4B3SM

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3sM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3sM02
4DR1M 3SAUA 2UXDM 1Q3CA 4G4RA 2XZFA 4NRVA 2Q2EB 2UU9M 3T1YM 4DV3M 1L1TA 4DV2M 1I94M 4NRWA 4OX9M 4JI3M 1EE8A 4AQYM 5ITXA 4YHHM 3GPPA 1N34M 2UXBM 4DV7M 2OPFA 1K3XA 1Z5CA 1XMQM 1L2DA 2UXCM 4DV6M 5A2QS 1K3WA 1HR0M 3SAVA 4LF9M 4DUYM 4DV5M 3VK7A 3SAWA 4JI7M 4JI2M 4NXMM 2UUBM 1IBKM 4JI8M 4LF4M 4DV4M 3U6CA 3SARA 2UUCM 2XZUA 4LFCM 4JV5M 1FJGM 2F5OA 4LF8M 5IT9S 3JR4A 1L2BA 4CISA 3SASA 4NXNM 5IWAM 4LF7M 1HNXM 3GP1A 1R2ZA 1J5EM 1IBMM 3U6MA 3U6EA 4JI1M 1Q3BA 4DR6M 4B3MM 4PDGA 1IBLM 2VQFM 3JAMS 2F5SA 3A42A 2HHHM 1Z59A 4B3TM 2VQEM 4PCZA 4DR2M 4JI4M 4G4NA 1PJJA 1HNWM 4X65M 4G4OA 4G4QA 2UUAM 4DV1M 2E5LM 3OTOM 2HKJA 4DR4M 4JI0M 1R2YA 1Z5AA 4K0KM 5ITXE 5LMUM 1Q39A 2OQ4A 4KHPM 1MU5A 3GO8A 1L2CA 3J7AS 3TWMA 3GPYA 3J81S 2F4VM 1XMOM 4GKJM 3GQ4A 1NNJA 5BR8M 1XNRM 3J80S 3U6PA 2F5NA 1N32M 1XC8A 5LMNM 3U6LA 4JI5M 4DR3M 4DUZM 1L1ZA 4LFAM 1HNZM 2F5PA 1N33M 4ITQA 1KFVA 3TWKA 3SATA 4X66M 4DR5M 5ITYA 4DR7M 1N36M 4DV0M 1PJIA 3GPUA 3W0FA 3U6OA 3GQ5A 1K82A 2EA0A 1PM5A 4JYAM 2ZM6M 5ITRA 3DOAA 4PDIA 4B3SM 5ITTA 3U6DA 5ITUA 3VK8A 1TDHA 1TDZA 3SBJA 2F5QA 3T1HM 2ZBKB 4B3RM 4YY3M 1MX0A 4LFBM 5ITQA 3TWLA 4X64M 4LF5M 4LF6M 1XNQM 3C58A 4X62M 1Z5BA 3U6QA 4MB7A 4PD2A 3U6SA 5FLXS 3GPXA 3JR5A 4JI6M 3A46A 3GQ3A 3A45A 4GKKM
chains in the Genus database with same CATH superfamily
1YE9A 4DR1M 3SAUA 1N77A 2QBYA 2DI0A 1TTEA 2R6FA 3E46A 4FCWA 2Q2EB 4NRVA 4CIZA 1X37A 4GHLA 4DV3M 2EKFA 3LQRA 1DGBA 1T6OA 1XB2B 4OX9M 4JI3M 2VF8A 5EP1A 2C9CA 4HLQA 4AG5A 4CJ6A 3GPPA 2XF3A 5FTLA 1L2DA 3HU2A 4KODA 1IN7A 4LCBA 5A2QS 3HY5A 3SAVA 1K3WA 5EXTA 3B89A 4JI2M 1IN8A 4B7FA 1IBKM 1C7YA 4F2LA 3VDUA 4JI8M 1T43A 3U61A 3U6CA 3GLIA 4XK8F 1XXHE 3U60A 4LFCM 4JV5M 2QNJA 2ERCA 3HJSA 4PT5A 2F5OA 2QENA 4LF8M 3J7BA 2V1CA 3UGJA 1GVNA 3JR4A 5IT9S 3HHWA 3FTFA 1SXJC 1BVSA 3FUUA 3PNYA 2H5XA 4KLNA 4R7GA 1IN4A 2KA6B 4LJ4A 3ZH9B 1T3TA 2CHQA 4ZPXA 3U6EA 1Q3BA 2XFSA 2LVQD 1YUBA 2R4JA 4IBEA 2X8AA 1V34A 1SG9A 1WXQA 1IBLM 3KSJA 4XBOA 2FS1A 4CHTB 3A42A 1OKSA 1GL7A 1G41A 2VQEM 2CV0A 2XEPA 2JP7A 3HJQA 4JXJA 4DR2M 4JI4M 4G4NA 4F1IA 1OFHA 4Q7JA 2UUAM 1GABA 3KW6A 2E5LM 3B7ZA 2LVPC 1NHWC 4IBGA 2QCUA 1WHCA 3W0LB 1Z5AA 3I01M 1J7KA 3NBIA 3SHFA 1VQ1A 3BXWA 4NC6A 2LXEA 4GH9A 4Z8XA 4CGYB 2L09A 5BPVA 3GO8A 1PJTA 1L2CA 4KHPM 1VEGA 4MM3B 3TWMA 2VDBB 1H6UA 1TH4A 3FUXA 4LRTA 4WW0A 3TPZA 4KO8A 1E9SA 3K9OA 2FH0A 2Z8YM 1XNRM 3KS8A 3CTWB 3HHYA 3U6PA 1A5TA 3GLIE 3FUWA 5KPRA 5LMNM 2I7PA 4JI5M 4DR3M 5FTJA 3KSXA 1ZMVA 2F5PA 5FTNA 2H1RA 2OOBA 2OQ4A 3SATA 1N78A 4X66M 1GL6A 4A3VB 3R9XB 2K0BX 2BNKA 4II7A 4BLCA 4D82A 2XSZA 3L27A 5E26A 2JWSA 3KP1E 1SXJA 4IBDA 3GQ5A 4FVMA 3GRRA 2FOIC 4PDIA 2B3TA 2Z7JA 1NJGA 4AKGA 2D7GA 2FNAA 3MHVC 2N35A 4IBFA 1VDDA 1TDZA 3F92A 1IY0A 1JQJC 5IZ7D 4R71A 2MH8A 2YFQA 5C1BA 2RRUA 3T1HM 4L8RC 2JA2A 1C1KA 1G3IA 2YR0A 1MX0A 2KRUA 2LTUA 2KNVA 3GRVA 4L15A 4WURA 4LF5M 4LF6M 2Z4RA 3EIHA 3C58A 1R6BX 3NWLA 4X62M 3UK6A 3A98B 3U6QA 4PD2A 3U6SA 4I81A 1LV7A 1AUAA 1WGLA 2WSCF 2DENA 1Y8GA 5H37D 3MJ5A 2WSFF 2DAEA 1Q3CA 5KPZA 3LCUA 3AOEC 4IJEA 1R4GA 2QP9X 4QNMA 1VDLA 3WHKA 2OOAA 3GLGB 2UU9M 3I51A 1L1TA 1IY2A 1IXRC 3NBXX 4LJAA 3E9SA 4DV2M 2R46A 5EJCA 1NVMA 1JR3A 3C9PA 4MGKE 5ITXA 5F3WA 1SXJE 4WP2A 2UXBM 2OPFA 4M9XA 1K3XA 1Z5CA 3B7QA 1HR0M 3FUVA 5DNYA 4DV5M 4LJ8A 3SMPA 4ANRA 3T6PA 2QHOB 1AIPC 2UUBM 4M0DA 3AV0A 3Q8GA 3FKEA 5DYIA 3FYDA 1OAOC 3SARA 3PVSA 4MGYE 4L78A 4D81A 2UUCM 4LY6A 1MJGM 4MGHA 2EO2A 4I4LA 1WJ7A 2NQ8C 3FRHA 2VIIA 2C99A 4NXNM 3HHZA 2DXIA 1S3SA 3RE8A 3GP1A 1HNXM 3SMSA 1TGUA 1QZEA 1R2ZA 1J5EM 1J09A 1NHGC 2ZTDA 3GLFA 1ZAEA 3WHLA 3KOYE 4MGZE 1IN5A 4PDGA 3U5ZB 3HU3A 5KPTA 4GEWA 5GKNA 3JAMS 2XGNA 1Z59A 4AI6A 1QYRA 3DFZA 3W67A 1HNWM 3H4JA 3ZCBB 3IECA 2YNMD 1IXSB 4LJ9A 2KW0A 2LWXA 2HKJA 1V33A 2W82A 1EIJA 2O25A 3V76A 4NL4H 2K6BA 1QUTA 