4YY3M

30s ribosomal subunit- higb complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4yy3M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4yy3M02
1HNWM 4MB7A 3J81S 5LMUM 1HNZM 4G4RA 4ITQA 4DV6M 5IT9S 1MU5A 4DV2M 4AQYM 4G4NA 4CISA 1PJIA 4LFAM 4JI8M 1Q39A 1L1TA 4JI3M 5ITQA 1Z5AA 3T1HM 1IBKM 4JYAM 4LF9M 4LFBM 1XNQM 2UXBM 3U6PA 1HNXM 2UUCM 1N33M 4DV7M 3U6EA 4DV4M 3SATA 1FJGM 4PD2A 4DUYM 2VQEM 1J5EM 1IBLM 1IBMM 4LF4M 3JR5A 5ITRA 1XNRM 1R2YA 2UUBM 4DUZM 1XMQM 1Z5BA 3J80S 3SAWA 1N36M 1MX0A 1Z5CA 2UUAM 4LF7M 4DR7M 4PDGA 3OTOM 1K3XA 4DV0M 1PM5A 4PCZA 4LF5M 2XZFA 2VQFM 1Q3BA 3A42A 1K82A 3W0FA 2UU9M 2Q2EB 1EE8A 2ZBKB 2F5QA 4DR3M 2ZM6M 2E5LM 5ITTA 3GPUA 3DOAA 5FLXS 3GQ4A 4YY3M 3U6SA 1K3WA 5ITXA 2F5SA 3SASA 4DV3M 4X64M 4X62M 4YHHM 4JI2M 3GPPA 4G4OA 3TWMA 3T1YM 3U6MA 4JI5M 1R2ZA 3VK7A 1KFVA 2F5NA 4DR5M 3GQ5A 1Z59A 5LMNM 5ITUA 5IWAM 4NXMM 4GKKM 4JV5M 4DR2M 3U6QA 2OQ4A 2XZUA 1L1ZA 3SBJA 5A2QS 4B3SM 3U6OA 3SARA 4B3MM 3J7AS 1N34M 2UXCM 1Q3CA 3A46A 4NXNM 3GPXA 1XC8A 1HR0M 4LF8M 3SAUA 3U6DA 4B3RM 4OX9M 4DR4M 4X65M 4JI7M 3C58A 3A45A 3JAMS 4LFCM 4NRVA 3GO8A 2EA0A 3JR4A 4JI1M 1NNJA 1PJJA 4DR6M 1I94M 2F4VM 3VK8A 1TDHA 1N32M 4DR1M 3GPYA 1TDZA 1XMOM 3GQ3A 5ITXE 4GKJM 2F5PA 2OPFA 5BR8M 3TWLA 4K0KM 4LF6M 2HKJA 4DV1M 4DV5M 3SAVA 1L2CA 4B3TM 4JI6M 4G4QA 4KHPM 3U6CA 2HHHM 1L2DA 4JI0M 3GP1A 5ITYA 2UXDM 4X66M 4PDIA 3TWKA 2F5OA 1L2BA 4JI4M 4NRWA 3U6LA
chains in the Genus database with same CATH superfamily
3R9XB 2L09A 2DWZB 2CP8A 2JZ0A 2KA6B 1Q02A 3KOYE 1ZMWA 2YFQA 4DV2M 5EP2A 4CISA 1IN8A 4LFAM 1L1TA 1IN5A 4AZFA 4EIWA 2QP9X 1WHCA 1QUSA 3B89A 4JYAM 3C3EA 1D0LA 1E9SA 2VF8A 5DFLA 1SG9A 2UXBM 1HT1E 2LNHC 4FWDA 3KSXA 4DV4M 1JQJC 3C9PA 1IN4A 3FTDA 1J5EM 4LF4M 3JR5A 2BWBA 5ITRA 2XFTA 1IY1A 3KP1E 5FTKA 3RGSA 1Z5BA 1QYRA 4GHAA 1SXJD 1DGGA 1MJGM 3FUWA 1JB0F 2QHOB 1ZAEA 3E9SA 3KDSE 4DBGB 3FRHA 2FS1A 3HU1A 3DFZA 1K3XA 2CV0A 1UFZA 4JXJA 3FD9A 3B7NA 1IN7A 4IBFA 3GRRA 2LVPC 3KOZE 1Q3BA 5C1BA 1K82A 3SHGB 4NOOB 3AL0C 2KXEA 3W0FA 3FTFA 4NSOB 3CF2A 1E94E 3FTEA 1R4GA 2DAKA 2ZBKB 5GKNA 3J2PB 1WXQA 3DOAA 2O01F 3BXWA 4L6V6 2K47A 2ZTCA 4BBAA 2ZANA 3SASA 3D8BA 1QDRA 3V76A 4JI2M 3GPPA 2Y0QA 4G4OA 4M0WA 3T1YM 2CV2A 2RGOA 3NWLA 5EJCA 3VK7A 1JR3A 4IBEA 2F5NA 3VKGA 5IWAM 4GKKM 1IFYA 1SXJC 3NBIA 1NY5A 1DV0A 4WP2A 1HT2E 2DNAA 2QQ8A 4L8RC 1XWIA 1L8QA 3TL4X 2C9OA 4BLCA 1L1ZA 2LVAA 1GL6A 4R3DA 2HCBA 3SBJA 4QHSA 3U60A 4ZPXA 4GITA 3IG8A 1EFUB 3KOWE 1PRBA 2CUZA 5EXTA 4B3MM 5EQTA 2R6FA 2XSZA 2O5RA 5BPVA 1V92A 2DZNB 4I5SA 3D8LA 4XGIA 4IBJA 2R45A 4JI7M 1OKSA 4MGYE 5L8RF 1D2NA 3VKHA 2R0IA 2W82A 4CHTB 4REZA 1YSYA 4I8OA 4GRIA 4RKUF 4IIWA 2C5RA 1GABA 3UZUA 4QNRA 3HKPA 3I04M 4OVZB 3GPYA 1TR8A 1V33A 2KRUA 3J7BA 4FCTA 1XMOM 4GKJM 5BR8M 3TWLA 4GEWA 3B7ZA 4LF6M 4QHTA 4I4LA 5EP1A 4DV1M 3ZQJA 2V1CA 4BB9A 4KODA 2RKOA 1NJGA 4JI0M 3GP1A 4QOSA 5ITYA 3THGA 4PDIA 2BJWA 1TTEA 3W68A 4HL4A 5C18A 1FNNA 2DKLA 1IXSA 5E26A 4B7FA 3L29A 2KNVA 3PVSA 2VIIA 4RF0A 4IBDA 4AG5A 3J81S 4D80A 4G4RA 4G3OA 4OW0A 3SYKA 4B08A 2CHQA 1HJPA 4WW0A 3W0LB 2LWXA 4G4NA 4FWHA 1ZV1A 3GLGB 4JI8M 1Q39A 2RRUA 2HWJA 4XK8F 2D7EA 5ITQA 1Z5AA 2J5YA 1OAOC 4P16A 4UN2B 4LF9M 3UMMA 2D7HA 4IBIA 1XNQM 1X37A 1HNXM 2UUCM 4DV7M 1NNUC 3HU2A 4GIPA 4Q7JA 3GRVA 4AG6A 2X8AA 1VG5A 2FE8A 1IBLM 4II7A 2FNAA 3GLHB 3IG5A 2APLA 4B7HA 3IECA 3U60B 3E4RA 1W5TA 1RU3A 2BNKA 4ANRA 3SAWA 1DO0A 3HHYA 3LVVA 3IHPA 2VDBB 3SYLA 1NHGC 4AI6A 4IBCA 1G3IA 3FRIA 2DWNA 1VDLA 4LY6A 1WGLA 2QBYA 4LF5M 1XXHB 3U61A 1IY0A 1I4WA 2JY5A 1A5TA 2XZFA 3A42A 3ZC7B 2JY8A 1N75A 2DZOB 4CGYB 2MR9A 2Q2EB 1EE8A 4LJ8A 3HZJA 3T38A 1AIPC 2CHVA 3RFWA 4D82A 1QQWA 4OVZA 1J7KA 3WHKA 2H5XA 3U5ZA 1T43A 4DV3M 1WGNA 2JA2A 4Z6YA 4X62M 4YHHM 1NSFA 3KSJA 5E6JA 3TWMA 3AJIB 3U6MA 2XF3A 1JR3D 2KZUA 4DR5M 4FWGA 2DXIA 3I51A 4JV5M 2XLJA 4LJ6A 2OQ4A 5KQDA 2QPAA 4G6ZA 1IY2A 2XZUA 1OJLA 1OIPA 1DO2A 2EKKA 2LHGA 1C1KA 3SMPA 3K9PA 2C96A 2G5GX 