4YY3M

30s ribosomal subunit- higb complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4yy3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4yy3M02
1N33M 3DOAA 4YHHM 4OX9M 3GPUA 2E5LM 5ITQA 3SBJA 4DR2M 4G4OA 3JR4A 4DV0M 5A2QS 4DV1M 1HNXM 3TWKA 2UUAM 4ITQA 3U6LA 4PCZA 3J7AS 1L1ZA 1HR0M 3GPPA 4LF8M 4JI3M 1N32M 4KHPM 1IBLM 3SATA 3A46A 3W0FA 3SAWA 4X62M 3J81S 4DR1M 4DUYM 2F5OA 4NXNM 2UUBM 3A42A 2UUCM 4JI5M 1TDHA 3GPXA 2VQFM 4JI2M 3VK8A 3C58A 1MX0A 5ITUA 4PDGA 2Q2EB 4K0KM 4GKJM 4DR5M 3T1YM 1Z5BA 2OQ4A 4DV4M 1N34M 1KFVA 3GO8A 2ZM6M 4DR3M 3U6PA 4G4NA 4JI7M 3TWLA 4JI4M 5IT9S 3U6EA 1K3XA 3TWMA 2F4VM 4LFAM 1XNQM 4X64M 3U6MA 1Z5AA 3U6QA 4B3TM 4DV2M 5IWAM 5LMNM 4DV7M 1IBKM 2UU9M 3SASA 4NXMM 3U6SA 4DV3M 1XNRM 4DR4M 4JI1M 1R2ZA 1NNJA 4B3SM 3U6DA 1R2YA 4JI8M 4B3RM 3GQ5A 4PDIA 4G4QA 5ITXA 1XMOM 4LF5M 1Z5CA 5FLXS 4JI6M 4DR7M 1PM5A 5ITTA 2F5PA 2UXCM 1EE8A 4JI0M 4LF7M 4DUZM 4YY3M 3GPYA 2ZBKB 4CISA 1PJIA 1Q3CA 4GKKM 3T1HM 1L2DA 2XZFA 3SAUA 4LFCM 5ITYA 1L1TA 2UXBM 3OTOM 1I94M 1N36M 4LF4M 1Q39A 5BR8M 3J80S 2F5QA 2VQEM 3JR5A 4JV5M 5LMUM 3U6OA 4DR6M 4DV5M 4LFBM 4LF6M 3SAVA 4NRVA 1K82A 5ITXE 1PJJA 1Z59A 4LF9M 2UXDM 3SARA 1L2BA 1IBMM 1Q3BA 1XMQM 4JYAM 3A45A 2F5NA 2F5SA 1MU5A 1FJGM 2HKJA 4X66M 2EA0A 2HHHM 2XZUA 3JAMS 5ITRA 3GQ3A 2OPFA 3VK7A 4G4RA 1J5EM 4AQYM 1HNWM 4B3MM 4PD2A 3GP1A 4DV6M 3GQ4A 4X65M 4MB7A 3U6CA 1XC8A 1K3WA 1L2CA 4NRWA 1HNZM 1TDZA
chains in the Genus database with same CATH superfamily
1ZV1A 3DOAA 4XGIA 3D8LA 2FE8A 2DAEA 2GQFA 2VF7A 3L26A 1N33M 1XWIA 4GC9A 2C5RA 1EIJA 2XSZD 2A5YB 3B9PA 1NJFA 2APLA 2DZOB 2ZAMA 5IREB 4DV0M 4DV1M 3VFDA 1HNXM 1OQYA 2UUAM 4IIWA 1D0LA 3EIEA 3J7AS 1L1ZA 2CV1A 1D2NA 4LF8M 1MN3A 1TTEA 1C1KA 1IBLM 5FSWA 3LW5F 3I4YA 2X4AA 3MK6A 1DO2A 1QDRA 4AI6A 4I8OA 1PGYA 2UUBM 2DWMA 4IBEA 2XEPA 3UGJA 3PNYA 2KNAA 1OJLA 1CUKA 2FNAA 2JXNA 3IG8A 3MMPA 4I4LA 2DKLA 4PDGA 2Q2EB 4GKJM 1NSFA 4LRTA 4FD2A 1C7YA 3CF6E 2FS1A 3HHWA 1N34M 1KFVA 2L6OA 3C3EA 3GO8A 3F92A 3I4VA 1GJSA 4LZZA 4FCVA 5IT9S 3U6EA 3HJ8A 4CJ6A 1SXJD 4LFAM 4IBDA 4MGIE 4X64M 1Z5AA 4DV7M 3NWLA 4R7GA 1IBKM 3HGIA 4NXMM 2DWLA 2I7NA 2KA6B 3E9SA 2BWEA 2R6FA 1IXSA 4IBFA 1VEKA 1OAOC 4GRIA 4D81A 3U5ZB 2J5YA 1R2ZA 3NBXX 3SYLA 3IG5A 3KOYE 2OO9A 4L8RC 1HQCA 1XMOM 2R4JA 5EP2A 2DVWB 4GHLA 4IBKA 2YQZA 1QAMA 2Z8YM 1Q02A 2XFTA 5JI3E 4GC5A 2O25A 2C99A 2UXCM 1EE8A 4D80A 2OOBA 3K92A 1DGFA 3UMMA 3J27B 4DBGB 2C9CA 2R65A 3ZCBB 2LBCA 2RGOA 3AOEC 3A98B 3UJNA 4YY3M 3RGPA 2CP8A 3KP1E 1IN7A 4JN6A 3T1HM 3FYCA 5H37D 1VG5A 4I81A 4LFCM 2JY5A 3LQQA 2JY6B 2G5GX 2YNMD 4NC6A 1LTMA 4LF4M 4LGYA 3TE6A 4D82A 3JR5A 2QP9X 4RF0A 5LMUM 3KP0E 3GLIE 3AL0C 4I5SA 4LFBM 1ZMVA 1PJQA 3SAVA 2RRUA 4Z6YA 1R7RA 5ITXE 1TH4A 1PJJA 3LCVB 3HJQA 1Z59A 4IBBA 1PJSA 1T3TA 1DGHA 4JYAM 4MGZE 1L8QA 5EJCA 4P16A 4LCBA 2L2DA 2P5TA 1IN4A 1SXJB 1H6UA 2F5SA 2LVOC 1E32A 4MGHA 5EP4A 4B7HA 1FJGM 2RKOA 5FTJA 4IBCA 4EIWA 1BVSA 3GRUA 1QANA 3FUWA 1GL6A 1EFUB 1OAIA 4AKIA 4OU7A 2B3TA 2XZUA 2R62A 1NHGC 3BOSA 3GLHE 2OPFA 4G4RA 2KHHA 3GLIB 4FWDA 3GQ4A 4M9SA 1TF0B 1OKSA 4ZPXA 1QAOA 1K3WA 2QQ8A 4NRWA 1QZEA 1J7KA 4CIZA 2X8AA 3Q8GA 1TDZA 3CF2A 5ITQA 1XXHB 2V6ZM 3KSXA 2D7GA 1IQPA 1IXSB 3JR4A 2QENA 2W82A 4ITQA 2DZNB 2AHMA 4OVZA 3HWSA 3KSJA 3U6LA 2QSFX 1G4AE 3GPPA 4JI3M 4AKHA 1KYIA 2LWXA 4RF1A 1N75A 3SATA 4M0DA 5KQ8A 3W0FA 4X62M 3J81S 3AKZA 3C9PA 2V1CA 3V76A 3HKPA 2MH8A 5KPTA 4DR1M 2F5OA 2Y0TA 3FRHA 4L15A 3A42A 3HJSA 3UK6A 1SG9A 4JI5M 4FCTA 4GH9A 1TDHA 1IN6A 2ZTDA 4LY6A 2VQFM 3R8FA 4CGYB 1MX0A 1A5TA 5ITUA 2MGWA 3U60B 3K9OA 4LJ7A 4RNAA 4DR5M 3M0EA 3FYDA 4DV4M 4M9ZA 2VF8A 4DR3M 3U6PA 2JNHA 2DAGA 4G4NA 3GLFE 2JP7A 3EIHA 1YUBA 2O01F 3HU1A 4JI4M 3L28A 3HHXA 2L7HA 3GLGA 2HL7A 1OIPA 1NO1A 3HX3A 1XXHA 1NHWC 7CATA 4GMQA 1TR8A 4JXJA 3U6MA 3HY5A 4B3TM 3CF0A 3L29A 2J7NA 3M7GA 4M0WA 4Q7JA 5IWAM 1XXHE 4GITA 2QPAA 4G6ZA 4L6V6 3SASA 2EO2A 4DV3M 5EXPA 2DI0A 4NSRA 5DYIA 3GLIA 4XBOA 5E6JA 