  4AW4 A;  2WSF F;  1ZAE A;  1L2B A;  3SHF A;  3CTW B;  4QHS A;  3U6L A;  4DR7 M;  3GLH A;  2R0I A;  4NXN M;  1DGB A;  1DGH A;  4R71 A;  3I01 M;  1C7Y A;  2CHG A;  2V6Z M;  1SXJ D;  2UUC M;  2D7H A;  2KZS A;  1W5T A;  2JZ1 A;  4DR4 M;  3QAU A;  3GLH B;  2GNO A;  5KPR A;  1DGH B;  4DV5 M;  1CUK A;  1OTR A;  2C9C A;  2QZ4 A;  1R2Z A;  2QHO B;  1IN7 A;  4D81 A;  4LFA M;  4IBF A;  3DOA A;  2WSC F;  1Z59 A;  2KEB A;  3KOY E;  1DO2 A;  2LWX A;  1H6U A;  1YLA A;  3H4M A;  4UN2 B;  3HU3 A;  5DYG A;  3T1H M;  4G3O A;  5EXX A;  3R9X B;  3SC3 A;  2A5Y B;  1N77 A;  3T15 A;  4L16 A;  4NOO B;  1IQP A;  3B89 A;  4LJA A;  1YE9 A;  2Y21 A;  2LHC A;  2OO9 A;  2GQF A;  4OX9 M;  1XMQ M;  2KRU A;  3AL0 C;  1DGF A;  2NQ8 C;  4LGM A;  4GKK M;  1NJF A;  4M9Z A;  3LCV B;  1JR3 A;  3DA1 A;  2RGO A;  2G3Q A;  4IJF A;  2FFJ A;  4LFB M;  4PCZ A;  4JI2 M;  2QCU A;  2DAG A;  1OIZ A;  3SFZ A;  2F5Q A;  1QUT A;  2QQ8 A;  4P17 A;  4X66 M;  1Q39 A;  1R6B X;  3FKE A;  4WW0 A;  3RGS A;  4AZF A;  3KS8 A;  2I7P A;  4HLQ A;  3LVV A;  5FTK A;  3R8F A;  2XFT A;  4NSR A;  2MH8 A;  3EIE A;  1Z6T A;  2Y20 A;  2QSF X;  3MK6 A;  3FUT A;  1GKI A;  5E6J A;  3GPU A;  1HNW M;  2CFO A;  3U5Z B;  1GJT A;  3W0F A;  4I81 A;  2R46 A;  4QOZ C;  3GRV A;  1V33 A;  3J7B A;  3AV0 A;  4PD2 A;  1XNQ M;  1N34 M;  4LRS A;  2VII A;  1RU3 A;  1KSF X;  2MR9 A;  4M0W A;  3GRR A;  5KO3 A;  4FVM A;  5GKN A;  1WXQ A;  3U6S A;  2J5Y A;  5A2Q S;  1BVS A;  2DKL A;  2H5X A;  1D0L A;  3UGJ A;  4DR6 M;  1Y8G A;  2KA6 B;  3HY5 A;  1VEJ A;  3OTO M;  2B3T A;  1VDD A;  4RF0 A;  3CF2 A;  2CP8 A;  2P5T A;  2Z8Y M;  3C58 A;  3D8L A;  4I5S A;  2DZN B;  1PJI A;  5FTJ A;  1G8P A;  2K9D A;  2KNZ A;  4D82 A;  2J7O A;  4AKH A;  3GLF A;  2YQZ A;  1NV9 A;  1NJG A;  3B7N A;  4S12 A;  1PRB A;  4JI3 M;  1NY5 A;  1GAB A;  4LGY A;  3B7Q A;  1PM5 A;  3K9O A; 
#chains in the Genus database with same CATH homology
 5FSW A;  3AOE A;  4B3S M;  1L2C A;  3KXE C;  1XXH A;  3K2L A;  2ZAO A;  4GIT A;  2FE8 A;  2QP9 X;  2DWL A;  1SXJ E;  3CF0 A;  4OU7 A;  2C9O A;  1TH4 A;  4JN6 A;  1XXH B;  3KOX E;  4MB7 A;  4AG5 A;  2CHQ A;  3UK6 A;  5LMN M;  5ITY A;  2X49 A;  3HKP A;  3KSX A;  4NL4 H;  1IXS B;  3PXG A;  1GVN A;  1J5E M;  4MGH A;  2XF3 A;  3VK8 