3HWSA 1IXSB 3T6PA 1VDDA 4B3SM 3SARA 4QOZC 2LVNC 1GLNA 2N35A 3J7AS 1GVNA 1HQYE 2DHRA 3QAUA 4CIZA 3GLIA 2XSZD 1Q3CA 2QCUA 3AOGA 3Q8XA 1XC8A 4LF8M 4NRWA 3SAUA 5EP4A 2R18A 2CFOA 3W67A 3KW6A 4L4UA 3A45A 3JAMS 4L15A 2G8LA 3LW5F 4NRVA 3GLGA 3C58A 2I7NA 3L28A 2GNOA 4DR6M 2F4VM 3VDUA 1N32M 5JI3E 3K2LA 2Y21A 3BOSA 3CF6E 3M7GA 1NV9A 5KPZA 1TGUA 3TQSA 2OPFA 1DGBA 3GLHA 5H37D 4K0KM 2CRUA 4Y28F 1TH2A 4B3TM 4F2LA 1W5SA 2JUJA 4LGMA 2JNHA 4G4QA 2QZ4A 4KHPM 4PT5A 2DWLA 2G3QA 3HX3A 2D7GA 2UXDM 2JZ1A 1ORYB 1XXHA 2KW0A 2F5OA 2QBYB 3PFIA 5KQ8A 3U61B 2M5ZA 1VEJA 3FE3A 5JI2E 2ZAOA 1GKIA 1QUTA 4GH9A 4MB7A 1C7YA 3E21A 1HNZM 1NJFA 4GC9A 5EXXA 1OAIA 4D81A 1MU5A 2QENA 1QZEA 2CEAA 1QAMA 1E9RA 2DAMA 4I81A 3GLIE 1ZMVA 1NY6A 4FCVA 1D0MA 4NSRA 3U5ZB 1D0KA 2KNZA 4NC6A 3GLGE 4JI3M 4LG2A 3M0EA 4IJFA 3FUVA 1ZQ9A 1IBKM 4LFBM 4LJ4A 1QVRA 5KPRA 1J09A 3U6PA 2YNMD 3QWLA 3U6EA 4LRSA 1FJGM 1JR3E 2WSFF 3HY5A 4OU7A 2Z4RA 1DGFA 4B7GA 8CATA 2C9CA 1IBMM 5IREB 1XNRM 2LH0A 3KP0E 2X4AA 3GLHE 3UK6A 5FTNA 4DUZM 1XMQM 2UUBM 3MMPA 4HLQA 1XB2B 4MGKE 3J80S 4MM3B 2UUAM 1VQ1A 1F4IA 4LF7M 3GLIB 5EXSA 2LVQD 4XBOA 3KVWA 2L6OA 2AHMA 4LRTA 4DV0M 1PM5A 2B3TA 2HL7A 2VQFM 2ZAMA 2R65A 1XXHE 4LJ5A 4MGHA 3FYCA 3LQRA 2DAIA 2FOIC 1IXRC 2LHCA 3GRYA 4CJ6A 3AKZA 2UU9M 2XGNA 3HGIA 4MH0E 1GJSA 3CF0A 2DI0A 4LZJA 2ZM6M 2E5LM 5ITTA 1OIZA 1GJTA 3AOEA 3VDPA 4IBBA 2CHGA 1QAQA 1EIJA 2DAEA 1TH4A 2BJVA 3FUXA 1IQPA 4X64M 1OTRA 3CTWB 2QNJA 1PJQA 2MROB 2V1UA 4JI5M 1R2ZA 1KFVA 3A98B 3HJSA 3GQ5A 2H1RA 5LMNM 4NXMM 1MN3A 3U6QA 1S3SA 1LTMA 1Y8GA 5DYGA 4L78A 4NL4H 4F1IA 1OFHA 3MK6A 2KDLA 4M0DA 1PJSA 3LMMA 1QAOA 5A2QS 4WURA 3SHFA 1QDTA 1WIVA 3FTCA 3MJ5A 1SXJB 2CE7A 2K0BX 2BWEA 2VF7A 1YUBA 5IZ7D 1HR0M 1PGYA 2ZTDA 1E32A 3I4YA 1NHWC 5KO3A 4B3RM 4QNMA 3UJNA 4DR4M 2JWSA 1DGHB 3LVWA 2EA0A 2JXNA 2L4FA 2LXEA 4JI1M 4LJAA 3QYBA 3HHZA 1YLAA 7CATA 1NNJA 1PJJA 3ZH9B 1KYIA 3PNVA 3B74A 2J7NA 2EKFA 2YQZA 2YR0A 3EIEA 3KS8A 1HQCA 3WHLA 3L27A 2L4EA 3GQ3A 2F5PA 3AV0A 5FTMA 3HJQA 4RNAA 2QSFX 2R62A 2DWMA 2HKJA 3SAVA 1L2CA 3FYDA 4IBKA 4TUWA 4JN6A 5FTJA 1IM2A 1G71A 4KT0F 4JI6M 2R44A 1R5LA 2K6BA 3L25A 4GHLA 2HHHM 2DENA 1QZMA 2EJSA 1Z6TA 3B7QA 2FFJA 2OOAA 2DVWB 3EIHA 3K92A 4L16A 1YE9A 2Y20A 4M9SA 2DAGA 3AFHA 4X66M 4A3VB 1AUAA 1L2BA 1IN6A 3L2AA 4JI4M 5FTLA 2JP7A 1WR1B 2XFSA 3LCVB 1HNWM 4MGIE 5LMUM 4ITQA 3PXGA 2WSCF 3NBXX 4DV6M 5IT9S 1NO1A 5EP3A 2EUCA 4AQYM 3FUUA 2LBCA 3K1JA 1PJIA 1H6UA 2L2DA 4KLNA 3C3DA 2I7PA 1L2DA 3B9PA 3GRUA 3VFDA 3TPZA 3LCUA 3T15A 3T1HM 1BVSA 1T3TA 3H4MA 2R4JA 4AW4A 2NQ8C 1N33M 2JY6B 2OO9A 5EXPA 3FUTA 2CV1A 3SATA 3MHVC 1V34A 4PD2A 4DUYM 2VQEM 5DYIA 3ILKA 2RGHA 3UGJA 2K9DA 5DNYA 1R2YA 4M9ZA 3SFZA 2Z8YM 1SXJA 1N36M 2C99A 1MX0A 1Z5CA 2FH0A 4LZZA 3ZCBB 4DR7M 2KNAA 1OFIA 4P17A 4PDGA 3OTOM 4AKIA 1GL7A 2EO2A 3I4VA 4R7GA 3GLFA 4PCZA 2OOBA 2Y0TA 4R71A 1DGHA 4LGYA 4MGZE 2XEPA 2KEBA 1TH3A 2WSEF 4LCBA 2J7OA 3KFUG 2F5QA 3H4JA 3KS4A 1G59A 4DR3M 2KHHA 3SC3A 1XHBA 1NV8A 1PJTA 5FLXS 2P5TA 2Z7JA 3GPUA 3GQ4A 4YY3M 1NVMA 1R7RA 3HJ8A 3M6AA 4GC5A 3CGWA 5ITXA 3U6SA 1K3WA 2F5SA 2MGWA 4FD2A 4M9XA 3Q8GA 3E46A 3LQQA 2KRKA 2X49A 4IBGA 5KPTA 1Z59A 5ITUA 2V6ZM 3QYEA 4DR2M 1QANA 2XH9A 2DZLA 2WZJA 5F3WA 2KZSA 3DZDA 2JY7A 1UM8A 2R4EA 4KO8A 3I01M 1T6OA 3HHXA 4AKGA 2HAKA 3U6OA 3J27B 1N78A 2DHYA 1N34M 2UXCM 4AKHA 3VLFB 1SXJE 1N77A 4NXNM 3GPXA 1TF0B 2LTUA 3BBZA 4LJ9A 3KXEC 2GQFA 4RF1A 3A46A 3U6DA 4OX9M 1ZMUA 3AOEC 3F92A 3RE8A 4X65M 3TE6A 3PNYA 4S12A 3GO8A 3GLFE 4LFCM 3JR4A 3K9OA 2MH8A 3K8ZA 3HU3A 3KOXE 2L7IA 1G8PA 1I94M 4LJ7A 3VK8A 1TDHA 1OQYA 1GO5A 2LVOC 1R6BX 2O25A 4DR1M 4IJEA 1TDZA 3L26A 1G41A 4HEOA 5ITXE 1IXZA 3SMSA 2C98A 2CWBA 2M60A 3DA1A 4DV5M 2ERCA 4FCWA 4FW9A 1KSFX 1P3QQ 2A5YB 2Z4SA 5FSWA 3U6CA 2R46A 1LV7A 3HHWA 3R8FA 1VEKA 1CUKA 4Z8XA 1VEGA 3RGPA 1G4AE 2Z3XA 1WJ7A 3TWKA 3GLFB 2L7HA 4W5WA 2MJ5B 4FVMA 3FKEA 4GMQA 3U6LA
chains in the Genus database with same CATH topology