1IXRC 2KNZA 3T6PA 4KODA 1NY6A 4B3RM 1QVRA 1SXJE 3SHGB 4PDIA 3Q8XA 3GQ5A 3KOZE 2JA2A 2LNHC 5ITXA 1QAQA 1T43A 1Y8GA 1Z5CA 2DAIA 4JI6M 5ITTA 2F5PA 1JR3D 2DHRA 3KOWE 1ORYB 1JR3E 2EKKA 3T38A 4F2LA 1VQ1A 4B7GA 4LJ9A 2Y20A 2JY7A 3KDSE 1LV7A 4R71A 3VKHA 1HT2E 2Z4RA 5FTNA 4II7A 3HHZA 1WGNA 3FKEA 3LCUA 3C3DA 3E4RA 4L78A 5ITYA 2MROB 3FD9A 3GLGB 1L1TA 3OTOM 1PRBA 1FNNA 2JZ0A 1N36M 4HL4A 3J80S 2CFOA 2H1RA 4BB9A 1GKIA 2WSEF 4DV5M 2CWBA 5LMNM 5GKNA 3NBIA 3K9PA 3WHKA 4IBGA 2ERCA 3DA1A 1ZMUA 3BXWA 1I4WA 2M60A 1W5SA 4MH0E 3RGSA 4LF9M 2V1UA 2UXDM 1E9RA 2LVAA 3FE3A 2BNKA 1DGBA 2MR9A 2LH0A 3E21A 3SC3A 1L2BA 3SMPA 4B7FA 2JWSA 3I01M 1V92A 2KDLA 4FCWA 4LJ8A 2XSZA 2ZAOA 1MU5A 1G3IA 2HKJA 1QYRA 1YLAA 5FTKA 2L09A 2LTUA 3GLGE 1X37A 2KW0A 3KS4A 4OVZB 2DAMA 1UM8A 2XF3A 4WP2A 1VDDA 3K1JA 3GLHA 3JAMS 5ITRA 4HEOA 3MHVC 1E94E 3PNVA 4DV6M 3U5ZA 4BLCA 1XHBA 1L2CA 1J09A 1XNQM 1IFYA 4HLQA 1HNZM 2DHYA 3HU2A 2LVPC 4YHHM 4OX9M 2L4EA 1N78A 1ZMWA 3GPUA 2E5LM 2DAKA 2ZANA 4DR2M 1GABA 4G4OA 4NSOB 3L2AA 5A2QS 3FUXA 4AG6A 2G8LA 3L25A 5EQTA 1V33A 2D7HA 4PCZA 5F3WA 1IN5A 5EP3A 5BPVA 1JQJC 1NY5A 2K6BA 1N32M 1SXJA 2NQ8C 3AFHA 5DFLA 3WHLA 3A46A 2R45A 2Z7JA 5EXXA 1NJGA 3GRYA 3D8BA 1TH3A 2LHGA 5KPZA 3CGWA 2QBYA 3VKGA 1DV0A 1OFIA 3VK8A 3W68A 1DGGA 2XLJA 3KOXE 4K0KM 4B08A 3HHYA 5EXSA 3T1YM 1Z5BA 3DFZA 3DZDA 3M6AA 4QHTA 3TWLA 1G41A 2EJSA 5FTMA 4IBIA 2DXIA 5C18A 1K3XA 2F4VM 1JR3A 1YE9A 3I51A 3IHPA 4AG5A 2RGHA 4UN2B 2EUCA 2BJVA 1DO0A 8CATA 2UU9M 4AKGA 1NVMA 3FUUA 1XNRM 2HWJA 3J2PB 4DR4M 3I04M 2MJ5B 1NNJA 4B3SM 3TQSA 4L16A 5DNYA 1R2YA 2JY8A 1WHCA 2VDBB 1D0MA 3LVVA 3VDPA 4LF5M 2XH9A 5FLXS 1V34A 3THGA 1VEGA 1PM5A 4DR7M 1WJ7A 1ZQ9A 1VEJA 3UZUA 3QAUA 4LJ5A 1G8PA 5KO3A 5L8RF 3RE8A 2CHVA 4MM3B 3GPYA 3AOGA 3W0LB 2CHGA 2Z3XA 1PJIA 3R9XB 5IZ7D 2HCBA 3U60A 3FRIA 2XZFA 2EKFA 2UXBM 1I94M 1HQYE 3FTDA 2K47A 1IN8A 1Q39A 2WSCF 2VQEM 2Y0QA 4JV5M 1HT1E 3U6OA 4WW0A 1QZMA 1MJGM 4AW4A 3FTFA 4LG2A 2R46A 2ZTCA 5JI2E 2G3QA 5EXTA 3FUTA 4NRVA 3AOEA 1K82A 4GEWA 2CHQA 1RU3A 2LVNC 1XB2B 1NNUC 1IBMM 3LQRA 3LMMA 1Q3BA 1R4GA 1WR1B 2H5XA 2KRUA 2LXEA 2FFJA 4P17A 4REZA 2DNAA 2R4EA 1HJPA 4NOOB 2FOIC 3GRVA 1QDTA 1VDLA 4X66M 4TUWA 4WURA 2Z4SA 5KPRA 3SFZA 3ZQJA 1GO5A 4S12A 4MGKE 4NL4H 2QHOB 1R5LA 3GQ3A 3VK7A 2DWZB 3L27A 4QOSA 4AQYM 4Z8XA 3GP1A 3B7NA 2KRKA 2WSFF 4QNRA 4FVMA 4MB7A 3E46A 4X65M 1GJTA 3U6CA 1OFHA 1G71A 1IY1A 5FTLA 2KZUA 4IJEA 3AV0A 3SBJA 3TL4X 1E9SA 3SYKA 3U61B 1QUSA 3TWKA 3QYBA 4LJ6A 1ZAEA 2R18A 3ZH9B 1DGHB 4LGMA 1YSYA 3J7BA 4FWHA 4FWGA 4AZFA 3H4JA 2CRUA 1D0KA 1HR0M 2DWNA 4KHPM 2M5ZA 3AJIB 3SAWA 4IBJA 4DUYM 1QQWA 1GVNA 4ANRA 3FTCA 4NXNM 5E26A 5KQDA 2KNVA 2HAKA 4BBAA 2C9OA 2CE7A 2UUCM 1NV8A 3SMSA 1QUTA 3GPXA 2O5RA 3HU3A 2R0IA 4JI2M 3T15A 3C58A 4L4UA 1S3SA 2JUJA 3MJ5A 4XK8F 2XGNA 2OQ4A 3W67A 2QBYB 2ZM6M 2Y21A 1IXZA 4JI7M 2FH0A 4KT0F 3U61A 1P3QQ 1OTRA 3TWMA 4G3OA 1UFZA 3KW6A 3U6QA 4DV2M 4LRSA 2DZLA 4QOZC 2QNJA 2J7OA 3U6SA 4JI1M 1WXQA 4M9XA 3GLFB 1Z6TA 2BJWA 3U6DA 2LVQD 4JI8M 4PT5A 4G4QA 2KEBA 4QHSA 1GL7A 1TH2A 3VDUA 3H4MA 2N35A 4QNMA 2VIIA 2R44A 2L4FA 3QYEA 3QWLA 1T6OA 3IECA 4R3DA 4GIPA 4JI0M 3GLFA 3HZJA 4LF7M 3KS8A 3GLHB 4DUZM 5DYGA 1IY2A 2JZ1A 1JB0F 4OW0A 1NV9A 2OOAA 3ZC7B 2X49A 1W5TA 3B89A 5C1BA 3FUVA 2ZBKB 4CISA 3ILKA 3GRRA 1Q3CA 4GKKM 1L2DA 2K9DA 2QCUA 3SAUA 3K2LA 5EP1A 4A3VB 4IJFA 3BBZA 4RKUF 1G59A 2GNOA 5BR8M 2DENA 4MGYE 2F5QA 2I7PA 2KZSA 3PFIA 3PVSA 3RFWA 4DR6M 2D7EA 2CEAA 3K8ZA 1N77A 1PJTA 2YR0A 4LF6M 1AIPC 2LHCA 1KSFX 1IY0A 3TPZA 4W5WA 2KXEA 2K0BX 1F4IA 1AUAA 1WIVA 2CV0A 3B74A 3SARA 1XMQM 3CTWB 3A45A 2F5NA 3KFUG 4GHAA 2EA0A 4KLNA 2QZ4A 3SHFA 1GLNA 3B7QA 2CUZA 1R6BX 3KXEC 2L7IA 4LJAA 4LZJA 4F1IA 2CV2A 2HHHM 3VLFB 4Y28F 3FTEA 2XFSA 1IM2A 1WGLA 3LVWA 1J5EM 2WZJA 1HNWM 2BWBA 2YFQA 4FW9A 1OIZA 4PD2A 4B3MM 1TGUA 2C98A 4KO8A 3PXGA 1XC8A 4CHTB 3KVWA 4LJ4A 1SXJC 2C96A 3B7ZA
chains in the Genus database with same CATH topology