A;  5IRE B;  2K47 A;  5ITX A;  2C5R A;  4IBG A;  4LCB A;  2R62 A;  4AQY M;  1FJG M;  1E94 E;  1TGU A;  2ERC A;  2XSZ D;  3J27 B;  5EXP A;  3KS4 A;  1Q3B A;  1L1Z A;  3M7G A;  3KW6 A;  4MGY E;  3KSJ A;  3ZCB B;  3SHG B;  4ITQ A;  1FNN A;  5KQD A;  4LJ5 A;  4IIW A;  1HNZ M;  2CE7 A;  1J7K A;  1HT2 E;  3K92 A;  4B3M M;  5C18 A;  3HHY A;  3ZH9 B;  1IM2 A;  1NNU C;  4LJ7 A;  3GPY A;  3U5Z A;  1IBK M;  3M6A A;  2M60 A;  4LZZ A;  1GLN A;  1XWI A;  4BBA A;  3U6D A;  5BR8 M;  2YR0 A;  4IBI A;  2AHM A;  1QAO A;  4GHL A;  2Y0T A;  4XBO A;  3WHK A;  2OQ4 A;  4G4Q A;  2M5Z A;  3U6C A;  3GRY A;  4JXJ A;  3U5Z B;  2ZAM A;  3LQQ A;  3AFH A;  2C96 A;  3ILK A;  3HHZ A;  4JV5 M;  1QAN A;  4L78 A;  2CUZ A;  4BLC A;  3JAM S;  4LZJ A;  3SAT A;  1R2Y A;  4LF8 M;  4QHT A;  4D80 A;  2XFS A;  4IBJ A;  2H1R A;  5JI3 E;  4DR2 M;  2RKO A;  3U60 A;  3IG8 A;  2L6O A;  1X37 A;  1ORY B;  2FNA A;  2HKJ A;  2LXE A;  3U6E A;  3A45 A;  3U60 B;  3J2P B;  1IN8 A;  3U6M A;  3U61 A;  4OVZ B;  3FYC A;  3JR5 A;  4OW0 A;  2ZM6 M;  3GLG A;  3SAV A;  1C1K A;  4I8O A;  1IN6 A;  1MU5 A;  3LVW A;  4B7F A;  3SAW A;  4DV7 M;  2G8L A;  4LF5 M;  4KHP M;  4GMQ A;  3GLI B;  5IT9 S;  2XLJ A;  3U61 B;  4Z8X A;  1N75 A;  2KZU A;  5KPZ A;  1ZQ9 A;  4Z6Y A;  3GLG B;  1N33 M;  1NVM A;  1NY6 A;  3FTF A;  4DV6 M;  3BOS A;  1QVR A;  3PNY A;  4LF9 M;  3VDP A;  4MGZ E;  2BJV A;  1XMO M;  1IY2 A;  5ITT A;  1D2N A;  2ZAN A;  3WHL A;  2QPA A;  4LF4 M;  2G5G X;  5DYI A;  4YY3 M;  1XNR M;  4DR5 M;  3SBJ A;  2Q2E B;  1HNX M;  4G6Z A;  3SAS A;  3AOG A;  2BNK A;  2D7E A;  1Z5A A;  2Y0Q A;  5C1B A;  1Z5C A;  1NSF A;  3FTD A;  4DUY M;  2V1U A;  2CHV A;  3VLF B;  4DV1 M;  2DVW B;  4JI1 M;  4QNM A;  5LMU M;  2KXE A;  5EP1 A;  2XGN A;  2X8A A;  4X65 M;  2LH0 A;  3A98 B;  1I94 M;  4X64 M;  2QEN A;  1S3S A;  2UXD M;  4JI8 M;  1L2D A;  2CV2 A;  2YFQ A;  4MGK E;  3RFW A;  2YNM D;  4NSO B;  4FW9 A;  4GC5 A;  4LRT A;  3U6P A;  2QBY B;  2I7N A;  3LMM A;  3VKG A;  2UXC M;  3KDS E;  4RF1 A;  4DV0 M;  1L8Q A;  3PVS A;  2ZBK B;  4R7G A;  1HQY E;  1HT1 E;  4DUZ M;  3DZD A;  3GPX A;  3TWM A;  3E4R A;  1KFV A;  3TE6 A;  4LJ6 A;  2EUC A;  3UJN A;  1N32 M;  3GQ4 A;  4PT5 A;  4REZ A;  1MX0 A;  4GKJ M;  1SXJ A;  4NXM M;  3MJ5 A;  