4YY3M

30s ribosomal subunit- higb complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4yy3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4yy3M02
1XNQM 1XC8A 4LF7M 4DUYM 1Z59A 4JI5M 1L1ZA 4G4QA 1Z5CA 1HNZM 4DV2M 4DR2M 2F5SA 1XMQM 4YY3M 3JAMS 2VQEM 1J5EM 1R2YA 2Q2EB 3SASA 4OX9M 3GPPA 2UXCM 3JR5A 4JI4M 2EA0A 4PDIA 1PJIA 1Z5AA 2OPFA 4DV0M 4B3TM 3GPUA 1L2DA 4MB7A 2UU9M 1L1TA 1MX0A 1HNXM 1FJGM 2HHHM 3SAUA 4JI2M 5ITXA 4LF8M 3U6EA 3GQ3A 3GPYA 5LMUM 4YHHM 1K3WA 5ITQA 3GQ5A 1K3XA 5A2QS 1KFVA 5ITRA 2HKJA 4PCZA 4DR5M 3A42A 2VQFM 4NXMM 3U6DA 3DOAA 4JI7M 1IBLM 2F5NA 4G4RA 2XZUA 4NRWA 1XMOM 4LFAM 4DR3M 4DR6M 3SARA 4G4NA 4X64M 3T1YM 1I94M 3U6LA 2F5QA 3SBJA 4DUZM 1R2ZA 4KHPM 5ITUA 1N33M 4JYAM 3GPXA 2OQ4A 2UXBM 4CISA 4GKKM 4AQYM 4LF5M 3J81S 3JR4A 4NRVA 4DV4M 1L2CA 1PM5A 4JI8M 4DV6M 3U6CA 4ITQA 3A46A 4NXNM 5ITTA 1TDZA 1Q3CA 5IWAM 4B3RM 4K0KM 1PJJA 2F5PA 1Q39A 4DV1M 5ITYA 1HR0M 4G4OA 4DR4M 4GKJM 3GO8A 3U6OA 1IBMM 2UUCM 3SAWA 1L2BA 2UUBM 1TDHA 2F4VM 4X66M 2UUAM 3J7AS 4JI3M 4LF6M 4B3SM 5BR8M 1N34M 4PDGA 3GP1A 4LF9M 5ITXE 1EE8A 3SATA 3J80S 3TWLA 3TWKA 3VK7A 1MU5A 4JV5M 1Z5BA 1IBKM 1N32M 3T1HM 5LMNM 4JI1M 4LF4M 3A45A 3U6QA 3GQ4A 4DV3M 1XNRM 3C58A 2ZBKB 3OTOM 3U6PA 3TWMA 2XZFA 2F5OA 4X62M 5IT9S 3U6SA 1Q3BA 1K82A 5FLXS 4LFBM 4X65M 2ZM6M 3SAVA 3W0FA 1NNJA 1HNWM 4JI0M 4DV5M 4DR1M 4DR7M 2E5LM 4B3MM 4PD2A 4DV7M 3VK8A 4JI6M 3U6MA 4LFCM 2UXDM 1N36M
chains in the Genus database with same CATH superfamily
3M7GA 5H37D 1IY1A 2R18A 1G41A 4GIPA 1XNQM 4LF7M 2L2DA 1QUSA 4Q7JA 1TF0B 3D8LA 3FTDA 3I51A 3L27A 1HNZM 1HT2E 4DR2M 1N77A 3GLIE 3AJIB 1NY6A 3HU3A 1G8PA 3HX3A 3SC3A 3U61B 4QOZC 2JY6B 4DV0M 5JI2E 3B7NA 4D81A 1L2DA 4MGKE 3H4JA 4MB7A 3HU2A 1L1TA 1OIZA 1VEKA 2RGHA 3B89A 3SHGB 4CGYB 1IM2A 1OAIA 1FJGM 1JB0F 3SAUA 2CUZA 4QNRA 3W68A 4JI2M 1WXQA 4AKIA 5LMUM 1SXJD 4LCBA 1LV7A 1IXSA 1KFVA 5EXTA 1IY2A 3KOXE 4HLQA 2EO2A 3RGSA 2N35A 2DZNB 2Y0QA 2LNHC 4BLCA 3KFUG 2X49A 2BJWA 3MK6A 4JI7M 1IY0A 3I04M 1IQPA 4R71A 1AUAA 4LGYA 4WP2A 1PRBA 4NC6A 4GHAA 2FNAA 4LFAM 3DFZA 4EIWA 4FCWA 1I94M 7CATA 2Y20A 4L78A 2DAEA 8CATA 2F5QA 5EP2A 1VEJA 3SFZA 1R2ZA 1R4GA 1CUKA 4FWDA 3HJQA 4JYAM 3GPXA 2OQ4A 3L25A 1WHCA 1IFYA 4LF5M 2GNOA 1J09A 3GRVA 3KDSE 4NRVA 4MGYE 2JWSA 1SG9A 1JQJC 4IBFA 1PM5A 2HL7A 2ZAOA 5GKNA 1L2CA 4ANRA 3J7BA 3FRIA 1V92A 5ITTA 1Q3CA 2A5YB 1PJQA 3UK6A 3GLIB 1PJJA 2F5PA 1ZV1A 2CP8A 2Y0TA 3B7QA 3QYEA 3VDPA 1GJTA 1HR0M 3U6OA 2R0IA 1IBMM 3SAWA 2BWBA 1L2BA 2UUBM 3GLGA 4LG2A 2LVPC 1NJFA 1OKSA 2I7PA 2DXIA 2F4VM 2ERCA 2FS1A 3J7AS 5DYIA 1TR8A 3PVSA 4LJ9A 3AOGA 4LRTA 3M0EA 2CE7A 4P17A 5BR8M 1N34M 4B3SM 4LF9M 4M0WA 5FTLA 1MN3A 3UGJA 1PJTA 2I7NA 5KO3A 3J80S 3TWKA 1OIPA 3FUUA 4QNMA 3VK7A 1TTEA 1Z5BA 4QHSA 4KO8A 2M60A 5KQ8A 5LMNM 1QQWA 2DWMA 4LF4M 4LJ8A 3GQ4A 3BOSA 2ZBKB 3U6PA 2XZFA 2LHCA 3I4VA 1Z6TA 3IHPA 2V1UA 3KOWE 3L2AA 4S12A 4L15A 2JP7A 2ZM6M 3W0FA 2ZTCA 3C3EA 2AHMA 2APLA 3UMMA 1HNWM 2OOAA 4JI0M 3K9PA 4M9XA 3B9PA 4DR1M 4FCTA 3QWLA 4Z6YA 3B74A 2R44A 1H6UA 4LRSA 2UXDM 2DAKA 1YUBA 2LWXA 2BNKA 1KYIA 1IN6A 1G71A 1HT1E 1SXJE 1WR1B 2DZLA 3C3DA 4G4QA 3RGPA 4NSOB 2F5SA 2JUJA 1XMQM 4JXJA 4OX9M 2HCBA 2JA2A 3JR5A 2MGWA 3AL0C 5JI3E 4WW0A 3T15A 3C9PA 2CV2A 4KLNA 1W5SA 4AG5A 1ZMWA 2CFOA 2DAMA 2K9DA 3A98B 2ZAMA 3GLHE 4IBJA 5EP4A 1ZMUA 1GLNA 2NQ8C 4PT5A 2KDLA 4LF8M 3U6EA 3U5ZA 3EIHA 5IZ7D 3IG8A 2MJ5B 4GEWA 1QYRA 5ITQA 3AFHA 4IIWA 1ZQ9A 3AV0A 3SMSA 2OOBA 4B08A 1PGYA 4F1IA 1K3XA 4PCZA 3KP0E 1J7KA 1NSFA 2DHRA 4QHTA 2QBYA 2J7OA 2LXEA 4NSRA 4XGIA 3U6DA 4JN6A 1IN5A 2DHYA 2R45A 2WSCF 3HU1A 3E21A 3LQRA 4MH0E 3RE8A 1IBLM 2F5NA 4FWHA 2J7NA 1GL6A 3IG5A 3U60A 3LMMA 4I4LA 4FVMA 1D0MA 3U6LA 1VQ1A 2RGOA 4L8RC 2CHGA 3EIEA 2LVQD 2O5RA 3MJ5A 2LHGA 1UM8A 3KXEC 2L09A 3HHYA 4GKKM 4FD2A 4RF1A 4AI6A 2CEAA 1DV0A 4WURA 1YE9A 3J81S 3JR4A 1Y8GA 2C9OA 2JY5A 1OFHA 1S3SA 4CHTB 3AKZA 3GLFA 1QZEA 4ZPXA 2ZTDA 4L4UA 3A46A 3LCVB 1TDZA 3D8BA 1OJLA 