4B3SM

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3sM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3sM02
1MX0A 3VK8A 3DOAA 4DV4M 1L2BA 3SAWA 3GPXA 1K3XA 4JI6M 4JI2M 1L1ZA 4JI5M 2VQEM 2E5LM 4GKKM 4JI7M 4JI3M 1TDZA 4LFCM 2F5QA 2OQ4A 3J7AS 4DR4M 4JYAM 2UUBM 1TDHA 2F5SA 4AQYM 4YY3M 1EE8A 4PD2A 1K82A 3U6DA 1L2CA 1Z59A 5ITTA 4DV1M 1PM5A 1IBKM 1N32M 2VQFM 1N33M 3U6EA 2OPFA 4LFAM 4OX9M 5ITYA 4B3RM 3SBJA 4G4NA 1IBLM 5FLXS 3W0FA 4JI4M 1L2DA 5BR8M 3GPYA 2UUAM 4G4QA 1I94M 4DUZM 4LF4M 2XZFA 4DR5M 2UUCM 4LF8M 4JI1M 3GPPA 3GPUA 3T1HM 1R2ZA 2HHHM 1XC8A 3GQ4A 4DR7M 1L1TA 5ITQA 2F4VM 4B3SM 4NXMM 4PCZA 1Z5CA 3JR4A 3SAVA 4G4RA 1PJIA 3C58A 3U6PA 1Q39A 1PJJA 1HNWM 2UU9M 3GQ3A 3JAMS 1XNQM 4LF6M 4PDGA 2F5PA 4KHPM 3GO8A 4DUYM 4DV6M 5LMUM 4NRVA 3TWKA 2UXBM 3A46A 5A2QS 3GQ5A 4X66M 4DV0M 4JI0M 1HNXM 3U6OA 2F5NA 4X65M 4JI8M 1R2YA 3U6LA 4PDIA 4B3TM 4DR1M 4LF7M 4LF5M 4X64M 1Q3BA 1XMQM 3A45A 1XMOM 1Z5BA 2UXCM 1KFVA 3SAUA 1HNZM 5LMNM 3U6SA 4NRWA 4DV5M 4GKJM 1Q3CA 1Z5AA 1MU5A 1XNRM 1J5EM 4B3MM 5IT9S 4G4OA 3SARA 2HKJA 5ITXE 4DR2M 3VK7A 3J81S 1HR0M 4X62M 4ITQA 3U6CA 3T1YM 4YHHM 1FJGM 5IWAM 2ZM6M 2ZBKB 3J80S 4DV3M 5ITXA 5ITRA 3TWLA 1N36M 4DR3M 3U6MA 4LFBM 4JV5M 1IBMM 1NNJA 2UXDM 4CISA 3A42A 3GP1A 4DV7M 3TWMA 4NXNM 1N34M 3SASA 4DR6M 3SATA 3U6QA 1K3WA 3JR5A 4K0KM 5ITUA 2Q2EB 2XZUA 4LF9M 2EA0A 4MB7A 3OTOM 2F5OA 4DV2M
chains in the Genus database with same CATH superfamily
1MX0A 1TH4A 2J7OA 3FKEA 4HL4A 4REZA 1DGHA 1TF0B 4LJ7A 2BJVA 3FUTA 3VK8A 3VKHA 1QUTA 2DKLA 3K1JA 4MGKE 2EJSA 3FUUA 1ZAEA 3I4VA 3VFDA 4W5WA 4LFCM 1GLNA 4L78A 2F5QA 4L8RC 1QYRA 3J7AS 4JYAM 2UUBM 2JZ0A 3J2PB 5KPRA 4RKUF 2F5SA 3GLGA 4AQYM 1TH2A 1EE8A 1L2CA 1G8PA 1Z59A 1R4GA 2JA2A 4MH0E 3U60B 4GMQA 3UMMA 3AL0C 1IBKM 4M9XA 1WJ7A 2LXEA 2VQFM 2ZTCA 5EXXA 3GRRA 1NJGA 3CTWB 3BBZA 4B3RM 2C98A 2KDLA 4G6ZA 3WHLA 1ZQ9A 2VDBB 4QHSA 4G4QA 2HAKA 1IY1A 2JXNA 2OO9A 2CHQA 4DR5M 3HHZA 4LJ9A 3AOGA 4IBEA 2QBYA 4LF8M 2LHCA 1OQYA 3TQSA 1F4IA 3GPUA 1IM2A 4OW0A 3PVSA 4GC9A 4LZJA 1R2ZA 3KP0E 3TL4X 4DR7M 3SYKA 3QYBA 4IJFA 5FTNA 3U5ZB 1L1TA 4L4UA 2DI0A 2JNHA 4FVMA 4B3SM 3AOEA 4QOZC 1VEKA 4KO8A 3U6PA 4AW4A 1PJJA 1HNWM 1HT2E 4HLQA 4F1IA 1DGFA 1IN6A 2V6ZM 1LTMA 3E21A 3FUXA 1AIPC 1LV7A 3L2AA 3HJQA 4B7GA 2DHYA 4KHPM 4LY6A 4G3OA 4NL4H 3GO8A 5H37D 3A46A 3T38A 3W68A 3GQ5A 4JI0M 1SXJB 2L2DA 3LCUA 4UN2B 1NHWC 4I4LA 4X65M 1NJFA 1J09A 1D2NA 4PDIA 2DNAA 3BXWA 3KXEC 4X64M 1E32A 1Q3BA 4GHLA 1G3IA 1NVMA 2KXEA 3B7NA 3KVWA 3MHVC 1N77A 2UXCM 2L7HA 1L8QA 1D0LA 1T6OA 2H5XA 4X62M 2M60A 5FSWA 3SYLA 1WHCA 2WZJA 1V34A 2DXIA 1VG5A 4IBKA 1NO1A 1OAOC 1WGNA 5KPTA 2XFTA 3HKPA 4I81A 2CFOA 2D7HA 1JR3E 2FOIC 2HWJA 1TR8A 3IG8A 3L27A 4FCWA 4R71A 4ITQA 1E9SA 