1JR3E 1D2NA 2BJWA 5ITXE 4TUWA 2R44A 3E4RA 1DGHB 2ZTCA 4AKIA 1NV8A 1V92A 4OVZA 1OJLA 1HT2E 2JZ0A 3GQ4A 1NNJA 4LJ7A 3GRUA 3C3DA 3M0EA 2G5GX 2Z3XA 4GC9A 2V6ZM 4GRIA 1OTRA 4GIPA 1XC8A 3U6LA 2DAMA 1R7RA 2D7EA 2KEBA 3HX3A 4DUZM 2CE7A 2X4AA 1FNNA 1HNZM 5EP2A 3THGA 3PFIA 1GJSA 3VFDA 4DR5M 1HQCA 1MN3A 1DGGA 3GLFE 4AW4A 3ZQJA 5C18A 5EQTA 3W0FA 2DAIA 1K82A 1PM5A 2JY7A 2LNHC 5EXSA 4JYAM 5ITRA 3DOAA 5FSWA 2G3QA 3Q8XA 3J27B 4R3DA 5ITTA 2CV2A 2O5RA 3KXEC 1E32A 1QQWA 3GLHA 2AHMA 1E94E 2WSEF 3QAUA 3SBJA 2V1UA 3FTCA 1PJQA 3HJ8A 3KP0E 2F5QA 1XXHB 2ZBKB 4YY3M 3PXGA 5KQ8A 3W68A 1NV9A 2DHYA 1WR1B 2FE8A 4X64M 4M9ZA 1YSYA 3LCVB 2P5TA 2XFTA 4IBCA 1HT1E 3BBZA 2KHHA 1TH2A 3A46A 3GQ3A 3A45A 2HL7A 2Y21A 4GKKM 2DKLA 4G4RA 4I8OA 2XZFA 4RKUF 2JY8A 3AKZA 1NY5A 1UM8A 2CWBA 2QBYB 3T1YM 2K47A 2DVWB 4P17A 3GRYA 1QZMA 1I94M 4NRWA 4BB9A 1EE8A 4AQYM 4YHHM 2JNHA 2C96A 1IM2A 3J2PB 1XHBA 3PNVA 4GC5A 2UXCM 1XMQM 3LVWA 4LF9M 3DZDA 1JB0F 3KDSE 1IFYA 4NXMM 3VK7A 4JI7M 2QZ4A 3LQQA 4FD2A 4LF4M 4DV4M 3QYBA 3GLHE 1OIPA 2EUCA 3I04M 5IREB 3U61B 4GITA 2WZJA 3GLIB 2Y0TA 2M60A 1PGYA 2KRKA 4UN2B 3U60B 2DWZB 1WGNA 4CISA 2EKKA 3AFHA 3SASA 4LF7M 2G8LA 2VF7A 2BWEA 2EJSA 3CGWA 2A5YB 2JY5A 4NSOB 1G71A 4AZFA 4B3MM 3B74A 4IBIA 2LVAA 2R4EA 3HGIA 5FTKA 2DAKA 2VQFM 2KDLA 3K1JA 1PRBA 4I5SA 5FTMA 2F5SA 1D0MA 2JY6B 3HU1A 3FD9A 3AL0C 2CRUA 3B7NA 3VLFB 4HL4A 4X65M 4G4OA 2CFOA 3M6AA 2DZNB 3I4YA 3KOXE 3OTOM 4GHAA 3HHXA 2X49A 1E9RA 4G6ZA 4IJFA 1D0KA 3FTDA 4K0KM 2ZANA 1Q39A 5LMUM 4LZJA 3B9PA 4IBKA 1Q02A 5E6JA 2MROB 3TQSA 3J81S 4GKJM 2LHCA 2QQ8A 2RGHA 4Z6YA 2C98A 1KSFX 3J80S 1ZV1A 4LJ5A 1G8PA 4M0WA 2F5NA 1N32M 3CF2A 4RF1A 2CUZA 2J7OA 2K9DA 2O01F 2R45A 4DBGB 2CEAA 3FYCA 4NOOB 5L8RF 1N33M 4ITQA 1G4AE 3FE3A 2L6OA 2XSZD 4DR7M 1EFUB 1SXJD 2C9OA 4LJ6A 4DV0M 4LGMA 3AOGA 1PJIA 4LG2A 1Z6TA 3CF6E 3IG8A 2FFJA 2KNAA 2EA0A 2KXEA 1DV0A 3AOEA 4FCVA 2DNAA 4LGYA 1SXJB 1W5SA 4W5WA 5KQDA 2ZM6M 3C3EA 4AKHA 3T15A 3ZC7B 5ITUA 1ZQ9A 1TDHA 1YLAA 3UJNA 3KFUG 2DHRA 2LHGA 1OFIA 5EXXA 1GKIA 2DWNA 4B3RM 4M9SA 3L26A 5ITQA 1OQYA 1NJFA 2ZAMA 1OIZA 1GJTA 3BOSA 2HCBA 3KVWA 1XNQM 4QOSA 3IHPA 4QHTA 1Z5BA 1QAOA 5FLXS 3GPXA 2DWMA 5JI2E 4JI6M 1ORYB 3RGPA 2MGWA 3T38A 2J7NA 2UXDM 2ZAOA 2DWLA 1DO2A 1WIVA 3GLGA 3LW5F 3HWSA 4QNRA 4RNAA 1ZMWA 4P16A 1JR3D 4RF0A 4BBAA 2GNOA 2L2DA 2L4FA 3UZUA 3TE6A 4LZZA 3HZJA 4MGIE 2BJVA 2RKOA 4AG6A 1N34M 4DV7M 2CP8A 3K9PA 1NY6A 4DV6M 2R62A 2DAGA 3K8ZA 2APLA 4DUYM 4IBBA 4XGIA 1OAIA 3RGSA 1P3QQ 2RGOA 3UMMA 2LBCA 3K92A 1IQPA 2XZUA 2L7IA 3L28A 1QANA 1HJPA 1FJGM 1G59A 1VEKA 3FRIA 1QVRA 1L2BA 3FTEA 3H4MA 2L4EA 5IWAM 1IXZA 3VKHA 1DGFA 1QDRA 2D7HA 2C5RA 2DZLA 3U6MA 1IBMM 4JI1M 4EIWA 4DR6M 1RU3A 3U5ZA 3K2LA 2HAKA 3QYEA 2KNZA 2Z4SA 5DYGA 2MR9A 3GLFB 1I4WA 2M5ZA 2XH9A 1NO1A 3VKGA 4IBJA 3LVVA 4IIWA 3SHGB 2LVNC 2HHHM 3L25A 4QHSA 4Y28F 7CATA 4REZA 2DZOB 4B3TM 4PCZA 3D8LA 3GLGE 1IXSA 1L8QA 1UFZA 3L2AA 1NNUC 4B7GA 1PJJA 1GO5A 1TR8A 4FW9A 4G4QA 1QAQA 4DV1M 1LTMA 3R8FA 4DR4M 4JI0M 1PJSA 4OW0A 3RFWA 4B08A 3QWLA 4B7HA 1NSFA 2MJ5B 1R2YA 1DGHA 1TF0B 4GMQA 1HQYE 2LH0A 2Y20A 1F4IA 3M7GA 1ZMUA 4G3OA 3E21A 1MU5A 2CHVA 3I4VA 3LMMA 5EXPA 3SC3A 3TL4X 2CV1A 3J7AS 1VG5A 2YQZA 3MK6A 3GPYA 1DO0A 2QPAA 4NSRA 1XMOM 2LVOC 4OVZB 2F4VM 3KS4A 5BR8M 1XWIA 2JUJA 3VDPA 4HEOA 2CHGA 3SFZA 2XLJA 4L6V6 2QSFX 3ILKA 1W5TA 4LFAM 2R0IA 1L1ZA 3EIEA 2KZUA 2R65A 1KFVA 2JZ1A 1QUSA 3IG5A 3TWKA 5ITYA 2GQFA 1QDTA 2OO9A 4OU7A 4FWDA 8CATA 1N36M 4KT0F 5DFLA 1VEJA 3KOZE 3GPUA 1IN6A 3U6OA 4L16A 4FCTA 2JXNA 2Y0QA 4JN6A 2R18A 4D80A 1GLNA 3D8BA 3U6DA 4B3SM 3SYKA 3SYLA 4QOZC 1TH3A 3VK8A 4LRSA 3FUTA 5JI3E 1XXHA 3CF0A 1IY1A 2KZSA 4FWHA 1D0LA 4FWGA 3GLHB 5EP3A 3HKPA 5KO3A 4L4UA 4LFBM 3TWLA 1CUKA 3AJIB 3MMPA 3L29A 2HWJA 2J5YA 3KOWE 2L7HA 5EP4A 2I7NA 4S12A 4MB7A 1R5LA 1KYIA 3DA1A 4MH0E 3JR5A 3SAWA 2BWBA 1QAMA 1N75A
chains in the Genus database with same CATH topology