4CJ6A 3UJNA 5E26A 2YQZA 5ITYA 4IBBA 4AW4A 1SXJC 2EUCA 3HHXA 4AG6A 3GO8A 2UUCM 3HWSA 4FWGA 2FE8A 2Z8YM 3GLHB 2XLJA 1C7YA 1NHGC 4Z8XA 4A3VB 1DGFA 1IN4A 1XWIA 2KA6B 4X66M 1HQYE 2M5ZA 4R7GA 4GC5A 4LF6M 2O25A 1MJGM 1NY5A 3HHZA 5ITXE 3TWLA 4REZA 1L8QA 2JZ1A 2DVWB 3CF0A 1DGHA 1JR3D 4NOOB 5L8RF 3T1HM 4MM3B 1IBKM 2VDBB 1YLAA 1IN7A 4GMQA 2K0BX 2QQ8A 3C58A 4M9ZA 2FFJA 2F5OA 2GQFA 3HGIA 3L28A 4X62M 4B7HA 2Z4SA 3E4RA 1Q3BA 3GLGE 2KEBA 1NNJA 2DI0A 5EQTA 4IBCA 5FSWA 2JY8A 4DV5M 2FH0A 3LQQA 1TH3A 3FRHA 4NL4H 4B3MM 2KNVA 3VK8A 2KRKA 5EP1A 3FYCA 2JZ0A 2KNAA 1WGNA 4OVZB 2Z7JA 4LFCM 1XXHA 2V6ZM 3DZDA 1D0LA 3E46A 3HY5A 1D2NA 3CF2A 2EJSA 4DUYM 1QVRA 1Z59A 2C99A 1VG5A 4JI5M 2KRUA 1L1ZA 1Z5CA 3FTCA 3KS4A 4LGMA 4DV2M 1UFZA 2MR9A 2XH9A 2DWZB 3CGWA 3WHLA 4YY3M 1R5LA 1R2YA 2Q2EB 4FCVA 4GHLA 1NV8A 2X4AA 4JI4M 2WZJA 3H4MA 1VDLA 2OPFA 1R7RA 3SHFA 3THGA 1LTMA 4B3TM 1ZMVA 2J5YA 3K1JA 2C9CA 1NVMA 1VEGA 3K2LA 1YSYA 2KW0A 4TUWA 2CWBA 3GRRA 3ZQJA 1V33A 2VIIA 3LCUA 3K9OA 1T3TA 4IBIA 1NJGA 2EKKA 3I01M 2JXNA 2WSFF 3GQ3A 3GPYA 2LH0A 2G3QA 3GQ5A 2R46A 4IJFA 5ITRA 2CHQA 3A42A 2VQFM 4D80A 1XHBA 2K47A 1G4AE 3GLGB 2Y21A 3FE3A 4I81A 2MROB 3KP1E 4G4RA 5EP3A 4NRWA 2DNAA 2QSFX 4DBGB 4AZFA 3U61A 3SARA 4X64M 1EFUB 2QENA 3DA1A 2FOIC 4HL4A 3PXGA 2C5RA 3BBZA 1NNUC 1OTRA 4B7GA 1N33M 2QP9X 1XB2B 3KSJA 4AQYM 2LVNC 1TH4A 2G8LA 4HEOA 5DYGA 3TL4X 3ZCBB 4DV4M 2D7HA 4OW0A 1E32A 1QDTA 2L7HA 4LJ6A 1DGGA 3U6CA 1PJSA 3PFIA 2LVAA 2DKLA 1HQCA 2YR0A 3IECA 1JR3A 3MHVC 4MGIE 5IWAM 4B3RM 2XEPA 2LBCA 4K0KM 4MGHA 3T38A 2H5XA 4M0DA 2XSZD 1TDHA 3CTWB 1GJSA 1FNNA 2CRUA 3CF6E 2RRUA 3J2PB 4LZZA 5EXSA 3GLHA 2L7IA 1A5TA 1GABA 4G6ZA 1GVNA 3E9SA 3GP1A 2L6OA 3QAUA 3GLFE 1MU5A 4KODA 4JV5M 1SXJB 3ILKA 1I4WA 1N32M 4JI1M 5FTJA 3U6QA 4DV3M 1F4IA 1XNRM 2DENA 3FUXA 3OTOM 3TWMA 5EXPA 1TGUA 4IBEA 2KNZA 3NBIA 4GH9A 3GLIA 2XFSA 5IT9S 4AKGA 4LJ5A 1K82A 2LVOC 5FLXS 4LFBM 1DGBA 1WIVA 4X65M 3SAVA 2BJVA 1NV9A 1VDDA 4DR7M 2CV1A 5C1BA 2O01F 2E5LM 4PD2A 1W5TA 4RKUF 3ZH9B 4DV7M 3SYLA 3RFWA 3U5ZB 4JI6M 1BVSA 2K6BA 1TH2A 2H1RA 4OVZA 1N36M 2KZUA 1G59A 4XBOA 4W5WA 1XC8A 4RNAA 2CV0A 2QBYB 4LJ7A 3HKPA 2ZANA 2MH8A 5C18A 1GKIA 3HHWA 4XK8F 5KQDA 4CIZA 2B3TA 3VKGA 5KPTA 1IXRC 1D0KA 1Q02A 1NHWC 2R4JA 4Y28F 3JAMS 2VQEM 1E94E 3VLFB 4L16A 1J5EM 3GPPA 3U60B 3SASA 1C1KA 1ZAEA 2DAIA 2UXCM 2EA0A 4PDIA 1PJIA 3R8FA 2Z4RA 1Z5AA 3AOEA 3KW6A 3GPUA 3TQSA 4D82A 1QANA 3VKHA 2QNJA 5EJCA 3FUTA 2UU9M 4LY6A 4GRIA 2W82A 1HJPA 1MX0A 1HNXM 2XF3A 1GO5A 1XXHE 2EKFA 3B7ZA 2HHHM 5KPRA 3M6AA 3KVWA 5DNYA 3FKEA 3K8ZA 5ITXA 5DFLA 3KOYE 4LZJA 3GLFB 5IREB 1K3WA 4YHHM 3NBXX 1IXSB 3NWLA 4B7FA 3TPZA 5A2QS 3HJSA 3PNYA 1ORYB 2HKJA 4BBAA 3BXWA 2X8AA 4DR5M 3HJ8A 3FUWA 4NXMM 4IBDA 2KHHA 5BPVA 2HWJA 2P5TA 4LJAA 2JY7A 3DOAA 4RF0A 2XZUA 3F92A 4MGZE 1OFIA 2YNMD 3SYKA 1XMOM 3W67A 2KZSA 4DR6M 4DR3M 2OO9A 3KOZE 1E9SA 3WHKA 4G4NA 1AIPC 3ZC7B 3T1YM 3TE6A 3K92A 2HAKA 2L4FA 1KSFX 2XSZA 3KSXA 3FUVA 3SBJA 4DUZM 3FTEA 5F3WA 4KHPM 2XFTA 5ITUA 3V76A 2UXBM 5FTMA 4CISA 1DGHB 1IXZA 2DZOB 3SMPA 3T6PA 1P3QQ 1IN8A 2R65A 2VF7A 3GRYA 3L29A 4R3DA 2QHOB 2QCUA 3MMPA 2L4EA 1R6BX 4DV6M 4JI8M 1RU3A 4ITQA 1G3IA 4NXNM 3L26A 1DO0A 2C98A 4I5SA 5EXXA 2D7EA 1Q39A 2BWEA 2G5GX 4OU7A 3FD9A 4DV1M 4DR4M 4G4OA 4GKJM 1QZMA 4LJ4A 1WJ7A 1QDRA 2C96A 1V34A 4II7A 2LTUA 3R9XB 2DWNA 3UZUA 1EIJA 5E6JA 4I8OA 2UUAM 3AOEC 3HZJA 4P16A 2D7GA 2Z3XA 3I4YA 1XXHB 3QYBA 4JI3M 5KPZA 1X37A 2V1CA 3KS8A 5FTNA 4BB9A 4PDGA 4IJEA 3GRUA 2QPAA 4L6V6 1EE8A 3SATA 4GC9A 2RKOA 2KXEA 2R62A 4FW9A 4GITA 4IBGA 5FTKA 1SXJA 3A45A 2WSEF 4G3OA 3VDUA 4F2LA 1NO1A 1JR3E 3W0LB 4IBKA 2R4EA 3FYDA 3Q8GA 2CHVA 3Q8XA 1WGLA 1QUTA 2YFQA 2R6FA 1T43A 3U6SA 1GL7A 1QAOA 1N75A 4KT0F 1QAQA 2XGNA 4UN2B 4QOSA 2QZ4A 1E9RA 3J27B 3FTFA 2VF8A 1OAOC 1DO2A 1QAMA 4M9SA 1T6OA 4AKHA 3PNVA 1N78A 3LVWA 2DWLA 2JNHA 3LVVA 3U6MA 2DAGA 1OQYA 3LW5F 3VFDA
chains in the Genus database with same CATH topology