3R9XB 2L09A 2DWZB 2KA6B 3KOYE 2YFQA 4DV2M 5EP2A 4CISA 1IN8A 4LFAM 1L1TA 1IN5A 4AZFA 4EIWA 2QP9X 4JYAM 1E9SA 2UXBM 1HT1E 2LNHC 4FWDA 3KSXA 4DV4M 1JQJC 1IN4A 3FTDA 1J5EM 4LF4M 3JR5A 5ITRA 2XFTA 1IY1A 3KP1E 5FTKA 3RGSA 1Z5BA 1QYRA 4GHAA 1SXJD 1DGGA 3FUWA 3E9SA 1ZAEA 3KDSE 2CV0A 3HU1A 3DFZA 1K3XA 4JXJA 3FD9A 1IN7A 4IBFA 3GRRA 3KOZE 1Q3BA 5C1BA 1K82A 3SHGB 4NOOB 3AL0C 2KXEA 3W0FA 3FTFA 4NSOB 3CF2A 1E94E 3FTEA 2ZBKB 5GKNA 3J2PB 1WXQA 3DOAA 2K47A 4BBAA 2ZANA 3SASA 3D8BA 4JI2M 3GPPA 2Y0QA 4G4OA 4M0WA 3T1YM 2CV2A 2RGOA 3NWLA 5EJCA 3VK7A 1JR3A 4IBEA 2F5NA 3VKGA 5IWAM 4GKKM 1SXJC 3NBIA 1NY5A 1HT2E 4L8RC 1XWIA 1L8QA 3TL4X 2C9OA 4BLCA 1L1ZA 1GL6A 4R3DA 2HCBA 3SBJA 4QHSA 3U60A 4ZPXA 4GITA 3IG8A 5EXTA 3KOWE 4B3MM 2CUZA 5EQTA 2XSZA 2O5RA 5BPVA 2DZNB 4I5SA 3D8LA 4XGIA 4IBJA 2R45A 4JI7M 4MGYE 3VKHA 1D2NA 2W82A 4CHTB 4REZA 1YSYA 4I8OA 4GRIA 4IIWA 2C5RA 3UZUA 4QNRA 3HKPA 4OVZB 3GPYA 3J7BA 2KRUA 4FCTA 1XMOM 4GKJM 5BR8M 3TWLA 4LF6M 4QHTA 4I4LA 5EP1A 4DV1M 2V1CA 4BB9A 4KODA 2RKOA 1NJGA 4JI0M 3GP1A 4QOSA 5ITYA 3THGA 4PDIA 2BJWA 4HL4A 5C18A 1FNNA 5E26A 4B7FA 3L29A 3PVSA 2VIIA 4RF0A 4IBDA 4AG5A 3J81S 4D80A 4G4RA 4OW0A 3SYKA 4B08A 2CHQA 4WW0A 3W0LB 2LWXA 4G4NA 4FWHA 3GLGB 4JI8M 1Q39A 2D7EA 5ITQA 1Z5AA 4P16A 4LF9M 3UMMA 2D7HA 4IBIA 1XNQM 1X37A 1HNXM 2UUCM 4DV7M 1NNUC 3HU2A 4GIPA 4AG6A 3GRVA 2X8AA 2FE8A 1IBLM 4II7A 2FNAA 3GLHB 3IG5A 4B7HA 3U60B 3E4RA 1W5TA 2BNKA 3SAWA 1DO0A 3HHYA 3LVVA 3SYLA 1NHGC 4AI6A 4IBCA 1G3IA 2DWNA 4LY6A 2QBYA 4LF5M 1XXHB 3U61A 1IY0A 1I4WA 2XZFA 3A42A 3ZC7B 1N75A 2DZOB 4CGYB 2Q2EB 4LJ8A 1EE8A 3T38A 3RFWA 2CHVA 4D82A 1QQWA 4OVZA 1J7KA 3WHKA 3U5ZA 4DV3M 2JA2A 4Z6YA 4X62M 4YHHM 1NSFA 3KSJA 5E6JA 3TWMA 3AJIB 3U6MA 2XF3A 1JR3D 2KZUA 4DR5M 4FWGA 2DXIA 3I51A 4JV5M 2XLJA 4LJ6A 2OQ4A 5KQDA 2QPAA 4G6ZA 1IY2A 2XZUA 1OJLA 1DO2A 1C1KA 3SMPA 2C96A 2G5GX 3HWSA 1IXSB 1VDDA 4B3SM 3SARA 4QOZC 1GLNA 3J7AS 1GVNA 1HQYE 2DHRA 3QAUA 3GLIA 2XSZD 1Q3CA 2QCUA 3AOGA 3Q8XA 1XC8A 4LF8M 4NRWA 3SAUA 5EP4A 2R18A 2CFOA 3KW6A 4L4UA 3A45A 3JAMS 4L15A 2G8LA 4NRVA 3GLGA 3C58A 2I7NA 3L28A 4DR6M 2F4VM 3VDUA 1N32M 5JI3E 3K2LA 2Y21A 3BOSA 3CF6E 3M7GA 5KPZA 1TGUA 3TQSA 2OPFA 1DGBA 3GLHA 5H37D 4K0KM 1TH2A 4B3TM 1W5SA 4LGMA 4G4QA 2QZ4A 4KHPM 4PT5A 2DWLA 2D7GA 2UXDM 1ORYB 1XXHA 2KW0A 2F5OA 2QBYB 3PFIA 5KQ8A 3U61B 2M5ZA 5JI2E 2ZAOA 1GKIA 4GH9A 4MB7A 1HNZM 1NJFA 4GC9A 5EXXA 4D81A 1MU5A 2QENA 2CEAA 1QAMA 1E9RA 4I81A 1NY6A 4FCVA 4NSRA 3U5ZB 4JI3M 4LG2A 3M0EA 4IJFA 3FUVA 1ZQ9A 1IBKM 4LFBM 4LJ4A 1QVRA 5KPRA 1J09A 3U6PA 2YNMD 3QWLA 3U6EA 4LRSA 1FJGM 4OU7A 2Z4RA 1DGFA 4B7GA 8CATA 2C9CA 1IBMM 5IREB 1XNRM 2LH0A 3KP0E 2X4AA 3UK6A 5FTNA 4DUZM 1XMQM 2UUBM 4HLQA 4MGKE 3J80S 4MM3B 2UUAM 4LF7M 3GLIB 5EXSA 4XBOA 3KVWA 2L6OA 2AHMA 4LRTA 4DV0M 1PM5A 2HL7A 2VQFM 2ZAMA 2R65A 4LJ5A 4MGHA 3FYCA 3LQRA 2FOIC 1IXRC 3GRYA 3AKZA 2UU9M 2XGNA 3HGIA 4MH0E 3CF0A 4LZJA 2ZM6M 2E5LM 5ITTA 3AOEA 3VDPA 4IBBA 2CHGA 1QAQA 1TH4A 2BJVA 3FUXA 1IQPA 4X64M 3CTWB 2V1UA 4JI5M 1R2ZA 1KFVA 3A98B 3HJSA 3GQ5A 2H1RA 5LMNM 4NXMM 3U6QA 1S3SA 5DYGA 4L78A 4NL4H 1OFHA 3MK6A 4M0DA 3LMMA 1QAOA 5A2QS 4WURA 3SHFA 3FTCA 3MJ5A 1SXJB 2CE7A 1YUBA 5IZ7D 1HR0M 3I4YA 1E32A 1NHWC 5KO3A 4B3RM 4QNMA 3UJNA 4DR4M 1DGHB 3LVWA 2EA0A 2LXEA 4JI1M 4LJAA 3HHZA 7CATA 1NNJA 1PJJA 3ZH9B 1KYIA 3PNVA 2J7NA 2YQZA 2YR0A 3EIEA 3KS8A 1HQCA 3WHLA 3L27A 3GQ3A 2F5PA 3AV0A 5FTMA 3HJQA 4RNAA 2R62A 2DWMA 2HKJA 3SAVA 1L2CA 3FYDA 4IBKA 4TUWA 4JN6A 5FTJA 1IM2A 4JI6M 3L25A 4GHLA 2HHHM 1QZMA 1Z6TA 3EIHA 2FFJA 4L16A 2DVWB 1L2DA 3K92A 1YE9A 2Y20A 4M9SA 4X66M 3AFHA 4A3VB 1L2BA 1IN6A 3L2AA 4JI4M 5FTLA 2XFSA 1HNWM 4MGIE 5LMUM 4ITQA 3PXGA 4DV6M 5IT9S 5EP3A 2EUCA 4AQYM 3FUUA 3K1JA 1PJIA 1H6UA 4KLNA 2I7PA 3B9PA 3GRUA 3VFDA 3TPZA 3T15A 3T1HM 1T3TA 3H4MA 2R4JA 4AW4A 2NQ8C 1N33M 5EXPA 3FUTA 2CV1A 3SATA 3MHVC 4PD2A 4DUYM 2VQEM 5DYIA 3ILKA 2RGHA 3UGJA 5DNYA 1R2YA 4M9ZA 3SFZA 1SXJA 1N36M 2C99A 1MX0A 1Z5CA 