1YE9A 4DR1M 3SAUA 1N77A 2QBYA 4FCWA 4NRVA 2Q2EB 1X37A 4GHLA 4DV3M 3LQRA 1DGBA 4OX9M 4JI3M 5EP1A 2C9CA 4HLQA 4AG5A 3GPPA 2XF3A 5FTLA 1L2DA 3HU2A 4KODA 1IN7A 4LCBA 5A2QS 3SAVA 1K3WA 5EXTA 4JI2M 1IN8A 4B7FA 1IBKM 4JI8M 3VDUA 3U61A 3U6CA 3GLIA 3U60A 4LFCM 4JV5M 2ERCA 3HJSA 4PT5A 2F5OA 2QENA 4LF8M 3J7BA 2V1CA 3UGJA 1GVNA 3JR4A 5IT9S 3HHWA 3FTFA 1SXJC 3PNYA 3FUUA 4R7GA 4KLNA 1IN4A 2KA6B 4LJ4A 3ZH9B 1T3TA 2CHQA 4ZPXA 3U6EA 1Q3BA 2XFSA 1YUBA 2R4JA 4IBEA 2X8AA 1WXQA 1IBLM 3KSJA 4XBOA 4CHTB 3A42A 1GL7A 1G41A 2VQEM 2CV0A 2XEPA 3HJQA 4JXJA 4DR2M 4JI4M 4G4NA 1OFHA 2UUAM 3KW6A 2E5LM 1NHWC 4IBGA 2QCUA 3W0LB 1Z5AA 1J7KA 3NBIA 3SHFA 4Z8XA 4CGYB 2LXEA 4GH9A 5BPVA 3GO8A 2L09A 2OQ4A 1L2CA 4KHPM 4MM3B 3TWMA 1H6UA 1TH4A 3FUXA 4LRTA 4WW0A 3TPZA 4KO8A 1E9SA 1XNRM 3KS8A 3CTWB 3HHYA 3U6PA 3FUWA 5KPRA 5LMNM 2I7PA 4JI5M 4DR3M 5FTJA 3KSXA 2F5PA 5FTNA 2H1RA 3SATA 1N78A 4X66M 1GL6A 4A3VB 3R9XB 2BNKA 4II7A 4BLCA 4D82A 2XSZA 3L27A 5E26A 3KP1E 1SXJA 4IBDA 3GQ5A 4FVMA 3GRRA 2FOIC 4PDIA 2Z7JA 1NJGA 4AKGA 2D7GA 2FNAA 3MHVC 4IBFA 1VDDA 1TDZA 1IY0A 1JQJC 5IZ7D 2YFQA 5C1BA 3T1HM 4L8RC 2JA2A 1C1KA 1G3IA 2YR0A 1MX0A 2KRUA 3GRVA 4L15A 4WURA 4LF5M 4LF6M 2Z4RA 3EIHA 3C58A 1R6BX 3NWLA 4X62M 3UK6A 3A98B 3U6QA 4PD2A 3U6SA 4I81A 1LV7A 5H37D 3MJ5A 5KPZA 1Q3CA 3AOEC 4IJEA 2QP9X 3WHKA 4QNMA 2UU9M 3GLGB 3I51A 1L1TA 1IY2A 1IXRC 4LJAA 3E9SA 4DV2M 2R46A 5EJCA 1NVMA 1JR3A 4MGKE 5ITXA 5F3WA 1SXJE 2UXBM 2OPFA 4M9XA 1K3XA 1Z5CA 1HR0M 3FUVA 5DNYA 4DV5M 4LJ8A 3SMPA 2UUBM 4M0DA 3AV0A 3FKEA 5DYIA 3FYDA 3SARA 3PVSA 4MGYE 4L78A 4D81A 2UUCM 4LY6A 4MGHA 2EO2A 4I4LA 2NQ8C 3HHZA 2VIIA 2C99A 4NXNM 2DXIA 1S3SA 3RE8A 3GP1A 1HNXM 3SMSA 1TGUA 1R2ZA 1J5EM 1J09A 1NHGC 3GLFA 1ZAEA 3WHLA 3KOYE 4MGZE 1IN5A 4PDGA 3U5ZB 3HU3A 5KPTA 5GKNA 3JAMS 2XGNA 1Z59A 4AI6A 1QYRA 3DFZA 1HNWM 3ZCBB 2YNMD 1IXSB 4LJ9A 2KW0A 2LWXA 2HKJA 2W82A 4NL4H 1D2NA 2BJWA 5ITXE 4TUWA 3E4RA 1DGHB 4AKIA 4OVZA 1OJLA 1HT2E 3GQ4A 1NNJA 4LJ7A 3GRUA 3M0EA 2G5GX 2Z3XA 4GC9A 2V6ZM 4GRIA 4GIPA 1XC8A 3U6LA 1R7RA 2D7EA 2KEBA 4DUZM 2CE7A 2X4AA 1FNNA 1HNZM 5EP2A 3THGA 3PFIA 3VFDA 4DR5M 1HQCA 1DGGA 4AW4A 5C18A 5EQTA 3W0FA 1K82A 1PM5A 2LNHC 5EXSA 4JYAM 5ITRA 3DOAA 5FSWA 3Q8XA 3J27B 4R3DA 5ITTA 2CV2A 2O5RA 3KXEC 1QQWA 1E32A 3GLHA 2AHMA 1E94E 3QAUA 3SBJA 2V1UA 3FTCA 3HJ8A 3KP0E 2F5QA 1XXHB 2ZBKB 4YY3M 3PXGA 5KQ8A 2FE8A 4X64M 4M9ZA 1YSYA 2P5TA 2XFTA 4IBCA 1HT1E 1TH2A 3A46A 3GQ3A 3A45A 2HL7A 2Y21A 4GKKM 4G4RA 4I8OA 2XZFA 3AKZA 1NY5A 1UM8A 2QBYB 3T1YM 2K47A 2DVWB 3GRYA 1QZMA 1I94M 4NRWA 4BB9A 1EE8A 4AQYM 4YHHM 2C96A 1IM2A 3J2PB 1XHBA 3PNVA 4GC5A 2UXCM 1XMQM 3LVWA 4LF9M 3DZDA 3KDSE 4NXMM 3VK7A 4JI7M 2QZ4A 3LQQA 4FD2A 4LF4M 4DV4M 2EUCA 5IREB 3U61B 4GITA 3GLIB 2Y0TA 2M60A 2KRKA 3U60B 2DWZB 4CISA 3AFHA 3SASA 4LF7M 2G8LA 2A5YB 4NSOB 4AZFA 4B3MM 4IBIA 2R4EA 3HGIA 5FTKA 2VQFM 3K1JA 4I5SA 5FTMA 2F5SA 3HU1A 3FD9A 3AL0C 3VLFB 4HL4A 4X65M 4G4OA 2CFOA 3M6AA 2DZNB 3I4YA 3KOXE 3OTOM 4GHAA 3HHXA 2X49A 1E9RA 4G6ZA 4IJFA 3FTDA 4K0KM 2ZANA 1Q39A 5LMUM 4LZJA 3B9PA 4IBKA 5E6JA 3TQSA 3J81S 4GKJM 2RGHA 4Z6YA 2C98A 1KSFX 3J80S 4LJ5A 1G8PA 4M0WA 2F5NA 1N32M 3CF2A 4RF1A 2CUZA 2J7OA 2R45A 2CEAA 3FYCA 4NOOB 1N33M 4ITQA 1G4AE 2L6OA 2XSZD 4DR7M 1SXJD 2C9OA 4LJ6A 4DV0M 4LGMA 3AOGA 1PJIA 4LG2A 1Z6TA 3CF6E 3IG8A 2FFJA 2EA0A 2KXEA 3AOEA 4FCVA 4LGYA 4W5WA 1SXJB 1W5SA 5KQDA 2ZM6M 4AKHA 3T15A 3ZC7B 5ITUA 1ZQ9A 1TDHA 3UJNA 3KFUG 2DHRA 1OFIA 5EXXA 1GKIA 2DWNA 4B3RM 4M9SA 3L26A 5ITQA 1NJFA 2ZAMA 3BOSA 2HCBA 3KVWA 1XNQM 4QOSA 4QHTA 1Z5BA 1QAOA 5FLXS 3GPXA 2DWMA 5JI2E 4JI6M 1ORYB 3RGPA 3T38A 2J7NA 2UXDM 2ZAOA 2DWLA 1DO2A 3GLGA 3HWSA 4QNRA 4RNAA 4P16A 1JR3D 4RF0A 4BBAA 3UZUA 3TE6A 4LZZA 4AG6A 4MGIE 2BJVA 2RKOA 1N34M 4DV7M 1NY6A 4DV6M 2R62A 3K8ZA 4DUYM 4IBBA 4XGIA 3RGSA 2RGOA 3UMMA 3K92A 1IQPA 2XZUA 2L7IA 3L28A 1QANA 1FJGM 1G59A 3FTEA 1QVRA 1L2BA 3H4MA 5IWAM 1IXZA 3VKHA 1DGFA 2D7HA 2C5RA 1IBMM 3U6MA 4JI1M 4EIWA 4DR6M 3U5ZA 3K2LA 2Z4SA 5DYGA 