3M7GA 5H37D 1IY1A 2R18A 1G41A 4GIPA 1XNQM 4LF7M 3D8LA 3FTDA 3I51A 3L27A 1HNZM 1HT2E 4DR2M 1N77A 3AJIB 1NY6A 3HU3A 1G8PA 3SC3A 3U61B 4QOZC 4DV0M 5JI2E 4D81A 1L2DA 4MGKE 4MB7A 3HU2A 1L1TA 2RGHA 3SHGB 4CGYB 1IM2A 1FJGM 3SAUA 2CUZA 4QNRA 4JI2M 1WXQA 4AKIA 5LMUM 1SXJD 4LCBA 1LV7A 1KFVA 5EXTA 1IY2A 3KOXE 4HLQA 2EO2A 3RGSA 2DZNB 2Y0QA 2LNHC 4BLCA 3KFUG 2X49A 2BJWA 3MK6A 4JI7M 1IY0A 1IQPA 4LGYA 4GHAA 2FNAA 4LFAM 3DFZA 4EIWA 4FCWA 1I94M 7CATA 2Y20A 4L78A 8CATA 2F5QA 5EP2A 3SFZA 1R2ZA 4FWDA 3HJQA 4JYAM 3GPXA 2OQ4A 3L25A 4LF5M 1J09A 3KDSE 3GRVA 4NRVA 4MGYE 1L2CA 1JQJC 4IBFA 1PM5A 2HL7A 2ZAOA 5GKNA 3J7BA 5ITTA 3GLIB 1Q3CA 2A5YB 3UK6A 1PJJA 2F5PA 2Y0TA 1HR0M 3VDPA 3U6OA 1IBMM 3SAWA 1L2BA 2UUBM 3GLGA 4LG2A 1NJFA 2I7PA 2DXIA 2F4VM 2ERCA 3J7AS 5DYIA 4LRTA 3PVSA 4LJ9A 3AOGA 5BR8M 3M0EA 2CE7A 1N34M 4B3SM 4LF9M 4M0WA 5FTLA 3UGJA 2I7NA 5KO3A 3J80S 3TWKA 3VK7A 3FUUA 4QNMA 1Z5BA 4QHSA 4KO8A 2M60A 5KQ8A 5LMNM 1QQWA 2DWMA 4LF4M 4LJ8A 3GQ4A 3BOSA 2ZBKB 3U6PA 2XZFA 3I4VA 1Z6TA 2V1UA 3KOWE 3L2AA 4S12A 4L15A 2ZM6M 3W0FA 2AHMA 3UMMA 1HNWM 4JI0M 4DR1M 4M9XA 3B9PA 4FCTA 3QWLA 4Z6YA 1H6UA 4LRSA 2UXDM 1YUBA 1KYIA 2LWXA 2BNKA 1IN6A 1HT1E 1SXJE 4G4QA 3RGPA 4NSOB 2F5SA 1XMQM 4JXJA 4OX9M 2HCBA 2JA2A 3JR5A 3AL0C 5JI3E 4WW0A 3T15A 2CV2A 4KLNA 1W5SA 4AG5A 2CFOA 3A98B 2ZAMA 4IBJA 5EP4A 1GLNA 2NQ8C 4PT5A 4LF8M 3U6EA 3U5ZA 3EIHA 5IZ7D 3IG8A 1QYRA 5ITQA 3AFHA 4IIWA 1ZQ9A 3AV0A 3SMSA 4B08A 1K3XA 4PCZA 3KP0E 1J7KA 1NSFA 2DHRA 4QHTA 2QBYA 2J7OA 2LXEA 4NSRA 4XGIA 3U6DA 4JN6A 1IN5A 2R45A 3HU1A 3LQRA 4MH0E 3RE8A 1IBLM 2F5NA 4FWHA 2J7NA 1GL6A 3IG5A 3U60A 3LMMA 4I4LA 4FVMA 3U6LA 2RGOA 4L8RC 2CHGA 3EIEA 2O5RA 3MJ5A 3KXEC 1UM8A 2L09A 3HHYA 4GKKM 4FD2A 4RF1A 4AI6A 2CEAA 4WURA 1YE9A 3J81S 3JR4A 2C9OA 4CHTB 3GLFA 1OFHA 1S3SA 3AKZA 4ZPXA 4L4UA 3A46A 1TDZA 3D8BA 1OJLA 3UJNA 5E26A 2YQZA 5ITYA 4IBBA 4AW4A 1SXJC 2EUCA 3HHXA 4AG6A 3GO8A 2UUCM 3HWSA 4FWGA 2FE8A 3GLHB 2XLJA 1NHGC 4Z8XA 4A3VB 1DGFA 1IN4A 1XWIA 2KA6B 4X66M 1HQYE 2M5ZA 4R7GA 4GC5A 4LF6M 1NY5A 3HHZA 5ITXE 3TWLA 4REZA 1L8QA 2DVWB 3CF0A 1DGHA 1JR3D 4NOOB 1IBKM 3T1HM 4MM3B 1IN7A 4GMQA 3C58A 4M9ZA 2FFJA 2F5OA 3HGIA 3L28A 4X62M 4B7HA 2Z4SA 3E4RA 1Q3BA 2KEBA 1NNJA 5EQTA 4IBCA 5FSWA 4DV5M 3LQQA 1TH3A 4NL4H 4B3MM 3VK8A 2KRKA 5EP1A 3FYCA 4OVZB 4LFCM 2Z7JA 2V6ZM 1XXHA 3DZDA 1D2NA 3CF2A 4DUYM 1QVRA 1Z59A 2C99A 4JI5M 2KRUA 1L1ZA 1Z5CA 3FTCA 3KS4A 4LGMA 4DV2M 2XH9A 2DWZB 3WHLA 4YY3M 1R2YA 2Q2EB 4FCVA 4GHLA 2X4AA 4JI4M 3H4MA 2OPFA 1R7RA 3SHFA 3THGA 4B3TM 3K1JA 2C9CA 1NVMA 3K2LA 1YSYA 2KW0A 4TUWA 3GRRA 2VIIA 1T3TA 4IBIA 1NJGA 3GQ3A 3GPYA 2LH0A 3GQ5A 2R46A 4IJFA 5ITRA 2CHQA 3A42A 2VQFM 4D80A 1XHBA 2K47A 1G4AE 3GLGB 2Y21A 4I81A 3KP1E 4G4RA 5EP3A 4NRWA 4AZFA 3U61A 3SARA 4X64M 2QENA 3DA1A 2FOIC 4HL4A 3PXGA 2C5RA 1NNUC 4B7GA 1N33M 2QP9X 3KSJA 4AQYM 1TH4A 5DYGA 2G8LA 3TL4X 4DV4M 3ZCBB 2D7HA 4OW0A 1E32A 2L7HA 4LJ6A 1DGGA 3U6CA 3PFIA 1HQCA 2YR0A 5IWAM 1JR3A 3MHVC 4MGIE 4B3RM 4K0KM 2XEPA 4MGHA 3T38A 4M0DA 2XSZD 1TDHA 3CTWB 1FNNA 3CF6E 3J2PB 4LZZA 5EXSA 3GLHA 2L7IA 4G6ZA 1GVNA 3E9SA 3GP1A 2L6OA 3QAUA 1MU5A 4KODA 4JV5M 1SXJB 3ILKA 1I4WA 1N32M 4JI1M 5FTJA 3U6QA 4DV3M 1XNRM 3FUXA 3OTOM 3TWMA 5EXPA 1TGUA 4IBEA 4GH9A 3NBIA 3GLIA 2XFSA 5IT9S 4AKGA 4LJ5A 1K82A 5FLXS 4LFBM 1DGBA 4X65M 3SAVA 2BJVA 1VDDA 4DR7M 2CV1A 5C1BA 2E5LM 4PD2A 1W5TA 3ZH9B 4DV7M 3SYLA 3RFWA 3U5ZB 4JI6M 1TH2A 2H1RA 4OVZA 1N36M 2KZUA 1G59A 4XBOA 4W5WA 1XC8A 4RNAA 2CV0A 2QBYB 4LJ7A 3HKPA 2ZANA 5C18A 1GKIA 3HHWA 5KQDA 3VKGA 5KPTA 1IXRC 2R4JA 1NHWC 3JAMS 2VQEM 1J5EM 1E94E 3VLFB 4L16A 3SASA 3GPPA 3U60B 1C1KA 1ZAEA 2UXCM 2EA0A 4PDIA 1PJIA 3R8FA 2Z4RA 1Z5AA 3AOEA 3KW6A 3GPUA 3TQSA 4D82A 1QANA 3VKHA 5EJCA 3FUTA 2UU9M 4LY6A 4GRIA 2W82A 1MX0A 1HNXM 2XF3A 2HHHM 5KPRA 3M6AA 3KVWA 5DNYA 3FKEA 3K8ZA 5ITXA 3GLFB 3KOYE 4LZJA 5IREB 1K3WA 4YHHM 1IXSB 3NWLA 4B7FA 3TPZA 5A2QS 3HJSA 3PNYA 1ORYB 2HKJA 4BBAA 2X8AA 4DR5M 3HJ8A 3FUWA 