1OFIA 3KOZE 3TE6A 2MH8A 2XF3A 3AJIB 4IJEA 2EO2A 4QNMA 2ZBKB 3H4MA 4AG6A 1XXHA 2J5YA 2L4FA 4JN6A 3RFWA 1N36M 3W0LB 1RU3A 4JV5M 1IBMM 1D0KA 2JZ1A 2DAEA 4KT0F 3I01M 1IXSB 1BVSA 1G71A 1OAIA 2Z8YM 4ZPXA 5DYGA 2RRUA 4NXNM 3SASA 3KS8A 4DR6M 8CATA 1DV0A 1IY0A 5EXSA 1K3WA 1DGGA 4WURA 1SXJE 3JR5A 5ITUA 2XZUA 3UGJA 2DWLA 1IN5A 1Q02A 3HGIA 2H1RA 4FW9A 2A5YB 2O5RA 4LGMA 1HQYE 3KSJA 4R3DA 3PXGA 1K3XA 3GPXA 1V92A 4FWGA 4QOSA 5EP3A 2JY8A 2QCUA 3C3EA 3HU3A 3QWLA 2E5LM 3L25A 2XLJA 3AOEC 1NHGC 1EFUB 3HU2A 4JI3M 2KEBA 2OQ4A 2Z4RA 2LVOC 1TDHA 1QVRA 1PM5A 1N33M 3I04M 3U6EA 2OPFA 2KRUA 4AKIA 1ZMUA 5KO3A 4G4NA 4JI4M 4MGZE 2R46A 1L2DA 3GPYA 3FRIA 3LVWA 3VKGA 1I94M 2Y21A 4IBGA 4CJ6A 1PJSA 2FNAA 3UJNA 1X37A 2R44A 3FUVA 3GLHA 1DO0A 3GRUA 1N75A 1DGHB 4IBFA 4QHTA 3UZUA 5FTLA 1DGBA 1GKIA 3T1HM 1W5TA 4GRIA 5KPZA 1IQPA 5EQTA 2HHHM 1XC8A 3GQ3A 2Y0QA 3W67A 1QQWA 3SHGB 4MGHA 3GRYA 1IXRC 3K9OA 3M7GA 4EIWA 3JR4A 5DFLA 2VF8A 4IBCA 3R9XB 3GLGB 1QAQA 4XK8F 3C9PA 2J7NA 3M0EA 5EJCA 2O01F 2I7PA 4LF6M 4PDGA 1XNQM 3HHWA 2QSFX 1KYIA 2OOAA 2D7GA 3DFZA 3IECA 2UXBM 4DV6M 1YUBA 2BWBA 4FD2A 4S12A 5DNYA 2ZAMA 1HNXM 2XEPA 4L6V6 1YE9A 2QBYB 3PFIA 4B3TM 2OOBA 4DR1M 1Z6TA 2X49A 3FTCA 2LHGA 4LGYA 2KZUA 2KHHA 3IHPA 4LF5M 4D82A 2DHRA 1XMOM 4Z6YA 2XFSA 1QUSA 1FNNA 2DAKA 2G5GX 1HNZM 4NRWA 3ZC7B 3FTDA 4XGIA 1T43A 1Z5AA 3EIEA 1UFZA 1VQ1A 2KNAA 3FUWA 5E26A 3THGA 4DBGB 1P3QQ 2R18A 3GLIA 4B3MM 1XNRM 3SARA 1UM8A 2WSCF 2APLA 2QZ4A 4GITA 2KW0A 1YSYA 1VEGA 1IY2A 1QZEA 2Z3XA 2ZANA 1TGUA 2XGNA 4M9ZA 2EKFA 2ZM6M 1WR1B 1IFYA 5DYIA 3E9SA 3J80S 2CV0A 2D7EA 3FE3A 1WGLA 3HX3A 2CUZA 1HJPA 3Q8GA 2KNVA 4CISA 1GJTA 2BNKA 1PRBA 1HQCA 1JB0F 2R62A 3WHKA 2JP7A 2QHOB 3U6QA 2XH9A 4K0KM 2JUJA 2R65A 3L28A 3FRHA 2DENA 3L29A 5JI3E 3GLFB 4KLNA 2LTUA 3HU1A 2JY6B 3A98B 4MB7A 4AKGA 4Y28F 1SXJA 1GL6A 2DZNB 3K8ZA 3DOAA 4DV4M 1IN4A 2C9OA 4WW0A 4JI6M 2DWNA 2N35A 4D80A 5JI2E 1L1ZA 3PNVA 4NSRA 3OTOM 1G41A 1QDTA 1E9RA 1WIVA 1W5SA 2DWZB 1EIJA 1XXHB 3UK6A 4DR4M 5FTKA 2GNOA 2CV2A 2K9DA 5KQ8A 3K9PA 4B08A 2FE8A 2JWSA 3FD9A 4PD2A 3U6DA 2XSZD 2C99A 2XSZA 4DV1M 1N32M 2R0IA 5L8RF 4CIZA 1OIPA 4IIWA 4OVZA 5ITYA 4OX9M 3LMMA 4L15A 3LCVB 1IBLM 2CHVA 3W0FA 5FLXS 3SMPA 2ZTDA 4CGYB 3VDPA 2VF7A 5BR8M 2UUAM 4FCTA 1H6UA 3B7QA 1GJSA 2L7IA 2UUCM 2BWEA 4IBDA 3GPPA 1A5TA 3AKZA 2V1UA 1QDRA 4LRTA 4GIPA 3GLFE 3T6PA 2LWXA 3U61A 3MJ5A 3GQ4A 2F4VM 2CEAA 2ZAOA 3KSXA 2P5TA 4NXMM 4AKHA 3KFUG 2CE7A 3D8LA 2R4JA 2KRKA 3VLFB 1KSFX 1OIZA 4LRSA 4A3VB 3SAVA 3SC3A 4IBBA 1D0MA 1Q39A 3LVVA 5EP2A 2HCBA 3DZDA 3QAUA 4LJ6A 4P16A 4AG5A 3KOXE 4HEOA 3Q8XA 3K2LA 1SG9A 2WSEF 4GC5A 4I5SA 2LBCA 4QNRA 1XXHE 4B7FA 4M0DA 2F5PA 1N78A 1V33A 3K92A 1TTEA 4MM3B 1I4WA 4DUYM 1XWIA 5LMUM 4NRVA 3TWKA 