4MH0 E;  3AKZ A;  1J09 A;  2EA0 A;  3U6O A;  2R45 A;  4B08 A;  3FTE A;  1N78 A;  3HJS A;  3LQR A;  1SXJ B;  4DV4 M;  1W5S A;  4XGI A;  2DWZ B;  5FTM A;  4HL4 A;  3GQ3 A;  2VQE M;  1IBL M;  4DR3 M;  4G4N A;  4QNR A;  4FWD A;  5ITQ A;  1IXR C;  4GHA A;  1JR3 D;  2LNH C;  3AOE C;  4II7 A;  5ITR A;  3SYL A;  3SMS A;  2JA2 A;  4B3R M;  4LF6 M;  3HJ8 A;  1DO0 A;  3HGI A;  2L09 A;  3AJI B;  3VKH A;  4IBC A;  4GRI A;  4EIW A;  3GP1 A;  1YSY A;  4M0D A;  1HR0 M;  4LFC M;  1QAQ A;  4IBD A;  4CIS A;  2E5L M;  1I4W A;  4B3T M;  3SAR A;  2FOI C;  3J81 S;  4AI6 A;  4B7G A;  3T38 A;  3HHW A;  1QAM A;  3KP0 E;  4JI7 M;  1T3T A;  1Z5B A;  1QYR A;  1YUB A;  1XHB A;  3FYD A;  3RGP A;  5EP2 A;  4MGI E;  3EIH A;  2R4E A;  4GC9 A;  1L1T A;  4IBE A;  2C98 A;  2O5R A;  4G4O A;  3L25 A;  4PDG A;  2Z4S A;  3TWK A;  2Z4R A;  3E9S A;  3K1J A;  2EO2 A;  5IWA M;  2DWM A;  3L26 A;  4TUW A;  3HU1 A;  2C99 A;  3L28 A;  4I4L A;  5FLX S;  2F5P A;  5FTL A;  5EQT A;  3FUU A;  1G4A E;  1K82 A;  2UXB M;  2XH9 A;  4OVZ A;  4L4U A;  4LJ9 A;  2F5S A;  1IBM M;  3FUX A;  3J80 S;  3L2A A;  3GLI A;  4KOD A;  4AKI A;  5DNY A;  1IXZ A;  2RGH A;  5F3W A;  1IY0 A;  2X4A A;  3GPP A;  4KLN A;  1IY1 A;  5EJC A;  3HHX A;  2R4J A;  1N36 M;  2R65 A;  4BB9 A;  4JI4 M;  4DV2 M;  3PFI A;  4FD2 A;  3ZC7 B;  2HHH M;  3TL4 X;  2XZF A;  4KO8 A;  3SYK A;  5EXT A;  1GL7 A;  4L8R C;  3THG A;  3VK7 A;  1K3X A;  3RE8 A;  3Q8X A;  2DWN A;  4AKG A;  3QWL A;  3A42 A;  3JR4 A;  4K0K M;  2DXI A;  4JI5 M;  4FWH A;  3GQ5 A;  1TH2 A;  2F5O A;  3VFD A;  4WUR A;  2BJW A;  3L27 A;  3I51 A;  4JI6 M;  5FTN A;  4AG6 A;  3MHV C;  4W5W A;  2UUB M;  3KP1 E;  3TWL A;  2QBY A;  5KPT A;  4QOS A;  1G59 A;  5IZ7 D;  1HQC A;  3A46 A;  3GO8 A;  4ZPX A;  3SAU A;  2Z3X A;  1TDZ A;  4M9S A;  3T1Y M;  1QQW A;  1TDH A;  3FD9 A;  3I4Y A;  4GH9 A;  4MM3 B;  2XSZ A;  3IG5 A;  1K3W A;  1E9S A;  4M9X A;  5E26 A;  2F5N A;  1DGG A;  5ITU A;  4FCW A;  4IBK A;  3FUW A;  3U6Q A;  4FWG A;  1Q3C A;  1R7R A;  2XZU A;  1EE8 A;  2XEP A;  3UZU A;  4DR1 M;  1QZM A;  1TH3 A;  3GRU A;  4B7H A;  4LY6 A;  5KQ8 A;  2VQF M;  2UUA M;  4G4R A;  3KOZ E;  4LF7 M;  4FCV A;  1IN5 A;  4RNA A;  4PDI A;  4GIP A;  5EP4 A;  2DHR A;  2KRK A;  3I4V A;  3HWS A;  3D8B A;  