4LZZA 3ZCBB 4DR7M 1OFIA 4PDGA 3OTOM 4AKIA 1GL7A 2EO2A 3I4VA 4R7GA 3GLFA 4PCZA 2Y0TA 1DGHA 4LGYA 4MGZE 2XEPA 2KEBA 1TH3A 3KFUG 4LCBA 2J7OA 2F5QA 1G59A 3KS4A 4DR3M 3SC3A 1XHBA 3GPUA 5FLXS 2P5TA 2Z7JA 3GQ4A 4YY3M 1NVMA 1R7RA 3HJ8A 3M6AA 4GC5A 5ITXA 3U6SA 1K3WA 2F5SA 4FD2A 4M9XA 3LQQA 2KRKA 2X49A 4IBGA 5KPTA 1Z59A 5ITUA 2V6ZM 4DR2M 1QANA 2XH9A 5F3WA 2KZSA 3DZDA 1UM8A 2R4EA 4KO8A 3HHXA 4AKGA 3U6OA 3J27B 1N78A 1N34M 4AKHA 2UXCM 3VLFB 1SXJE 1N77A 4NXNM 3GPXA 3A46A 4LJ9A 4RF1A 3KXEC 3U6DA 4OX9M 3AOEC 4X65M 3RE8A 3TE6A 3PNYA 4S12A 3GO8A 4LFCM 3JR4A 3K8ZA 3HU3A 3KOXE 2L7IA 1G8PA 1I94M 4LJ7A 3VK8A 1TDHA 1R6BX 4DR1M 4IJEA 1TDZA 3L26A 1G41A 5ITXE 1IXZA 3SMSA 2C98A 2M60A 3DA1A 4DV5M 2ERCA 4FCWA 4FW9A 1KSFX 2A5YB 2Z4SA 5FSWA 3U6CA 2R46A 1LV7A 3HHWA 3R8FA 3RGPA 4Z8XA 1G4AE 2Z3XA 3TWKA 3GLFB 2L7HA 4W5WA 4FVMA 3FKEA 4GMQA 3U6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW M;  4MB7 A;  3J81 S;  5LMU M;  1HNZ M;  4G4R A;  4ITQ A;  4DV6 M;  5IT9 S;  1MU5 A;  4DV2 M;  4AQY M;  4G4N A;  4CIS A;  1PJI A;  4LFA M;  4JI8 M;  1Q39 A;  1L1T A;  4JI3 M;  5ITQ A;  1Z5A A;  3T1H M;  1IBK M;  4JYA M;  4LF9 M;  4LFB M;  1XNQ M;  2UXB M;  3U6P A;  1HNX M;  2UUC M;  1N33 M;  4DV7 M;  3U6E A;  4DV4 M;  3SAT A;  1FJG M;  4PD2 A;  4DUY M;  2VQE M;  1J5E M;  1IBL M;  1IBM M;  4LF4 M;  3JR5 A;  5ITR A;  1XNR M;  1R2Y A;  2UUB M;  4DUZ M;  1XMQ M;  1Z5B A;  3J80 S;  3SAW A;  1N36 M;  1MX0 A;  1Z5C A;  2UUA M;  4LF7 M;  4DR7 M;  4PDG A;  3OTO M;  1K3X A;  4DV0 M;  1PM5 A;  4PCZ A;  4LF5 M;  2XZF A;  2VQF M;  1Q3B A;  3A42 A;  1K82 A;  3W0F A;  2UU9 M;  2Q2E B;  1EE8 A;  2ZBK B;  2F5Q A;  4DR3 M;  2ZM6 M;  2E5L M;  5ITT A;  3GPU A;  3DOA A;  5FLX S;  3GQ4 A;  4YY3 M;  3U6S A;  1K3W A;  5ITX A;  2F5S A;  3SAS A;  4DV3 M;  4X64 M;  4X62 M;  4YHH M;  4JI2 M;  3GPP A;  4G4O A;  3TWM A;  3T1Y M;  3U6M A;  4JI5 M;  1R2Z A;  3VK7 A;  1KFV A;  2F5N A;  4DR5 M;  3GQ5 A;  1Z59 A;  5LMN M;  5ITU A;  5IWA M;  4NXM M;  4GKK M;  4JV5 M;  4DR2 M;  3U6Q A;  2OQ4 A;  2XZU A;  1L1Z A;  3SBJ A;  5A2Q S;  4B3S M;  3U6O A;  3SAR A;  4B3M M;  3J7A S;  1N34 M;  2UXC M;  1Q3C A;  3A46 A;  4NXN M;  3GPX A;  1XC8 A;  1HR0 M;  4LF8 M;  3SAU A;  3U6D A;  4B3R M;  4OX9 M;  4DR4 M;  4X65 M;  4JI7 M;  3C58 A;  3A45 A;  3JAM S;  4LFC M;  4NRV A;  3GO8 A;  2EA0 A;  3JR4 A;  4JI1 M;  1NNJ A;  1PJJ A;  4DR6 M;  1I94 M;  2F4V M;  3VK8 A;  1TDH A;  1N32 M;  4DR1 M;  3GPY A;  1TDZ A;  1XMO M;  3GQ3 A;  5ITX E;  4GKJ M;  2F5P A;  2OPF A;  5BR8 M;  3TWL A;  4K0K M;  4LF6 M;  2HKJ A;  4DV1 M;  4DV5 M;  3SAV A;  1L2C A;  4B3T M;  4JI6 M;  4G4Q A;  4KHP M;  3U6C A;  2HHH M;  1L2D A;  4JI0 M;  3GP1 A;  5ITY A;  2UXD M;  4X66 M;  4PDI A;  3TWK A;  2F5O A;  1L2B A;  4JI4 M;  4NRW A;  3U6L A; 
#chains in the Genus database with same CATH topology
 3R9X B;  2L09 A;  2DWZ B;  2CP8 A;  2JZ0 A;  2KA6 B;  1Q02 A;  3KOY E;  1ZMW A;  2YFQ A;  4DV2 M;  5EP2 A;  4CIS A;  1IN8 A;  4LFA M;  1L1T A;  1IN5 A;  4AZF A;  4EIW A;  2QP9 X;  1WHC A;  1QUS A;  3B89 A;  4JYA M;  3C3E A;  1D0L A;  1E9S A;  2VF8 A;  5DFL A;  1SG9 A;  2UXB M;  1HT1 E;  2LNH C;  4FWD A;  3KSX A;  4DV4 M;  1JQJ C;  3C9P A;  1IN4 A;  3FTD A;  1J5E M;  4LF4 M;  3JR5 A;  2BWB A;  5ITR A;  2XFT A;  1IY1 A;  3KP1 E;  5FTK A;  3RGS A;  1Z5B A;  1QYR A;  4GHA A;  1SXJ D;  1DGG A;  1MJG M;  3FUW A;  1JB0 F;  2QHO B;  1ZAE A;  3E9S A;  3KDS E;  4DBG B;  3FRH A;  2FS1 A;  3HU1 A;  3DFZ A;  1K3X A;  2CV0 A;  1UFZ A;  4JXJ A;  3FD9 A;  3B7N A;  1IN7 A;  4IBF A;  3GRR A;  2LVP C;  3KOZ E;  1Q3B A;  5C1B A;  1K82 A;  3SHG B;  4NOO B;  3AL0 C;  2KXE A;  3W0F A;  3FTF A;  4NSO B;  3CF2 A;  1E94 E;  3FTE A;  1R4G A;  2DAK A;  2ZBK B;  5GKN A;  3J2P B;  1WXQ A;  3DOA A;  2O01 F;  3BXW A;  4L6V 6;  2K47 A;  2ZTC A;  4BBA A;  2ZAN A;  3SAS A;  3D8B A;  1QDR A;  3V76 A;  4JI2 M;  3GPP A;  