3GLFB 1I4WA 2M5ZA 2XH9A 3VKGA 4IBJA 3LVVA 4IIWA 3SHGB 2HHHM 3L25A 4QHSA 4B3TM 7CATA 4REZA 2DZOB 4PCZA 3D8LA 1L8QA 3L2AA 1NNUC 4B7GA 1PJJA 4FW9A 4G4QA 1QAQA 4DV1M 3R8FA 4DR4M 4JI0M 4OW0A 3RFWA 4B08A 3QWLA 4B7HA 1NSFA 1R2YA 1DGHA 4GMQA 1HQYE 2LH0A 2Y20A 3M7GA 3SC3A 3I4VA 1MU5A 2CHVA 3LMMA 3TL4X 5EXPA 3J7AS 2CV1A 2YQZA 3MK6A 3GPYA 1DO0A 2QPAA 4NSRA 1XMOM 4OVZB 2F4VM 3KS4A 5BR8M 1XWIA 3VDPA 2CHGA 3SFZA 2XLJA 3ILKA 1W5TA 4LFAM 1L1ZA 3EIEA 2KZUA 2R65A 1KFVA 3IG5A 3TWKA 5ITYA 4OU7A 4FWDA 8CATA 1N36M 3GPUA 3KOZE 3U6OA 1IN6A 4L16A 4FCTA 2Y0QA 4JN6A 2R18A 4D80A 1GLNA 3D8BA 3U6DA 4B3SM 3SYKA 3SYLA 4QOZC 1TH3A 3VK8A 4LRSA 3FUTA 5JI3E 1XXHA 3CF0A 1IY1A 2KZSA 4FWHA 4FWGA 5EP3A 3GLHB 5KO3A 3HKPA 4L4UA 4LFBM 3TWLA 3AJIB 3L29A 3KOWE 2L7HA 5EP4A 2I7NA 4S12A 4MB7A 1KYIA 3DA1A 4MH0E 3JR5A 3SAWA 1QAMA 1N75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 M;  3SAU A;  2UXD M;  1Q3C A;  4G4R A;  2XZF A;  4NRV A;  2Q2E B;  2UU9 M;  3T1Y M;  4DV3 M;  1L1T A;  4DV2 M;  1I94 M;  4NRW A;  4OX9 M;  4JI3 M;  1EE8 A;  4AQY M;  5ITX A;  4YHH M;  3GPP A;  1N34 M;  2UXB M;  4DV7 M;  2OPF A;  1K3X A;  1Z5C A;  1XMQ M;  1L2D A;  2UXC M;  4DV6 M;  5A2Q S;  1K3W A;  1HR0 M;  3SAV A;  4LF9 M;  4DUY M;  4DV5 M;  3VK7 A;  3SAW A;  4JI7 M;  4JI2 M;  4NXM M;  2UUB M;  1IBK M;  4JI8 M;  4LF4 M;  4DV4 M;  3U6C A;  3SAR A;  2UUC M;  2XZU A;  4LFC M;  4JV5 M;  1FJG M;  2F5O A;  4LF8 M;  5IT9 S;  3JR4 A;  1L2B A;  4CIS A;  3SAS A;  4NXN M;  5IWA M;  4LF7 M;  1HNX M;  3GP1 A;  1R2Z A;  1J5E M;  1IBM M;  3U6M A;  3U6E A;  4JI1 M;  1Q3B A;  4DR6 M;  4B3M M;  4PDG A;  1IBL M;  2VQF M;  3JAM S;  2F5S A;  3A42 A;  2HHH M;  1Z59 A;  4B3T M;  2VQE M;  4PCZ A;  4DR2 M;  4JI4 M;  4G4N A;  1PJJ A;  1HNW M;  4X65 M;  4G4O A;  4G4Q A;  2UUA M;  4DV1 M;  2E5L M;  3OTO M;  2HKJ A;  4DR4 M;  4JI0 M;  1R2Y A;  1Z5A A;  4K0K M;  5ITX E;  5LMU M;  1Q39 A;  2OQ4 A;  4KHP M;  1MU5 A;  3GO8 A;  1L2C A;  3J7A S;  3TWM A;  3GPY A;  3J81 S;  2F4V M;  1XMO M;  4GKJ M;  3GQ4 A;  1NNJ A;  5BR8 M;  1XNR M;  3J80 S;  3U6P A;  2F5N A;  1N32 M;  1XC8 A;  5LMN M;  3U6L A;  4JI5 M;  4DR3 M;  4DUZ M;  1L1Z A;  4LFA M;  1HNZ M;  2F5P A;  1N33 M;  4ITQ A;  1KFV A;  3TWK A;  3SAT A;  4X66 M;  4DR5 M;  5ITY A;  4DR7 M;  1N36 M;  4DV0 M;  1PJI A;  3GPU A;  3W0F A;  3U6O A;  3GQ5 A;  1K82 A;  2EA0 A;  1PM5 A;  4JYA M;  2ZM6 M;  5ITR A;  3DOA A;  4PDI A;  4B3S M;  5ITT A;  3U6D A;  5ITU A;  3VK8 A;  1TDH A;  1TDZ A;  3SBJ A;  2F5Q A;  3T1H M;  2ZBK B;  4B3R M;  4YY3 M;  1MX0 A;  4LFB M;  5ITQ A;  3TWL A;  4X64 M;  4LF5 M;  4LF6 M;  1XNQ M;  3C58 A;  4X62 M;  1Z5B A;  3U6Q A;  4MB7 A;  4PD2 A;  3U6S A;  5FLX S;  3GPX A;  3JR5 A;  4JI6 M;  3A46 A;  3GQ3 A;  3A45 A;  4GKK M; 
#chains in the Genus database with same CATH topology
 1YE9 A;  4DR1 M;  3SAU A;  1N77 A;  2QBY A;  2DI0 A;  1TTE A;  2R6F A;  3E46 A;  4FCW A;  2Q2E B;  4NRV A;  4CIZ A;  1X37 A;  4GHL A;  4DV3 M;  2EKF A;  3LQR A;  1DGB A;  1T6O A;  1XB2 B;  4OX9 M;  4JI3 M;  2VF8 A;  5EP1 A;  2C9C A;  4HLQ A;  4AG5 A;  4CJ6 A;  3GPP A;  2XF3 A;  5FTL A;  1L2D A;  3HU2 A;  4KOD A;  1IN7 A;  4LCB A;  5A2Q S;  3HY5 A;  3SAV A;  1K3W A;  5EXT A;  3B89 A;  4JI2 M;  1IN8 A;  4B7F A;  1IBK M;  1C7Y A;  4F2L A;  3VDU A;  4JI8 M;  1T43 A;  3U61 A;  3U6C A;  3GLI A;  4XK8 F;  1XXH E;  3U60 A;  4LFC M;  4JV5 M;  2QNJ A;  2ERC A;  3HJS A;  4PT5 A;  2F5O A;  2QEN A;  4LF8 M;  3J7B A;  2V1C A;  3UGJ A;  1GVN A;  3JR4 A;  5IT9 S;  3HHW A;  3FTF A;  1SXJ C;  1BVS A;  3FUU A;  3PNY A;  2H5X A;  4KLN A;  4R7G A;  1IN4 A;  2KA6 B;  4LJ4 A;  3ZH9 B;  1T3T A;  2CHQ A;  4ZPX A;  3U6E A;  1Q3B A;  2XFS A;  2LVQ D;  1YUB A;  2R4J A;  4IBE A;  2X8A A;  1V34 A;  1SG9 A;  1WXQ A;  1IBL M;  3KSJ A;  4XBO A;  2FS1 A;  4CHT B;  3A42 A;  1OKS A;  1GL7 A;  1G41 A;  2VQE M;  2CV0 A;  2XEP A;  2JP7 A;  