4XGIA 3DOAA 1N33M 3D8LA 2FE8A 3L26A 1XWIA 4GC9A 2C5RA 2XSZD 2A5YB 3B9PA 1NJFA 5IREB 2DZOB 2ZAMA 4DV0M 4DV1M 1HNXM 3VFDA 2UUAM 4IIWA 3EIEA 3J7AS 1L1ZA 2CV1A 1D2NA 4LF8M 1C1KA 1IBLM 5FSWA 3I4YA 2X4AA 3MK6A 1DO2A 4AI6A 4I8OA 2UUBM 2DWMA 4IBEA 2XEPA 3UGJA 3PNYA 1OJLA 2FNAA 3IG8A 4I4LA 4PDGA 2Q2EB 4GKJM 1NSFA 4LRTA 4FD2A 3CF6E 3HHWA 1N34M 1KFVA 2L6OA 3GO8A 3I4VA 4LZZA 4FCVA 5IT9S 3U6EA 3HJ8A 1SXJD 4LFAM 4IBDA 4MGIE 4X64M 1Z5AA 4DV7M 3NWLA 4R7GA 1IBKM 3HGIA 4NXMM 2DWLA 2I7NA 2KA6B 3E9SA 4IBFA 3U5ZB 4D81A 1R2ZA 4GRIA 3SYLA 3IG5A 3KOYE 4L8RC 1HQCA 1XMOM 2R4JA 5EP2A 2DVWB 4GHLA 4IBKA 2YQZA 1QAMA 2XFTA 5JI3E 4GC5A 2C99A 2UXCM 1EE8A 4D80A 3K92A 1DGFA 3UMMA 3J27B 2C9CA 2R65A 3ZCBB 3UJNA 2RGOA 3AOEC 3A98B 4YY3M 3RGPA 3KP1E 1IN7A 4JN6A 3T1HM 3FYCA 5H37D 4I81A 4LFCM 3LQQA 2G5GX 2YNMD 4LF4M 4LGYA 3TE6A 4D82A 3JR5A 2QP9X 4RF0A 5LMUM 3KP0E 3AL0C 4I5SA 4LFBM 3SAVA 4Z6YA 1R7RA 5ITXE 1TH4A 1PJJA 3HJQA 1Z59A 4IBBA 1T3TA 1DGHA 4JYAM 4MGZE 1L8QA 5EJCA 4P16A 4LCBA 1IN4A 1SXJB 2P5TA 1H6UA 2F5SA 1FJGM 1E32A 4MGHA 5EP4A 4B7HA 2RKOA 5FTJA 4IBCA 4EIWA 3GRUA 1QANA 3FUWA 1GL6A 4AKIA 4OU7A 2XZUA 2R62A 1NHGC 3BOSA 2OPFA 4G4RA 3GLIB 4FWDA 3GQ4A 4M9SA 1K3WA 4ZPXA 1QAOA 4NRWA 1J7KA 2X8AA 1TDZA 3CF2A 5ITQA 1XXHB 2V6ZM 3KSXA 2D7GA 1IQPA 1IXSB 3JR4A 2QENA 2W82A 4ITQA 2DZNB 2AHMA 4OVZA 3HWSA 3KSJA 3U6LA 1G4AE 3GPPA 4JI3M 4AKHA 1KYIA 2LWXA 4RF1A 1N75A 3SATA 4M0DA 5KQ8A 3W0FA 4X62M 3J81S 3AKZA 4DR1M 2V1CA 5KPTA 3HKPA 2F5OA 2Y0TA 4L15A 3A42A 3HJSA 3UK6A 4JI5M 4FCTA 4GH9A 1TDHA 1IN6A 4LY6A 2VQFM 3R8FA 4CGYB 1MX0A 5ITUA 3U60B 4LJ7A 4RNAA 4DR5M 3M0EA 3FYDA 4DV4M 4M9ZA 4DR3M 3U6PA 4G4NA 3EIHA 1YUBA 3HU1A 4JI4M 3L28A 3HHXA 2L7HA 3GLGA 2HL7A 1XXHA 1NHWC 7CATA 4GMQA 4JXJA 3U6MA 4B3TM 3CF0A 3L29A 2J7NA 3M7GA 4M0WA 5IWAM 5LMNM 4GITA 3SASA 2QPAA 4G6ZA 2EO2A 4DV3M 5EXPA 4NSRA 5DYIA 3GLIA 4XBOA 5E6JA 1IXRC 4KODA 1NY6A 4B3RM 1QVRA 1SXJE 3SHGB 4PDIA 3Q8XA 3GQ5A 3KOZE 2JA2A 2LNHC 5ITXA 1QAQA 1Z5CA 4JI6M 5ITTA 2F5PA 1JR3D 2DHRA 3KOWE 1ORYB 3T38A 4B7GA 4LJ9A 2Y20A 3KDSE 3VKHA 1LV7A 1HT2E 2Z4RA 5FTNA 4II7A 3HHZA 3FKEA 3E4RA 4L78A 5ITYA 3GLGB 3FD9A 1L1TA 3OTOM 1FNNA 1N36M 4HL4A 3J80S 2CFOA 2H1RA 4BB9A 1GKIA 4DV5M 5GKNA 3NBIA 3WHKA 4IBGA 2ERCA 3DA1A 1I4WA 2M60A 1W5SA 4MH0E 3RGSA 4LF9M 2V1UA 2UXDM 1E9RA 2BNKA 1DGBA 2LH0A 3SC3A 1L2BA 3SMPA 4B7FA 4FCWA 4LJ8A 2XSZA 2ZAOA 1MU5A 1G3IA 2HKJA 1QYRA 5FTKA 2L09A 1X37A 2KW0A 3KS4A 4OVZB 1UM8A 2XF3A 1VDDA 3K1JA 3GLHA 3JAMS 5ITRA 3MHVC 1E94E 3PNVA 4DV6M 3U5ZA 4BLCA 1XHBA 1L2CA 1J09A 1XNQM 4HLQA 1HNZM 3HU2A 4YHHM 4OX9M 1N78A 3GPUA 2E5LM 2ZANA 4DR2M 4G4OA 4NSOB 3L2AA 5A2QS 3FUXA 4AG6A 2G8LA 3L25A 5EQTA 2D7HA 4PCZA 5F3WA 1IN5A 5EP3A 5BPVA 1JQJC 1NY5A 1N32M 1SXJA 2NQ8C 3AFHA 3WHLA 3A46A 2R45A 2Z7JA 5EXXA 1NJGA 3GRYA 3D8BA 1TH3A 5KPZA 2QBYA 3VKGA 1OFIA 3VK8A 1DGGA 2XLJA 3KOXE 4K0KM 4B08A 3HHYA 5EXSA 3T1YM 1Z5BA 3DFZA 3DZDA 3M6AA 4QHTA 3TWLA 1G41A 5FTMA 4IBIA 2DXIA 5C18A 1K3XA 2F4VM 1JR3A 1YE9A 3I51A 4AG5A 2RGHA 2EUCA 2BJVA 1DO0A 8CATA 2UU9M 4AKGA 1NVMA 3FUUA 1XNRM 4DR4M 3J2PB 1NNJA 4B3SM 3TQSA 4L16A 5DNYA 1R2YA 3LVVA 3VDPA 4LF5M 2XH9A 5FLXS 4DR7M 3THGA 1PM5A 1ZQ9A 3UZUA 3QAUA 4LJ5A 1G8PA 5KO3A 3RE8A 2CHVA 4MM3B 3GPYA 3AOGA 3W0LB 2CHGA 2Z3XA 1PJIA 3R9XB 5IZ7D 2HCBA 3U60A 2XZFA 2UXBM 1I94M 1HQYE 3FTDA 2K47A 1IN8A 1Q39A 4JV5M 2VQEM 2Y0QA 1HT1E 3U6OA 4WW0A 1QZMA 4AW4A 3FTFA 4LG2A 2R46A 5JI2E 5EXTA 3FUTA 4NRVA 3AOEA 1K82A 2CHQA 1NNUC 1IBMM 3LQRA 3LMMA 1Q3BA 2KRUA 4REZA 2LXEA 2FFJA 2R4EA 4NOOB 2FOIC 3GRVA 4X66M 4TUWA 4WURA 2Z4SA 5KPRA 3SFZA 4S12A 4MGKE 4NL4H 3GQ3A 3VK7A 2DWZB 3L27A 4QOSA 4AQYM 4Z8XA 3GP1A 2KRKA 4QNRA 4FVMA 4MB7A 4X65M 3U6CA 1OFHA 1IY1A 5FTLA 2KZUA 4IJEA 3AV0A 3SBJA 3TL4X 1E9SA 3SYKA 3U61B 3TWKA 4LJ6A 1ZAEA 2R18A 3ZH9B 1DGHB 4LGMA 1YSYA 3J7BA 4FWHA 4FWGA 4AZFA 1HR0M 2DWNA 4KHPM 2M5ZA 3AJIB 3SAWA 4IBJA 4DUYM 1QQWA 1GVNA 3FTCA 4NXNM 5E26A 5KQDA 4BBAA 2C9OA 2CE7A 2UUCM 