2Y0Q A;  4G4O A;  4M0W A;  3T1Y M;  2CV2 A;  2RGO A;  3NWL A;  5EJC A;  3VK7 A;  1JR3 A;  4IBE A;  2F5N A;  3VKG A;  5IWA M;  4GKK M;  1IFY A;  1SXJ C;  3NBI A;  1NY5 A;  1DV0 A;  4WP2 A;  1HT2 E;  2DNA A;  2QQ8 A;  4L8R C;  1XWI A;  1L8Q A;  3TL4 X;  2C9O A;  4BLC A;  1L1Z A;  2LVA A;  1GL6 A;  4R3D A;  2HCB A;  3SBJ A;  4QHS A;  3U60 A;  4ZPX A;  4GIT A;  3IG8 A;  1EFU B;  3KOW E;  1PRB A;  2CUZ A;  5EXT A;  4B3M M;  5EQT A;  2R6F A;  2XSZ A;  2O5R A;  5BPV A;  1V92 A;  2DZN B;  4I5S A;  3D8L A;  4XGI A;  4IBJ A;  2R45 A;  4JI7 M;  1OKS A;  4MGY E;  5L8R F;  1D2N A;  3VKH A;  2R0I A;  2W82 A;  4CHT B;  4REZ A;  1YSY A;  4I8O A;  4GRI A;  4RKU F;  4IIW A;  2C5R A;  1GAB A;  3UZU A;  4QNR A;  3HKP A;  3I04 M;  4OVZ B;  3GPY A;  1TR8 A;  1V33 A;  2KRU A;  3J7B A;  4FCT A;  1XMO M;  4GKJ M;  5BR8 M;  3TWL A;  4GEW A;  3B7Z A;  4LF6 M;  4QHT A;  4I4L A;  5EP1 A;  4DV1 M;  3ZQJ A;  2V1C A;  4BB9 A;  4KOD A;  2RKO A;  1NJG A;  4JI0 M;  3GP1 A;  4QOS A;  5ITY A;  3THG A;  4PDI A;  2BJW A;  1TTE A;  3W68 A;  4HL4 A;  5C18 A;  1FNN A;  2DKL A;  1IXS A;  5E26 A;  4B7F A;  3L29 A;  2KNV A;  3PVS A;  2VII A;  4RF0 A;  4IBD A;  4AG5 A;  3J81 S;  4D80 A;  4G4R A;  4G3O A;  4OW0 A;  3SYK A;  4B08 A;  2CHQ A;  1HJP A;  4WW0 A;  3W0L B;  2LWX A;  4G4N A;  4FWH A;  1ZV1 A;  3GLG B;  4JI8 M;  1Q39 A;  2RRU A;  2HWJ A;  4XK8 F;  2D7E A;  5ITQ A;  1Z5A A;  2J5Y A;  1OAO C;  4P16 A;  4UN2 B;  4LF9 M;  3UMM A;  2D7H A;  4IBI A;  1XNQ M;  1X37 A;  1HNX M;  2UUC M;  4DV7 M;  1NNU C;  3HU2 A;  4GIP A;  4Q7J A;  3GRV A;  4AG6 A;  2X8A A;  1VG5 A;  2FE8 A;  1IBL M;  4II7 A;  2FNA A;  3GLH B;  3IG5 A;  2APL A;  4B7H A;  3IEC A;  3U60 B;  3E4R A;  1W5T A;  1RU3 A;  2BNK A;  4ANR A;  3SAW A;  1DO0 A;  3HHY A;  3LVV A;  3IHP A;  2VDB B;  3SYL A;  1NHG C;  4AI6 A;  4IBC A;  1G3I A;  3FRI A;  2DWN A;  1VDL A;  4LY6 A;  1WGL A;  2QBY A;  4LF5 M;  1XXH B;  3U61 A;  1IY0 A;  1I4W A;  2JY5 A;  1A5T A;  2XZF A;  3A42 A;  3ZC7 B;  2JY8 A;  1N75 A;  2DZO B;  4CGY B;  2MR9 A;  2Q2E B;  1EE8 A;  4LJ8 A;  3HZJ A;  3T38 A;  1AIP C;  2CHV A;  3RFW A;  4D82 A;  1QQW A;  4OVZ A;  1J7K A;  3WHK A;  2H5X A;  3U5Z A;  1T43 A;  4DV3 M;  1WGN A;  2JA2 A;  4Z6Y A;  4X62 M;  4YHH M;  1NSF A;  3KSJ A;  5E6J A;  3TWM A;  3AJI B;  3U6M A;  2XF3 A;  1JR3 D;  2KZU A;  4DR5 M;  4FWG A;  2DXI A;  3I51 A;  4JV5 M;  2XLJ A;  4LJ6 A;  2OQ4 A;  5KQD A;  2QPA A;  4G6Z A;  1IY2 A;  2XZU A;  1OJL A;  1OIP A;  1DO2 A;  2EKK A;  2LHG A;  1C1K A;  3SMP A;  3K9P A;  2C96 A;  2G5G X;  3HWS A;  1IXS B;  3T6P A;  1VDD A;  4B3S M;  3SAR A;  4QOZ C;  2LVN C;  1GLN A;  2N35 A;  3J7A S;  1GVN A;  1HQY E;  2DHR A;  3QAU A;  4CIZ A;  3GLI A;  2XSZ D;  1Q3C A;  2QCU A;  3AOG A;  3Q8X A;  1XC8 A;  4LF8 M;  4NRW A;  3SAU A;  5EP4 A;  2R18 A;  2CFO A;  3W67 A;  3KW6 A;  4L4U A;  3A45 A;  3JAM S;  4L15 A;  2G8L A;  3LW5 F;  4NRV A;  3GLG A;  3C58 A;  2I7N A;  3L28 A;  2GNO A;  4DR6 M;  2F4V M;  3VDU A;  1N32 M;  5JI3 E;  3K2L A;  2Y21 A;  3BOS A;  3CF6 E;  3M7G A;  1NV9 A;  5KPZ A;  1TGU A;  3TQS A;  2OPF A;  1DGB A;  3GLH A;  5H37 D;  4K0K M;  2CRU A;  4Y28 F;  1TH2 A;  4B3T M;  4F2L A;  1W5S A;  2JUJ A;  4LGM A;  2JNH A;  4G4Q A;  2QZ4 A;  4KHP M;  4PT5 A;  2DWL A;  2G3Q A;  3HX3 A;  2D7G A;  2UXD M;  2JZ1 A;  1ORY B;  1XXH A;  2KW0 A;  2F5O A;  2QBY B;  3PFI A;  5KQ8 A;  3U61 B;  2M5Z A;  1VEJ A;  3FE3 A;  5JI2 E;  2ZAO A;  1GKI A;  1QUT A;  4GH9 A;  4MB7 A;  1C7Y A;  3E21 A;  1HNZ M;  1NJF A;  4GC9 A;  5EXX A;  1OAI A;  4D81 A;  1MU5 A;  2QEN A;  1QZE A;  2CEA A;  1QAM A;  1E9R A;  2DAM A;  4I81 A;  3GLI E;  1ZMV A;  1NY6 A;  4FCV A;  1D0M A;  4NSR A;  3U5Z B;  1D0K A;  2KNZ A;  4NC6 A;  3GLG E;  4JI3 M;  4LG2 A;  3M0E A;  4IJF A;  3FUV A;  1ZQ9 A;  1IBK M;  4LFB M;  4LJ4 A;  1QVR A;  5KPR A;  1J09 A;  3U6P A;  2YNM D;  3QWL