4P17A 5C18A 4ANRA 5IREB 4X66M 4DV0M 2L6OA 2ERCA 2YFQA 3SHFA 3GLHB 4D81A 3GRVA 3B7ZA 1R2YA 3U6LA 4LF7M 3HY5A 2LVAA 1NSFA 2MJ5B 4M9SA 4RF0A 1XMQM 1CUKA 1HT1E 2QQ8A 1IXZA 1KFVA 4TUWA 1NY5A 2K0BX 1VDLA 1SXJC 4GKJM 3FTEA 3ZCBB 3SFZA 3KOYE 5F3WA 3VDUA 3LQRA 1ZMVA 4LCBA 2DZOB 5ITXE 4DR2M 3SMSA 3VK7A 2LH0A 3J81S 3B74A 2EUCA 1HR0M 3U6CA 1S3SA 3T1YM 2L4EA 2V1CA 1AUAA 1OFHA 2M5ZA 1VDDA 2DAGA 2LVNC 2FH0A 3EIHA 4DV3M 3CF6E 5EP1A 2YQZA 5ITRA 3U6MA 4LFBM 4NOOB 2CRUA 4AZFA 1NNJA 2UXDM 3CGWA 3KDSE 2O25A 3A42A 4F2LA 3L26A 3TWMA 3HWSA 2YNMD 2Y0TA 3U60A 3HHXA 3MK6A 3SATA 1NNUC 4XBOA 2R4EA 4IBJA 1QZMA 4BB9A 2RKOA 1MJGM 1YLAA 2Q2EB 3GLHE 3I4YA 4Z8XA 3RE8A 7CATA 3J27B 2G8LA 4BBAA 1JQJC 2QPAA 5FTMA 2EA0A 3GLIB 2QENA 2F5OA 4DV2M 2JY7A 2G3QA 2AHMA 2Y20A 2Z7JA 3I51A 4BLCA 1L2BA 3SAWA 4JI2M 5FTJA 1QANA 3FYCA 2X8AA 3GLGE 3PNYA 4JI5M 3ZQJA 1OKSA 2VQEM 4OU7A 4GKKM 2FFJA 4PT5A 5IZ7D 4JI7M 1TDZA 2DZLA 2CP8A 1XHBA 1JR3D 4M0WA 4GH9A 1JR3A 3F92A 4RNAA 1GL7A 4YY3M 2DAMA 2KNZA 1K82A 2JY5A 5ITTA 2YR0A 3NWLA 2QNJA 4I8OA 3H4JA 4LJAA 2NQ8C 4LFAM 2FS1A 3SBJA 2R45A 2WSFF 3FYDA 4Q7JA 1E94E 3C3DA 5EXPA 2K47A 4DUZM 4LJ8A 4LF4M 1SXJD 4WP2A 2XZFA 5KQDA 2HL7A 4II7A 4JI1M 3HJSA 2EKKA 3R8FA 3BOSA 1GO5A 3QYEA 4LG2A 5BPVA 1GABA 2I7NA 1T3TA 2MR9A 2R6FA 3B89A 3KP1E 5ITQA 2L09A 3TPZA 3GLIE 3J7BA 1VEJA 2C96A 3E4RA 1NV8A 4PCZA 1Z5CA 4IBIA 3KS4A 1ZMWA 2CHGA 3KW6A 4G4RA 3C58A 2C5RA 1PJIA 3DA1A 1PGYA 3GLFA 1C7YA 4MGYE 4AI6A 2UU9M 2Z4SA 4RF1A 2DVWB 2GQFA 3LQQA 3JAMS 4OVZB 1G59A 1WXQA 4L16A 2W82A 3E46A 4CHTB 3B9PA 4GHAA 3KOWE 1J7KA 2LVPC 1Y8GA 5A2QS 3MMPA 1TH3A 2MGWA 4B7HA 3U6OA 2F5NA 3ILKA 3HHYA 2LNHC 4JI8M 5C1BA 3NBXX 2QP9X 1OJLA 1IXSA 1NV9A 3AV0A 3RGSA 3U61B 3NBIA 4JXJA 1XB2B 3A45A 1Z5BA 1QAMA 2X4AA 3SAUA 1DO2A 5LMNM 3U6SA 5EXTA 1MN3A 2B3TA 2DAIA 4DV5M 1Q3CA 1PJTA 4FWHA 1MU5A 1QAOA 4NSOB 1J5EM 2VIIA 5IT9S 1IN7A 3M6AA 2K6BA 4G4OA 4LZZA 2DWMA 1IN8A 2HKJA 1R5LA 3CF2A 1G4AE 1OTRA 1R7RA 3HZJA 2MROB 2CV1A 3FTFA 1C1KA 1R6BX 3LW5F 4YHHM 1FJGM 2RGHA 5IWAM 5ITXA 1ZV1A 1NY6A 3RGPA 3TWLA 3D8BA 4MGIE 4DR3M 4FCVA 2BJWA 3CF0A 1PJQA 5EP4A 4NC6A 2RGOA 1GVNA 4LJ4A 3GP1A 4DV7M 1N34M 3AFHA 2LVQD 5E6JA 2CWBA 2KA6B 5GKNA 3T15A 3U5ZA 4KODA 3IG5A 3HJ8A 3V76A 4GEWA 4LJ5A 4LF9M 2KZSA 2C9CA 3ZH9B 4R7GA 1ORYB 4FWDA
chains in the Genus database with same CATH topology