4NXMM 4IBDA 5BPVA 2P5TA 4LJAA 3DOAA 4RF0A 2XZUA 4MGZE 1OFIA 2YNMD 3SYKA 1XMOM 2KZSA 4DR6M 4DR3M 3KOZE 1E9SA 3WHKA 4G4NA 3ZC7B 3T1YM 3TE6A 3K92A 1KSFX 2XSZA 3KSXA 3FUVA 3SBJA 4DUZM 3FTEA 5F3WA 4KHPM 2XFTA 5ITUA 2UXBM 5FTMA 4CISA 1DGHB 1IXZA 2DZOB 3SMPA 1IN8A 2R65A 3GRYA 3L29A 4R3DA 2QCUA 4DV6M 4JI8M 4ITQA 1G3IA 4NXNM 3L26A 1DO0A 2C98A 4I5SA 5EXXA 2D7EA 1Q39A 2G5GX 4OU7A 3FD9A 4DV1M 4DR4M 4G4OA 4GKJM 1QZMA 4LJ4A 2C96A 4II7A 3R9XB 2DWNA 3UZUA 5E6JA 4I8OA 2UUAM 3AOEC 4P16A 2D7GA 2Z3XA 3I4YA 1XXHB 4JI3M 5KPZA 1X37A 2V1CA 3KS8A 5FTNA 4BB9A 4PDGA 4IJEA 3GRUA 2QPAA 1EE8A 3SATA 4GC9A 2RKOA 2KXEA 2R62A 4FW9A 4GITA 4IBGA 5FTKA 1SXJA 3A45A 3VDUA 3W0LB 4IBKA 2R4EA 3FYDA 2CHVA 3Q8XA 2YFQA 3U6SA 1GL7A 1QAOA 1N75A 1QAQA 2XGNA 4QOSA 2QZ4A 1E9RA 3J27B 3FTFA 1DO2A 1QAMA 4M9SA 4AKHA 3PNVA 1N78A 3LVWA 2DWLA 3LVVA 3U6MA 1R6BX 3VFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ M;  1XC8 A;  4LF7 M;  4DUY M;  1Z59 A;  4JI5 M;  1L1Z A;  4G4Q A;  1Z5C A;  1HNZ M;  4DV2 M;  4DR2 M;  2F5S A;  1XMQ M;  4YY3 M;  3JAM S;  2VQE M;  1J5E M;  1R2Y A;  2Q2E B;  3SAS A;  4OX9 M;  3GPP A;  2UXC M;  3JR5 A;  4JI4 M;  2EA0 A;  4PDI A;  1PJI A;  1Z5A A;  2OPF A;  4DV0 M;  4B3T M;  3GPU A;  1L2D A;  4MB7 A;  2UU9 M;  1L1T A;  1MX0 A;  1HNX M;  1FJG M;  2HHH M;  3SAU A;  4JI2 M;  5ITX A;  4LF8 M;  3U6E A;  3GQ3 A;  3GPY A;  5LMU M;  4YHH M;  1K3W A;  5ITQ A;  3GQ5 A;  1K3X A;  5A2Q S;  1KFV A;  5ITR A;  2HKJ A;  4PCZ A;  4DR5 M;  3A42 A;  2VQF M;  4NXM M;  3U6D A;  3DOA A;  4JI7 M;  1IBL M;  2F5N A;  4G4R A;  2XZU A;  4NRW A;  1XMO M;  4LFA M;  4DR3 M;  4DR6 M;  3SAR A;  4G4N A;  4X64 M;  3T1Y M;  1I94 M;  3U6L A;  2F5Q A;  3SBJ A;  4DUZ M;  1R2Z A;  4KHP M;  5ITU A;  1N33 M;  4JYA M;  3GPX A;  2OQ4 A;  2UXB M;  4CIS A;  4GKK M;  4AQY M;  4LF5 M;  3J81 S;  3JR4 A;  4NRV A;  4DV4 M;  1L2C A;  1PM5 A;  4JI8 M;  4DV6 M;  3U6C A;  4ITQ A;  3A46 A;  4NXN M;  5ITT A;  1TDZ A;  1Q3C A;  5IWA M;  4B3R M;  4K0K M;  1PJJ A;  2F5P A;  1Q39 A;  4DV1 M;  5ITY A;  1HR0 M;  4G4O A;  4DR4 M;  4GKJ M;  3GO8 A;  3U6O A;  1IBM M;  2UUC M;  3SAW A;  1L2B A;  2UUB M;  1TDH A;  2F4V M;  4X66 M;  2UUA M;  3J7A S;  4JI3 M;  4LF6 M;  4B3S M;  5BR8 M;  1N34 M;  4PDG A;  3GP1 A;  4LF9 M;  5ITX E;  1EE8 A;  3SAT A;  3J80 S;  3TWL A;  3TWK A;  3VK7 A;  1MU5 A;  4JV5 M;  1Z5B A;  1IBK M;  1N32 M;  3T1H M;  5LMN M;  4JI1 M;  4LF4 M;  3A45 A;  3U6Q A;  3GQ4 A;  4DV3 M;  1XNR M;  3C58 A;  2ZBK B;  3OTO M;  3U6P A;  3TWM A;  2XZF A;  2F5O A;  4X62 M;  5IT9 S;  3U6S A;  1Q3B A;  1K82 A;  5FLX S;  4LFB M;  4X65 M;  2ZM6 M;  3SAV A;  3W0F A;  1NNJ A;  1HNW M;  4JI0 M;  4DV5 M;  4DR1 M;  4DR7 M;  2E5L M;  4B3M M;  4PD2 A;  4DV7 M;  3VK8 A;  4JI6 M;  3U6M A;  4LFC M;  2UXD M;  1N36 M; 
#chains in the Genus database with same CATH topology
 3M7G A;  5H37 D;  1IY1 A;  2R18 A;  1G41 A;  4GIP A;  1XNQ M;  4LF7 M;  2L2D A;  1QUS A;  4Q7J A;  1TF0 B;  3D8L A;  3FTD A;  3I51 A;  3L27 A;  1HNZ M;  1HT2 E;  4DR2 M;  1N77 A;  3GLI E;  3AJI B;  1NY6 A;  3HU3 A;  1G8P A;  3HX3 A;  3SC3 A;  3U61 B;  4QOZ C;  2JY6 B;  4DV0 M;  5JI2 E;  3B7N A;  4D81 A;  1L2D A;  4MGK E;  3H4J A;  4MB7 A;  3HU2 A;  1L1T A;  1OIZ A;  1VEK A;  2RGH A;  3B89 A;  3SHG B;  4CGY B;  1IM2 A;  1OAI A;  1FJG M;  1JB0 F;  3SAU A;  2CUZ A;  4QNR A;  3W68 A;  4JI2 M;  1WXQ A;  4AKI A;  5LMU M;  1SXJ D;  4LCB A;  1LV7 A;  1IXS A;  1KFV A;  5EXT A;  1IY2 A;  3KOX E;  4HLQ A;  2EO2 A;  3RGS A;  2N35 A;  2DZN B;  2Y0Q A;  2LNH C;  4BLC A;  3KFU G;  2X49 A;  2BJW A;  3MK6 A;  4JI7 M;  1IY0 A;  3I04 M;  1IQP A;  4R71 A;  1AUA A;  4LGY A;  4WP2 A;  1PRB A;  4NC6 A;  4GHA A;  2FNA A;  4LFA M;  3DFZ A;  4EIW A;  4FCW A;  1I94 M;  7CAT A;  2Y20 A;  4L78 A;  2DAE A;  8CAT A;  2F5Q A;  5EP2 A;  1VEJ A;  3SFZ A;  1R2Z A;  1R4G A;  1CUK A;  4FWD A;  3HJQ A;  4JYA M;  3GPX A;  