A;  3U6E A;  4LRS A;  1FJG M;  1JR3 E;  2WSF F;  3HY5 A;  4OU7 A;  2Z4R A;  1DGF A;  4B7G A;  8CAT A;  2C9C A;  1IBM M;  5IRE B;  1XNR M;  2LH0 A;  3KP0 E;  2X4A A;  3GLH E;  3UK6 A;  5FTN A;  4DUZ M;  1XMQ M;  2UUB M;  3MMP A;  4HLQ A;  1XB2 B;  4MGK E;  3J80 S;  4MM3 B;  2UUA M;  1VQ1 A;  1F4I A;  4LF7 M;  3GLI B;  5EXS A;  2LVQ D;  4XBO A;  3KVW A;  2L6O A;  2AHM A;  4LRT A;  4DV0 M;  1PM5 A;  2B3T A;  2HL7 A;  2VQF M;  2ZAM A;  2R65 A;  1XXH E;  4LJ5 A;  4MGH A;  3FYC A;  3LQR A;  2DAI A;  2FOI C;  1IXR C;  2LHC A;  3GRY A;  4CJ6 A;  3AKZ A;  2UU9 M;  2XGN A;  3HGI A;  4MH0 E;  1GJS A;  3CF0 A;  2DI0 A;  4LZJ A;  2ZM6 M;  2E5L M;  5ITT A;  1OIZ A;  1GJT A;  3AOE A;  3VDP A;  4IBB A;  2CHG A;  1QAQ A;  1EIJ A;  2DAE A;  1TH4 A;  2BJV A;  3FUX A;  1IQP A;  4X64 M;  1OTR A;  3CTW B;  2QNJ A;  1PJQ A;  2MRO B;  2V1U A;  4JI5 M;  1R2Z A;  1KFV A;  3A98 B;  3HJS A;  3GQ5 A;  2H1R A;  5LMN M;  4NXM M;  1MN3 A;  3U6Q A;  1S3S A;  1LTM A;  1Y8G A;  5DYG A;  4L78 A;  4NL4 H;  4F1I A;  1OFH A;  3MK6 A;  2KDL A;  4M0D A;  1PJS A;  3LMM A;  1QAO A;  5A2Q S;  4WUR A;  3SHF A;  1QDT A;  1WIV A;  3FTC A;  3MJ5 A;  1SXJ B;  2CE7 A;  2K0B X;  2BWE A;  2VF7 A;  1YUB A;  5IZ7 D;  1HR0 M;  1PGY A;  2ZTD A;  1E32 A;  3I4Y A;  1NHW C;  5KO3 A;  4B3R M;  4QNM A;  3UJN A;  4DR4 M;  2JWS A;  1DGH B;  3LVW A;  2EA0 A;  2JXN A;  2L4F A;  2LXE A;  4JI1 M;  4LJA A;  3QYB A;  3HHZ A;  1YLA A;  7CAT A;  1NNJ A;  1PJJ A;  3ZH9 B;  1KYI A;  3PNV A;  3B74 A;  2J7N A;  2EKF A;  2YQZ A;  2YR0 A;  3EIE A;  3KS8 A;  1HQC A;  3WHL A;  3L27 A;  2L4E A;  3GQ3 A;  2F5P A;  3AV0 A;  5FTM A;  3HJQ A;  4RNA A;  2QSF X;  2R62 A;  2DWM A;  2HKJ A;  3SAV A;  1L2C A;  3FYD A;  4IBK A;  4TUW A;  4JN6 A;  5FTJ A;  1IM2 A;  1G71 A;  4KT0 F;  4JI6 M;  2R44 A;  1R5L A;  2K6B A;  3L25 A;  4GHL A;  2HHH M;  2DEN A;  1QZM A;  2EJS A;  1Z6T A;  3B7Q A;  2FFJ A;  2OOA A;  2DVW B;  3EIH A;  3K92 A;  4L16 A;  1YE9 A;  2Y20 A;  4M9S A;  2DAG A;  3AFH A;  4X66 M;  4A3V B;  1AUA A;  1L2B A;  1IN6 A;  3L2A A;  4JI4 M;  5FTL A;  2JP7 A;  1WR1 B;  2XFS A;  3LCV B;  1HNW M;  4MGI E;  5LMU M;  4ITQ A;  3PXG A;  2WSC F;  3NBX X;  4DV6 M;  5IT9 S;  1NO1 A;  5EP3 A;  2EUC A;  4AQY M;  3FUU A;  2LBC A;  3K1J A;  1PJI A;  1H6U A;  2L2D A;  4KLN A;  3C3D A;  2I7P A;  1L2D A;  3B9P A;  3GRU A;  3VFD A;  3TPZ A;  3LCU A;  3T15 A;  3T1H M;  1BVS A;  1T3T A;  3H4M A;  2R4J A;  4AW4 A;  2NQ8 C;  1N33 M;  2JY6 B;  2OO9 A;  5EXP A;  3FUT A;  2CV1 A;  3SAT A;  3MHV C;  1V34 A;  4PD2 A;  4DUY M;  2VQE M;  5DYI A;  3ILK A;  2RGH A;  3UGJ A;  2K9D A;  5DNY A;  1R2Y A;  4M9Z A;  3SFZ A;  2Z8Y M;  1SXJ A;  1N36 M;  2C99 A;  1MX0 A;  1Z5C A;  2FH0 A;  4LZZ A;  3ZCB B;  4DR7 M;  2KNA A;  1OFI A;  4P17 A;  4PDG A;  3OTO M;  4AKI A;  1GL7 A;  2EO2 A;  3I4V A;  4R7G A;  3GLF A;  4PCZ A;  2OOB A;  2Y0T A;  4R71 A;  1DGH A;  4LGY A;  4MGZ E;  2XEP A;  2KEB A;  1TH3 A;  2WSE F;  4LCB A;  2J7O A;  3KFU G;  2F5Q A;  3H4J A;  3KS4 A;  1G59 A;  4DR3 M;  2KHH A;  3SC3 A;  1XHB A;  1NV8 A;  1PJT A;  5FLX S;  2P5T A;  2Z7J A;  3GPU A;  3GQ4 A;  4YY3 M;  1NVM A;  1R7R A;  3HJ8 A;  3M6A A;  4GC5 A;  3CGW A;  5ITX A;  3U6S A;  1K3W A;  2F5S A;  2MGW A;  4FD2 A;  4M9X A;  3Q8G A;  3E46 A;  3LQQ A;  2KRK A;  2X49 A;  4IBG A;  5KPT A;  1Z59 A;  5ITU A;  2V6Z M;  3QYE A;  4DR2 M;  1QAN A;  2XH9 A;  2DZL A;  2WZJ A;  5F3W A;  2KZS A;  3DZD A;  2JY7 A;  1UM8 A;  2R4E A;  4KO8 A;  3I01 M;  1T6O A;  3HHX A;  4AKG A;  2HAK A;  3U6O A;  3J27 B;  1N78 A;  2DHY A;  1N34 M;  2UXC M;  4AKH A;  3VLF B;  1SXJ E;  1N77 A;  4NXN M;  3GPX A;  1TF0 B;  2LTU A;  3BBZ A;  4LJ9 A;  3KXE C;  2GQF A;  4RF1 A;  3A46 A;  3U6D A;  4OX9 M;  1ZMU A;  3AOE C;  3F92 A;  3RE8 A;  4X65 M;  3TE6 A;  3PNY A;  4S12 A;  3GO8 A;  3GLF E;  4LFC M;  3JR4 A;  3K9O A;  2MH8 A;  3K8Z A;  3HU3 A;  3KOX E;  2L7I A;  1G8P A;  1I94 M;  4LJ7 A;  3VK8 A;  1TDH A;  1OQY A;  1GO5 A;  2LVO C;  1R6B X;  2O25 A;  4DR1 M;  4IJE A;  1TDZ A;  3L26 A;  1G41 A;  4HEO A;  5ITX E;  1IXZ A;  3SMS A;  2C98 A;  2CWB A;  2M60 A;  3DA1 A;  4DV5 M;  2ERC A;  4FCW A;  4FW9 A;  1KSF X;  1P3Q Q;  2A5Y B;  2Z4S A;  5FSW A;  3U6C A;  2R46 A;  1LV7 A;  3HHW A;  3R8F A;  1VEK A;  1CUK A;  4Z8X A;  1VEG A;  3RGP A;  1G4A E;  2Z3X A;  1WJ7 A;  3TWK A;  3GLF B;  2L7H A;  4W5W A;  2MJ5 B;  4FVM A;  3FKE A;  4GMQ A;  3U6L A; 