3HJQ A;  4JXJ A;  4DR2 M;  4JI4 M;  4G4N A;  4F1I A;  1OFH A;  4Q7J A;  2UUA M;  1GAB A;  3KW6 A;  2E5L M;  3B7Z A;  2LVP C;  1NHW C;  4IBG A;  2QCU A;  1WHC A;  3W0L B;  1Z5A A;  3I01 M;  1J7K A;  3NBI A;  3SHF A;  1VQ1 A;  3BXW A;  4NC6 A;  2LXE A;  4GH9 A;  4Z8X A;  4CGY B;  2L09 A;  5BPV A;  3GO8 A;  1PJT A;  1L2C A;  4KHP M;  1VEG A;  4MM3 B;  3TWM A;  2VDB B;  1H6U A;  1TH4 A;  3FUX A;  4LRT A;  4WW0 A;  3TPZ A;  4KO8 A;  1E9S A;  3K9O A;  2FH0 A;  2Z8Y M;  1XNR M;  3KS8 A;  3CTW B;  3HHY A;  3U6P A;  1A5T A;  3GLI E;  3FUW A;  5KPR A;  5LMN M;  2I7P A;  4JI5 M;  4DR3 M;  5FTJ A;  3KSX A;  1ZMV A;  2F5P A;  5FTN A;  2H1R A;  2OOB A;  2OQ4 A;  3SAT A;  1N78 A;  4X66 M;  1GL6 A;  4A3V B;  3R9X B;  2K0B X;  2BNK A;  4II7 A;  4BLC A;  4D82 A;  2XSZ A;  3L27 A;  5E26 A;  2JWS A;  3KP1 E;  1SXJ A;  4IBD A;  3GQ5 A;  4FVM A;  3GRR A;  2FOI C;  4PDI A;  2B3T A;  2Z7J A;  1NJG A;  4AKG A;  2D7G A;  2FNA A;  3MHV C;  2N35 A;  4IBF A;  1VDD A;  1TDZ A;  3F92 A;  1IY0 A;  1JQJ C;  5IZ7 D;  4R71 A;  2MH8 A;  2YFQ A;  5C1B A;  2RRU A;  3T1H M;  4L8R C;  2JA2 A;  1C1K A;  1G3I A;  2YR0 A;  1MX0 A;  2KRU A;  2LTU A;  2KNV A;  3GRV A;  4L15 A;  4WUR A;  4LF5 M;  4LF6 M;  2Z4R A;  3EIH A;  3C58 A;  1R6B X;  3NWL A;  4X62 M;  3UK6 A;  3A98 B;  3U6Q A;  4PD2 A;  3U6S A;  4I81 A;  1LV7 A;  1AUA A;  1WGL A;  2WSC F;  2DEN A;  1Y8G A;  5H37 D;  3MJ5 A;  2WSF F;  2DAE A;  1Q3C A;  5KPZ A;  3LCU A;  3AOE C;  4IJE A;  1R4G A;  2QP9 X;  4QNM A;  1VDL A;  3WHK A;  2OOA A;  3GLG B;  2UU9 M;  3I51 A;  1L1T A;  1IY2 A;  1IXR C;  3NBX X;  4LJA A;  3E9S A;  4DV2 M;  2R46 A;  5EJC A;  1NVM A;  1JR3 A;  3C9P A;  4MGK E;  5ITX A;  5F3W A;  1SXJ E;  4WP2 A;  2UXB M;  2OPF A;  4M9X A;  1K3X A;  1Z5C A;  3B7Q A;  1HR0 M;  3FUV A;  5DNY A;  4DV5 M;  4LJ8 A;  3SMP A;  4ANR A;  3T6P A;  2QHO B;  1AIP C;  2UUB M;  4M0D A;  3AV0 A;  3Q8G A;  3FKE A;  5DYI A;  3FYD A;  1OAO C;  3SAR A;  3PVS A;  4MGY E;  4L78 A;  4D81 A;  2UUC M;  4LY6 A;  1MJG M;  4MGH A;  2EO2 A;  4I4L A;  1WJ7 A;  2NQ8 C;  3FRH A;  2VII A;  2C99 A;  4NXN M;  3HHZ A;  2DXI A;  1S3S A;  3RE8 A;  3GP1 A;  1HNX M;  3SMS A;  1TGU A;  1QZE A;  1R2Z A;  1J5E M;  1J09 A;  1NHG C;  2ZTD A;  3GLF A;  1ZAE A;  3WHL A;  3KOY E;  4MGZ E;  1IN5 A;  4PDG A;  3U5Z B;  3HU3 A;  5KPT A;  4GEW A;  5GKN A;  3JAM S;  2XGN A;  1Z59 A;  4AI6 A;  1QYR A;  3DFZ A;  3W67 A;  1HNW M;  3H4J A;  3ZCB B;  3IEC A;  2YNM D;  1IXS B;  4LJ9 A;  2KW0 A;  2LWX A;  2HKJ A;  1V33 A;  2W82 A;  1EIJ A;  2O25 A;  3V76 A;  4NL4 H;  2K6B A;  1QUT A;  1JR3 E;  1D2N A;  2BJW A;  5ITX E;  4TUW A;  2R44 A;  3E4R A;  1DGH B;  2ZTC A;  4AKI A;  1NV8 A;  1V92 A;  4OVZ A;  1OJL A;  1HT2 E;  2JZ0 A;  3GQ4 A;  1NNJ A;  4LJ7 A;  3GRU A;  3C3D A;  3M0E A;  2G5G X;  2Z3X A;  4GC9 A;  2V6Z M;  4GRI A;  1OTR A;  4GIP A;  1XC8 A;  3U6L A;  2DAM A;  1R7R A;  2D7E A;  2KEB A;  3HX3 A;  4DUZ M;  2CE7 A;  2X4A A;  1FNN A;  1HNZ M;  5EP2 A;  3THG A;  3PFI A;  1GJS A;  3VFD A;  4DR5 M;  1HQC A;  1MN3 A;  1DGG A;  3GLF E;  4AW4 A;  3ZQJ A;  5C18 A;  5EQT A;  3W0F A;  2DAI A;  1K82 A;  1PM5 A;  2JY7 A;  2LNH C;  5EXS A;  4JYA M;  5ITR A;  3DOA A;  5FSW A;  2G3Q A;  3Q8X A;  3J27 B;  4R3D A;  5ITT A;  2CV2 A;  2O5R A;  3KXE C;  1E32 A;  1QQW A;  3GLH A;  2AHM A;  1E94 E;  2WSE F;  3QAU A;  3SBJ A;  2V1U A;  3FTC A;  1PJQ A;  3HJ8 A;  3KP0 E;  2F5Q A;  1XXH B;  2ZBK B;  4YY3 M;  3PXG A;  5KQ8 A;  3W68 A;  1NV9 A;  2DHY A;  1WR1 B;  2FE8 A;  4X64 M;  4M9Z A;  1YSY A;  3LCV B;  2P5T A;  2XFT A;  4IBC A;  1HT1 E;  3BBZ A;  2KHH A;  1TH2 A;  3A46 A;  3GQ3 A;  3A45 A;  2HL7 A;  2Y21 A;  4GKK M;  2DKL A;  4G4R A;  4I8O A;  2XZF A;  4RKU F;  2JY8 A;  3AKZ A;  1NY5 A;  1UM8 A;  2CWB A;  2QBY B;  3T1Y M;  2K47 A;  2DVW B;  4P17 A;  3GRY A;  1QZM A;  1I94 M;  4NRW A;  4BB9 A;  1EE8 A;  