3SMSA 3GPXA 2O5RA 3HU3A 4JI2M 3T15A 3C58A 4L4UA 1S3SA 3MJ5A 2XGNA 2OQ4A 2QBYB 2ZM6M 2Y21A 1IXZA 4JI7M 3U61A 3TWMA 3KW6A 3U6QA 4DV2M 4LRSA 4QOZC 3U6SA 2J7OA 4JI1M 1WXQA 4M9XA 3GLFB 1Z6TA 2BJWA 3U6DA 4JI8M 4PT5A 4G4QA 2KEBA 4QHSA 1GL7A 1TH2A 3VDUA 3H4MA 4QNMA 2VIIA 3QWLA 4R3DA 4GIPA 4JI0M 3GLFA 4LF7M 3KS8A 3GLHB 4DUZM 5DYGA 1IY2A 4OW0A 3ZC7B 2X49A 1W5TA 5C1BA 3FUVA 2ZBKB 4CISA 3ILKA 3GRRA 1Q3CA 4GKKM 1L2DA 2QCUA 3SAUA 3K2LA 5EP1A 4A3VB 4IJFA 1G59A 5BR8M 4MGYE 2F5QA 2I7PA 2KZSA 3PFIA 3PVSA 3RFWA 4DR6M 2D7EA 2CEAA 3K8ZA 1N77A 2YR0A 4LF6M 1KSFX 1IY0A 3TPZA 4W5WA 2KXEA 2CV0A 3SARA 1XMQM 3CTWB 3A45A 2F5NA 3KFUG 4GHAA 2EA0A 4KLNA 2QZ4A 3SHFA 1GLNA 4LJAA 2CUZA 1R6BX 3KXEC 2L7IA 4LZJA 2CV2A 2HHHM 3VLFB 3FTEA 2XFSA 1IM2A 3LVWA 1J5EM 1HNWM 4FW9A 2YFQA 4PD2A 4B3MM 1TGUA 2C98A 4KO8A 3PXGA 1XC8A 4CHTB 3KVWA 4LJ4A 1SXJC 2C96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 M;  3DOA A;  4YHH M;  4OX9 M;  3GPU A;  2E5L M;  5ITQ A;  3SBJ A;  4DR2 M;  4G4O A;  3JR4 A;  4DV0 M;  5A2Q S;  4DV1 M;  1HNX M;  3TWK A;  2UUA M;  4ITQ A;  3U6L A;  4PCZ A;  3J7A S;  1L1Z A;  1HR0 M;  3GPP A;  4LF8 M;  4JI3 M;  1N32 M;  4KHP M;  1IBL M;  3SAT A;  3A46 A;  3W0F A;  3SAW A;  4X62 M;  3J81 S;  4DR1 M;  4DUY M;  2F5O A;  4NXN M;  2UUB M;  3A42 A;  2UUC M;  4JI5 M;  1TDH A;  3GPX A;  2VQF M;  4JI2 M;  3VK8 A;  3C58 A;  1MX0 A;  5ITU A;  4PDG A;  2Q2E B;  4K0K M;  4GKJ M;  4DR5 M;  3T1Y M;  1Z5B A;  2OQ4 A;  4DV4 M;  1N34 M;  1KFV A;  3GO8 A;  2ZM6 M;  4DR3 M;  3U6P A;  4G4N A;  4JI7 M;  3TWL A;  4JI4 M;  5IT9 S;  3U6E A;  1K3X A;  3TWM A;  2F4V M;  4LFA M;  1XNQ M;  4X64 M;  3U6M A;  1Z5A A;  3U6Q A;  4B3T M;  4DV2 M;  5IWA M;  5LMN M;  4DV7 M;  1IBK M;  2UU9 M;  3SAS A;  4NXM M;  3U6S A;  4DV3 M;  1XNR M;  4DR4 M;  4JI1 M;  1R2Z A;  1NNJ A;  4B3S M;  3U6D A;  1R2Y A;  4JI8 M;  4B3R M;  3GQ5 A;  4PDI A;  4G4Q A;  5ITX A;  1XMO M;  4LF5 M;  1Z5C A;  5FLX S;  4JI6 M;  4DR7 M;  1PM5 A;  5ITT A;  2F5P A;  2UXC M;  1EE8 A;  4JI0 M;  4LF7 M;  4DUZ M;  4YY3 M;  3GPY A;  2ZBK B;  4CIS A;  1PJI A;  1Q3C A;  4GKK M;  3T1H M;  1L2D A;  2XZF A;  3SAU A;  4LFC M;  5ITY A;  1L1T A;  2UXB M;  3OTO M;  1I94 M;  1N36 M;  4LF4 M;  1Q39 A;  5BR8 M;  3J80 S;  2F5Q A;  2VQE M;  3JR5 A;  4JV5 M;  5LMU M;  3U6O A;  4DR6 M;  4DV5 M;  4LFB M;  4LF6 M;  3SAV A;  4NRV A;  1K82 A;  5ITX E;  1PJJ A;  1Z59 A;  4LF9 M;  2UXD M;  3SAR A;  1L2B A;  1IBM M;  1Q3B A;  1XMQ M;  4JYA M;  3A45 A;  2F5N A;  2F5S A;  1MU5 A;  1FJG M;  2HKJ A;  4X66 M;  2EA0 A;  2HHH M;  2XZU A;  3JAM S;  5ITR A;  3GQ3 A;  2OPF A;  3VK7 A;  4G4R A;  1J5E M;  4AQY M;  1HNW M;  4B3M M;  4PD2 A;  3GP1 A;  4DV6 M;  3GQ4 A;  4X65 M;  4MB7 A;  3U6C A;  1XC8 A;  1K3W A;  1L2C A;  4NRW A;  1HNZ M;  1TDZ A; 
#chains in the Genus database with same CATH topology
 1ZV1 A;  3DOA A;  4XGI A;  3D8L A;  2FE8 A;  2DAE A;  2GQF A;  2VF7 A;  3L26 A;  1N33 M;  1XWI A;  4GC9 A;  2C5R A;  1EIJ A;  2XSZ D;  2A5Y B;  3B9P A;  1NJF A;  2APL A;  2DZO B;  2ZAM A;  5IRE B;  4DV0 M;  4DV1 M;  3VFD A;  1HNX M;  1OQY A;  2UUA M;  4IIW A;  1D0L A;  3EIE A;  3J7A S;  1L1Z A;  2CV1 A;  1D2N A;  4LF8 M;  1MN3 A;  1TTE A;  1C1K A;  1IBL M;  5FSW A;  3LW5 F;  3I4Y A;  2X4A A;  3MK6 A;  1DO2 A;  1QDR A;  4AI6 A;  4I8O A;  1PGY A;  2UUB M;  2DWM A;  4IBE A;  2XEP A;  3UGJ A;  3PNY A;  2KNA A;  1OJL A;  1CUK A;  2FNA A;  2JXN A;  3IG8 A;  3MMP A;  4I4L A;  2DKL A;  4PDG A;  2Q2E B;  4GKJ M;  1NSF A;  4LRT A;  4FD2 A;  1C7Y A;  3CF6 E;  2FS1 A;  3HHW A;  1N34 M;  1KFV A;  2L6O A;  3C3E A;  3GO8 A;  3F92 A;  3I4V A;  1GJS A;  4LZZ A;  4FCV A;  5IT9 S;  3U6E A;  3HJ8 A;  4CJ6 A;  1SXJ D;  4LFA M;  4IBD A;  4MGI E;  4X64 M;  1Z5A A;  4DV7 M;  3NWL A;  4R7G A;  1IBK M;  3HGI A;  4NXM M;  2DWL A;  2I7N A;  2KA6 B;  3E9S A;  2BWE A;  2R6F A;  1IXS A;  4IBF A;  1VEK A;  1OAO C;  