1NHG C;  3NWL A;  3W0L B;  2HL7 A;  3M0E A;  1E9R A;  3DFZ A;  4CGY B;  2V1C A;  3L29 A;  2CV1 A;  4NRW A;  2Z7J A;  3UMM A;  4L15 A;  4LJ8 A;  1SXJ C;  5EP3 A;  5H37 D;  4LJ4 A;  3TPZ A;  1UM8 A;  3K8Z A;  7CAT A;  4X62 M;  3KOW E;  3B9P A;  4IBB A;  4FCT A;  2DZO B;  1G41 A;  3FUV A;  3KVW A;  1OFI A;  3J7A S;  3GLF B;  4P16 A;  4DV3 M;  2L7I A;  3PNV A;  1JQJ C;  3SMP A;  3FTC A;  2OPF A;  8CAT A;  1G3I A;  2W82 A;  3HU2 A;  5JI2 E;  1XC8 A;  1LV7 A;  2L7H A;  4YHH M;  2UU9 M;  3VDU A;  2J7N A;  1GL6 A;  4CHT B;  3KFU G;  4A3V B;  4NRV A;  3HJQ A;  1E32 A;  1OJL A;  2CV0 A;  4R3D A;  5BPV A;  2HCB A;  2CEA A;  2KW0 A;  2D7G A;  3NBI A;  1PJJ A;  1OFH A;  4JI0 M;  1NHW C;  1KYI A;  5ITX E;  1NNJ A;  4LG2 A;  2F4V M;  4IJE A;  5EXS A;  3TQS A;  1IN4 A;  2R18 A;  3CF6 E;  4JYA M;  4AW4 A;  1L2B A;  1ZAE A;  3SHF A;  3CTW B;  4QHS A;  3U6L A;  4DR7 M;  3GLH A;  4NXN M;  1DGB A;  1DGH A;  2CHG A;  2V6Z M;  1SXJ D;  2UUC M;  2D7H A;  2KZS A;  1W5T A;  4DR4 M;  3QAU A;  3GLH B;  5KPR A;  1DGH B;  4DV5 M;  2C9C A;  2QZ4 A;  1R2Z A;  1IN7 A;  4D81 A;  4LFA M;  4IBF A;  3DOA A;  1Z59 A;  2KEB A;  3KOY E;  1DO2 A;  2LWX A;  1H6U A;  3H4M A;  3T1H M;  3HU3 A;  5DYG A;  5EXX A;  3R9X B;  3SC3 A;  2A5Y B;  1N77 A;  3T15 A;  4L16 A;  4NOO B;  1IQP A;  4LJA A;  1YE9 A;  2Y21 A;  4OX9 M;  1XMQ M;  2KRU A;  3AL0 C;  1DGF A;  2NQ8 C;  4LGM A;  4GKK M;  1NJF A;  4M9Z A;  1JR3 A;  3DA1 A;  2RGO A;  4IJF A;  2FFJ A;  4LFB M;  4PCZ A;  4JI2 M;  2QCU A;  3SFZ A;  2F5Q A;  3KS8 A;  4X66 M;  1Q39 A;  3FKE A;  1R6B X;  4WW0 A;  3RGS A;  4AZF A;  2I7P A;  4HLQ A;  3LVV A;  5FTK A;  3R8F A;  2XFT A;  4NSR A;  3EIE A;  1Z6T A;  2Y20 A;  3MK6 A;  3FUT A;  1GKI A;  5E6J A;  3GPU A;  1HNW M;  2CFO A;  3W0F A;  4I81 A;  2R46 A;  4QOZ C;  3GRV A;  3J7B A;  3AV0 A;  4PD2 A;  1XNQ M;  1N34 M;  4LRS A;  2VII A;  1KSF X;  4M0W A;  3GRR A;  5KO3 A;  4FVM A;  5GKN A;  1WXQ A;  3U6S A;  5A2Q S;  4DR6 M;  3UGJ A;  2KA6 B;  3OTO M;  1VDD A;  4RF0 A;  3CF2 A;  2P5T A;  3C58 A;  3D8L A;  4I5S A;  2DZN B;  1PJI A;  5FTJ A;  1G8P A;  4D82 A;  2J7O A;  4AKH A;  3GLF A;  2YQZ A;  1NJG A;  4S12 A;  4JI3 M;  1NY5 A;  4LGY A;  1PM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...