1MX0A 1TH4A 2J7OA 3FKEA 4HL4A 4REZA 1DGHA 3VK8A 4LJ7A 2BJVA 3FUTA 3VKHA 3K1JA 4MGKE 3FUUA 1ZAEA 3I4VA 3VFDA 4W5WA 4LFCM 1GLNA 4L78A 2F5QA 4L8RC 1QYRA 3J7AS 4JYAM 2UUBM 3J2PB 5KPRA 2F5SA 3GLGA 4AQYM 1TH2A 1EE8A 1L2CA 1G8PA 1Z59A 2JA2A 4MH0E 3U60B 3AL0C 4GMQA 3UMMA 1IBKM 4M9XA 2LXEA 2VQFM 5EXXA 3GRRA 1NJGA 3CTWB 4B3RM 2C98A 4G6ZA 3WHLA 1ZQ9A 4QHSA 4G4QA 1IY1A 2CHQA 4DR5M 3HHZA 4LJ9A 3AOGA 4IBEA 2QBYA 4LF8M 3TQSA 3GPUA 1IM2A 4OW0A 3PVSA 4GC9A 4LZJA 1R2ZA 3KP0E 3TL4X 4DR7M 3SYKA 5FTNA 4IJFA 1L1TA 4L4UA 4FVMA 4B3SM 3AOEA 4QOZC 4KO8A 3U6PA 4AW4A 1PJJA 1HNWM 1HT2E 4HLQA 1ORYB 1DGFA 1IN6A 2V6ZM 3FUXA 1LV7A 3L2AA 3HJQA 4B7GA 4KHPM 4LY6A 3GO8A 4NL4H 5H37D 3A46A 3T38A 3GQ5A 4JI0M 1SXJB 1NHWC 4I4LA 4X65M 1NJFA 1J09A 1D2NA 4PDIA 3KXEC 4X64M 1E32A 1Q3BA 4GHLA 1G3IA 1NVMA 2KXEA 3KVWA 3MHVC 1N77A 2UXCM 2L7HA 1L8QA 2M60A 5FSWA 3SYLA 2DXIA 4IBKA 5KPTA 3HKPA 2XFTA 4I81A 2CFOA 2D7HA 2FOIC 3IG8A 3L27A 4FCWA 4X62M 4ITQA 1E9SA 1OFIA 3KOZE 3TE6A 2XF3A 3AJIB 4IJEA 2EO2A 4QNMA 2ZBKB 3H4MA 4AG6A 1XXHA 4JN6A 3RFWA 1N36M 3W0LB 4JV5M 1IBMM 1IXSB 4ZPXA 5DYGA 3KS8A 3SASA 4NXNM 4DR6M 8CATA 1IY0A 5EXSA 1K3WA 1DGGA 4WURA 1SXJE 3JR5A 5ITUA 2XZUA 3UGJA 2DWLA 1IN5A 3HGIA 4FW9A 2H1RA 2A5YB 2O5RA 4LGMA 1HQYE 3KSJA 4R3DA 3PXGA 1K3XA 3GPXA 4FWGA 4QOSA 5EP3A 2QCUA 3HU3A 3QWLA 2E5LM 3L25A 2XLJA 3AOEC 1NHGC 3HU2A 4JI3M 2KEBA 2OQ4A 2Z4RA 1TDHA 1QVRA 1PM5A 1N33M 3U6EA 2OPFA 2KRUA 4AKIA 5KO3A 4G4NA 4JI4M 4MGZE 2R46A 1L2DA 3GPYA 3LVWA 3VKGA 1I94M 2Y21A 4IBGA 2FNAA 3UJNA 1X37A 3FUVA 3GLHA 1DO0A 3GRUA 1N75A 1DGHB 4IBFA 4QHTA 3UZUA 5FTLA 1DGBA 1GKIA 3T1HM 1W5TA 4GRIA 5KPZA 1IQPA 5EQTA 2HHHM 1XC8A 2Y0QA 1QQWA 3SHGB 4MGHA 3GRYA 1IXRC 3M7GA 4EIWA 3JR4A 4IBCA 3R9XB 3GLGB 1QAQA 2J7NA 3M0EA 5EJCA 2I7PA 4LF6M 4PDGA 1XNQM 3HHWA 1KYIA 2D7GA 3DFZA 2UXBM 4DV6M 1YUBA 4FD2A 4S12A 5DNYA 2ZAMA 1HNXM 2XEPA 1YE9A 2QBYB 3PFIA 4B3TM 4DR1M 1Z6TA 2X49A 3FTCA 4LGYA 2KZUA 4LF5M 4D82A 2DHRA 1XMOM 4Z6YA 2XFSA 1FNNA 2G5GX 1HNZM 4NRWA 3ZC7B 3FTDA 4XGIA 1Z5AA 3EIEA 3FUWA 3THGA 5E26A 1XNRM 3GLIA 2R18A 4B3MM 3SARA 1UM8A 2QZ4A 4GITA 2KW0A 1YSYA 1IY2A 2Z3XA 2ZANA 1TGUA 2XGNA 4M9ZA 2ZM6M 5DYIA 3E9SA 3J80S 2CV0A 2D7EA 2CUZA 4CISA 2BNKA 1HQCA 2R62A 3WHKA 3U6QA 2XH9A 4K0KM 2R65A 3L28A 3L29A 5JI3E 3GLFB 4KLNA 3HU1A 3A98B 4MB7A 4AKGA 1SXJA 1GL6A 2DZNB 3K8ZA 3DOAA 4DV4M 1IN4A 2C9OA 4WW0A 4JI6M 2DWNA 4D80A 5JI2E 1L1ZA 3PNVA 4NSRA 3OTOM 1G41A 1E9RA 1W5SA 2DWZB 1XXHB 3UK6A 4DR4M 5FTKA 2CV2A 5KQ8A 4B08A 2FE8A 3FD9A 4PD2A 3U6DA 2XSZD 2C99A 2XSZA 4DV1M 1N32M 4IIWA 4OVZA 4OX9M 5ITYA 3LMMA 4L15A 1IBLM 2CHVA 3W0FA 5FLXS 3SMPA 4CGYB 5BR8M 3VDPA 2UUAM 4FCTA 1H6UA 2L7IA 2UUCM 4IBDA 3GPPA 3AKZA 2V1UA 4LRTA 4GIPA 2LWXA 3U61A 3MJ5A 3GQ4A 2F4VM 2CEAA 2ZAOA 3KSXA 2P5TA 4NXMM 4AKHA 3KFUG 2CE7A 3D8LA 2R4JA 2KRKA 3VLFB 1KSFX 4A3VB 4LRSA 3SAVA 3SC3A 4IBBA 1Q39A 3LVVA 5EP2A 2HCBA 3DZDA 3QAUA 4LJ6A 4P16A 4AG5A 3KOXE 4QNRA 3Q8XA 3K2LA 4GC5A 3GQ3A 4I5SA 3U5ZB 4B7FA 2F5PA 4M0DA 1N78A 4MM3B 3K92A 1I4WA 4DUYM 1XWIA 5LMUM 4NRVA 3TWKA 5C18A 5IREB 4X66M 4DV0M 2L6OA 2ERCA 2YFQA 3SHFA 3GLHB 4D81A 3GRVA 1R2YA 3U6LA 4LF7M 