4GRI A;  4D81 A;  3U5Z B;  2J5Y A;  1R2Z A;  3NBX X;  3SYL A;  3IG5 A;  3KOY E;  2OO9 A;  4L8R C;  1HQC A;  1XMO M;  2R4J A;  5EP2 A;  2DVW B;  4GHL A;  4IBK A;  2YQZ A;  1QAM A;  2Z8Y M;  1Q02 A;  2XFT A;  5JI3 E;  4GC5 A;  2O25 A;  2C99 A;  2UXC M;  1EE8 A;  4D80 A;  2OOB A;  3K92 A;  1DGF A;  3UMM A;  3J27 B;  4DBG B;  2C9C A;  2R65 A;  3ZCB B;  2LBC A;  2RGO A;  3AOE C;  3A98 B;  3UJN A;  4YY3 M;  3RGP A;  2CP8 A;  3KP1 E;  1IN7 A;  4JN6 A;  3T1H M;  3FYC A;  5H37 D;  1VG5 A;  4I81 A;  4LFC M;  2JY5 A;  3LQQ A;  2JY6 B;  2G5G X;  2YNM D;  4NC6 A;  1LTM A;  4LF4 M;  4LGY A;  3TE6 A;  4D82 A;  3JR5 A;  2QP9 X;  4RF0 A;  5LMU M;  3KP0 E;  3GLI E;  3AL0 C;  4I5S A;  4LFB M;  1ZMV A;  1PJQ A;  3SAV A;  2RRU A;  4Z6Y A;  1R7R A;  5ITX E;  1TH4 A;  1PJJ A;  3LCV B;  3HJQ A;  1Z59 A;  4IBB A;  1PJS A;  1T3T A;  1DGH A;  4JYA M;  4MGZ E;  1L8Q A;  5EJC A;  4P16 A;  4LCB A;  2L2D A;  2P5T A;  1IN4 A;  1SXJ B;  1H6U A;  2F5S A;  2LVO C;  1E32 A;  4MGH A;  5EP4 A;  4B7H A;  1FJG M;  2RKO A;  5FTJ A;  4IBC A;  4EIW A;  1BVS A;  3GRU A;  1QAN A;  3FUW A;  1GL6 A;  1EFU B;  1OAI A;  4AKI A;  4OU7 A;  2B3T A;  2XZU A;  2R62 A;  1NHG C;  3BOS A;  3GLH E;  2OPF A;  4G4R A;  2KHH A;  3GLI B;  4FWD A;  3GQ4 A;  4M9S A;  1TF0 B;  1OKS A;  4ZPX A;  1QAO A;  1K3W A;  2QQ8 A;  4NRW A;  1QZE A;  1J7K A;  4CIZ A;  2X8A A;  3Q8G A;  1TDZ A;  3CF2 A;  5ITQ A;  1XXH B;  2V6Z M;  3KSX A;  2D7G A;  1IQP A;  1IXS B;  3JR4 A;  2QEN A;  2W82 A;  4ITQ A;  2DZN B;  2AHM A;  4OVZ A;  3HWS A;  3KSJ A;  3U6L A;  2QSF X;  1G4A E;  3GPP A;  4JI3 M;  4AKH A;  1KYI A;  2LWX A;  4RF1 A;  1N75 A;  3SAT A;  4M0D A;  5KQ8 A;  3W0F A;  4X62 M;  3J81 S;  3AKZ A;  3C9P A;  2V1C A;  3V76 A;  3HKP A;  2MH8 A;  5KPT A;  4DR1 M;  2F5O A;  2Y0T A;  3FRH A;  4L15 A;  3A42 A;  3HJS A;  3UK6 A;  1SG9 A;  4JI5 M;  4FCT A;  4GH9 A;  1TDH A;  1IN6 A;  2ZTD A;  4LY6 A;  2VQF M;  3R8F A;  4CGY B;  1MX0 A;  1A5T A;  5ITU A;  2MGW A;  3U60 B;  3K9O A;  4LJ7 A;  4RNA A;  4DR5 M;  3M0E A;  3FYD A;  4DV4 M;  4M9Z A;  2VF8 A;  4DR3 M;  3U6P A;  2JNH A;  2DAG A;  4G4N A;  3GLF E;  2JP7 A;  3EIH A;  1YUB A;  2O01 F;  3HU1 A;  4JI4 M;  3L28 A;  3HHX A;  2L7H A;  3GLG A;  2HL7 A;  1OIP A;  1NO1 A;  3HX3 A;  1XXH A;  1NHW C;  7CAT A;  4GMQ A;  1TR8 A;  4JXJ A;  3U6M A;  3HY5 A;  4B3T M;  3CF0 A;  3L29 A;  2J7N A;  3M7G A;  4M0W A;  4Q7J A;  5IWA M;  1XXH E;  4GIT A;  2QPA A;  4G6Z A;  4L6V 6;  3SAS A;  2EO2 A;  4DV3 M;  5EXP A;  2DI0 A;  4NSR A;  5DYI A;  3GLI A;  4XBO A;  5E6J A;  1IXR C;  2KNZ A;  3T6P A;  4KOD A;  1NY6 A;  4B3R M;  1QVR A;  1SXJ E;  3SHG B;  4PDI A;  3Q8X A;  3GQ5 A;  3KOZ E;  2JA2 A;  2LNH C;  5ITX A;  1QAQ A;  1T43 A;  1Y8G A;  1Z5C A;  2DAI A;  4JI6 M;  5ITT A;  2F5P A;  1JR3 D;  2DHR A;  3KOW E;  1ORY B;  1JR3 E;  2EKK A;  3T38 A;  4F2L A;  1VQ1 A;  4B7G A;  4LJ9 A;  2Y20 A;  2JY7 A;  3KDS E;  1LV7 A;  4R71 A;  3VKH A;  1HT2 E;  2Z4R A;  5FTN A;  4II7 A;  3HHZ A;  1WGN A;  3FKE A;  3LCU A;  3C3D A;  3E4R A;  4L78 A;  5ITY A;  2MRO B;  3FD9 A;  3GLG B;  1L1T A;  3OTO M;  1PRB A;  1FNN A;  2JZ0 A;  1N36 M;  4HL4 A;  3J80 S;  2CFO A;  2H1R A;  4BB9 A;  1GKI A;  2WSE F;  4DV5 M;  2CWB A;  5LMN M;  5GKN A;  3NBI A;  3K9P A;  3WHK A;  4IBG A;  2ERC A;  3DA1 A;  1ZMU A;  3BXW A;  1I4W A;  2M60 A;  1W5S A;  4MH0 E;  3RGS A;  4LF9 M;  2V1U A;  2UXD M;  1E9R A;  2LVA A;  3FE3 A;  2BNK A;  1DGB A;  2MR9 A;  2LH0 A;  3E21 A;  3SC3 A;  1L2B A;  3SMP A;  4B7F A;  2JWS A;  3I01 M;  1V92 A;  2KDL A;  4FCW A;  4LJ8 A;  2XSZ A;  2ZAO A;  1MU5 A;  1G3I A;  2HKJ A;  1QYR A;  1YLA A;  5FTK A;  2L09 A;  2LTU A;  3GLG E;  1X37 A;  2KW0 A;  3KS4 A;  4OVZ B;  2DAM A;  1UM8 A;  2XF3 A;  4WP2 A;  1VDD A;  3K1J A;  3GLH A;  3JAM S;  5ITR A;  4HEO A;  3MHV C;  1E94 E;  3PNV A;  4DV6 M;  3U5Z A;  4BLC A;  1XHB A;  1L2C