#chains in the Genus database with same CATH homology
 3R9X B;  2L09 A;  2DWZ B;  2KA6 B;  3KOY E;  2YFQ A;  4DV2 M;  5EP2 A;  4CIS A;  1IN8 A;  4LFA M;  1L1T A;  1IN5 A;  4AZF A;  4EIW A;  2QP9 X;  4JYA M;  1E9S A;  2UXB M;  1HT1 E;  2LNH C;  4FWD A;  3KSX A;  4DV4 M;  1JQJ C;  1IN4 A;  3FTD A;  1J5E M;  4LF4 M;  3JR5 A;  5ITR A;  2XFT A;  1IY1 A;  3KP1 E;  5FTK A;  3RGS A;  1Z5B A;  1QYR A;  4GHA A;  1SXJ D;  1DGG A;  3FUW A;  3E9S A;  1ZAE A;  3KDS E;  2CV0 A;  3HU1 A;  3DFZ A;  1K3X A;  4JXJ A;  3FD9 A;  1IN7 A;  4IBF A;  3GRR A;  3KOZ E;  1Q3B A;  5C1B A;  1K82 A;  3SHG B;  4NOO B;  3AL0 C;  2KXE A;  3W0F A;  3FTF A;  4NSO B;  3CF2 A;  1E94 E;  3FTE A;  2ZBK B;  5GKN A;  3J2P B;  1WXQ A;  3DOA A;  2K47 A;  4BBA A;  2ZAN A;  3SAS A;  3D8B A;  4JI2 M;  3GPP A;  2Y0Q A;  4G4O A;  4M0W A;  3T1Y M;  2CV2 A;  2RGO A;  3NWL A;  5EJC A;  3VK7 A;  1JR3 A;  4IBE A;  2F5N A;  3VKG A;  5IWA M;  4GKK M;  1SXJ C;  3NBI A;  1NY5 A;  1HT2 E;  4L8R C;  1XWI A;  1L8Q A;  3TL4 X;  2C9O A;  4BLC A;  1L1Z A;  1GL6 A;  4R3D A;  2HCB A;  3SBJ A;  4QHS A;  3U60 A;  4ZPX A;  4GIT A;  3IG8 A;  5EXT A;  3KOW E;  4B3M M;  2CUZ A;  5EQT A;  2XSZ A;  2O5R A;  5BPV A;  2DZN B;  4I5S A;  3D8L A;  4XGI A;  4IBJ A;  2R45 A;  4JI7 M;  4MGY E;  3VKH A;  1D2N A;  2W82 A;  4CHT B;  4REZ A;  1YSY A;  4I8O A;  4GRI A;  4IIW A;  2C5R A;  3UZU A;  4QNR A;  3HKP A;  4OVZ B;  3GPY A;  3J7B A;  2KRU A;  4FCT A;  1XMO M;  4GKJ M;  5BR8 M;  3TWL A;  4LF6 M;  4QHT A;  4I4L A;  5EP1 A;  4DV1 M;  2V1C A;  4BB9 A;  4KOD A;  2RKO A;  1NJG A;  4JI0 M;  3GP1 A;  4QOS A;  5ITY A;  3THG A;  4PDI A;  2BJW A;  4HL4 A;  5C18 A;  1FNN A;  5E26 A;  4B7F A;  3L29 A;  3PVS A;  2VII A;  4RF0 A;  4IBD A;  4AG5 A;  3J81 S;  4D80 A;  4G4R A;  4OW0 A;  3SYK A;  4B08 A;  2CHQ A;  4WW0 A;  3W0L B;  2LWX A;  4G4N A;  4FWH A;  3GLG B;  4JI8 M;  1Q39 A;  2D7E A;  5ITQ A;  1Z5A A;  4P16 A;  4LF9 M;  3UMM A;  2D7H A;  4IBI A;  1XNQ M;  1X37 A;  1HNX M;  2UUC M;  4DV7 M;  1NNU C;  3HU2 A;  4GIP A;  4AG6 A;  3GRV A;  2X8A A;  2FE8 A;  1IBL M;  4II7 A;  2FNA A;  3GLH B;  3IG5 A;  4B7H A;  3U60 B;  3E4R A;  1W5T A;  2BNK A;  3SAW A;  1DO0 A;  3HHY A;  3LVV A;  3SYL A;  1NHG C;  4AI6 A;  4IBC A;  1G3I A;  2DWN A;  4LY6 A;  2QBY A;  4LF5 M;  1XXH B;  3U61 A;  1IY0 A;  1I4W A;  2XZF A;  3A42 A;  3ZC7 B;  1N75 A;  2DZO B;  4CGY B;  2Q2E B;  4LJ8 A;  1EE8 A;  3T38 A;  3RFW A;  2CHV A;  4D82 A;  1QQW A;  4OVZ A;  1J7K A;  3WHK A;  3U5Z A;  4DV3 M;  2JA2 A;  4Z6Y A;  4X62 M;  4YHH M;  1NSF A;  3KSJ A;  5E6J A;  3TWM A;  3AJI B;  3U6M A;  2XF3 A;  1JR3 D;  2KZU A;  4DR5 M;  4FWG A;  2DXI A;  3I51 A;  4JV5 M;  2XLJ A;  4LJ6 A;  2OQ4 A;  5KQD A;  2QPA A;  4G6Z A;  1IY2 A;  2XZU A;  1OJL A;  1DO2 A;  1C1K A;  3SMP A;  2C96 A;  2G5G X;  3HWS A;  1IXS B;  1VDD A;  4B3S M;  3SAR A;  4QOZ C;  1GLN A;  3J7A S;  1GVN A;  1HQY E;  2DHR A;  3QAU A;  3GLI A;  2XSZ D;  1Q3C A;  2QCU A;  3AOG A;  3Q8X A;  1XC8 A;  4LF8 M;  4NRW A;  3SAU A;  5EP4 A;  2R18 A;  2CFO A;  3KW6 A;  4L4U A;  3A45 A;  3JAM S;  4L15 A;  2G8L A;  4NRV A;  3GLG A;  3C58 A;  2I7N A;  3L28 A;  4DR6 M;  2F4V M;  3VDU A;  1N32 M;  5JI3 E;  3K2L A;  2Y21 A;  3BOS A;  3CF6 E;  3M7G A;  5KPZ A;  1TGU A;  3TQS A;  2OPF A;  1DGB A;  3GLH A;  5H37 D;  4K0K M;  1TH2 A;  