4AQY M;  4YHH M;  2JNH A;  2C96 A;  1IM2 A;  3J2P B;  1XHB A;  3PNV A;  4GC5 A;  2UXC M;  1XMQ M;  3LVW A;  4LF9 M;  3DZD A;  1JB0 F;  3KDS E;  1IFY A;  4NXM M;  3VK7 A;  4JI7 M;  2QZ4 A;  3LQQ A;  4FD2 A;  4LF4 M;  4DV4 M;  3QYB A;  3GLH E;  1OIP A;  2EUC A;  3I04 M;  5IRE B;  3U61 B;  4GIT A;  2WZJ A;  3GLI B;  2Y0T A;  2M60 A;  1PGY A;  2KRK A;  4UN2 B;  3U60 B;  2DWZ B;  1WGN A;  4CIS A;  2EKK A;  3AFH A;  3SAS A;  4LF7 M;  2G8L A;  2VF7 A;  2BWE A;  2EJS A;  3CGW A;  2A5Y B;  2JY5 A;  4NSO B;  1G71 A;  4AZF A;  4B3M M;  3B74 A;  4IBI A;  2LVA A;  2R4E A;  3HGI A;  5FTK A;  2DAK A;  2VQF M;  2KDL A;  3K1J A;  1PRB A;  4I5S A;  5FTM A;  2F5S A;  1D0M A;  2JY6 B;  3HU1 A;  3FD9 A;  3AL0 C;  2CRU A;  3B7N A;  3VLF B;  4HL4 A;  4X65 M;  4G4O A;  2CFO A;  3M6A A;  2DZN B;  3I4Y A;  3KOX E;  3OTO M;  4GHA A;  3HHX A;  2X49 A;  1E9R A;  4G6Z A;  4IJF A;  1D0K A;  3FTD A;  4K0K M;  2ZAN A;  1Q39 A;  5LMU M;  4LZJ A;  3B9P A;  4IBK A;  1Q02 A;  5E6J A;  2MRO B;  3TQS A;  3J81 S;  4GKJ M;  2LHC A;  2QQ8 A;  2RGH A;  4Z6Y A;  2C98 A;  1KSF X;  3J80 S;  1ZV1 A;  4LJ5 A;  1G8P A;  4M0W A;  2F5N A;  1N32 M;  3CF2 A;  4RF1 A;  2CUZ A;  2J7O A;  2K9D A;  2O01 F;  2R45 A;  4DBG B;  2CEA A;  3FYC A;  4NOO B;  5L8R F;  1N33 M;  4ITQ A;  1G4A E;  3FE3 A;  2L6O A;  2XSZ D;  4DR7 M;  1EFU B;  1SXJ D;  2C9O A;  4LJ6 A;  4DV0 M;  4LGM A;  3AOG A;  1PJI A;  4LG2 A;  1Z6T A;  3CF6 E;  3IG8 A;  2FFJ A;  2KNA A;  2EA0 A;  2KXE A;  1DV0 A;  3AOE A;  4FCV A;  2DNA A;  4LGY A;  1SXJ B;  1W5S A;  4W5W A;  5KQD A;  2ZM6 M;  3C3E A;  4AKH A;  3T15 A;  3ZC7 B;  5ITU A;  1ZQ9 A;  1TDH A;  1YLA A;  3UJN A;  3KFU G;  2DHR A;  2LHG A;  1OFI A;  5EXX A;  1GKI A;  2DWN A;  4B3R M;  4M9S A;  3L26 A;  5ITQ A;  1OQY A;  1NJF A;  2ZAM A;  1OIZ A;  1GJT A;  3BOS A;  2HCB A;  3KVW A;  1XNQ M;  4QOS A;  3IHP A;  4QHT A;  1Z5B A;  1QAO A;  5FLX S;  3GPX A;  2DWM A;  5JI2 E;  4JI6 M;  1ORY B;  3RGP A;  2MGW A;  3T38 A;  2J7N A;  2UXD M;  2ZAO A;  2DWL A;  1DO2 A;  1WIV A;  3GLG A;  3LW5 F;  3HWS A;  4QNR A;  4RNA A;  1ZMW A;  4P16 A;  1JR3 D;  4RF0 A;  4BBA A;  2GNO A;  2L2D A;  2L4F A;  3UZU A;  3TE6 A;  4LZZ A;  3HZJ A;  4MGI E;  2BJV A;  2RKO A;  4AG6 A;  1N34 M;  4DV7 M;  2CP8 A;  3K9P A;  1NY6 A;  4DV6 M;  2R62 A;  2DAG A;  3K8Z A;  2APL A;  4DUY M;  4IBB A;  4XGI A;  1OAI A;  3RGS A;  1P3Q Q;  2RGO A;  3UMM A;  2LBC A;  3K92 A;  1IQP A;  2XZU A;  2L7I A;  3L28 A;  1QAN A;  1HJP A;  1FJG M;  1G59 A;  1VEK A;  3FRI A;  1QVR A;  1L2B A;  3FTE A;  3H4M A;  2L4E A;  5IWA M;  1IXZ A;  3VKH A;  1DGF A;  1QDR A;  2D7H A;  2C5R A;  2DZL A;  3U6M A;  1IBM M;  4JI1 M;  4EIW A;  4DR6 M;  1RU3 A;  3U5Z A;  3K2L A;  2HAK A;  3QYE A;  2KNZ A;  2Z4S A;  5DYG A;  2MR9 A;  3GLF B;  1I4W A;  2M5Z A;  2XH9 A;  1NO1 A;  3VKG A;  4IBJ A;  3LVV A;  4IIW A;  3SHG B;  2LVN C;  2HHH M;  3L25 A;  4QHS A;  4Y28 F;  7CAT A;  4REZ A;  2DZO B;  4B3T M;  4PCZ A;  3D8L A;  3GLG E;  1IXS A;  1L8Q A;  1UFZ A;  3L2A A;  1NNU C;  4B7G A;  1PJJ A;  1GO5 A;  1TR8 A;  4FW9 A;  4G4Q A;  1QAQ A;  4DV1 M;  1LTM A;  3R8F A;  4DR4 M;  4JI0 M;  1PJS A;  4OW0 A;  3RFW A;  4B08 A;  3QWL A;  4B7H A;  1NSF A;  2MJ5 B;  1R2Y A;  1DGH A;  1TF0 B;  4GMQ A;  1HQY E;  2LH0 A;  2Y20 A;  1F4I A;  3M7G A;  1ZMU A;  4G3O A;  3E21 A;  1MU5 A;  2CHV A;  3I4V A;  3LMM A;  5EXP A;  3SC3 A;  3TL4 X;  2CV1 A;  3J7A S;  1VG5 A;  2YQZ A;  3MK6 A;  3GPY A;  1DO0 A;  2QPA A;  4NSR A;  1XMO M;  2LVO C;  4OVZ B;  2F4V M;  3KS4 A;  5BR8 M;  1XWI A;  2JUJ A;  3VDP A;  4HEO A;  2CHG A;  3SFZ A;  2XLJ A;  4L6V 6;  2QSF X;  3ILK A;  1W5T A;  4LFA M;  2R0I A;  1L1Z A;  3EIE A;  2KZU A;  2R65 A;  1KFV A;  2JZ1 A;  1QUS A;  3IG5 A;  3TWK A;  5ITY A;  2GQF A;  1QDT A;  2OO9 A;  4OU7 A;  4FWD A;  8CAT A;  1N36 M;  4KT0 F;  5DFL A;  1VEJ A;  3KOZ E;  3GPU A;  1IN6 A;  3U6O A;  4L16 A;  4FCT A;  2JXN A;  2Y0Q A;  4JN6 A;  2R18 A;  4D80 A;  1GLN A;  3D8B A;  3U6D A;  4B3S M;  3SYK A;  3SYL A;  4QOZ C;  1TH3 A;  3VK8 A;  4LRS A;  3FUT A;  5JI3 E;  1XXH A;  3CF0 A;  1IY1 A;  2KZS A;  4FWH A;  1D0L A;  4FWG A;  3GLH B;  5EP3 A;  3HKP A;  5KO3 A;  4L4U A;  4LFB M;  3TWL A;  1CUK A;  3AJI B;  3MMP A;  3L29 A;  2HWJ A;  2J5Y A;  3KOW E;  2L7H A;  5EP4 A;  2I7N A;  4S12 A;  4MB7 A;  1R5L A;  1KYI A;  3DA1 A;  4MH0 E;  3JR5 A;  3SAW A;  2BWB A;  1QAM A;  1N75 A; 