A;  1J09 A;  1XNQ M;  1IFY A;  4HLQ A;  1HNZ M;  2DHY A;  3HU2 A;  2LVP C;  4YHH M;  4OX9 M;  2L4E A;  1N78 A;  1ZMW A;  3GPU A;  2E5L M;  2DAK A;  2ZAN A;  4DR2 M;  1GAB A;  4G4O A;  4NSO B;  3L2A A;  5A2Q S;  3FUX A;  4AG6 A;  2G8L A;  3L25 A;  5EQT A;  1V33 A;  2D7H A;  4PCZ A;  5F3W A;  1IN5 A;  5EP3 A;  5BPV A;  1JQJ C;  1NY5 A;  2K6B A;  1N32 M;  1SXJ A;  2NQ8 C;  3AFH A;  5DFL A;  3WHL A;  3A46 A;  2R45 A;  2Z7J A;  5EXX A;  1NJG A;  3GRY A;  3D8B A;  1TH3 A;  2LHG A;  5KPZ A;  3CGW A;  2QBY A;  3VKG A;  1DV0 A;  1OFI A;  3VK8 A;  3W68 A;  1DGG A;  2XLJ A;  3KOX E;  4K0K M;  4B08 A;  3HHY A;  5EXS A;  3T1Y M;  1Z5B A;  3DFZ A;  3DZD A;  3M6A A;  4QHT A;  3TWL A;  1G41 A;  2EJS A;  5FTM A;  4IBI A;  2DXI A;  5C18 A;  1K3X A;  2F4V M;  1JR3 A;  1YE9 A;  3I51 A;  3IHP A;  4AG5 A;  2RGH A;  4UN2 B;  2EUC A;  2BJV A;  1DO0 A;  8CAT A;  2UU9 M;  4AKG A;  1NVM A;  3FUU A;  1XNR M;  2HWJ A;  3J2P B;  4DR4 M;  3I04 M;  2MJ5 B;  1NNJ A;  4B3S M;  3TQS A;  4L16 A;  5DNY A;  1R2Y A;  2JY8 A;  1WHC A;  2VDB B;  1D0M A;  3LVV A;  3VDP A;  4LF5 M;  2XH9 A;  5FLX S;  1V34 A;  3THG A;  1VEG A;  1PM5 A;  4DR7 M;  1WJ7 A;  1ZQ9 A;  1VEJ A;  3UZU A;  3QAU A;  4LJ5 A;  1G8P A;  5KO3 A;  5L8R F;  3RE8 A;  2CHV A;  4MM3 B;  3GPY A;  3AOG A;  3W0L B;  2CHG A;  2Z3X A;  1PJI A;  3R9X B;  5IZ7 D;  2HCB A;  3U60 A;  3FRI A;  2XZF A;  2EKF A;  2UXB M;  1I94 M;  1HQY E;  3FTD A;  2K47 A;  1IN8 A;  1Q39 A;  2WSC F;  2VQE M;  2Y0Q A;  4JV5 M;  1HT1 E;  3U6O A;  4WW0 A;  1QZM A;  1MJG M;  4AW4 A;  3FTF A;  4LG2 A;  2R46 A;  2ZTC A;  5JI2 E;  2G3Q A;  5EXT A;  3FUT A;  4NRV A;  3AOE A;  1K82 A;  4GEW A;  2CHQ A;  1RU3 A;  2LVN C;  1XB2 B;  1NNU C;  1IBM M;  3LQR A;  3LMM A;  1Q3B A;  1R4G A;  1WR1 B;  2H5X A;  2KRU A;  2LXE A;  2FFJ A;  4P17 A;  4REZ A;  2DNA A;  2R4E A;  1HJP A;  4NOO B;  2FOI C;  3GRV A;  1QDT A;  1VDL A;  4X66 M;  4TUW A;  4WUR A;  2Z4S A;  5KPR A;  3SFZ A;  3ZQJ A;  1GO5 A;  4S12 A;  4MGK E;  4NL4 H;  2QHO B;  1R5L A;  3GQ3 A;  3VK7 A;  2DWZ B;  3L27 A;  4QOS A;  4AQY M;  4Z8X A;  3GP1 A;  3B7N A;  2KRK A;  2WSF F;  4QNR A;  4FVM A;  4MB7 A;  3E46 A;  4X65 M;  1GJT A;  3U6C A;  1OFH A;  1G71 A;  1IY1 A;  5FTL A;  2KZU A;  4IJE A;  3AV0 A;  3SBJ A;  3TL4 X;  1E9S A;  3SYK A;  3U61 B;  1QUS A;  3TWK A;  3QYB A;  4LJ6 A;  1ZAE A;  2R18 A;  3ZH9 B;  1DGH B;  4LGM A;  1YSY A;  3J7B A;  4FWH A;  4FWG A;  4AZF A;  3H4J A;  2CRU A;  1D0K A;  1HR0 M;  2DWN A;  4KHP M;  2M5Z A;  3AJI B;  3SAW A;  4IBJ A;  4DUY M;  1QQW A;  1GVN A;  4ANR A;  3FTC A;  4NXN M;  5E26 A;  5KQD A;  2KNV A;  2HAK A;  4BBA A;  2C9O A;  2CE7 A;  2UUC M;  1NV8 A;  3SMS A;  1QUT A;  3GPX A;  2O5R A;  3HU3 A;  2R0I A;  4JI2 M;  3T15 A;  3C58 A;  4L4U A;  1S3S A;  2JUJ A;  3MJ5 A;  4XK8 F;  2XGN A;  2OQ4 A;  3W67 A;  2QBY B;  2ZM6 M;  2Y21 A;  1IXZ A;  4JI7 M;  2FH0 A;  4KT0 F;  3U61 A;  1P3Q Q;  1OTR A;  3TWM A;  4G3O A;  1UFZ A;  3KW6 A;  3U6Q A;  4DV2 M;  4LRS A;  2DZL A;  4QOZ C;  2QNJ A;  2J7O A;  3U6S A;  4JI1 M;  1WXQ A;  4M9X A;  3GLF B;  1Z6T A;  2BJW A;  3U6D A;  2LVQ D;  4JI8 M;  4PT5 A;  4G4Q A;  2KEB A;  4QHS A;  1GL7 A;  1TH2 A;  3VDU A;  3H4M A;  2N35 A;  4QNM A;  2VII A;  2R44 A;  2L4F A;  3QYE A;  3QWL A;  1T6O A;  3IEC A;  4R3D A;  4GIP A;  4JI0 M;  3GLF A;  3HZJ A;  4LF7 M;  3KS8 A;  3GLH B;  4DUZ M;  5DYG A;  1IY2 A;  2JZ1 A;  1JB0 F;  4OW0 A;  1NV9 A;  2OOA A;  3ZC7 B;  2X49 A;  1W5T A;  3B89 A;  5C1B A;  3FUV A;  2ZBK B;  4CIS A;  3ILK A;  3GRR A;  1Q3C A;  4GKK M;  1L2D A;  2K9D A;  2QCU A;  3SAU A;  3K2L A;  5EP1 A;  4A3V B;  4IJF A;  3BBZ A;  4RKU F;  1G59 A;  2GNO A;  5BR8 M;  2DEN A;  4MGY E;  2F5Q A;  2I7P A;  2KZS A;  3PFI A;  3PVS A;  3RFW A;  4DR6 M;  2D7E A;  2CEA A;  3K8Z A;  1N77 A;  1PJT A;  2YR0 A;  4LF6 M;  1AIP C;  2LHC A;  1KSF X;  1IY0 A;  3TPZ A;  4W5W A;  2KXE A;  2K0B X;  1F4I A;  1AUA A;  1WIV A;  2CV0 A;  3B74 A;  3SAR A;  1XMQ M;  3CTW B;  3A45 A;  2F5N A;  3KFU G;  4GHA A;  2EA0 A;  4KLN A;  2QZ4 A;  3SHF A;  1GLN A;  3B7Q A;  2CUZ A;  1R6B X;  3KXE C;  2L7I A;  4LJA A;  4LZJ A;  4F1I A;  2CV2 A;  2HHH M;  3VLF B;  4Y28 F;  3FTE A;  2XFS A;  1IM2 A;  1WGL A;  3LVW A;  1J5E M;  2WZJ A;  1HNW M;  2BWB A;  2YFQ A;  4FW9 A;  1OIZ A;  4PD2 A;  4B3M M;  1TGU A;  2C98 A;  4KO8 A;  3PXG A;  1XC8 A;  4CHT B;  3KVW A;  4LJ4 A;  1SXJ C;  2C96 A;  3B7Z A; 