4B3T M;  1W5S A;  4LGM A;  4G4Q A;  2QZ4 A;  4KHP M;  4PT5 A;  2DWL A;  2D7G A;  2UXD M;  1ORY B;  1XXH A;  2KW0 A;  2F5O A;  2QBY B;  3PFI A;  5KQ8 A;  3U61 B;  2M5Z A;  5JI2 E;  2ZAO A;  1GKI A;  4GH9 A;  4MB7 A;  1HNZ M;  1NJF A;  4GC9 A;  5EXX A;  4D81 A;  1MU5 A;  2QEN A;  2CEA A;  1QAM A;  1E9R A;  4I81 A;  1NY6 A;  4FCV A;  4NSR A;  3U5Z B;  4JI3 M;  4LG2 A;  3M0E A;  4IJF A;  3FUV A;  1ZQ9 A;  1IBK M;  4LFB M;  4LJ4 A;  1QVR A;  5KPR A;  1J09 A;  3U6P A;  2YNM D;  3QWL A;  3U6E A;  4LRS A;  1FJG M;  4OU7 A;  2Z4R A;  1DGF A;  4B7G A;  8CAT A;  2C9C A;  1IBM M;  5IRE B;  1XNR M;  2LH0 A;  3KP0 E;  2X4A A;  3UK6 A;  5FTN A;  4DUZ M;  1XMQ M;  2UUB M;  4HLQ A;  4MGK E;  3J80 S;  4MM3 B;  2UUA M;  4LF7 M;  3GLI B;  5EXS A;  4XBO A;  3KVW A;  2L6O A;  2AHM A;  4LRT A;  4DV0 M;  1PM5 A;  2HL7 A;  2VQF M;  2ZAM A;  2R65 A;  4LJ5 A;  4MGH A;  3FYC A;  3LQR A;  2FOI C;  1IXR C;  3GRY A;  3AKZ A;  2UU9 M;  2XGN A;  3HGI A;  4MH0 E;  3CF0 A;  4LZJ A;  2ZM6 M;  2E5L M;  5ITT A;  3AOE A;  3VDP A;  4IBB A;  2CHG A;  1QAQ A;  1TH4 A;  2BJV A;  3FUX A;  1IQP A;  4X64 M;  3CTW B;  2V1U A;  4JI5 M;  1R2Z A;  1KFV A;  3A98 B;  3HJS A;  3GQ5 A;  2H1R A;  5LMN M;  4NXM M;  3U6Q A;  1S3S A;  5DYG A;  4L78 A;  4NL4 H;  1OFH A;  3MK6 A;  4M0D A;  3LMM A;  1QAO A;  5A2Q S;  4WUR A;  3SHF A;  3FTC A;  3MJ5 A;  1SXJ B;  2CE7 A;  1YUB A;  5IZ7 D;  1HR0 M;  3I4Y A;  1E32 A;  1NHW C;  5KO3 A;  4B3R M;  4QNM A;  3UJN A;  4DR4 M;  1DGH B;  3LVW A;  2EA0 A;  2LXE A;  4JI1 M;  4LJA A;  3HHZ A;  7CAT A;  1NNJ A;  1PJJ A;  3ZH9 B;  1KYI A;  3PNV A;  2J7N A;  2YQZ A;  2YR0 A;  3EIE A;  3KS8 A;  1HQC A;  3WHL A;  3L27 A;  3GQ3 A;  2F5P A;  3AV0 A;  5FTM A;  3HJQ A;  4RNA A;  2R62 A;  2DWM A;  2HKJ A;  3SAV A;  1L2C A;  3FYD A;  4IBK A;  4TUW A;  4JN6 A;  5FTJ A;  1IM2 A;  4JI6 M;  3L25 A;  4GHL A;  2HHH M;  1QZM A;  1Z6T A;  3EIH A;  2FFJ A;  4L16 A;  2DVW B;  1L2D A;  3K92 A;  1YE9 A;  2Y20 A;  4M9S A;  4X66 M;  3AFH A;  4A3V B;  1L2B A;  1IN6 A;  3L2A A;  4JI4 M;  5FTL A;  2XFS A;  1HNW M;  4MGI E;  5LMU M;  4ITQ A;  3PXG A;  4DV6 M;  5IT9 S;  5EP3 A;  2EUC A;  4AQY M;  3FUU A;  3K1J A;  1PJI A;  1H6U A;  4KLN A;  2I7P A;  3B9P A;  3GRU A;  3VFD A;  3TPZ A;  3T15 A;  3T1H M;  1T3T A;  3H4M A;  2R4J A;  4AW4 A;  2NQ8 C;  1N33 M;  5EXP A;  3FUT A;  2CV1 A;  3SAT A;  3MHV C;  4PD2 A;  4DUY M;  2VQE M;  5DYI A;  3ILK A;  2RGH A;  3UGJ A;  5DNY A;  1R2Y A;  4M9Z A;  3SFZ A;  1SXJ A;  1N36 M;  2C99 A;  1MX0 A;  1Z5C A;  4LZZ A;  3ZCB B;  4DR7 M;  1OFI A;  4PDG A;  3OTO M;  4AKI A;  1GL7 A;  2EO2 A;  3I4V A;  4R7G A;  3GLF A;  4PCZ A;  2Y0T A;  1DGH A;  4LGY A;  4MGZ E;  2XEP A;  2KEB A;  1TH3 A;  3KFU G;  4LCB A;  2J7O A;  2F5Q A;  1G59 A;  3KS4 A;  4DR3 M;  3SC3 A;  1XHB A;  3GPU A;  5FLX S;  2P5T A;  2Z7J A;  3GQ4 A;  4YY3 M;  1NVM A;  1R7R A;  3HJ8 A;  3M6A A;  4GC5 A;  5ITX A;  3U6S A;  1K3W A;  2F5S A;  4FD2 A;  4M9X A;  3LQQ A;  2KRK A;  2X49 A;  4IBG A;  5KPT A;  1Z59 A;  5ITU A;  2V6Z M;  4DR2 M;  1QAN A;  2XH9 A;  5F3W A;  2KZS A;  3DZD A;  1UM8 A;  2R4E A;  4KO8 A;  3HHX A;  4AKG A;  3U6O A;  3J27 B;  1N78 A;  1N34 M;  4AKH A;  2UXC M;  3VLF B;  1SXJ E;  1N77 A;  4NXN M;  3GPX A;  3A46 A;  4LJ9 A;  4RF1 A;  3KXE C;  3U6D A;  4OX9 M;  3AOE C;  4X65 M;  3RE8 A;  3TE6 A;  3PNY A;  4S12 A;  3GO8 A;  4LFC M;  3JR4 A;  3K8Z A;  3HU3 A;  3KOX E;  2L7I A;  1G8P A;  1I94 M;  4LJ7 A;  3VK8 A;  1TDH A;  1R6B X;  4DR1 M;  4IJE A;  1TDZ A;  3L26 A;  1G41 A;  5ITX E;  1IXZ A;  3SMS A;  2C98 A;  2M60 A;  3DA1 A;  4DV5 M;  2ERC A;  4FCW A;  4FW9 A;  1KSF X;  2A5Y B;  2Z4S A;  5FSW A;  3U6C A;  2R46 A;  1LV7 A;  3HHW A;  3R8F A;  3RGP A;  4Z8X A;  1G4A E;  2Z3X A;  3TWK A;  3GLF B;  2L7H A;  4W5W A;  4FVM A;  3FKE A;  4GMQ A;  3U6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...