4YY3M

30s ribosomal subunit- higb complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4yy3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4yy3M02
5ITUA 3SBJA 4NRVA 2UU9M 1MU5A 4LF8M 1L1TA 2UXBM 3GO8A 1KFVA 2F5NA 1MX0A 4DV3M 4ITQA 1IBMM 4JI6M 5ITQA 5ITTA 4DUZM 3T1YM 4JI7M 3GQ4A 1L1ZA 4X65M 4CISA 1Q3BA 3A46A 3U6LA 2EA0A 2HHHM 4JI2M 1FJGM 4DUYM 1PJIA 4DR6M 4PDIA 1Z5BA 1XMQM 3GPXA 1TDHA 3U6CA 3VK7A 1L2CA 2Q2EB 4LFAM 2F5PA 1K3WA 4LF9M 1J5EM 4B3MM 4X66M 4DV1M 3TWLA 5ITYA 1Z59A 3J81S 3GPUA 1I94M 4YHHM 4LF6M 4YY3M 2UUCM 4PDGA 3GPYA 2F4VM 2ZBKB 4GKKM 5BR8M 1TDZA 3TWKA 5ITRA 2ZM6M 2VQEM 4DR5M 4B3RM 4LF5M 2UXDM 4JI8M 4X64M 3SAWA 4PD2A 3GPPA 1HNXM 2F5SA 2UUAM 3GQ5A 1Q39A 3J7AS 3JR5A 4G4QA 4G4RA 1L2DA 1HNWM 4DR4M 4LFBM 5FLXS 3U6OA 5ITXA 1XMOM 1PJJA 4DV7M 1XC8A 1R2ZA 2E5LM 3A42A 1Q3CA 4MB7A 5LMNM 3TWMA 3SARA 4DV6M 1K82A 4DV4M 2XZUA 1N33M 2XZFA 3GP1A 4DR3M 2F5OA 4DV0M 2F5QA 1R2YA 1HNZM 4G4NA 4DV5M 4LF4M 4KHPM 4JI1M 3U6QA 1K3XA 3U6SA 5LMUM 5IWAM 1N34M 3T1HM 4JI4M 3C58A 4X62M 4JI5M 1XNQM 4JYAM 3U6PA 3DOAA 1IBKM 3U6MA 3JR4A 1IBLM 4JV5M 3A45A 5ITXE 1EE8A 2VQFM 4GKJM 3U6DA 4G4OA 4DR2M 1N32M 3JAMS 1Z5CA 1HR0M 4NRWA 1PM5A 3GQ3A 4K0KM 2UXCM 4DR7M 5IT9S 2OQ4A 4DR1M 4B3TM 3W0FA 4PCZA 3SAVA 3VK8A 4JI0M 5A2QS 4B3SM 4LFCM 4NXMM 2OPFA 4AQYM 2UUBM 1NNJA 3OTOM 1L2BA 4LF7M 1Z5AA 4OX9M 3SASA 1N36M 3SAUA 2HKJA 3U6EA 3SATA 4NXNM 3J80S 1XNRM 4DV2M 4JI3M
chains in the Genus database with same CATH superfamily
2R46A 3HGIA 2KA6B 4FWGA 2APLA 1IM2A 3CF6E 2UXBM 3GRVA 4BBAA 1BVSA 2L4FA 1F4IA 1IBMM 1QZEA 2DI0A 2JUJA 3FUXA 2OO9A 3L26A 2OOAA 3I4YA 4B08A 1P3QQ 2BWBA 4DUZM 1OIZA 3T1YM 4CISA 1Q3BA 3U60B 1NY6A 4LJAA 2HHHM 4IBIA 3RFWA 2C96A 1E9RA 1FJGM 2AHMA 4L15A 2V6ZM 3ZQJA 2H1RA 4LJ7A 5GKNA 4PDIA 1IY1A 1TDHA 1VEGA 1N78A 1XXHE 1L2CA 1TTEA 2L4EA 1OIPA 2N35A 2QHOB 2X8AA 3PVSA 1QAQA 2YFQA 3TE6A 5DNYA 3GLFB 2BJVA 3T38A 3GLHE 2DAEA 4X66M 3KOWE 2XGNA 5EXSA 1AUAA 3I04M 5EP2A 3KP0E 5FTLA 4DV1M 1Z59A 1T43A 2DVWB 2FH0A 2RGHA 4KO8A 3FUVA 4LF6M 1OFHA 4YY3M 2UUCM 4PDGA 3GPYA 1NJFA 2XLJA 4OU7A 1X37A 3GLGE 3FTDA 2KDLA 2MJ5B 2J7NA 4GRIA 4DR5M 2RKOA 3B7QA 3EIHA 3I51A 1VDLA 1NNUC 2WZJA 4Q7JA 3AOGA 2QNJA 3SAWA 3GPPA 3UK6A 3IECA 4FCWA 4AKHA 3E4RA 5FSWA 4LZJA 5DFLA 3JR5A 1SXJA 1WGNA 3V76A 4G4RA 1OJLA 2CHQA 2WSCF 3FUWA 1ZMWA 2Z4RA 4DV7M 1XC8A 2E5LM 4NOOB 4NL4H 2CUZA 2KZUA 3A42A 4MB7A 5LMNM 1HQCA 2L09A 4WURA 1G4AE 2KNZA 5IREB 4XBOA 4BLCA 1C7YA 3SC3A 2XZUA 3PXGA 1N33M 3WHLA 5KQDA 2CWBA 2XFTA 2F5OA 2Y21A 4ANRA 2Y0TA 3HWSA 1WGLA 2CP8A 3U6QA 2VF8A 1GLNA 1QAOA 3NBIA 4CHTB 4IBCA 5KPRA 4D80A 1SG9A 4JI5M 1XNQM 3J2PB 2R0IA 2C9CA 1H6UA 3KOZE 2LVQD 3NBXX 1IBKM 2DWZB 2R65A 1I4WA 4LGYA 3JR4A 4W5WA 3U6MA 4JV5M 4MGYE 1EE8A 1DGHA 3KDSE 4FWDA 1TGUA 3TL4X 3SYKA 2BNKA 5F3WA 2R44A 3HHWA 5H37D 3VDUA 1Y8GA 2R45A 3AV0A 5IT9S 3QYEA 1JB0F 2D7HA 4NC6A 3SHGB 3MK6A 5A2QS 2I7PA 3E46A 4R3DA 4L8RC 2P5TA 3Q8XA 4OVZB 4FWHA 2OPFA 3AOEC 3U5ZA 2UUBM 3EIEA 1Z5AA 2QBYA 4OX9M 3U61A 2WSEF 3DA1A 3M0EA 3FRHA 3FUTA 4KLNA 2QQ8A 3SATA 4NXNM 1MJGM 1HR0M 2R6FA 1TF0B 4JI6M 2J5YA 1XNRM 2OOBA 3GLHA 1SXJE 2LTUA 1QAMA 2UU9M 1NSFA 1MU5A 2ZTCA 4LF8M 2KRKA 2K6BA 1R4GA 1L8QA 1MX0A 2DWLA 2HCBA 1IXSB 4FVMA 2ERCA 4L6V6 2MROB 3HU1A 5ITQA 1NO1A 1ZAEA 2VDBB 4KT0F 4LRSA 3HJQA 4MH0E 1HJPA 1GL7A 4JI7M 4GHLA 3GQ4A 3W67A 4X65M 1L1ZA 3H4MA 3SHFA 4CGYB 3ILKA 2EA0A 1V34A 4GC9A 5IZ7D 3SFZA 4S12A 3HY5A 4DR6M 4FCTA 1PGYA 4EIWA 4GITA 2DZOB 3AKZA 4IBDA 3HHXA 1J5EM 1J7KA 4MGZE 3A98B 3MHVC 4P16A 2DWNA 3U60A 1IY2A 3CF2A 3QYBA 3J81S 3GPUA 1I94M 1XXHB 1NVMA 3T15A 1XB2B 1VQ1A 3AL0C 2ZBKB 1TH3A 4KODA 1WIVA 1JR3D 3HKPA 4QNRA 3UGJA 2DHYA 5BR8M 5KPTA 3W68A 1T3TA 3ZC7B 2YQZA 2M5ZA 4IJFA 1E9SA 3AOEA 1IXZA 4JI8M 4RKUF 1G8PA 2R4JA 3GLGB 1HNXM 4LJ5A 1T6OA 3VFDA 5KO3A 3B7NA 3IHPA 3K1JA 4CIZA 5EP3A 3WHKA 3HHYA 4M0DA 3U6OA 4UN2B 1XMOM 4REZA 2ZAMA 1AIPC 4R71A 2JP7A 4IBBA 4LJ6A 2FNAA 4B7HA 3UMMA 