1NSFA 4M9SA 4RF0A 1XMQM 1HT1E 1IXZA 1KFVA 4TUWA 1NY5A 4GKJM 1SXJC 3FTEA 3ZCBB 3SFZA 3KOYE 5F3WA 3VDUA 3LQRA 4LCBA 2DZOB 5ITXE 4DR2M 3SMSA 3VK7A 2LH0A 3J81S 1HR0M 2EUCA 3U6CA 1S3SA 3T1YM 2V1CA 1OFHA 2M5ZA 1VDDA 3EIHA 4DV3M 3CF6E 5EP1A 2YQZA 5ITRA 3U6MA 4LFBM 4NOOB 4AZFA 1NNJA 2UXDM 3KDSE 3A42A 3U60A 3L26A 3TWMA 3HWSA 2YNMD 2Y0TA 3HHXA 3MK6A 3SATA 1NNUC 4XBOA 2R4EA 4IBJA 1QZMA 4BB9A 2RKOA 3RE8A 3I4YA 7CATA 4Z8XA 3J27B 2G8LA 4BBAA 1JQJC 2QPAA 5FTMA 2EA0A 3GLIB 2QENA 2F5OA 4DV2M 2AHMA 2Y20A 2Z7JA 3I51A 4BLCA 1L2BA 3SAWA 4JI2M 5FTJA 1QANA 3FYCA 2X8AA 3PNYA 4JI5M 2VQEM 4OU7A 4GKKM 2FFJA 4PT5A 5IZ7D 4JI7M 1TDZA 1XHBA 1JR3D 4M0WA 4GH9A 1JR3A 4RNAA 1GL7A 4YY3M 1K82A 5ITTA 2YR0A 3NWLA 4I8OA 4LFAM 4LJAA 2NQ8C 3SBJA 2R45A 3FYDA 1E94E 5EXPA 2K47A 4DUZM 4LJ8A 4LF4M 1SXJD 2XZFA 5KQDA 2HL7A 4II7A 4JI1M 3HJSA 3R8FA 3BOSA 4LG2A 5BPVA 2I7NA 1T3TA 3KP1E 5ITQA 2L09A 3TPZA 3J7BA 2C96A 3E4RA 4PCZA 1Z5CA 4IBIA 3KS4A 2CHGA 3KW6A 4G4RA 3C58A 2C5RA 1PJIA 3DA1A 4AI6A 3GLFA 4MGYE 2UU9M 2Z4SA 4RF1A 2DVWB 3LQQA 3JAMS 4OVZB 1G59A 1WXQA 4L16A 2W82A 4CHTB 3B9PA 4GHAA 3KOWE 1J7KA 5A2QS 1TH3A 4B7HA 3U6OA 2F5NA 3ILKA 3HHYA 2LNHC 4JI8M 5C1BA 2QP9X 1OJLA 3AV0A 3RGSA 3U61B 3NBIA 4JXJA 3A45A 1Z5BA 1QAMA 2X4AA 3SAUA 1DO2A 5LMNM 3U6SA 5EXTA 4DV5M 1Q3CA 4FWHA 1MU5A 1QAOA 4NSOB 1J5EM 2VIIA 5IT9S 1IN7A 3M6AA 4G4OA 2DWMA 4LZZA 1IN8A 2HKJA 3CF2A 1G4AE 1R7RA 2CV1A 3FTFA 1C1KA 1R6BX 4YHHM 1FJGM 2RGHA 5IWAM 5ITXA 3RGPA 1NY6A 3TWLA 4DR3M 3D8BA 4MGIE 4FCVA 2BJWA 3CF0A 5EP4A 2RGOA 1GVNA 4LJ4A 3GP1A 4DV7M 1N34M 3AFHA 5E6JA 2KA6B 5GKNA 3T15A 3U5ZA 4KODA 3IG5A 3HJ8A 4LJ5A 4LF9M 2KZSA 2C9CA 3ZH9B 4R7GA 2Q2EB 4FWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX0 A;  3VK8 A;  3DOA A;  4DV4 M;  1L2B A;  3SAW A;  3GPX A;  1K3X A;  4JI6 M;  4JI2 M;  1L1Z A;  4JI5 M;  2VQE M;  2E5L M;  4GKK M;  4JI7 M;  4JI3 M;  1TDZ A;  4LFC M;  2F5Q A;  2OQ4 A;  3J7A S;  4DR4 M;  4JYA M;  2UUB M;  1TDH A;  2F5S A;  4AQY M;  4YY3 M;  1EE8 A;  4PD2 A;  1K82 A;  3U6D A;  1L2C A;  1Z59 A;  5ITT A;  4DV1 M;  1PM5 A;  1IBK M;  1N32 M;  2VQF M;  1N33 M;  3U6E A;  2OPF A;  4LFA M;  4OX9 M;  5ITY A;  4B3R M;  3SBJ A;  4G4N A;  1IBL M;  5FLX S;  3W0F A;  4JI4 M;  1L2D A;  5BR8 M;  3GPY A;  2UUA M;  4G4Q A;  1I94 M;  4DUZ M;  4LF4 M;  2XZF A;  4DR5 M;  2UUC M;  4LF8 M;  4JI1 M;  3GPP A;  3GPU A;  3T1H M;  1R2Z A;  2HHH M;  1XC8 A;  3GQ4 A;  4DR7 M;  1L1T A;  5ITQ A;  2F4V M;  4B3S M;  4NXM M;  4PCZ A;  1Z5C A;  3JR4 A;  3SAV A;  4G4R A;  1PJI A;  3C58 A;  3U6P A;  1Q39 A;  1PJJ A;  1HNW M;  2UU9 M;  3GQ3 A;  3JAM S;  1XNQ M;  4LF6 M;  4PDG A;  2F5P A;  4KHP M;  3GO8 A;  4DUY M;  4DV6 M;  5LMU M;  4NRV A;  3TWK A;  2UXB