2OQ4 A;  3L25 A;  1WHC A;  1IFY A;  4LF5 M;  2GNO A;  1J09 A;  3GRV A;  3KDS E;  4NRV A;  4MGY E;  2JWS A;  1SG9 A;  1JQJ C;  4IBF A;  1PM5 A;  2HL7 A;  2ZAO A;  5GKN A;  1L2C A;  4ANR A;  3J7B A;  3FRI A;  1V92 A;  5ITT A;  1Q3C A;  2A5Y B;  1PJQ A;  3UK6 A;  3GLI B;  1PJJ A;  2F5P A;  1ZV1 A;  2CP8 A;  2Y0T A;  3B7Q A;  3QYE A;  3VDP A;  1GJT A;  1HR0 M;  3U6O A;  2R0I A;  1IBM M;  3SAW A;  2BWB A;  1L2B A;  2UUB M;  3GLG A;  4LG2 A;  2LVP C;  1NJF A;  1OKS A;  2I7P A;  2DXI A;  2F4V M;  2ERC A;  2FS1 A;  3J7A S;  5DYI A;  1TR8 A;  3PVS A;  4LJ9 A;  3AOG A;  4LRT A;  3M0E A;  2CE7 A;  4P17 A;  5BR8 M;  1N34 M;  4B3S M;  4LF9 M;  4M0W A;  5FTL A;  1MN3 A;  3UGJ A;  1PJT A;  2I7N A;  5KO3 A;  3J80 S;  3TWK A;  1OIP A;  3FUU A;  4QNM A;  3VK7 A;  1TTE A;  1Z5B A;  4QHS A;  4KO8 A;  2M60 A;  5KQ8 A;  5LMN M;  1QQW A;  2DWM A;  4LF4 M;  4LJ8 A;  3GQ4 A;  3BOS A;  2ZBK B;  3U6P A;  2XZF A;  2LHC A;  3I4V A;  1Z6T A;  3IHP A;  2V1U A;  3KOW E;  3L2A A;  4S12 A;  4L15 A;  2JP7 A;  2ZM6 M;  3W0F A;  2ZTC A;  3C3E A;  2AHM A;  2APL A;  3UMM A;  1HNW M;  2OOA A;  4JI0 M;  3K9P A;  4M9X A;  3B9P A;  4DR1 M;  4FCT A;  3QWL A;  4Z6Y A;  3B74 A;  2R44 A;  1H6U A;  4LRS A;  2UXD M;  2DAK A;  1YUB A;  2LWX A;  2BNK A;  1KYI A;  1IN6 A;  1G71 A;  1HT1 E;  1SXJ E;  1WR1 B;  2DZL A;  3C3D A;  4G4Q A;  3RGP A;  4NSO B;  2F5S A;  2JUJ A;  1XMQ M;  4JXJ A;  4OX9 M;  2HCB A;  2JA2 A;  3JR5 A;  2MGW A;  3AL0 C;  5JI3 E;  4WW0 A;  3T15 A;  3C9P A;  2CV2 A;  4KLN A;  1W5S A;  4AG5 A;  1ZMW A;  2CFO A;  2DAM A;  2K9D A;  3A98 B;  2ZAM A;  3GLH E;  4IBJ A;  5EP4 A;  1ZMU A;  1GLN A;  2NQ8 C;  4PT5 A;  2KDL A;  4LF8 M;  3U6E A;  3U5Z A;  3EIH A;  5IZ7 D;  3IG8 A;  2MJ5 B;  4GEW A;  1QYR A;  5ITQ A;  3AFH A;  4IIW A;  1ZQ9 A;  3AV0 A;  3SMS A;  2OOB A;  4B08 A;  1PGY A;  4F1I A;  1K3X A;  4PCZ A;  3KP0 E;  1J7K A;  1NSF A;  2DHR A;  4QHT A;  2QBY A;  2J7O A;  2LXE A;  4NSR A;  4XGI A;  3U6D A;  4JN6 A;  1IN5 A;  2DHY A;  2R45 A;  2WSC F;  3HU1 A;  3E21 A;  3LQR A;  4MH0 E;  3RE8 A;  1IBL M;  2F5N A;  4FWH A;  2J7N A;  1GL6 A;  3IG5 A;  3U60 A;  3LMM A;  4I4L A;  4FVM A;  1D0M A;  3U6L A;  1VQ1 A;  2RGO A;  4L8R C;  2CHG A;  3EIE A;  2LVQ D;  2O5R A;  3MJ5 A;  2LHG A;  1UM8 A;  3KXE C;  2L09 A;  3HHY A;  4GKK M;  4FD2 A;  4RF1 A;  4AI6 A;  2CEA A;  1DV0 A;  4WUR A;  1YE9 A;  3J81 S;  3JR4 A;  1Y8G A;  2C9O A;  2JY5 A;  1OFH A;  1S3S A;  4CHT B;  3AKZ A;  3GLF A;  1QZE A;  4ZPX A;  2ZTD A;  4L4U A;  3A46 A;  3LCV B;  1TDZ A;  3D8B A;  1OJL A;  4CJ6 A;  3UJN A;  5E26 A;  2YQZ A;  5ITY A;  4IBB A;  4AW4 A;  1SXJ C;  2EUC A;  3HHX A;  4AG6 A;  3GO8 A;  2UUC M;  3HWS A;  4FWG A;  2FE8 A;  2Z8Y M;  3GLH B;  2XLJ A;  1C7Y A;  1NHG C;  4Z8X A;  4A3V B;  1DGF A;  1IN4 A;  1XWI A;  2KA6 B;  4X66 M;  1HQY E;  2M5Z A;  4R7G A;  4GC5 A;  4LF6 M;  2O25 A;  1MJG M;  1NY5 A;  3HHZ A;  5ITX E;  3TWL A;  4REZ A;  1L8Q A;  2JZ1 A;  2DVW B;  3CF0 A;  1DGH A;  1JR3 D;  4NOO B;  5L8R F;  3T1H M;  4MM3 B;  1IBK M;  2VDB B;  1YLA A;  1IN7 A;  4GMQ A;  2K0B X;  2QQ8 A;  3C58 A;  4M9Z A;  2FFJ A;  2F5O A;  2GQF A;  3HGI A;  3L28 A;  4X62 M;  4B7H A;  2Z4S A;  3E4R A;  1Q3B A;  3GLG E;  2KEB A;  1NNJ A;  2DI0 A;  5EQT A;  4IBC A;  5FSW A;  2JY8 A;  4DV5 M;  2FH0 A;  3LQQ A;  1TH3 A;  3FRH A;  4NL4 H;  4B3M M;  2KNV A;  3VK8 A;  2KRK A;  5EP1 A;  3FYC A;  2JZ0 A;  2KNA A;  1WGN A;  4OVZ B;  2Z7J A;  4LFC M;  1XXH A;  2V6Z M;  3DZD A;  1D0L A;  3E46 A;  3HY5 A;  1D2N A;  3CF2 A;  2EJS A;  4DUY M;  1QVR A;  1Z59 A;  2C99 A;  1VG5 A;  4JI5 M;  2KRU A;  1L1Z A;  1Z5C A;  3FTC A;  3KS4 A;  4LGM A;  4DV2 M;  1UFZ A;  2MR9 A;  2XH9 A;  2DWZ B;  3CGW A;  3WHL A;  4YY3 M;  1R5L A;  1R2Y A;  2Q2E B;  4FCV A;  4GHL A;  1NV8 A;  2X4A A;  4JI4 M;  2WZJ A;  3H4M A;  1VDL A;  2OPF A;  1R7R A;  3SHF A;  3THG A;  1LTM