#chains in the Genus database with same CATH homology
 4XGI A;  3DOA A;  1N33 M;  3D8L A;  2FE8 A;  3L26 A;  1XWI A;  4GC9 A;  2C5R A;  2XSZ D;  2A5Y B;  3B9P A;  1NJF A;  5IRE B;  2DZO B;  2ZAM A;  4DV0 M;  4DV1 M;  1HNX M;  3VFD A;  2UUA M;  4IIW A;  3EIE A;  3J7A S;  1L1Z A;  2CV1 A;  1D2N A;  4LF8 M;  1C1K A;  1IBL M;  5FSW A;  3I4Y A;  2X4A A;  3MK6 A;  1DO2 A;  4AI6 A;  4I8O A;  2UUB M;  2DWM A;  4IBE A;  2XEP A;  3UGJ A;  3PNY A;  1OJL A;  2FNA A;  3IG8 A;  4I4L A;  4PDG A;  2Q2E B;  4GKJ M;  1NSF A;  4LRT A;  4FD2 A;  3CF6 E;  3HHW A;  1N34 M;  1KFV A;  2L6O A;  3GO8 A;  3I4V A;  4LZZ A;  4FCV A;  5IT9 S;  3U6E A;  3HJ8 A;  1SXJ D;  4LFA M;  4IBD A;  4MGI E;  4X64 M;  1Z5A A;  4DV7 M;  3NWL A;  4R7G A;  1IBK M;  3HGI A;  4NXM M;  2DWL A;  2I7N A;  2KA6 B;  3E9S A;  4IBF A;  3U5Z B;  4D81 A;  1R2Z A;  4GRI A;  3SYL A;  3IG5 A;  3KOY E;  4L8R C;  1HQC A;  1XMO M;  2R4J A;  5EP2 A;  2DVW B;  4GHL A;  4IBK A;  2YQZ A;  1QAM A;  2XFT A;  5JI3 E;  4GC5 A;  2C99 A;  2UXC M;  1EE8 A;  4D80 A;  3K92 A;  1DGF A;  3UMM A;  3J27 B;  2C9C A;  2R65 A;  3ZCB B;  3UJN A;  2RGO A;  3AOE C;  3A98 B;  4YY3 M;  3RGP A;  3KP1 E;  1IN7 A;  4JN6 A;  3T1H M;  3FYC A;  5H37 D;  4I81 A;  4LFC M;  3LQQ A;  2G5G X;  2YNM D;  4LF4 M;  4LGY A;  3TE6 A;  4D82 A;  3JR5 A;  2QP9 X;  4RF0 A;  5LMU M;  3KP0 E;  3AL0 C;  4I5S A;  4LFB M;  3SAV A;  4Z6Y A;  1R7R A;  5ITX E;  1TH4 A;  1PJJ A;  3HJQ A;  1Z59 A;  4IBB A;  1T3T A;  1DGH A;  4JYA M;  4MGZ E;  1L8Q A;  5EJC A;  4P16 A;  4LCB A;  1IN4 A;  1SXJ B;  2P5T A;  1H6U A;  2F5S A;  1FJG M;  1E32 A;  4MGH A;  5EP4 A;  4B7H A;  2RKO A;  5FTJ A;  4IBC A;  4EIW A;  3GRU A;  1QAN A;  3FUW A;  1GL6 A;  4AKI A;  4OU7 A;  2XZU A;  2R62 A;  1NHG C;  3BOS A;  2OPF A;  4G4R A;  3GLI B;  4FWD A;  3GQ4 A;  4M9S A;  1K3W A;  4ZPX A;  1QAO A;  4NRW A;  1J7K A;  2X8A A;  1TDZ A;  3CF2 A;  5ITQ A;  1XXH B;  2V6Z M;  3KSX A;  2D7G A;  1IQP A;  1IXS B;  3JR4 A;  2QEN A;  2W82 A;  4ITQ A;  2DZN B;  2AHM A;  4OVZ A;  3HWS A;  3KSJ A;  3U6L A;  1G4A E;  3GPP A;  4JI3 M;  4AKH A;  1KYI A;  2LWX A;  4RF1 A;  1N75 A;  3SAT A;  4M0D A;  5KQ8 A;  3W0F A;  4X62 M;  3J81 S;  3AKZ A;  4DR1 M;  2V1C A;  5KPT A;  3HKP A;  2F5O A;  2Y0T A;  4L15 A;  3A42 A;  3HJS A;  3UK6 A;  4JI5 M;  4FCT A;  4GH9 A;  1TDH A;  1IN6 A;  4LY6 A;  2VQF M;  3R8F A;  4CGY B;  1MX0 A;  5ITU A;  3U60 B;  4LJ7 A;  4RNA A;  4DR5 M;  3M0E A;  3FYD A;  4DV4 M;  4M9Z A;  4DR3 M;  3U6P A;  4G4N A;  3EIH A;  1YUB A;  3HU1 A;  4JI4 M;  3L28 A;  3HHX A;  2L7H A;  3GLG A;  2HL7 A;  1XXH A;  1NHW C;  7CAT A;  4GMQ A;  4JXJ A;  3U6M A;  4B3T M;  3CF0 A;  3L29 A;  2J7N A;  3M7G A;  4M0W A;  5IWA M;  5LMN M;  4GIT A;  3SAS A;  2QPA A;  4G6Z A;  2EO2 A;  4DV3 M;  5EXP A;  4NSR A;  5DYI A;  3GLI A;  4XBO A;  5E6J A;  1IXR C;  4KOD A;  1NY6 A;  4B3R M;  1QVR A;  1SXJ E;  3SHG B;  4PDI A;  3Q8X A;  3GQ5 A;  3KOZ E;  2JA2 A;  2LNH C;  5ITX A;  1QAQ A;  1Z5C A;  4JI6 M;  5ITT A;  2F5P A;  1JR3 D;  2DHR A;  3KOW E;  1ORY B;  3T38 A;  4B7G A;  4LJ9 A;  2Y20 A;  3KDS E;  3VKH A;  1LV7 A;  1HT2 E;  2Z4R A;  5FTN A;  4II7 A;  3HHZ A;  3FKE A;  3E4R A;  4L78 A;  5ITY A;  3GLG B;  3FD9 A;  1L1T A;  3OTO M;  1FNN A;  1N36 M;  4HL4 A;  3J80 S;  2CFO A;  2H1R A;  4BB9 A;  1GKI A;  4DV5 M;  5GKN A;  