M;  3A46 A;  5A2Q S;  3GQ5 A;  4X66 M;  4DV0 M;  4JI0 M;  1HNX M;  3U6O A;  2F5N A;  4X65 M;  4JI8 M;  1R2Y A;  3U6L A;  4PDI A;  4B3T M;  4DR1 M;  4LF7 M;  4LF5 M;  4X64 M;  1Q3B A;  1XMQ M;  3A45 A;  1XMO M;  1Z5B A;  2UXC M;  1KFV A;  3SAU A;  1HNZ M;  5LMN M;  3U6S A;  4NRW A;  4DV5 M;  4GKJ M;  1Q3C A;  1Z5A A;  1MU5 A;  1XNR M;  1J5E M;  4B3M M;  5IT9 S;  4G4O A;  3SAR A;  2HKJ A;  5ITX E;  4DR2 M;  3VK7 A;  3J81 S;  1HR0 M;  4X62 M;  4ITQ A;  3U6C A;  3T1Y M;  4YHH M;  1FJG M;  5IWA M;  2ZM6 M;  2ZBK B;  3J80 S;  4DV3 M;  5ITX A;  5ITR A;  3TWL A;  1N36 M;  4DR3 M;  3U6M A;  4LFB M;  4JV5 M;  1IBM M;  1NNJ A;  2UXD M;  4CIS A;  3A42 A;  3GP1 A;  4DV7 M;  3TWM A;  4NXN M;  1N34 M;  3SAS A;  4DR6 M;  3SAT A;  3U6Q A;  1K3W A;  3JR5 A;  4K0K M;  5ITU A;  2Q2E B;  2XZU A;  4LF9 M;  2EA0 A;  4MB7 A;  3OTO M;  2F5O A;  4DV2 M; 
#chains in the Genus database with same CATH topology
 1MX0 A;  1TH4 A;  2J7O A;  3FKE A;  4HL4 A;  4REZ A;  1DGH A;  1TF0 B;  4LJ7 A;  2BJV A;  3FUT A;  3VK8 A;  3VKH A;  1QUT A;  2DKL A;  3K1J A;  4MGK E;  2EJS A;  3FUU A;  1ZAE A;  3I4V A;  3VFD A;  4W5W A;  4LFC M;  1GLN A;  4L78 A;  2F5Q A;  4L8R C;  1QYR A;  3J7A S;  4JYA M;  2UUB M;  2JZ0 A;  3J2P B;  5KPR A;  4RKU F;  2F5S A;  3GLG A;  4AQY M;  1TH2 A;  1EE8 A;  1L2C A;  1G8P A;  1Z59 A;  1R4G A;  2JA2 A;  4MH0 E;  3U60 B;  4GMQ A;  3UMM A;  3AL0 C;  1IBK M;  4M9X A;  1WJ7 A;  2LXE A;  2VQF M;  2ZTC A;  5EXX A;  3GRR A;  1NJG A;  3CTW B;  3BBZ A;  4B3R M;  2C98 A;  2KDL A;  4G6Z A;  3WHL A;  1ZQ9 A;  2VDB B;  4QHS A;  4G4Q A;  2HAK A;  1IY1 A;  2JXN A;  2OO9 A;  2CHQ A;  4DR5 M;  3HHZ A;  4LJ9 A;  3AOG A;  4IBE A;  2QBY A;  4LF8 M;  2LHC A;  1OQY A;  3TQS A;  1F4I A;  3GPU A;  1IM2 A;  4OW0 A;  3PVS A;  4GC9 A;  4LZJ A;  1R2Z A;  3KP0 E;  3TL4 X;  4DR7 M;  3SYK A;  3QYB A;  4IJF A;  5FTN A;  3U5Z B;  1L1T A;  4L4U A;  2DI0 A;  2JNH A;  4FVM A;  4B3S M;  3AOE A;  4QOZ C;  1VEK A;  4KO8 A;  3U6P A;  4AW4 A;  1PJJ A;  1HNW M;  1HT2 E;  4HLQ A;  4F1I A;  1DGF A;  1IN6 A;  2V6Z M;  1LTM A;  3E21 A;  3FUX A;  1AIP C;  1LV7 A;  3L2A A;  3HJQ A;  4B7G A;  2DHY A;  4KHP M;  4LY6 A;  4G3O A;  4NL4 H;  3GO8 A;  5H37 D;  3A46 A;  3T38 A;  3W68 A;  3GQ5 A;  4JI0 M;  1SXJ B;  2L2D A;  3LCU A;  4UN2 B;  1NHW C;  4I4L A;  4X65 M;  1NJF A;  1J09 A;  1D2N A;  4PDI A;  2DNA A;  3BXW A;  3KXE C;  4X64 M;  1E32 A;  1Q3B A;  4GHL A;  1G3I A;  1NVM A;  2KXE A;  3B7N A;  3KVW A;  3MHV C;  1N77 A;  2UXC M;  2L7H A;  1L8Q A;  1D0L A;  1T6O A;  2H5X A;  4X62 M;  2M60 A;  5FSW A;  3SYL A;  1WHC A;  2WZJ A;  1V34 A;  2DXI A;  1VG5 A;  4IBK A;  1NO1 A;  1OAO C;  1WGN A;  5KPT A;  2XFT