A;  4B3T M;  1ZMV A;  2J5Y A;  3K1J A;  2C9C A;  1NVM A;  1VEG A;  3K2L A;  1YSY A;  2KW0 A;  4TUW A;  2CWB A;  3GRR A;  3ZQJ A;  1V33 A;  2VII A;  3LCU A;  3K9O A;  1T3T A;  4IBI A;  1NJG A;  2EKK A;  3I01 M;  2JXN A;  2WSF F;  3GQ3 A;  3GPY A;  2LH0 A;  2G3Q A;  3GQ5 A;  2R46 A;  4IJF A;  5ITR A;  2CHQ A;  3A42 A;  2VQF M;  4D80 A;  1XHB A;  2K47 A;  1G4A E;  3GLG B;  2Y21 A;  3FE3 A;  4I81 A;  2MRO B;  3KP1 E;  4G4R A;  5EP3 A;  4NRW A;  2DNA A;  2QSF X;  4DBG B;  4AZF A;  3U61 A;  3SAR A;  4X64 M;  1EFU B;  2QEN A;  3DA1 A;  2FOI C;  4HL4 A;  3PXG A;  2C5R A;  3BBZ A;  1NNU C;  1OTR A;  4B7G A;  1N33 M;  2QP9 X;  1XB2 B;  3KSJ A;  4AQY M;  2LVN C;  1TH4 A;  2G8L A;  4HEO A;  5DYG A;  3TL4 X;  3ZCB B;  4DV4 M;  2D7H A;  4OW0 A;  1E32 A;  1QDT A;  2L7H A;  4LJ6 A;  1DGG A;  3U6C A;  1PJS A;  3PFI A;  2LVA A;  2DKL A;  1HQC A;  2YR0 A;  3IEC A;  1JR3 A;  3MHV C;  4MGI E;  5IWA M;  4B3R M;  2XEP A;  2LBC A;  4K0K M;  4MGH A;  3T38 A;  2H5X A;  4M0D A;  2XSZ D;  1TDH A;  3CTW B;  1GJS A;  1FNN A;  2CRU A;  3CF6 E;  2RRU A;  3J2P B;  4LZZ A;  5EXS A;  3GLH A;  2L7I A;  1A5T A;  1GAB A;  4G6Z A;  1GVN A;  3E9S A;  3GP1 A;  2L6O A;  3QAU A;  3GLF E;  1MU5 A;  4KOD A;  4JV5 M;  1SXJ B;  3ILK A;  1I4W A;  1N32 M;  4JI1 M;  5FTJ A;  3U6Q A;  4DV3 M;  1F4I A;  1XNR M;  2DEN A;  3FUX A;  3OTO M;  3TWM A;  5EXP A;  1TGU A;  4IBE A;  2KNZ A;  3NBI A;  4GH9 A;  3GLI A;  2XFS A;  5IT9 S;  4AKG A;  4LJ5 A;  1K82 A;  2LVO C;  5FLX S;  4LFB M;  1DGB A;  1WIV A;  4X65 M;  3SAV A;  2BJV A;  1NV9 A;  1VDD A;  4DR7 M;  2CV1 A;  5C1B A;  2O01 F;  2E5L M;  4PD2 A;  1W5T A;  4RKU F;  3ZH9 B;  4DV7 M;  3SYL A;  3RFW A;  3U5Z B;  4JI6 M;  1BVS A;  2K6B A;  1TH2 A;  2H1R A;  4OVZ A;  1N36 M;  2KZU A;  1G59 A;  4XBO A;  4W5W A;  1XC8 A;  4RNA A;  2CV0 A;  2QBY B;  4LJ7 A;  3HKP A;  2ZAN A;  2MH8 A;  5C18 A;  1GKI A;  3HHW A;  4XK8 F;  5KQD A;  4CIZ A;  2B3T A;  3VKG A;  5KPT A;  1IXR C;  1D0K A;  1Q02 A;  1NHW C;  2R4J A;  4Y28 F;  3JAM S;  2VQE M;  1E94 E;  3VLF B;  4L16 A;  1J5E M;  3GPP A;  3U60 B;  3SAS A;  1C1K A;  1ZAE A;  2DAI A;  2UXC M;  2EA0 A;  4PDI A;  1PJI A;  3R8F A;  2Z4R A;  1Z5A A;  3AOE A;  3KW6 A;  3GPU A;  3TQS A;  4D82 A;  1QAN A;  3VKH A;  2QNJ A;  5EJC A;  3FUT A;  2UU9 M;  4LY6 A;  4GRI A;  2W82 A;  1HJP A;  1MX0 A;  1HNX M;  2XF3 A;  1GO5 A;  1XXH E;  2EKF A;  3B7Z A;  2HHH M;  5KPR A;  3M6A A;  3KVW A;  5DNY A;  3FKE A;  3K8Z A;  5ITX A;  5DFL A;  3KOY E;  4LZJ A;  3GLF B;  5IRE B;  1K3W A;  4YHH M;  3NBX X;  1IXS B;  3NWL A;  4B7F A;  3TPZ A;  5A2Q S;  3HJS A;  3PNY A;  1ORY B;  2HKJ A;  4BBA A;  3BXW A;  2X8A A;  4DR5 M;  3HJ8 A;  3FUW A;  4NXM M;  4IBD A;  2KHH A;  5BPV A;  2HWJ A;  2P5T A;  4LJA A;  2JY7 A;  3DOA A;  4RF0 A;  2XZU A;  3F92 A;  4MGZ E;  1OFI A;  2YNM D;  3SYK A;  1XMO M;  3W67 A;  2KZS A;  4DR6 M;  4DR3 M;  2OO9 A;  3KOZ E;  1E9S A;  3WHK A;  4G4N A;  1AIP C;  3ZC7 B;  3T1Y M;  3TE6 A;  3K92 A;  2HAK A;  2L4F A;  1KSF X;  2XSZ A;  3KSX A;  3FUV A;  3SBJ A;  4DUZ M;  3FTE A;  5F3W A;  4KHP M;  2XFT A;  5ITU A;  3V76 A;  2UXB M;  5FTM A;  4CIS A;  1DGH B;  1IXZ A;  2DZO B;  3SMP A;  3T6P A;  1P3Q Q;  1IN8 A;  2R65 A;  2VF7 A;  3GRY A;  3L29 A;  4R3D A;  2QHO B;  2QCU A;  3MMP A;  2L4E A;  1R6B X;  4DV6 M;  4JI8 M;  1RU3 A;  4ITQ A;  1G3I A;  4NXN M;  3L26 A;  1DO0 A;  2C98 A;  4I5S A;  5EXX A;  2D7E A;  1Q39 A;  2BWE A;  2G5G X;  4OU7 A;  3FD9 A;  4DV1 M;  4DR4 M;  4G4O A;  4GKJ M;  1QZM A;  4LJ4 A;  1WJ7 A;  1QDR A;  2C96 A;  1V34 A;  4II7 A;  2LTU A;  3R9X B;  2DWN A;  3UZU A;  1EIJ A;  5E6J A;  4I8O A;  2UUA M;  3AOE C;  3HZJ A;  4P16 A;  2D7G A;  2Z3X A;  3I4Y A;  1XXH B;  3QYB A;  4JI3 M;  5KPZ A;  1X37 A;  2V1C A;  3KS8 A;  5FTN A;  4BB9 A;  4PDG A;  4IJE A;  3GRU A;  2QPA A;  4L6V 6;  1EE8 A;  3SAT A;  4GC9 A;  2RKO A;  2KXE A;  2R62 A;  4FW9 A;  4GIT A;  4IBG A;  5FTK A;  1SXJ A;  3A45 A;  2WSE F;  4G3O A;  3VDU A;  4F2L A;  1NO1 A;  1JR3 E;  3W0L B;  4IBK A;  2R4E A;  3FYD A;  3Q8G A;  2CHV A;  3Q8X A;  1WGL A;  1QUT A;  2YFQ A;  2R6F A;  1T43 A;  3U6S A;  1GL7 A;  1QAO A;  1N75 A;  4KT0 F;  1QAQ A;  2XGN A;  4UN2 B;  4QOS A;  2QZ4 A;  1E9R A;  3J27 B;  3FTF A;  2VF8 A;  1OAO C;  1DO2 A;  1QAM A;  4M9S A;  1T6O A;  4AKH A;  3PNV A;  1N78 A;  3LVW A;  2DWL A;  2JNH A;  3LVV A;  3U6M A;  2DAG A;  1OQY A;  3LW5 F;  3VFD A; 