3NBI A;  3WHK A;  4IBG A;  2ERC A;  3DA1 A;  1I4W A;  2M60 A;  1W5S A;  4MH0 E;  3RGS A;  4LF9 M;  2V1U A;  2UXD M;  1E9R A;  2BNK A;  1DGB A;  2LH0 A;  3SC3 A;  1L2B A;  3SMP A;  4B7F A;  4FCW A;  4LJ8 A;  2XSZ A;  2ZAO A;  1MU5 A;  1G3I A;  2HKJ A;  1QYR A;  5FTK A;  2L09 A;  1X37 A;  2KW0 A;  3KS4 A;  4OVZ B;  1UM8 A;  2XF3 A;  1VDD A;  3K1J A;  3GLH A;  3JAM S;  5ITR A;  3MHV C;  1E94 E;  3PNV A;  4DV6 M;  3U5Z A;  4BLC A;  1XHB A;  1L2C A;  1J09 A;  1XNQ M;  4HLQ A;  1HNZ M;  3HU2 A;  4YHH M;  4OX9 M;  1N78 A;  3GPU A;  2E5L M;  2ZAN A;  4DR2 M;  4G4O A;  4NSO B;  3L2A A;  5A2Q S;  3FUX A;  4AG6 A;  2G8L A;  3L25 A;  5EQT A;  2D7H A;  4PCZ A;  5F3W A;  1IN5 A;  5EP3 A;  5BPV A;  1JQJ C;  1NY5 A;  1N32 M;  1SXJ A;  2NQ8 C;  3AFH A;  3WHL A;  3A46 A;  2R45 A;  2Z7J A;  5EXX A;  1NJG A;  3GRY A;  3D8B A;  1TH3 A;  5KPZ A;  2QBY A;  3VKG A;  1OFI A;  3VK8 A;  1DGG A;  2XLJ A;  3KOX E;  4K0K M;  4B08 A;  3HHY A;  5EXS A;  3T1Y M;  1Z5B A;  3DFZ A;  3DZD A;  3M6A A;  4QHT A;  3TWL A;  1G41 A;  5FTM A;  4IBI A;  2DXI A;  5C18 A;  1K3X A;  2F4V M;  1JR3 A;  1YE9 A;  3I51 A;  4AG5 A;  2RGH A;  2EUC A;  2BJV A;  1DO0 A;  8CAT A;  2UU9 M;  4AKG A;  1NVM A;  3FUU A;  1XNR M;  4DR4 M;  3J2P B;  1NNJ A;  4B3S M;  3TQS A;  4L16 A;  5DNY A;  1R2Y A;  3LVV A;  3VDP A;  4LF5 M;  2XH9 A;  5FLX S;  4DR7 M;  3THG A;  1PM5 A;  1ZQ9 A;  3UZU A;  3QAU A;  4LJ5 A;  1G8P A;  5KO3 A;  3RE8 A;  2CHV A;  4MM3 B;  3GPY A;  3AOG A;  3W0L B;  2CHG A;  2Z3X A;  1PJI A;  3R9X B;  5IZ7 D;  2HCB A;  3U60 A;  2XZF A;  2UXB M;  1I94 M;  1HQY E;  3FTD A;  2K47 A;  1IN8 A;  1Q39 A;  4JV5 M;  2VQE M;  2Y0Q A;  1HT1 E;  3U6O A;  4WW0 A;  1QZM A;  4AW4 A;  3FTF A;  4LG2 A;  2R46 A;  5JI2 E;  5EXT A;  3FUT A;  4NRV A;  3AOE A;  1K82 A;  2CHQ A;  1NNU C;  1IBM M;  3LQR A;  3LMM A;  1Q3B A;  2KRU A;  4REZ A;  2LXE A;  2FFJ A;  2R4E A;  4NOO B;  2FOI C;  3GRV A;  4X66 M;  4TUW A;  4WUR A;  2Z4S A;  5KPR A;  3SFZ A;  4S12 A;  4MGK E;  4NL4 H;  3GQ3 A;  3VK7 A;  2DWZ B;  3L27 A;  4QOS A;  4AQY M;  4Z8X A;  3GP1 A;  2KRK A;  4QNR A;  4FVM A;  4MB7 A;  4X65 M;  3U6C A;  1OFH A;  1IY1 A;  5FTL A;  2KZU A;  4IJE A;  3AV0 A;  3SBJ A;  3TL4 X;  1E9S A;  3SYK A;  3U61 B;  3TWK A;  4LJ6 A;  1ZAE A;  2R18 A;  3ZH9 B;  1DGH B;  4LGM A;  1YSY A;  3J7B A;  4FWH A;  4FWG A;  4AZF A;  1HR0 M;  2DWN A;  4KHP M;  2M5Z A;  3AJI B;  3SAW A;  4IBJ A;  4DUY M;  1QQW A;  1GVN A;  3FTC A;  4NXN M;  5E26 A;  5KQD A;  4BBA A;  2C9O A;  2CE7 A;  2UUC M;  3SMS A;  3GPX A;  2O5R A;  3HU3 A;  4JI2 M;  3T15 A;  3C58 A;  4L4U A;  1S3S A;  3MJ5 A;  2XGN A;  2OQ4 A;  2QBY B;  2ZM6 M;  2Y21 A;  1IXZ A;  4JI7 M;  3U61 A;  3TWM A;  3KW6 A;  3U6Q A;  4DV2 M;  4LRS A;  4QOZ C;  3U6S A;  2J7O A;  4JI1 M;  1WXQ A;  4M9X A;  3GLF B;  1Z6T A;  2BJW A;  3U6D A;  4JI8 M;  4PT5 A;  4G4Q A;  2KEB A;  4QHS A;  1GL7 A;  1TH2 A;  3VDU A;  3H4M A;  4QNM A;  2VII A;  3QWL A;  4R3D A;  4GIP A;  4JI0 M;  3GLF A;  4LF7 M;  3KS8 A;  3GLH B;  4DUZ M;  5DYG A;  1IY2 A;  4OW0 A;  3ZC7 B;  2X49 A;  1W5T A;  5C1B A;  3FUV A;  2ZBK B;  4CIS A;  3ILK A;  3GRR A;  1Q3C A;  4GKK M;  1L2D A;  2QCU A;  3SAU A;  3K2L A;  5EP1 A;  4A3V B;  4IJF A;  1G59 A;  5BR8 M;  4MGY E;  2F5Q A;  2I7P A;  2KZS A;  3PFI A;  3PVS A;  3RFW A;  4DR6 M;  2D7E A;  2CEA A;  3K8Z A;  1N77 A;  2YR0 A;  4LF6 M;  1KSF X;  1IY0 A;  3TPZ A;  4W5W A;  2KXE A;  2CV0 A;  3SAR A;  1XMQ M;  3CTW B;  3A45 A;  2F5N A;  3KFU G;  4GHA A;  2EA0 A;  4KLN A;  2QZ4 A;  3SHF A;  1GLN A;  4LJA A;  2CUZ A;  1R6B X;  3KXE C;  2L7I A;  4LZJ A;  2CV2 A;  2HHH M;  3VLF B;  3FTE A;  2XFS A;  1IM2 A;  3LVW A;  1J5E M;  1HNW M;  4FW9 A;  2YFQ A;  4PD2 A;  4B3M M;  1TGU A;  2C98 A;  4KO8 A;  3PXG A;  1XC8 A;  4CHT B;  3KVW A;  4LJ4 A;  1SXJ C;  2C96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...