A;  3HKP A;  4I81 A;  2CFO A;  2D7H A;  1JR3 E;  2FOI C;  2HWJ A;  1TR8 A;  3IG8 A;  3L27 A;  4FCW A;  4R71 A;  4ITQ A;  1E9S A;  1OFI A;  3KOZ E;  3TE6 A;  2MH8 A;  2XF3 A;  3AJI B;  4IJE A;  2EO2 A;  4QNM A;  2ZBK B;  3H4M A;  4AG6 A;  1XXH A;  2J5Y A;  2L4F A;  4JN6 A;  3RFW A;  1N36 M;  3W0L B;  1RU3 A;  4JV5 M;  1IBM M;  1D0K A;  2JZ1 A;  2DAE A;  4KT0 F;  3I01 M;  1IXS B;  1BVS A;  1G71 A;  1OAI A;  2Z8Y M;  4ZPX A;  5DYG A;  2RRU A;  4NXN M;  3SAS A;  3KS8 A;  4DR6 M;  8CAT A;  1DV0 A;  1IY0 A;  5EXS A;  1K3W A;  1DGG A;  4WUR A;  1SXJ E;  3JR5 A;  5ITU A;  2XZU A;  3UGJ A;  2DWL A;  1IN5 A;  1Q02 A;  3HGI A;  2H1R A;  4FW9 A;  2A5Y B;  2O5R A;  4LGM A;  1HQY E;  3KSJ A;  4R3D A;  3PXG A;  1K3X A;  3GPX A;  1V92 A;  4FWG A;  4QOS A;  5EP3 A;  2JY8 A;  2QCU A;  3C3E A;  3HU3 A;  3QWL A;  2E5L M;  3L25 A;  2XLJ A;  3AOE C;  1NHG C;  1EFU B;  3HU2 A;  4JI3 M;  2KEB A;  2OQ4 A;  2Z4R A;  2LVO C;  1TDH A;  1QVR A;  1PM5 A;  1N33 M;  3I04 M;  3U6E A;  2OPF A;  2KRU A;  4AKI A;  1ZMU A;  5KO3 A;  4G4N A;  4JI4 M;  4MGZ E;  2R46 A;  1L2D A;  3GPY A;  3FRI A;  3LVW A;  3VKG A;  1I94 M;  2Y21 A;  4IBG A;  4CJ6 A;  1PJS A;  2FNA A;  3UJN A;  1X37 A;  2R44 A;  3FUV A;  3GLH A;  1DO0 A;  3GRU A;  1N75 A;  1DGH B;  4IBF A;  4QHT A;  3UZU A;  5FTL A;  1DGB A;  1GKI A;  3T1H M;  1W5T A;  4GRI A;  5KPZ A;  1IQP A;  5EQT A;  2HHH M;  1XC8 A;  3GQ3 A;  2Y0Q A;  3W67 A;  1QQW A;  3SHG B;  4MGH A;  3GRY A;  1IXR C;  3K9O A;  3M7G A;  4EIW A;  3JR4 A;  5DFL A;  2VF8 A;  4IBC A;  3R9X B;  3GLG B;  1QAQ A;  4XK8 F;  3C9P A;  2J7N A;  3M0E A;  5EJC A;  2O01 F;  2I7P A;  4LF6 M;  4PDG A;  1XNQ M;  3HHW A;  2QSF X;  1KYI A;  2OOA A;  2D7G A;  3DFZ A;  3IEC A;  2UXB M;  4DV6 M;  1YUB A;  2BWB A;  4FD2 A;  4S12 A;  5DNY A;  2ZAM A;  1HNX M;  2XEP A;  4L6V 6;  1YE9 A;  2QBY B;  3PFI A;  4B3T M;  2OOB A;  4DR1 M;  1Z6T A;  2X49 A;  3FTC A;  2LHG A;  4LGY A;  2KZU A;  2KHH A;  3IHP A;  4LF5 M;  4D82 A;  2DHR A;  1XMO M;  4Z6Y A;  2XFS A;  1QUS A;  1FNN A;  2DAK A;  2G5G X;  1HNZ M;  4NRW A;  3ZC7 B;  3FTD A;  4XGI A;  1T43 A;  1Z5A A;  3EIE A;  1UFZ A;  1VQ1 A;  2KNA A;  3FUW A;  5E26 A;  3THG A;  4DBG B;  1P3Q Q;  2R18 A;  3GLI A;  4B3M M;  1XNR M;  3SAR A;  1UM8 A;  2WSC F;  2APL A;  2QZ4 A;  4GIT A;  2KW0 A;  1YSY A;  1VEG A;  1IY2 A;  1QZE A;  2Z3X A;  2ZAN A;  1TGU A;  2XGN A;  4M9Z A;  2EKF A;  2ZM6 M;  1WR1 B;  1IFY A;  5DYI A;  3E9S A;  3J80 S;  2CV0 A;  2D7E A;  3FE3 A;  1WGL A;  3HX3 A;  2CUZ A;  1HJP A;  3Q8G A;  2KNV A;  4CIS A;  1GJT A;  2BNK A;  1PRB A;  1HQC A;  1JB0 F;  2R62 A;  3WHK A;  2JP7 A;  2QHO B;  3U6Q A;  2XH9 A;  4K0K M;  2JUJ A;  2R65 