#chains in the Genus database with same CATH homology
 3M7G A;  5H37 D;  1IY1 A;  2R18 A;  1G41 A;  4GIP A;  1XNQ M;  4LF7 M;  3D8L A;  3FTD A;  3I51 A;  3L27 A;  1HNZ M;  1HT2 E;  4DR2 M;  1N77 A;  3AJI B;  1NY6 A;  3HU3 A;  1G8P A;  3SC3 A;  3U61 B;  4QOZ C;  4DV0 M;  5JI2 E;  4D81 A;  1L2D A;  4MGK E;  4MB7 A;  3HU2 A;  1L1T A;  2RGH A;  3SHG B;  4CGY B;  1IM2 A;  1FJG M;  3SAU A;  2CUZ A;  4QNR A;  4JI2 M;  1WXQ A;  4AKI A;  5LMU M;  1SXJ D;  4LCB A;  1LV7 A;  1KFV A;  5EXT A;  1IY2 A;  3KOX E;  4HLQ A;  2EO2 A;  3RGS A;  2DZN B;  2Y0Q A;  2LNH C;  4BLC A;  3KFU G;  2X49 A;  2BJW A;  3MK6 A;  4JI7 M;  1IY0 A;  1IQP A;  4LGY A;  4GHA A;  2FNA A;  4LFA M;  3DFZ A;  4EIW A;  4FCW A;  1I94 M;  7CAT A;  2Y20 A;  4L78 A;  8CAT A;  2F5Q A;  5EP2 A;  3SFZ A;  1R2Z A;  4FWD A;  3HJQ A;  4JYA M;  3GPX A;  2OQ4 A;  3L25 A;  4LF5 M;  1J09 A;  3KDS E;  3GRV A;  4NRV A;  4MGY E;  1L2C A;  1JQJ C;  4IBF A;  1PM5 A;  2HL7 A;  2ZAO A;  5GKN A;  3J7B A;  5ITT A;  3GLI B;  1Q3C A;  2A5Y B;  3UK6 A;  1PJJ A;  2F5P A;  2Y0T A;  1HR0 M;  3VDP A;  3U6O A;  1IBM M;  3SAW A;  1L2B A;  2UUB M;  3GLG A;  4LG2 A;  1NJF A;  2I7P A;  2DXI A;  2F4V M;  2ERC A;  3J7A S;  5DYI A;  4LRT A;  3PVS A;  4LJ9 A;  3AOG A;  5BR8 M;  3M0E A;  2CE7 A;  1N34 M;  4B3S M;  4LF9 M;  4M0W A;  5FTL A;  3UGJ A;  2I7N A;  5KO3 A;  3J80 S;  3TWK A;  3VK7 A;  3FUU A;  4QNM A;  1Z5B A;  4QHS A;  4KO8 A;  2M60 A;  5KQ8 A;  5LMN M;  1QQW A;  2DWM A;  4LF4 M;  4LJ8 A;  3GQ4 A;  3BOS A;  2ZBK B;  3U6P A;  2XZF A;  3I4V A;  1Z6T A;  2V1U A;  3KOW E;  3L2A A;  4S12 A;  4L15 A;  2ZM6 M;  3W0F A;  2AHM A;  3UMM A;  1HNW M;  4JI0 M;  4DR1 M;  4M9X A;  3B9P A;  4FCT A;  3QWL A;  4Z6Y A;  1H6U A;  4LRS A;  2UXD M;  1YUB A;  1KYI A;  2LWX A;  2BNK A;  1IN6 A;  1HT1 E;  1SXJ E;  4G4Q A;  3RGP A;  4NSO B;  2F5S A;  1XMQ M;  4JXJ A;  4OX9 M;  2HCB A;  2JA2 A;  3JR5 A;  3AL0 C;  5JI3 E;  4WW0 A;  3T15 A;  2CV2 A;  4KLN A;  1W5S A;  4AG5 A;  2CFO A;  3A98 B;  2ZAM A;  4IBJ A;  5EP4 A;  1GLN A;  2NQ8 C;  4PT5 A;  4LF8 M;  3U6E A;  3U5Z A;  3EIH A;  5IZ7 D;  3IG8 A;  1QYR A;  5ITQ A;  3AFH A;  4IIW A;  1ZQ9 A;  3AV0 A;  3SMS A;  4B08 A;  1K3X A;  4PCZ A;  3KP0 E;  1J7K A;  1NSF A;  2DHR A;  4QHT A;  2QBY A;  2J7O A;  2LXE A;  4NSR A;  4XGI A;  3U6D A;  4JN6 A;  1IN5 A;  2R45 A;  3HU1 A;  3LQR A;  4MH0 E;  3RE8 A;  1IBL M;  2F5N A;  4FWH A;  2J7N A;  1GL6 A;  3IG5 A;  3U60 A;  3LMM A;  4I4L A;  4FVM A;  3U6L A;  2RGO A;  4L8R C;  2CHG A;  3EIE A;  2O5R A;  3MJ5 A;  3KXE C;  1UM8 A;  2L09 A;  3HHY A;  4GKK M;  4FD2 A;  4RF1 A;  4AI6 A;  2CEA A;  4WUR A;  1YE9 A;  3J81 S;  3JR4 A;  2C9O A;  4CHT B;  3GLF A;  1OFH A;  1S3S A;  3AKZ A;  4ZPX A;  4L4U A;  3A46 A;  1TDZ A;  3D8B A;  1OJL A;  3UJN A;  5E26 A;  2YQZ A;  5ITY A;  4IBB A;  4AW4 A;  1SXJ C;  2EUC A;  3HHX A;  4AG6 A;  3GO8 A;  2UUC M;  3HWS A;  4FWG A;  2FE8 A;  3GLH B;  2XLJ A;  1NHG C;  4Z8X A;  4A3V B;  1DGF A;  1IN4 A;  1XWI A;  2KA6 B;  4X66 M;  1HQY E;  2M5Z A;  4R7G A;  4GC5 A;  4LF6 M;  1NY5 A;  3HHZ A;  5ITX E;  3TWL A;  4REZ A;  1L8Q A;  2DVW B;  3CF0 A;  1DGH A;  1JR3 D;  4NOO B;  1IBK M;  3T1H M;  4MM3 B;  1IN7 A;  4GMQ A;  3C58 A;  4M9Z A;  2FFJ A;  2F5O A;  3HGI A;  3L28 A;  4X62 M;  4B7H A;  2Z4S A;  3E4R A;  1Q3B A;  2KEB A;  1NNJ A;  