1MN3A 2JZ0A 4I4LA 3UZUA 1ZV1A 3LVWA 1PJSA 5C1BA 2XZFA 4L78A 3GP1A 3CF0A 4B7GA 1E94E 1R2YA 2I7NA 4LF4M 2L7HA 1DGBA 1OTRA 3GLIA 1K3XA 3HX3A 5IWAM 2CHGA 2V1CA 4TUWA 2CHVA 4I5SA 3QAUA 5EJCA 3K9OA 4QNMA 4NSOB 4B7FA 1NV9A 3T1HM 2C98A 3IG8A 4JI4M 1QYRA 4X62M 3THGA 3ZCBB 3DOAA 2D7EA 2Z4SA 3R8FA 2XH9A 2DAKA 4D81A 1IBLM 2JNHA 2VQFM 1EIJA 3U6DA 4XK8F 3LW5F 4DR2M 1D2NA 1N32M 4MM3B 3D8BA 5EXXA 3JAMS 4NRWA 3LQQA 4CJ6A 3KS4A 2RGOA 4L16A 4DR7M 2LXEA 2JY8A 1IFYA 1QDRA 1V92A 3W0FA 3K92A 5L8RF 1W5SA 2RRUA 3W0LB 2MH8A 2HL7A 3GLFE 5DYGA 2LVOC 2L2DA 3TPZA 3KW6A 1L2BA 4LF7M 2DAGA 2EJSA 2M60A 2G5GX 3FUUA 4IBGA 5FTMA 3IG5A 2DZNB 3GRUA 3T6PA 2CV0A 3VKGA 3H4JA 3L2AA 3J80S 2QZ4A 4DV2M 4JI3M 4IJEA 2JWSA 2FE8A 1L1TA 3KXEC 4JXJA 3GO8A 2LVAA 2KW0A 2F5NA 4LCBA 2XEPA 4ITQA 3KSXA 2G3QA 5EXPA 1GJSA 4DBGB 1SXJB 2Y20A 3LMMA 4LJ4A 4A3VB 5ITTA 3B89A 4F1IA 1OFIA 1R7RA 3C3EA 3FTCA 2C9OA 3B7ZA 3A46A 2JXNA 5EP4A 3L27A 2HAKA 1LV7A 1G3IA 1V33A 1ORYB 2DZLA 4IBEA 4AZFA 3GLIE 3C9PA 1PJIA 1Z5BA 3GPXA 2LHGA 4RNAA 2Q2EB 2MR9A 2CV2A 3KVWA 3VDPA 4AKGA 1KYIA 4GIPA 4F2LA 1IN7A 3GRYA 3I4VA 3SYLA 1JR3A 2O5RA 3M6AA 1YUBA 4B3MM 4LF9M 4AG6A 2DENA 3LQRA 3TWLA 5ITYA 4AG5A 4YHHM 2QSFX 3HJ8A 4XGIA 3CGWA 2F4VM 3J27B 4G6ZA 5JI3E 3F92A 5FTKA 2O25A 4GKKM 2YR0A 2R18A 3TWKA 5ITRA 2JY5A 2JZ1A 2ZM6M 1DGHB 1VDDA 3PFIA 2UXDM 8CATA 3NWLA 2ZTDA 2EO2A 2KXEA 4QOSA 2KEBA 2L7IA 1C1KA 1QVRA 2DAMA 2DKLA 2FS1A 2QPAA 3BXWA 3E9SA 4X64M 1IN8A 2F5SA 2QP9X 2G8LA 3GQ5A 1RU3A 4IIWA 2JY6B 3J7AS 1PRBA 3Q8GA 1PJQA 3M7GA 4DR4M 2X49A 2CEAA 2XFSA 1NJGA 4LFBM 2V1UA 2Z3XA 3U5ZB 3LCUA 1Q02A 1PJJA 4FCVA 1R5LA 1YLAA 3FRIA 3J7BA 2QBYB 1KSFX 3FE3A 3FTEA 1GKIA 3KOYE 3TWMA 3U61B 4FW9A 4M9SA 3KOXE 4QOZC 5FTJA 4LRTA 3GLHB 4JN6A 2DHRA 2R4EA 4DV0M 3L29A 2D7GA 3GLFA 4LG2A 5KQ8A 1WR1B 2FFJA 5LMUM 2FOIC 5BPVA 4AKIA 1N77A 2J7OA 1N34M 3LCVB 2LNHC 4P17A 4JYAM 4AW4A 2KRUA 5EXTA 4GMQA 3L25A 4OW0A 3K9PA 2YNMD 2B3TA 2DAIA 4M9ZA 3A45A 1NV8A 1E32A 1JR3E 1QUSA 5ITXE 3QWLA 4GKJM 7CATA 3FYCA 4QHSA 1Z5CA 1G59A 3GQ3A 4LGMA 3I01M 4II7A 2C99A 2OQ4A 2XSZD 1HQYE 5KPZA 1TH2A 1IXRC 4PCZA 3VK8A 4B3SM 4NXMM 3DFZA 1YE9A 1YSYA 3UJNA 4GEWA 1Z6TA 3OTOM 1WHCA 2MGWA 3E21A 4G3OA 4AI6A 3SASA 2NQ8C 2QCUA 3B74A 3SAUA 4I81A 4ZPXA 3PNVA 1DO0A 3HHZA 4LY6A 5ITUA 3SBJA 1DGGA 3HU3A 4NRVA 4Z6YA 1N75A 1QQWA 1IQPA 1ZMVA 3PNYA 4R7GA 1LTMA 2Z7JA 1KFVA 4DV3M 4GC5A 1S3SA 5EP1A 2ZANA 2KNVA 2BJWA 5DYIA 4HLQA 1IN4A 3CTWB 4RF0A 4Y28F 3U6LA 2LH0A 5E26A 2HWJA 4WW0A 4L4UA 4JI2M 3B9PA 2Z8YM 4DUYM 1VG5A 2EKFA 1XMQM 2CV1A 3U6CA 3VK7A 1OAIA 4LFAM 3L28A 4M0WA 2DWMA 2F5PA 2H5XA 1K3WA 1TH4A 2LWXA 2EUCA 1DV0A 3GLIB 1GJTA 2DXIA 1CUKA 1EFUB 2LVNC 3FKEA 4NSRA 4QHTA 1G71A 2DNAA 5FTNA 4OVZA 2X4AA 2XF3A 1WJ7A 2VIIA 4RF1A 1NHWC 2CFOA 2QENA 4MGIE 1OKSA 3FYDA 4IBJA 4GHAA 1D0MA 1TDZA 3ZH9B 2VQEM 4B3RM 3GRRA 3AFHA 4LF5M 2K47A 2JA2A 3K8ZA 3SMPA 5JI2E 2LVPC 2GQFA 4WP2A 1OQYA 4MGHA 1FNNA 4PD2A 2UUAM 1Q39A 1IXSA 1ZMUA 2K9DA 1J09A 3D8LA 3HJSA 5E6JA 4G4QA 1TR8A 2KZSA 1L2DA 1HNWM 3R9XB 1W5TA 2BWEA 4LJ8A 3SMSA 5FLXS 4IBFA 5ITXA 1R2ZA 2A5YB 1Q3CA 2O01F 3SARA 4DV6M 1K82A 1D0KA 3BBZA 4DV4M 1PJTA 1SXJD 2R62A 3VKHA 3RGSA 2VF7A 3TQSA 5C18A 4PT5A 2K0BX 4M9XA 2LBCA 1A5TA 1DO2A 3KSJA 2Y0QA 1NHGC 4DR3M 2CRUA 2KHHA 1IN6A 4FD2A 1QUTA 2F5QA 1HNZM 4LJ9A 4DV5M 4G4NA 4KHPM 1GO5A 4JI1M 3U6SA 5EQTA 1VEKA 3HU2A 1UFZA 1XXHA 1R6BX 2CE7A 3BOSA 3MJ5A 4I8OA 4Z8XA 4LZZA 3C58A 3DZDA 3K2LA 3U6PA 4MGKE 3KP1E 3RGPA 2C5RA 1XWIA 2GNOA 2W82A 2WSFF 2XSZA 1OAOC 1UM8A 3FD9A 2JY7A 3MMPA 1DGFA 1XHBA 1IY0A 2EKKA 4G4OA 3LVVA 1QANA 3HZJA 3GLGA 1IN5A 1QZMA 3VLFB 1PM5A 4K0KM 2UXCM 4HL4A 1WXQA 1D0LA 4DR1M 4B3TM 4HEOA 1HT1E 1ZQ9A 4D82A 3SAVA 2ZAOA 4JI0M 3KFUG 4LFCM 3C3DA 1QDTA 3FTFA 1G41A 1VEJA 2KNAA 2LHCA 4AQYM 1NY5A 4BB9A 1NNJA 1GL6A 1GABA 3RE8A 1JQJC 1HT2E 1GVNA 1N36M 4GH9A 3AJIB 3KS8A 2HKJA 2L6OA 3U6EA 4IBKA 1SXJC
chains in the Genus database with same CATH topology