#chains in the Genus database with same CATH homology
 1YE9 A;  4DR1 M;  3SAU A;  1N77 A;  2QBY A;  4FCW A;  4NRV A;  2Q2E B;  1X37 A;  4GHL A;  4DV3 M;  3LQR A;  1DGB A;  4OX9 M;  4JI3 M;  5EP1 A;  2C9C A;  4HLQ A;  4AG5 A;  3GPP A;  2XF3 A;  5FTL A;  1L2D A;  3HU2 A;  4KOD A;  1IN7 A;  4LCB A;  5A2Q S;  3SAV A;  1K3W A;  5EXT A;  4JI2 M;  1IN8 A;  4B7F A;  1IBK M;  4JI8 M;  3VDU A;  3U61 A;  3U6C A;  3GLI A;  3U60 A;  4LFC M;  4JV5 M;  2ERC A;  3HJS A;  4PT5 A;  2F5O A;  2QEN A;  4LF8 M;  3J7B A;  2V1C A;  3UGJ A;  1GVN A;  3JR4 A;  5IT9 S;  3HHW A;  3FTF A;  1SXJ C;  3PNY A;  3FUU A;  4R7G A;  4KLN A;  1IN4 A;  2KA6 B;  4LJ4 A;  3ZH9 B;  1T3T A;  2CHQ A;  4ZPX A;  3U6E A;  1Q3B A;  2XFS A;  1YUB A;  2R4J A;  4IBE A;  2X8A A;  1WXQ A;  1IBL M;  3KSJ A;  4XBO A;  4CHT B;  3A42 A;  1GL7 A;  1G41 A;  2VQE M;  2CV0 A;  2XEP A;  3HJQ A;  4JXJ A;  4DR2 M;  4JI4 M;  4G4N A;  1OFH A;  2UUA M;  3KW6 A;  2E5L M;  1NHW C;  4IBG A;  2QCU A;  3W0L B;  1Z5A A;  1J7K A;  3NBI A;  3SHF A;  4Z8X A;  4CGY B;  2LXE A;  4GH9 A;  5BPV A;  3GO8 A;  2L09 A;  2OQ4 A;  1L2C A;  4KHP M;  4MM3 B;  3TWM A;  1H6U A;  1TH4 A;  3FUX A;  4LRT A;  4WW0 A;  3TPZ A;  4KO8 A;  1E9S A;  1XNR M;  3KS8 A;  3CTW B;  3HHY A;  3U6P A;  3FUW A;  5KPR A;  5LMN M;  2I7P A;  4JI5 M;  4DR3 M;  5FTJ A;  3KSX A;  2F5P A;  5FTN A;  2H1R A;  3SAT A;  1N78 A;  4X66 M;  1GL6 A;  4A3V B;  3R9X B;  2BNK A;  4II7 A;  4BLC A;  4D82 A;  2XSZ A;  3L27 A;  5E26 A;  3KP1 E;  1SXJ A;  4IBD A;  3GQ5 A;  4FVM A;  3GRR A;  2FOI C;  4PDI A;  2Z7J A;  1NJG A;  4AKG A;  2D7G A;  2FNA A;  3MHV C;  4IBF A;  1VDD A;  1TDZ A;  1IY0 A;  1JQJ C;  5IZ7 D;  2YFQ A;  5C1B A;  3T1H M;  4L8R C;  2JA2 A;  1C1K A;  1G3I A;  2YR0 A;  1MX0 A;  2KRU A;  3GRV A;  4L15 A;  4WUR A;  4LF5 M;  4LF6 M;  2Z4R A;  3EIH A;  3C58 A;  1R6B X;  3NWL A;  4X62 M;  3UK6 A;  3A98 B;  3U6Q A;  4PD2 A;  3U6S A;  4I81 A;  1LV7 A;  5H37 D;  3MJ5 A;  5KPZ A;  1Q3C A;  3AOE C;  4IJE A;  2QP9 X;  3WHK A;  4QNM A;  2UU9 M;  3GLG B;  3I51 A;  1L1T A;  1IY2 A;  1IXR C;  4LJA A;  3E9S A;  4DV2 M;  2R46 A;  5EJC A;  1NVM A;  1JR3 A;  4MGK E;  5ITX A;  5F3W A;  1SXJ E;  2UXB M;  2OPF A;  4M9X A;  1K3X A;  1Z5C A;  1HR0 M;  3FUV A;  5DNY A;  4DV5 M;  4LJ8 A;  3SMP A;  2UUB M;  4M0D A;  3AV0 A;  3FKE A;  5DYI A;  3FYD A;  3SAR A;  3PVS A;  4MGY E;  4L78 A;  4D81 A;  2UUC M;  4LY6 A;  4MGH A;  2EO2 A;  4I4L A;  2NQ8 C;  3HHZ A;  2VII A;  2C99 A;  4NXN M;  2DXI A;  1S3S A;  3RE8 A;  3GP1 A;  1HNX M;  3SMS A;  1TGU A;  1R2Z A;  1J5E M;  1J09 A;  1NHG C;  3GLF A;  1ZAE A;  3WHL A;  3KOY E;  4MGZ E;  1IN5 A;  4PDG A;  3U5Z B;  3HU3 A;  5KPT A;  5GKN A;  3JAM S;  2XGN A;  1Z59 A;  4AI6 A;  1QYR A;  3DFZ A;  1HNW M;  3ZCB B;  2YNM D;  1IXS B;  4LJ9 A;  2KW0 A;  2LWX A;  2HKJ A;  2W82 A;  4NL4 H;  1D2N A;  2BJW A;  5ITX E;  4TUW A;  3E4R A;  1DGH B;  4AKI A;  4OVZ A;  1OJL A;  1HT2 E;  3GQ4 A;  1NNJ A;  4LJ7 A;  3GRU A;  3M0E A;  2G5G X;  2Z3X A;  4GC9 A;  2V6Z M;  4GRI A;  4GIP A;  1XC8 A;  3U6L A;  1R7R A;  2D7E A;  2KEB A;  4DUZ M;  2CE7 A;  2X4A A;  1FNN A;  1HNZ M;  5EP2 A;  3THG A;  3PFI A;  3VFD A;  4DR5 M;  1HQC A;  1DGG A;  4AW4 A;  5C18 A;  5EQT A;  3W0F A;  1K82 A;  1PM5 A;  2LNH C;  5EXS A;  4JYA M;  5ITR A;  3DOA A;  5FSW A;  3Q8X A;  3J27 B;  4R3D