5EQT A;  4IBC A;  5FSW A;  4DV5 M;  3LQQ A;  1TH3 A;  4NL4 H;  4B3M M;  3VK8 A;  2KRK A;  5EP1 A;  3FYC A;  4OVZ B;  4LFC M;  2Z7J A;  2V6Z M;  1XXH A;  3DZD A;  1D2N A;  3CF2 A;  4DUY M;  1QVR A;  1Z59 A;  2C99 A;  4JI5 M;  2KRU A;  1L1Z A;  1Z5C A;  3FTC A;  3KS4 A;  4LGM A;  4DV2 M;  2XH9 A;  2DWZ B;  3WHL A;  4YY3 M;  1R2Y A;  2Q2E B;  4FCV A;  4GHL A;  2X4A A;  4JI4 M;  3H4M A;  2OPF A;  1R7R A;  3SHF A;  3THG A;  4B3T M;  3K1J A;  2C9C A;  1NVM A;  3K2L A;  1YSY A;  2KW0 A;  4TUW A;  3GRR A;  2VII A;  1T3T A;  4IBI A;  1NJG A;  3GQ3 A;  3GPY A;  2LH0 A;  3GQ5 A;  2R46 A;  4IJF A;  5ITR A;  2CHQ A;  3A42 A;  2VQF M;  4D80 A;  1XHB A;  2K47 A;  1G4A E;  3GLG B;  2Y21 A;  4I81 A;  3KP1 E;  4G4R A;  5EP3 A;  4NRW A;  4AZF A;  3U61 A;  3SAR A;  4X64 M;  2QEN A;  3DA1 A;  2FOI C;  4HL4 A;  3PXG A;  2C5R A;  1NNU C;  4B7G A;  1N33 M;  2QP9 X;  3KSJ A;  4AQY M;  1TH4 A;  5DYG A;  2G8L A;  3TL4 X;  4DV4 M;  3ZCB B;  2D7H A;  4OW0 A;  1E32 A;  2L7H A;  4LJ6 A;  1DGG A;  3U6C A;  3PFI A;  1HQC A;  2YR0 A;  5IWA M;  1JR3 A;  3MHV C;  4MGI E;  4B3R M;  4K0K M;  2XEP A;  4MGH A;  3T38 A;  4M0D A;  2XSZ D;  1TDH A;  3CTW B;  1FNN A;  3CF6 E;  3J2P B;  4LZZ A;  5EXS A;  3GLH A;  2L7I A;  4G6Z A;  1GVN A;  3E9S A;  3GP1 A;  2L6O A;  3QAU A;  1MU5 A;  4KOD A;  4JV5 M;  1SXJ B;  3ILK A;  1I4W A;  1N32 M;  4JI1 M;  5FTJ A;  3U6Q A;  4DV3 M;  1XNR M;  3FUX A;  3OTO M;  3TWM A;  5EXP A;  1TGU A;  4IBE A;  4GH9 A;  3NBI A;  3GLI A;  2XFS A;  5IT9 S;  4AKG A;  4LJ5 A;  1K82 A;  5FLX S;  4LFB M;  1DGB A;  4X65 M;  3SAV A;  2BJV A;  1VDD A;  4DR7 M;  2CV1 A;  5C1B A;  2E5L M;  4PD2 A;  1W5T A;  3ZH9 B;  4DV7 M;  3SYL A;  3RFW A;  3U5Z B;  4JI6 M;  1TH2 A;  2H1R A;  4OVZ A;  1N36 M;  2KZU A;  1G59 A;  4XBO A;  4W5W A;  1XC8 A;  4RNA A;  2CV0 A;  2QBY B;  4LJ7 A;  3HKP A;  2ZAN A;  5C18 A;  1GKI A;  3HHW A;  5KQD A;  3VKG A;  5KPT A;  1IXR C;  2R4J A;  1NHW C;  3JAM S;  2VQE M;  1J5E M;  1E94 E;  3VLF B;  4L16 A;  3SAS A;  3GPP A;  3U60 B;  1C1K A;  1ZAE A;  2UXC M;  2EA0 A;  4PDI A;  1PJI A;  3R8F A;  2Z4R A;  1Z5A A;  3AOE A;  3KW6 A;  3GPU A;  3TQS A;  4D82 A;  1QAN A;  3VKH A;  5EJC A;  3FUT A;  2UU9 M;  4LY6 A;  4GRI A;  2W82 A;  1MX0 A;  1HNX M;  2XF3 A;  2HHH M;  5KPR A;  3M6A A;  3KVW A;  5DNY A;  3FKE A;  3K8Z A;  5ITX A;  3GLF B;  3KOY E;  4LZJ A;  5IRE B;  1K3W A;  4YHH M;  1IXS B;  3NWL A;  4B7F A;  3TPZ A;  5A2Q S;  3HJS A;  3PNY A;  1ORY B;  2HKJ A;  4BBA A;  2X8A A;  4DR5 M;  3HJ8 A;  3FUW A;  4NXM M;  4IBD A;  5BPV A;  2P5T A;  4LJA A;  3DOA A;  4RF0 A;  2XZU A;  4MGZ E;  1OFI A;  2YNM D;  3SYK A;  1XMO M;  2KZS A;  4DR6 M;  4DR3 M;  3KOZ E;  1E9S A;  3WHK A;  4G4N A;  3ZC7 B;  3T1Y M;  3TE6 A;  3K92 A;  1KSF X;  2XSZ A;  3KSX A;  3FUV A;  3SBJ A;  4DUZ M;  3FTE A;  5F3W A;  4KHP M;  2XFT A;  5ITU A;  2UXB M;  5FTM A;  4CIS A;  1DGH B;  1IXZ A;  2DZO B;  3SMP A;  1IN8 A;  2R65 A;  3GRY A;  3L29 A;  4R3D A;  2QCU A;  4DV6 M;  4JI8 M;  4ITQ A;  1G3I A;  4NXN M;  3L26 A;  1DO0 A;  2C98 A;  4I5S A;  5EXX A;  2D7E A;  1Q39 A;  2G5G X;  4OU7 A;  3FD9 A;  4DV1 M;  4DR4 M;  4G4O A;  4GKJ M;  1QZM A;  4LJ4 A;  2C96 A;  4II7 A;  3R9X B;  2DWN A;  3UZU A;  5E6J A;  4I8O A;  2UUA M;  3AOE C;  4P16 A;  2D7G A;  2Z3X A;  3I4Y A;  1XXH B;  4JI3 M;  5KPZ A;  1X37 A;  2V1C A;  3KS8 A;  5FTN A;  4BB9 A;  4PDG A;  4IJE A;  3GRU A;  2QPA A;  1EE8 A;  3SAT A;  4GC9 A;  2RKO A;  2KXE A;  2R62 A;  4FW9 A;  4GIT A;  4IBG A;  5FTK A;  1SXJ A;  3A45 A;  3VDU A;  3W0L B;  4IBK A;  2R4E A;  3FYD A;  2CHV A;  3Q8X A;  2YFQ A;  3U6S A;  1GL7 A;  1QAO A;  1N75 A;  1QAQ A;  2XGN A;  4QOS A;  2QZ4 A;  1E9R A;  3J27 B;  3FTF A;  1DO2 A;  1QAM A;  4M9S A;  4AKH A;  3PNV A;  1N78 A;  3LVW A;  2DWL A;  3LVV A;  3U6M A;  1R6B X;  3VFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...