2R46A 3HGIA 2KA6B 4FWGA 1IM2A 3CF6E 2UXBM 3GRVA 4BBAA 1IBMM 3FUXA 3L26A 3I4YA 4B08A 4DUZM 3T1YM 4CISA 1Q3BA 3U60B 1NY6A 4LJAA 2HHHM 4IBIA 3RFWA 2C96A 1E9RA 1FJGM 2AHMA 4L15A 2V6ZM 2H1RA 4LJ7A 5GKNA 4PDIA 1IY1A 1TDHA 1N78A 1L2CA 2X8AA 3TE6A 3PVSA 1QAQA 2YFQA 5DNYA 3GLFB 2BJVA 3T38A 4X66M 3KOWE 2XGNA 5EXSA 5EP2A 5FTLA 4DV1M 3KP0E 1Z59A 2DVWB 2RGHA 4KO8A 3FUVA 4LF6M 1OFHA 4YY3M 2UUCM 4PDGA 3GPYA 1NJFA 2XLJA 4OU7A 1X37A 3FTDA 2J7NA 4GRIA 4DR5M 2RKOA 3EIHA 3I51A 1NNUC 3AOGA 3SAWA 3GPPA 3UK6A 4FCWA 4AKHA 3E4RA 5FSWA 4LZJA 3JR5A 1SXJA 4G4RA 1OJLA 2CHQA 3FUWA 2Z4RA 4DV7M 1XC8A 2E5LM 4NOOB 4NL4H 2CUZA 2KZUA 3A42A 4MB7A 5LMNM 1HQCA 2L09A 4WURA 1G4AE 5IREB 4BLCA 4XBOA 3SC3A 2XZUA 3PXGA 1N33M 3WHLA 5KQDA 2XFTA 2F5OA 2Y21A 2Y0TA 3HWSA 3U6QA 1QAOA 1GLNA 3NBIA 4CHTB 4IBCA 5KPRA 4D80A 4JI5M 1XNQM 3J2PB 2C9CA 1H6UA 3KOZE 1IBKM 2DWZB 2R65A 1I4WA 4LGYA 3JR4A 4W5WA 3U6MA 4JV5M 4MGYE 1EE8A 1DGHA 3KDSE 4FWDA 1TGUA 3TL4X 3SYKA 2BNKA 5F3WA 3HHWA 5H37D 3VDUA 2R45A 3AV0A 5IT9S 2D7HA 3SHGB 3MK6A 5A2QS 2I7PA 4R3DA 4L8RC 2P5TA 3Q8XA 4OVZB 4FWHA 2OPFA 3AOEC 3U5ZA 2UUBM 3EIEA 1Z5AA 2QBYA 4OX9M 3U61A 3DA1A 3M0EA 3FUTA 4KLNA 3SATA 4JI6M 4NXNM 1HR0M 1XNRM 3GLHA 1SXJE 1QAMA 2UU9M 1NSFA 1MU5A 4LF8M 2KRKA 1L8QA 1MX0A 2DWLA 2HCBA 1IXSB 4FVMA 2ERCA 3HU1A 5ITQA 1ZAEA 4LRSA 3HJQA 4MH0E 1GL7A 4JI7M 4GHLA 3GQ4A 1L1ZA 4X65M 3H4MA 3SHFA 4CGYB 3ILKA 2EA0A 4GC9A 5IZ7D 3SFZA 4S12A 4DR6M 4FCTA 4EIWA 4GITA 2DZOB 3AKZA 4IBDA 3HHXA 1J5EM 1J7KA 4MGZE 3A98B 3MHVC 4P16A 2DWNA 3U60A 1IY2A 3CF2A 3J81S 3GPUA 1I94M 1XXHB 1NVMA 3T15A 3AL0C 2ZBKB 1TH3A 4KODA 1JR3D 3HKPA 4QNRA 3UGJA 5BR8M 5KPTA 1T3TA 3ZC7B 2YQZA 2M5ZA 4IJFA 1E9SA 3AOEA 1IXZA 4JI8M 1G8PA 2R4JA 3GLGB 1HNXM 4LJ5A 3VFDA 5KO3A 3K1JA 5EP3A 3WHKA 3HHYA 4M0DA 3U6OA 1XMOM 4REZA 2ZAMA 4IBBA 4LJ6A 2FNAA 4B7HA 3UMMA 4I4LA 3UZUA 3LVWA 5C1BA 2XZFA 4L78A 3GP1A 3CF0A 4B7GA 1E94E 1R2YA 2I7NA 4LF4M 2L7HA 1DGBA 3GLIA 1K3XA 5IWAM 2CHGA 2V1CA 4TUWA 2CHVA 4I5SA 3QAUA 5EJCA 4QNMA 4NSOB 4B7FA 3T1HM 2C98A 3IG8A 4JI4M 1QYRA 4X62M 3THGA 3ZCBB 3DOAA 2D7EA 2Z4SA 3R8FA 2XH9A 4D81A 1IBLM 2VQFM 3U6DA 4DR2M 1D2NA 1N32M 4MM3B 3D8BA 5EXXA 3JAMS 4NRWA 3LQQA 3KS4A 2RGOA 4L16A 4DR7M 2LXEA 3W0FA 3K92A 1W5SA 3W0LB 2HL7A 5DYGA 3TPZA 3KW6A 1L2BA 4LF7M 3FUUA 2M60A 2G5GX 4IBGA 5FTMA 3IG5A 2DZNB 3GRUA 2CV0A 3VKGA 3L2AA 3J80S 2QZ4A 4DV2M 4JI3M 4IJEA 2FE8A 1L1TA 3KXEC 4JXJA 3GO8A 2F5NA 2KW0A 4LCBA 2XEPA 4ITQA 3KSXA 5EXPA 1SXJB 2Y20A 3LMMA 4LJ4A 4A3VB 5ITTA 1OFIA 1R7RA 3FTCA 2C9OA 3A46A 5EP4A 3L27A 4IBEA 1LV7A 1G3IA 1ORYB 4AZFA 1PJIA 1Z5BA 3GPXA 4RNAA 2Q2EB 2CV2A 3KVWA 3VDPA 4AKGA 1KYIA 4GIPA 1IN7A 3GRYA 3I4VA 3SYLA 1JR3A 2O5RA 3M6AA 1YUBA 4B3MM 4LF9M 4AG6A 3LQRA 3TWLA 5ITYA 4AG5A 4YHHM 3HJ8A 4XGIA 2F4VM 3J27B 4G6ZA 5JI3E 5FTKA 4GKKM 2YR0A 2R18A 3TWKA 5ITRA 2ZM6M 1DGHB 1VDDA 3PFIA 2UXDM 8CATA 3NWLA 2EO2A 2KXEA 4QOSA 2KEBA 2L7IA 1C1KA 1QVRA 2QPAA 3E9SA 4X64M 1IN8A 2F5SA 2QP9X 2G8LA 3GQ5A 4IIWA 3J7AS 3M7GA 4DR4M 2X49A 2CEAA 2XFSA 1NJGA 4LFBM 2V1UA 2Z3XA 3U5ZB 1PJJA 4FCVA 3J7BA 2QBYB 1KSFX 3FTEA 1GKIA 3KOYE 3TWMA 3U61B 4FW9A 4M9SA 3KOXE 4QOZC 5FTJA 4LRTA 3GLHB 4JN6A 2DHRA 2R4EA 4DV0M 3L29A 2D7GA 3GLFA 4LG2A 5KQ8A 2FFJA 5LMUM 2FOIC 5BPVA 4AKIA 1N77A 2J7OA 1N34M 2LNHC 4JYAM 4AW4A 2KRUA 5EXTA 4GMQA 3L25A 4OW0A 2YNMD 4M9ZA 3A45A 5ITXE 1E32A 3QWLA 4GKJM 7CATA 3FYCA 4QHSA 1Z5CA 1G59A 3GQ3A 4LGMA 4II7A 2C99A 2OQ4A 2XSZD 1HQYE 5KPZA 1TH2A 1IXRC 4PCZA 3VK8A 4B3SM 4NXMM 3DFZA 1YE9A 1YSYA 3UJNA 1Z6TA 3OTOM 4AI6A 3SASA 2NQ8C 2QCUA 3SAUA 4I81A 4ZPXA 3PNVA 1DO0A 3HHZA 4LY6A 5ITUA 3SBJA 1DGGA 3HU3A 4NRVA 4Z6YA 1N75A 1QQWA 1IQPA 3PNYA 4R7GA 2Z7JA 1KFVA 4DV3M 4GC5A 1S3SA 5EP1A 2ZANA 2BJWA 5DYIA 4HLQA 1IN4A 3CTWB 4RF0A 3U6LA 2LH0A 5E26A 4WW0A 4L4UA 4JI2M 3B9PA 4DUYM 1XMQM 2CV1A 3U6CA 3VK7A 2DWMA 4LFAM 3L28A 4M0WA 2F5PA 1K3WA 1TH4A 2LWXA 2EUCA 3GLIB 2DXIA 4QHTA 3FKEA 4NSRA 5FTNA 4OVZA 2X4AA 2XF3A 2VIIA 4RF1A 1NHWC 