A;  5ITT A;  2CV2 A;  2O5R A;  3KXE C;  1QQW A;  1E32 A;  3GLH A;  2AHM A;  1E94 E;  3QAU A;  3SBJ A;  2V1U A;  3FTC A;  3HJ8 A;  3KP0 E;  2F5Q A;  1XXH B;  2ZBK B;  4YY3 M;  3PXG A;  5KQ8 A;  2FE8 A;  4X64 M;  4M9Z A;  1YSY A;  2P5T A;  2XFT A;  4IBC A;  1HT1 E;  1TH2 A;  3A46 A;  3GQ3 A;  3A45 A;  2HL7 A;  2Y21 A;  4GKK M;  4G4R A;  4I8O A;  2XZF A;  3AKZ A;  1NY5 A;  1UM8 A;  2QBY B;  3T1Y M;  2K47 A;  2DVW B;  3GRY A;  1QZM A;  1I94 M;  4NRW A;  4BB9 A;  1EE8 A;  4AQY M;  4YHH M;  2C96 A;  1IM2 A;  3J2P B;  1XHB A;  3PNV A;  4GC5 A;  2UXC M;  1XMQ M;  3LVW A;  4LF9 M;  3DZD A;  3KDS E;  4NXM M;  3VK7 A;  4JI7 M;  2QZ4 A;  3LQQ A;  4FD2 A;  4LF4 M;  4DV4 M;  2EUC A;  5IRE B;  3U61 B;  4GIT A;  3GLI B;  2Y0T A;  2M60 A;  2KRK A;  3U60 B;  2DWZ B;  4CIS A;  3AFH A;  3SAS A;  4LF7 M;  2G8L A;  2A5Y B;  4NSO B;  4AZF A;  4B3M M;  4IBI A;  2R4E A;  3HGI A;  5FTK A;  2VQF M;  3K1J A;  4I5S A;  5FTM A;  2F5S A;  3HU1 A;  3FD9 A;  3AL0 C;  3VLF B;  4HL4 A;  4X65 M;  4G4O A;  2CFO A;  3M6A A;  2DZN B;  3I4Y A;  3KOX E;  3OTO M;  4GHA A;  3HHX A;  2X49 A;  1E9R A;  4G6Z A;  4IJF A;  3FTD A;  4K0K M;  2ZAN A;  1Q39 A;  5LMU M;  4LZJ A;  3B9P A;  4IBK A;  5E6J A;  3TQS A;  3J81 S;  4GKJ M;  2RGH A;  4Z6Y A;  2C98 A;  1KSF X;  3J80 S;  4LJ5 A;  1G8P A;  4M0W A;  2F5N A;  1N32 M;  3CF2 A;  4RF1 A;  2CUZ A;  2J7O A;  2R45 A;  2CEA A;  3FYC A;  4NOO B;  1N33 M;  4ITQ A;  1G4A E;  2L6O A;  2XSZ D;  4DR7 M;  1SXJ D;  2C9O A;  4LJ6 A;  4DV0 M;  4LGM A;  3AOG A;  1PJI A;  4LG2 A;  1Z6T A;  3CF6 E;  3IG8 A;  2FFJ A;  2EA0 A;  2KXE A;  3AOE A;  4FCV A;  4LGY A;  4W5W A;  1SXJ B;  1W5S A;  5KQD A;  2ZM6 M;  4AKH A;  3T15 A;  3ZC7 B;  5ITU A;  1ZQ9 A;  1TDH A;  3UJN A;  3KFU G;  2DHR A;  1OFI A;  5EXX A;  1GKI A;  2DWN A;  4B3R M;  4M9S A;  3L26 A;  5ITQ A;  1NJF A;  2ZAM A;  3BOS A;  2HCB A;  3KVW A;  1XNQ M;  4QOS A;  4QHT A;  1Z5B A;  1QAO A;  5FLX S;  3GPX A;  2DWM A;  5JI2 E;  4JI6 M;  1ORY B;  3RGP A;  3T38 A;  2J7N A;  2UXD M;  2ZAO A;  2DWL A;  1DO2 A;  3GLG A;  3HWS A;  4QNR A;  4RNA A;  4P16 A;  1JR3 D;  4RF0 A;  4BBA A;  3UZU A;  3TE6 A;  4LZZ A;  4AG6 A;  4MGI E;  2BJV A;  2RKO A;  1N34 M;  4DV7 M;  1NY6 A;  4DV6 M;  2R62 A;  3K8Z A;  4DUY M;  4IBB A;  4XGI A;  3RGS A;  2RGO A;  3UMM A;  3K92 A;  1IQP A;  2XZU A;  2L7I A;  3L28 A;  1QAN A;  1FJG M;  1G59 A;  3FTE A;  1QVR A;  1L2B A;  3H4M A;  5IWA M;  1IXZ A;  3VKH A;  1DGF A;  2D7H A;  2C5R A;  1IBM M;  3U6M A;  4JI1 M;  4EIW A;  4DR6 M;  3U5Z A;  3K2L A;  2Z4S A;  5DYG A;  3GLF B;  1I4W A;  2M5Z A;  2XH9 A;  3VKG A;  4IBJ A;  3LVV A;  4IIW A;  3SHG B;  2HHH M;  3L25 A;  4QHS A;  4B3T M;  7CAT A;  4REZ A;  2DZO B;  4PCZ A;  3D8L A;  1L8Q A;  3L2A A;  1NNU C;  4B7G A;  1PJJ A;  4FW9 A;  4G4Q A;  1QAQ A;  4DV1 M;  3R8F A;  4DR4 M;  4JI0 M;  4OW0 A;  3RFW A;  4B08 A;  3QWL A;  4B7H A;  1NSF A;  1R2Y A;  1DGH A;  4GMQ A;  1HQY E;  2LH0 A;  2Y20 A;  3M7G A;  3SC3 A;  3I4V A;  1MU5 A;  2CHV A;  3LMM A;  3TL4 X;  5EXP A;  3J7A S;  2CV1 A;  2YQZ A;  3MK6 A;  3GPY A;  1DO0 A;  2QPA A;  4NSR A;  1XMO M;  4OVZ B;  2F4V M;  3KS4 A;  5BR8 M;  1XWI A;  3VDP A;  2CHG A;  3SFZ A;  2XLJ A;  3ILK A;  1W5T A;  4LFA M;  1L1Z A;  3EIE A;  2KZU A;  2R65 A;  1KFV A;  3IG5 A;  3TWK A;  5ITY A;  4OU7 A;  4FWD A;  8CAT A;  1N36 M;  3GPU A;  3KOZ E;  3U6O A;  1IN6 A;  4L16 A;  4FCT A;  2Y0Q A;  4JN6 A;  2R18 A;  4D80 A;  1GLN A;  3D8B A;  3U6D A;  4B3S M;  3SYK A;  3SYL A;  4QOZ C;  1TH3 A;  3VK8 A;  4LRS A;  3FUT A;  5JI3 E;  1XXH A;  3CF0 A;  1IY1 A;  2KZS A;  4FWH A;  4FWG A;  5EP3 A;  3GLH B;  5KO3 A;  3HKP A;  4L4U A;  4LFB M;  3TWL A;  3AJI B;  3L29 A;  3KOW E;  2L7H A;  5EP4 A;  2I7N A;  4S12 A;  4MB7 A;  1KYI A;  3DA1 A;  4MH0 E;  3JR5 A;  3SAW A;  1QAM A;  1N75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...