2CFOA 2QENA 4MGIE 3FYDA 4IBJA 4GHAA 1TDZA 3ZH9B 2VQEM 4B3RM 3GRRA 3AFHA 4LF5M 2K47A 2JA2A 3K8ZA 3SMPA 5JI2E 4MGHA 1FNNA 4PD2A 2UUAM 1Q39A 1J09A 3D8LA 3HJSA 5E6JA 4G4QA 1L2DA 2KZSA 1HNWM 3R9XB 1W5TA 4LJ8A 3SMSA 5FLXS 4IBFA 5ITXA 1R2ZA 2A5YB 1Q3CA 3SARA 4DV6M 1K82A 4DV4M 1SXJD 2R62A 3VKHA 3RGSA 5C18A 3TQSA 4PT5A 4M9XA 3KSJA 1DO2A 2Y0QA 1NHGC 4DR3M 1IN6A 4FD2A 2F5QA 1HNZM 4LJ9A 4DV5M 4G4NA 4KHPM 4JI1M 3U6SA 5EQTA 3HU2A 1XXHA 1R6BX 2CE7A 3BOSA 3MJ5A 4I8OA 4Z8XA 4LZZA 3C58A 3DZDA 3K2LA 3U6PA 4MGKE 3KP1E 3RGPA 2C5RA 1XWIA 2W82A 2XSZA 1UM8A 3FD9A 1DGFA 1XHBA 1IY0A 4G4OA 3LVVA 1QANA 3GLGA 1IN5A 1QZMA 3VLFB 1PM5A 4K0KM 2UXCM 4HL4A 1WXQA 4DR1M 4B3TM 4D82A 1HT1E 1ZQ9A 3KFUG 3SAVA 2ZAOA 4JI0M 4LFCM 3FTFA 1G41A 4AQYM 1NNJA 1NY5A 4BB9A 1GL6A 3RE8A 1JQJC 1HT2E 1GVNA 1N36M 4GH9A 3AJIB 3KS8A 2HKJA 2L6OA 3U6EA 4IBKA 1SXJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITU A;  3SBJ A;  4NRV A;  2UU9 M;  1MU5 A;  4LF8 M;  1L1T A;  2UXB M;  3GO8 A;  1KFV A;  2F5N A;  1MX0 A;  4DV3 M;  4ITQ A;  1IBM M;  4JI6 M;  5ITQ A;  5ITT A;  4DUZ M;  3T1Y M;  4JI7 M;  3GQ4 A;  1L1Z A;  4X65 M;  4CIS A;  1Q3B A;  3A46 A;  3U6L A;  2EA0 A;  2HHH M;  4JI2 M;  1FJG M;  4DUY M;  1PJI A;  4DR6 M;  4PDI A;  1Z5B A;  1XMQ M;  3GPX A;  1TDH A;  3U6C A;  3VK7 A;  1L2C A;  2Q2E B;  4LFA M;  2F5P A;  1K3W A;  4LF9 M;  1J5E M;  4B3M M;  4X66 M;  4DV1 M;  3TWL A;  5ITY A;  1Z59 A;  3J81 S;  3GPU A;  1I94 M;  4YHH M;  4LF6 M;  4YY3 M;  2UUC M;  4PDG A;  3GPY A;  2F4V M;  2ZBK B;  4GKK M;  5BR8 M;  1TDZ A;  3TWK A;  5ITR A;  2ZM6 M;  2VQE M;  4DR5 M;  4B3R M;  4LF5 M;  2UXD M;  4JI8 M;  4X64 M;  3SAW A;  4PD2 A;  3GPP A;  1HNX M;  2F5S A;  2UUA M;  3GQ5 A;  1Q39 A;  3J7A S;  3JR5 A;  4G4Q A;  4G4R A;  1L2D A;  1HNW M;  4DR4 M;  4LFB M;  5FLX S;  3U6O A;  5ITX A;  1XMO M;  1PJJ A;  4DV7 M;  1XC8 A;  1R2Z A;  2E5L M;  3A42 A;  1Q3C A;  4MB7 A;  5LMN M;  3TWM A;  3SAR A;  4DV6 M;  1K82 A;  4DV4 M;  2XZU A;  1N33 M;  2XZF A;  3GP1 A;  4DR3 M;  2F5O A;  4DV0 M;  2F5Q A;  1R2Y A;  1HNZ M;  4G4N A;  4DV5 M;  4LF4 M;  4KHP M;  4JI1 M;  3U6Q A;  1K3X A;  3U6S A;  5LMU M;  5IWA M;  1N34 M;  3T1H M;  4JI4 M;  3C58 A;  4X62 M;  4JI5 M;  1XNQ M;  4JYA M;  3U6P A;  3DOA A;  1IBK M;  3U6M A;  3JR4 A;  1IBL M;  4JV5 M;  3A45 A;  5ITX E;  1EE8 A;  2VQF M;  4GKJ M;  3U6D A;  4G4O A;  4DR2 M;  1N32 M;  3JAM S;  1Z5C A;  1HR0 M;  4NRW A;  1PM5 A;  3GQ3 A;  4K0K M;  2UXC M;  4DR7 M;  5IT9 S;  2OQ4 A;  4DR1 M;  4B3T M;  3W0F A;  4PCZ A;  3SAV A;  3VK8 A;  4JI0 M;  5A2Q S;  4B3S M;  4LFC M;  4NXM M;  2OPF A;  4AQY M;  2UUB M;  1NNJ A;  3OTO M;  1L2B A;  4LF7 M;  1Z5A A;  4OX9 M;  3SAS A;  1N36 M;  3SAU A;  2HKJ A;  3U6E A;  3SAT A;  4NXN M;  3J80 S;  1XNR M;  4DV2 M;  4JI3 M; 
#chains in the Genus database with same CATH topology
 2R46 A;  3HGI A;  2KA6 B;  4FWG A;  2APL A;  1IM2 A;  3CF6 E;  2UXB M;  3GRV A;  4BBA A;  1BVS A;  2L4F A;  1F4I A;  1IBM M;  1QZE A;  2DI0 A;  2JUJ A;  3FUX A;  2OO9 A;  3L26 A;  2OOA A;  3I4Y A;  4B08 A;  1P3Q Q;  2BWB A;  4DUZ M;  1OIZ A;  3T1Y M;  4CIS A;  1Q3B A;  3U60 B;  1NY6 A;  4LJA A;  2HHH M;  4IBI A;  3RFW A;  2C96 A;  1E9R A;  1FJG M;  2AHM A;  4L15 A;  2V6Z M;  3ZQJ A;  2H1R A;  4LJ7 A;  5GKN A;  4PDI A;  1IY1 A;  1TDH A;  1VEG A;  1N78 A;  1XXH E;  1L2C A;  1TTE A;  2L4E A;  1OIP A;  2N35 A;  2QHO B;  2X8A A;  3PVS A;  1QAQ A;  2YFQ A;  3TE6 A;  5DNY A;  3GLF B;  2BJV A;  3T38 A;  3GLH E;  2DAE A;  4X66 M;  3KOW E;  2XGN A;  5EXS A;  1AUA A;  3I04 M;  5EP2 A;  3KP0 E;  5FTL A;  4DV1 M;  1Z59 A;  1T43 A;  2DVW B;  2FH0 A;  2RGH A;  4KO8 A;  3FUV A;  4LF6 M;  1OFH A;  4YY3 M;  2UUC M;  4PDG A;  3GPY A;  1NJF A;  2XLJ A;  4OU7 A;  1X37 A;  3GLG E;  3FTD A;  2KDL A;  2MJ5 B;  2J7N A;  4GRI A;  4DR5 M;  2RKO A;  3B7Q A;  3EIH A;  3I51 A;  1VDL A;  1NNU C;  2WZJ A;  4Q7J A;  3AOG A;  2QNJ A;  3SAW A;  3GPP A;  3UK6 A;  3IEC A;  4FCW A;  4AKH A;  3E4R A;  5FSW A;  4LZJ A;  5DFL A;  3JR5 A;  1SXJ A;  1WGN A;  3V76 A;  4G4R A;  1OJL A;  2CHQ A;  2WSC F;  3FUW A;  1ZMW A;  2Z4R A;  4DV7 M;  1XC8 A;  2E5L M;  4NOO B;  4NL4 H;  2CUZ A;  2KZU A;  3A42 A;  4MB7 A;  5LMN M;  1HQC A;  2L09 A;  4WUR A;  1G4A E;  2KNZ A;  5IRE B;  4XBO A;  4BLC A;  1C7Y A;  3SC3 A;  2XZU A;  3PXG A;  1N33 M;  3WHL A;  5KQD A;  2CWB A;  2XFT A;  2F5O A;  2Y21 A;  4ANR A;  2Y0T A;  3HWS A;  1WGL A;  2CP8 A;  3U6Q A;  2VF8 A;  1GLN A;  1QAO A;  3NBI A;  4CHT B;  4IBC A;  5KPR A;  4D80 A;  1SG9 A;  4JI5 M;  1XNQ M;  3J2P B;  2R0I A;  2C9C A;  1H6U A;  3KOZ E;  2LVQ D;  3NBX X;  1IBK M;  2DWZ B;  2R65 A;  1I4W A;  4LGY A;  3JR4 A;  4W5W A;  3U6M A;  4JV5 M;  4MGY E;  1EE8 A;  1DGH A;  3KDS E;  4FWD A;  1TGU A;  3TL4 X;  3SYK A;  2BNK A;  5F3W A;  2R44 A;  3HHW A;  5H37 D;  3VDU A;  1Y8G A;  2R45 A;  3AV0 A;  5IT9 S;  3QYE A;  1JB0 F;  2D7H A;  4NC6 A;  3SHG B;  3MK6 A;  5A2Q S;  2I7P A;  3E46 A;  4R3D A;  4L8R C;  2P5T A;  3Q8X A;  4OVZ B;  4FWH A;  2OPF A;  3AOE C;  3U5Z A;  2UUB M;  3EIE A;  1Z5A A;  2QBY A;  4OX9 M;  3U61 A;  2WSE F;  3DA1 A;  3M0E A;  3FRH A;  3FUT A;  4KLN A;  2QQ8 A;  3SAT A;  4NXN M;  1MJG M;  1HR0 M;  2R6F A;  1TF0 B;  4JI6 M;  2J5Y A;  1XNR M;  2OOB A;  3GLH A;  1SXJ E;  2LTU A;  1QAM A;  2UU9 M;  1NSF A;  1MU5 A;  2ZTC A;  4LF8 M;  2KRK A;  2K6B A;  1R4G A;  1L8Q A;  1MX0 A;  2DWL A;  2HCB A;  1IXS B;  4FVM A;  2ERC A;  4L6V 6;  2MRO B;  3HU1 A;  5ITQ A;  1NO1 A;  1ZAE A;  2VDB B;  4KT0 F;  4LRS A;  3HJQ A;  4MH0 E;  1HJP A;  1GL7 A;  4JI7 M;  4GHL A;  3GQ4 A;  3W67 A;  4X65 M;  1L1Z A;  3H4M A;  3SHF A;  4CGY B;  3ILK A;  2EA0 A;  1V34 A;  4GC9 A;  5IZ7 D;  3SFZ A;  4S12 A;  3HY5 A;  4DR6 M;  4FCT A;  1PGY A;  4EIW A;  4GIT A;  2DZO B;  3AKZ A;  4IBD A;  3HHX A;  1J5E M;  1J7K A;  4MGZ E;  3A98 B;  3MHV C;  4P16 A;  2DWN A;  3U60 A;  1IY2 A;  3CF2 A;  3QYB A;  3J81 S;  3GPU A;  1I94 M;  1XXH B;  1NVM A;  3T15 A;  1XB2 B;  1VQ1 A;  3AL0 C;  2ZBK B;  1TH3 A;  4KOD A;  1WIV A;  1JR3 D;  3HKP A;  4QNR A;  3UGJ A;  2DHY A;  5BR8 M;  5KPT A;  3W68 A;  1T3T A;  3ZC7 B;  2YQZ A;  2M5Z A;  4IJF A;  1E9S A;  3AOE A;  1IXZ A;  4JI8 M;  4RKU F;  1G8P A;  2R4J A;  3GLG B;  1HNX M;  4LJ5 A;  1T6O A;  3VFD A;  5KO3 A;  3B7N A;  3IHP A;  3K1J A;  4CIZ A;  5EP3 A;  3WHK A;  3HHY A;  4M0D A;  3U6O A;  4UN2 B;  1XMO M;  4REZ A;  2ZAM A;  1AIP C;  4R71 A;  2JP7 A;  4IBB A;  4LJ6 A;  2FNA A;  4B7H A;  3UMM A;  1MN3 A;  2JZ0 A;  4I4L A;  3UZU A;  1ZV1 A;  3LVW A;  1PJS A;  5C1B A;  2XZF A;  4L78 A;  3GP1 A;  3CF0 A;  4B7G A;  1E94 E;  1R2Y A;  2I7N A;  4LF4 M;  2L7H A;  1DGB A;  1OTR A;  3GLI A;  1K3X A;  3HX3 A;  5IWA M;  2CHG A;  2V1C A;  4TUW A;  2CHV A;  4I5S A;  3QAU A;  5EJC A;  3K9O A;  4QNM A;  4NSO B;  4B7F A;  1NV9 A;  3T1H M;  2C98 A;  3IG8 A;  4JI4 M;  1QYR A;  4X62 M;  3THG A;  3ZCB B;  3DOA A;  2D7E A;  2Z4S A;  3R8F A;  2XH9 A;  2DAK A;  4D81 A;  1IBL M;  2JNH A;  2VQF M;  1EIJ A;  3U6D A;  4XK8 F;  3LW5 F;  4DR2 M;  1D2N A;  1N32 M;  4MM3 B;  3D8B A;  5EXX A;  3JAM S;  4NRW A;  3LQQ A;  4CJ6 A;  3KS4 A;  2RGO A;  4L16 A;  4DR7 M;  2LXE A;  2JY8 A;  1IFY A;  1QDR A;  1V92 A;  3W0F A;  3K92 A;  5L8R F;  1W5S A;  2RRU A;  3W0L B;  2MH8 A;  2HL7 A;  3GLF E;  5DYG A;  2LVO C;  2L2D A;  3TPZ A;  3KW6 A;  1L2B A;  4LF7 M;  2DAG A;  2EJS A;  2M60 A;  2G5G X;  3FUU A;  4IBG A;  5FTM A;  3IG5 A;  2DZN B;  3GRU A;  3T6P A;  2CV0 A;  3VKG A;  3H4J A;  3L2A A;  3J80 S;  2QZ4 A;  4DV2 M;  4JI3 M;  4IJE A;  2JWS A;  2FE8 A;  1L1T A;  3KXE C;  4JXJ A;  3GO8 A;  2LVA A;  2KW0 A;  2F5N A;  4LCB A;  2XEP A;  4ITQ A;  3KSX A;  2G3Q A;  5EXP A;  1GJS A;  4DBG B;  1SXJ B;  2Y20 A;  3LMM A;  4LJ4 A;  4A3V B;  5ITT A;  3B89 A;  4F1I A;  1OFI A;  1R7R A;  3C3E A;  3FTC A;  2C9O A;  3B7Z A;  3A46 A;  2JXN A;  5EP4 A;  3L27 A;  2HAK A;  1LV7 A;  1G3I A;  1V33 A;  1ORY B;  2DZL A;  4IBE A;  4AZF A;  3GLI E;  3C9P A;  1PJI A;  1Z5B A;  3GPX A;  2LHG A;  4RNA A;  2Q2E B;  2MR9 A;  2CV2 A;  3KVW A;  3VDP A;  4AKG A;  1KYI A;  4GIP A;  4F2L A;  1IN7 A;  3GRY A;  3I4V A;  3SYL A;  1JR3 A;  2O5R A;  3M6A A;  1YUB A;  4B3M M;  4LF9 M;  4AG6 A;  2DEN A;  3LQR A;  3TWL A;  5ITY A;  4AG5 A;  4YHH M;  2QSF X;  3HJ8 A;  4XGI A;  3CGW A;  2F4V M;  3J27 B;  4G6Z A;  5JI3 E;  3F92 A;  5FTK A;  2O25 A;  4GKK M;  2YR0 A;  2R18 A;  3TWK A;  5ITR A;  2JY5 A;  2JZ1 A;  2ZM6 M;  1DGH B;  1VDD A;  3PFI A;  2UXD M;  8CAT A;  3NWL A;  2ZTD A;  2EO2 A;  2KXE A;  4QOS A;  2KEB A;  2L7I A;  1C1K A;  1QVR A;  2DAM A;  2DKL A;  2FS1 A;  2QPA A;  3BXW A;  3E9S A;  4X64 M;  1IN8 A;  2F5S A;  2QP9 X;  2G8L A;  3GQ5 A;  1RU3 A;  4IIW A;  2JY6 B;  3J7A S;  1PRB A;  3Q8G A;  1PJQ A;  3M7G A;  4DR4 M;  2X49 A;  2CEA A;  2XFS A;  1NJG A;  4LFB M;  2V1U A;  2Z3X A;  3U5Z B;  3LCU A;  1Q02 A;  1PJJ A;  4FCV A;  1R5L A;  1YLA A;  3FRI A;  3J7B A;  2QBY B;  1KSF X;  3FE3 A;  3FTE A;  1GKI A;  3KOY E;  3TWM A;  3U61 B;  4FW9 A;  4M9S A;  3KOX E;  4QOZ C;  5FTJ A;  4LRT A;  3GLH B;  4JN6 A;  2DHR A;  2R4E A;  4DV0 M;  3L29 A;  2D7G A;  3GLF A;  4LG2 A;  5KQ8 A;  1WR1 B;  2FFJ A;  5LMU M;  2FOI C;  5BPV A;  4AKI A;  1N77 A;  2J7O A;  1N34 M;  3LCV B;  2LNH C;  4P17 A;  4JYA M;  4AW4 A;  2KRU A;  5EXT A;  4GMQ A;  3L25 A;  4OW0 A;  3K9P A;  2YNM D;  2B3T A;  2DAI A;  4M9Z A;  3A45 A;  1NV8 A;  1E32 A;  1JR3 E;  1QUS A;  5ITX E;  3QWL A;  4GKJ M;  7CAT A;  3FYC A;  4QHS A;  1Z5C A;  1G59 A;  3GQ3 A;  4LGM A;  3I01 M;  4II7 A;  2C99 A;  2OQ4 A;  2XSZ D;  1HQY E;  5KPZ A;  1TH2 A;  1IXR C;  4PCZ A;  3VK8 A;  4B3S M;  4NXM M;  3DFZ A;  1YE9 A;  1YSY A;  3UJN A;  4GEW A;  1Z6T A;  3OTO M;  1WHC A;  2MGW A;  3E21 A;  4G3O A;  4AI6 A;  3SAS A;  2NQ8 C;  2QCU A;  3B74 A;  3SAU A;  4I81 A;  4ZPX A;  3PNV A;  1DO0 A;  3HHZ A;  4LY6 A;  5ITU A;  3SBJ A;  1DGG A;  3HU3 A;  4NRV A;  4Z6Y A;  1N75 A;  1QQW A;  1IQP A;  1ZMV A;  3PNY A;  4R7G A;  1LTM A;  2Z7J A;  1KFV A;  4DV3 M;  4GC5 A;  1S3S A;  5EP1 A;  2ZAN A;  2KNV A;  2BJW A;  5DYI A;  4HLQ A;  1IN4 A;  3CTW B;  4RF0 A;  4Y28 F;  3U6L A;  2LH0 A;  5E26 A;  2HWJ A;  4WW0 A;  4L4U A;  4JI2 M;  3B9P A;  2Z8Y M;  4DUY M;  1VG5 A;  2EKF A;  1XMQ M;  2CV1 A;  3U6C A;  3VK7 A;  1OAI A;  4LFA M;  3L28 A;  4M0W A;  2DWM A;  2F5P A;  2H5X A;  1K3W A;  1TH4 A;  2LWX A;  2EUC A;  1DV0 A;  3GLI B;  1GJT A;  2DXI A;  1CUK A;  1EFU B;  2LVN C;  3FKE A;  4NSR A;  4QHT A;  1G71 A;  2DNA A;  5FTN A;  4OVZ A;  2X4A A;  2XF3 A;  1WJ7 A;  2VII A;  4RF1 A;  1NHW C;  2CFO A;  2QEN A;  4MGI E;  1OKS A;  3FYD A;  4IBJ A;  4GHA A;  1D0M A;  1TDZ A;  3ZH9 B;  2VQE M;  4B3R M;  3GRR A;  3AFH A;  4LF5 M;  2K47 A;  2JA2 A;  3K8Z A;  3SMP A;  5JI2 E;  2LVP C;  2GQF A;  4WP2 A;  1OQY A;  4MGH A;  1FNN A;  4PD2 A;  2UUA M;  1Q39 A;  1IXS A;  1ZMU A;  2K9D A;  1J09 A;  3D8L A;  3HJS A;  5E6J A;  4G4Q A;  1TR8 A;  2KZS A;  1L2D A;  1HNW M;  3R9X B;  1W5T A;  2BWE A;  4LJ8 A;  3SMS A;  5FLX S;  4IBF A;  5ITX A;  1R2Z A;  2A5Y B;  1Q3C A;  2O01 F;  3SAR A;  4DV6 M;  1K82 A;  1D0K A;  3BBZ A;  4DV4 M;  1PJT A;  1SXJ D;  2R62 A;  3VKH A;  3RGS A;  2VF7 A;  3TQS A;  5C18 A;  4PT5 A;  2K0B X;  4M9X A;  2LBC A;  1A5T A;  1DO2 A;  3KSJ A;  2Y0Q A;  1NHG C;  4DR3 M;  2CRU A;  2KHH A;  1IN6 A;  4FD2 A;  1QUT A;  2F5Q A;  1HNZ M;  4LJ9 A;  4DV5 M;  4G4N A;  4KHP M;  1GO5 A;  4JI1 M;  3U6S A;  5EQT A;  1VEK A;  3HU2 A;  1UFZ A;  1XXH A;  1R6B X;  2CE7 A;  3BOS A;  3MJ5 A;  4I8O A;  4Z8X A;  4LZZ A;  3C58 A;  3DZD A;  3K2L A;  3U6P A;  4MGK E;  3KP1 E;  3RGP A;  2C5R A;  1XWI A;  2GNO A;  2W82 A;  2WSF F;  2XSZ A;  1OAO C;  1UM8 A;  3FD9 A;  2JY7 A;  3MMP A;  1DGF A;  1XHB A;  1IY0 A;  2EKK A;  4G4O A;  3LVV A;  1QAN A;  3HZJ A;  3GLG A;  1IN5 A;  1QZM A;  3VLF B;  1PM5 A;  4K0K M;  2UXC M;  4HL4 A;  1WXQ A;  1D0L A;  4DR1 M;  4B3T M;  4HEO A;  1HT1 E;  1ZQ9 A;  4D82 A;  3SAV A;  2ZAO A;  4JI0 M;  3KFU G;  4LFC M;  3C3D A;  1QDT A;  3FTF A;  1G41 A;  1VEJ A;  2KNA A;  2LHC A;  4AQY M;  1NY5 A;  4BB9 A;  1NNJ A;  1GL6 A;  1GAB A;  3RE8 A;  1JQJ C;  1HT2 E;  1GVN A;  1N36 M;  4GH9 A;  3AJI B;  3KS8 A;  2HKJ A;  2L6O A;  3U6E A;  4IBK A;  1SXJ C; 
#chains in the Genus database with same CATH homology
 2R46 A;  3HGI A;  2KA6 B;  4FWG A;  1IM2 A;  3CF6 E;  2UXB M;  3GRV A;  4BBA A;  1IBM M;  3FUX A;  3L26 A;  3I4Y A;  4B08 A;  4DUZ M;  3T1Y M;  4CIS A;  1Q3B A;  3U60 B;  1NY6 A;  4LJA A;  2HHH M;  4IBI A;  3RFW A;  2C96 A;  1E9R A;  1FJG M;  2AHM A;  4L15 A;  2V6Z M;  2H1R A;  4LJ7 A;  5GKN A;  4PDI A;  1IY1 A;  1TDH A;  1N78 A;  1L2C A;  2X8A A;  3TE6 A;  3PVS A;  1QAQ A;  2YFQ A;  5DNY A;  3GLF B;  2BJV A;  3T38 A;  4X66 M;  3KOW E;  2XGN A;  5EXS A;  5EP2 A;  5FTL A;  4DV1 M;  3KP0 E;  1Z59 A;  2DVW B;  2RGH A;  4KO8 A;  3FUV A;  4LF6 M;  1OFH A;  4YY3 M;  2UUC M;  4PDG A;  3GPY A;  1NJF A;  2XLJ A;  4OU7 A;  1X37 A;  3FTD A;  2J7N A;  4GRI A;  4DR5 M;  2RKO A;  3EIH A;  3I51 A;  1NNU C;  3AOG A;  3SAW A;  3GPP A;  3UK6 A;  4FCW A;  4AKH A;  3E4R A;  5FSW A;  4LZJ A;  3JR5 A;  1SXJ A;  4G4R A;  1OJL A;  2CHQ A;  3FUW A;  2Z4R A;  4DV7 M;  1XC8 A;  2E5L M;  4NOO B;  4NL4 H;  2CUZ A;  2KZU A;  3A42 A;  4MB7 A;  5LMN M;  1HQC A;  2L09 A;  4WUR A;  1G4A E;  5IRE B;  4BLC A;  4XBO A;  3SC3 A;  2XZU A;  3PXG A;  1N33 M;  3WHL A;  5KQD A;  2XFT A;  2F5O A;  2Y21 A;  2Y0T A;  3HWS A;  3U6Q A;  1QAO A;  1GLN A;  3NBI A;  4CHT B;  4IBC A;  5KPR A;  4D80 A;  4JI5 M;  1XNQ M;  3J2P B;  2C9C A;  1H6U A;  3KOZ E;  1IBK M;  2DWZ B;  2R65 A;  1I4W A;  4LGY A;  3JR4 A;  4W5W A;  3U6M A;  4JV5 M;  4MGY E;  1EE8 A;  1DGH A;  3KDS E;  4FWD A;  1TGU A;  3TL4 X;  3SYK A;  2BNK A;  5F3W A;  3HHW A;  5H37 D;  3VDU A;  2R45 A;  3AV0 A;  5IT9 S;  2D7H A;  3SHG B;  3MK6 A;  5A2Q S;  2I7P A;  4R3D A;  4L8R C;  2P5T A;  3Q8X A;  4OVZ B;  4FWH A;  2OPF A;  3AOE C;  3U5Z A;  2UUB M;  3EIE A;  1Z5A A;  2QBY A;  4OX9 M;  3U61 A;  3DA1 A;  3M0E A;  3FUT A;  4KLN A;  3SAT A;  4JI6 M;  4NXN M;  1HR0 M;  1XNR M;  3GLH A;  1SXJ E;  1QAM A;  2UU9 M;  1NSF A;  1MU5 A;  4LF8 M;  2KRK A;  1L8Q A;  1MX0 A;  2DWL A;  2HCB A;  1IXS B;  4FVM A;  2ERC A;  3HU1 A;  5ITQ A;  1ZAE A;  4LRS A;  3HJQ A;  4MH0 E;  1GL7 A;  4JI7 M;  4GHL A;  3GQ4 A;  1L1Z A;  4X65 M;  3H4M A;  3SHF A;  4CGY B;  3ILK A;  2EA0 A;  4GC9 A;  5IZ7 D;  3SFZ A;  4S12 A;  4DR6 M;  4FCT A;  4EIW A;  4GIT A;  2DZO B;  3AKZ A;  4IBD A;  3HHX A;  1J5E M;  1J7K A;  4MGZ E;  3A98 B;  3MHV C;  4P16 A;  2DWN A;  3U60 A;  1IY2 A;  3CF2 A;  3J81 S;  3GPU A;  1I94 M;  1XXH B;  1NVM A;  3T15 A;  3AL0 C;  2ZBK B;  1TH3 A;  4KOD A;  1JR3 D;  3HKP A;  4QNR A;  3UGJ A;  5BR8 M;  5KPT A;  1T3T A;  3ZC7 B;  2YQZ A;  2M5Z A;  4IJF A;  1E9S A;  3AOE A;  1IXZ A;  4JI8 M;  1G8P A;  2R4J A;  3GLG B;  1HNX M;  4LJ5 A;  3VFD A;  5KO3 A;  3K1J A;  5EP3 A;  3WHK A;  3HHY A;  4M0D A;  3U6O A;  1XMO M;  4REZ A;  2ZAM A;  4IBB A;  4LJ6 A;  2FNA A;  4B7H A;  3UMM A;  4I4L A;  3UZU A;  3LVW A;  5C1B A;  2XZF A;  4L78 A;  3GP1 A;  3CF0 A;  4B7G A;  1E94 E;  1R2Y A;  2I7N A;  4LF4 M;  2L7H A;  1DGB A;  3GLI A;  1K3X A;  5IWA M;  2CHG A;  2V1C A;  4TUW A;  2CHV A;  4I5S A;  3QAU A;  5EJC A;  4QNM A;  4NSO B;  4B7F A;  3T1H M;  2C98 A;  3IG8 A;  4JI4 M;  1QYR A;  4X62 M;  3THG A;  3ZCB B;  3DOA A;  2D7E A;  2Z4S A;  3R8F A;  2XH9 A;  4D81 A;  1IBL M;  2VQF M;  3U6D A;  4DR2 M;  1D2N A;  1N32 M;  4MM3 B;  3D8B A;  5EXX A;  3JAM S;  4NRW A;  3LQQ A;  3KS4 A;  2RGO A;  4L16 A;  4DR7 M;  2LXE A;  3W0F A;  3K92 A;  1W5S A;  3W0L B;  2HL7 A;  5DYG A;  3TPZ A;  3KW6 A;  1L2B A;  4LF7 M;  3FUU A;  2M60 A;  2G5G X;  4IBG A;  5FTM A;  3IG5 A;  2DZN B;  3GRU A;  2CV0 A;  3VKG A;  3L2A A;  3J80 S;  2QZ4 A;  4DV2 M;  4JI3 M;  4IJE A;  2FE8 A;  1L1T A;  3KXE C;  4JXJ A;  3GO8 A;  2F5N A;  2KW0 A;  4LCB A;  2XEP A;  4ITQ A;  3KSX A;  5EXP A;  1SXJ B;  2Y20 A;  3LMM A;  4LJ4 A;  4A3V B;  5ITT A;  1OFI A;  1R7R A;  3FTC A;  2C9O A;  3A46 A;  5EP4 A;  3L27 A;  4IBE A;  1LV7 A;  1G3I A;  1ORY B;  4AZF A;  1PJI A;  1Z5B A;  3GPX A;  4RNA A;  2Q2E B;  2CV2 A;  3KVW A;  3VDP A;  4AKG A;  1KYI A;  4GIP A;  1IN7 A;  3GRY A;  3I4V A;  3SYL A;  1JR3 A;  2O5R A;  3M6A A;  1YUB A;  4B3M M;  4LF9 M;  4AG6 A;  3LQR A;  3TWL A;  5ITY A;  4AG5 A;  4YHH M;  3HJ8 A;  4XGI A;  2F4V M;  3J27 B;  4G6Z A;  5JI3 E;  5FTK A;  4GKK M;  2YR0 A;  2R18 A;  3TWK A;  5ITR A;  2ZM6 M;  1DGH B;  1VDD A;  3PFI A;  2UXD M;  8CAT A;  3NWL A;  2EO2 A;  2KXE A;  4QOS A;  2KEB A;  2L7I A;  1C1K A;  1QVR A;  2QPA A;  3E9S A;  4X64 M;  1IN8 A;  2F5S A;  2QP9 X;  2G8L A;  3GQ5 A;  4IIW A;  3J7A S;  3M7G A;  4DR4 M;  2X49 A;  2CEA A;  2XFS A;  1NJG A;  4LFB M;  2V1U A;  2Z3X A;  3U5Z B;  1PJJ A;  4FCV A;  3J7B A;  2QBY B;  1KSF X;  3FTE A;  1GKI A;  3KOY E;  3TWM A;  3U61 B;  4FW9 A;  4M9S A;  3KOX E;  4QOZ C;  5FTJ A;  4LRT A;  3GLH B;  4JN6 A;  2DHR A;  2R4E A;  4DV0 M;  3L29 A;  2D7G A;  3GLF A;  4LG2 A;  5KQ8 A;  2FFJ A;  5LMU M;  2FOI C;  5BPV A;  4AKI A;  1N77 A;  2J7O A;  1N34 M;  2LNH C;  4JYA M;  4AW4 A;  2KRU A;  5EXT A;  4GMQ A;  3L25 A;  4OW0 A;  2YNM D;  4M9Z A;  3A45 A;  5ITX E;  1E32 A;  3QWL A;  4GKJ M;  7CAT A;  3FYC A;  4QHS A;  1Z5C A;  1G59 A;  3GQ3 A;  4LGM A;  4II7 A;  2C99 A;  2OQ4 A;  2XSZ D;  1HQY E;  5KPZ A;  1TH2 A;  1IXR C;  4PCZ A;  3VK8 A;  4B3S M;  4NXM M;  3DFZ A;  1YE9 A;  1YSY A;  3UJN A;  1Z6T A;  3OTO M;  4AI6 A;  3SAS A;  2NQ8 C;  2QCU A;  3SAU A;  4I81 A;  4ZPX A;  3PNV A;  1DO0 A;  3HHZ A;  4LY6 A;  5ITU A;  3SBJ A;  1DGG A;  3HU3 A;  4NRV A;  4Z6Y A;  1N75 A;  1QQW A;  1IQP A;  3PNY A;  4R7G A;  2Z7J A;  1KFV A;  4DV3 M;  4GC5 A;  1S3S A;  5EP1 A;  2ZAN A;  2BJW A;  5DYI A;  4HLQ A;  1IN4 A;  3CTW B;  4RF0 A;  3U6L A;  2LH0 A;  5E26 A;  4WW0 A;  4L4U A;  4JI2 M;  3B9P A;  4DUY M;  1XMQ M;  2CV1 A;  3U6C A;  3VK7 A;  2DWM A;  4LFA M;  3L28 A;  4M0W A;  2F5P A;  1K3W A;  1TH4 A;  2LWX A;  2EUC A;  3GLI B;  2DXI A;  4QHT A;  3FKE A;  4NSR A;  5FTN A;  4OVZ A;  2X4A A;  2XF3 A;  2VII A;  4RF1 A;  1NHW C;  2CFO A;  2QEN A;  4MGI E;  3FYD A;  4IBJ A;  4GHA A;  1TDZ A;  3ZH9 B;  2VQE M;  4B3R M;  3GRR A;  3AFH A;  4LF5 M;  2K47 A;  2JA2 A;  3K8Z A;  3SMP A;  5JI2 E;  4MGH A;  1FNN A;  4PD2 A;  2UUA M;  1Q39 A;  1J09 A;  3D8L A;  3HJS A;  5E6J A;  4G4Q A;  1L2D A;  2KZS A;  1HNW M;  3R9X B;  1W5T A;  4LJ8 A;  3SMS A;  5FLX S;  4IBF A;  5ITX A;  1R2Z A;  2A5Y B;  1Q3C A;  3SAR A;  4DV6 M;  1K82 A;  4DV4 M;  1SXJ D;  2R62 A;  3VKH A;  3RGS A;  5C18 A;  3TQS A;  4PT5 A;  4M9X A;  3KSJ A;  1DO2 A;  2Y0Q A;  1NHG C;  4DR3 M;  1IN6 A;  4FD2 A;  2F5Q A;  1HNZ M;  4LJ9 A;  4DV5 M;  4G4N A;  4KHP M;  4JI1 M;  3U6S A;  5EQT A;  3HU2 A;  1XXH A;  1R6B X;  2CE7 A;  3BOS A;  3MJ5 A;  4I8O A;  4Z8X A;  4LZZ A;  3C58 A;  3DZD A;  3K2L A;  3U6P A;  4MGK E;  3KP1 E;  3RGP A;  2C5R A;  1XWI A;  2W82 A;  2XSZ A;  1UM8 A;  3FD9 A;  1DGF A;  1XHB A;  1IY0 A;  4G4O A;  3LVV A;  1QAN A;  3GLG A;  1IN5 A;  1QZM A;  3VLF B;  1PM5 A;  4K0K M;  2UXC M;  4HL4 A;  1WXQ A;  4DR1 M;  4B3T M;  4D82 A;  1HT1 E;  1ZQ9 A;  3KFU G;  3SAV A;  2ZAO A;  4JI0 M;  4LFC M;  3FTF A;  1G41 A;  4AQY M;  1NNJ A;  1NY5 A;  4BB9 A;  1GL6 A;  3RE8 A;  1JQJ C;  1HT2 E;  1GVN A;  1N36 M;  4GH9 A;  3AJI B;  3KS8 A;  2HKJ A;  2L6O A;  3U6E A;  4IBK A;  1SXJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...