A;  3L28 A;  3FRH A;  2DEN A;  3L29 A;  5JI3 E;  3GLF B;  4KLN A;  2LTU A;  3HU1 A;  2JY6 B;  3A98 B;  4MB7 A;  4AKG A;  4Y28 F;  1SXJ A;  1GL6 A;  2DZN B;  3K8Z A;  3DOA A;  4DV4 M;  1IN4 A;  2C9O A;  4WW0 A;  4JI6 M;  2DWN A;  2N35 A;  4D80 A;  5JI2 E;  1L1Z A;  3PNV A;  4NSR A;  3OTO M;  1G41 A;  1QDT A;  1E9R A;  1WIV A;  1W5S A;  2DWZ B;  1EIJ A;  1XXH B;  3UK6 A;  4DR4 M;  5FTK A;  2GNO A;  2CV2 A;  2K9D A;  5KQ8 A;  3K9P A;  4B08 A;  2FE8 A;  2JWS A;  3FD9 A;  4PD2 A;  3U6D A;  2XSZ D;  2C99 A;  2XSZ A;  4DV1 M;  1N32 M;  2R0I A;  5L8R F;  4CIZ A;  1OIP A;  4IIW A;  4OVZ A;  5ITY A;  4OX9 M;  3LMM A;  4L15 A;  3LCV B;  1IBL M;  2CHV A;  3W0F A;  5FLX S;  3SMP A;  2ZTD A;  4CGY B;  3VDP A;  2VF7 A;  5BR8 M;  2UUA M;  4FCT A;  1H6U A;  3B7Q A;  1GJS A;  2L7I A;  2UUC M;  2BWE A;  4IBD A;  3GPP A;  1A5T A;  3AKZ A;  2V1U A;  1QDR A;  4LRT A;  4GIP A;  3GLF E;  3T6P A;  2LWX A;  3U61 A;  3MJ5 A;  3GQ4 A;  2F4V M;  2CEA A;  2ZAO A;  3KSX A;  2P5T A;  4NXM M;  4AKH A;  3KFU G;  2CE7 A;  3D8L A;  2R4J A;  2KRK A;  3VLF B;  1KSF X;  1OIZ A;  4LRS A;  4A3V B;  3SAV A;  3SC3 A;  4IBB A;  1D0M A;  1Q39 A;  3LVV A;  5EP2 A;  2HCB A;  3DZD A;  3QAU A;  4LJ6 A;  4P16 A;  4AG5 A;  3KOX E;  4HEO A;  3Q8X A;  3K2L A;  1SG9 A;  2WSE F;  4GC5 A;  4I5S A;  2LBC A;  4QNR A;  1XXH E;  4B7F A;  4M0D A;  2F5P A;  1N78 A;  1V33 A;  3K92 A;  1TTE A;  4MM3 B;  1I4W A;  4DUY M;  1XWI A;  5LMU M;  4NRV A;  3TWK A;  4P17 A;  5C18 A;  4ANR A;  5IRE B;  4X66 M;  4DV0 M;  2L6O A;  2ERC A;  2YFQ A;  3SHF A;  3GLH B;  4D81 A;  3GRV A;  3B7Z A;  1R2Y A;  3U6L A;  4LF7 M;  3HY5 A;  2LVA A;  1NSF A;  2MJ5 B;  4M9S A;  4RF0 A;  1XMQ M;  1CUK A;  1HT1 E;  2QQ8 A;  1IXZ A;  1KFV A;  4TUW A;  1NY5 A;  2K0B X;  1VDL A;  1SXJ C;  4GKJ M;  3FTE A;  3ZCB B;  3SFZ A;  3KOY E;  5F3W A;  3VDU A;  3LQR A;  1ZMV A;  4LCB A;  2DZO B;  5ITX E;  4DR2 M;  3SMS A;  3VK7 A;  2LH0 A;  3J81 S;  3B74 A;  2EUC A;  1HR0 M;  3U6C A;  1S3S A;  3T1Y M;  2L4E A;  2V1C A;  1AUA A;  1OFH A;  2M5Z A;  1VDD A;  2DAG A;  2LVN C;  2FH0 A;  3EIH A;  4DV3 M;  3CF6 E;  5EP1 A;  2YQZ A;  5ITR A;  3U6M A;  4LFB M;  4NOO B;  2CRU A;  4AZF A;  1NNJ A;  2UXD M;  3CGW A;  3KDS E;  2O25 A;  3A42 A;  4F2L A;  3L26 A;  3TWM A;  3HWS A;  2YNM D;  2Y0T A;  3U60 A;  3HHX A;  3MK6 A;  3SAT A;  1NNU C;  4XBO A;  2R4E A;  4IBJ A;  1QZM A;  4BB9 A;  2RKO A;  1MJG M;  1YLA A;  2Q2E B;  3GLH E;  3I4Y A;  4Z8X A;  3RE8 A;  7CAT A;  3J27 B;  2G8L A;  4BBA A;  1JQJ C;  2QPA A;  5FTM A;  2EA0 A;  3GLI B;  2QEN A;  2F5O A;  4DV2 M;  2JY7 A;  2G3Q A;  2AHM A;  2Y20 A;  2Z7J A;  3I51 A;  4BLC A;  1L2B A;  3SAW A;  4JI2 M;  5FTJ A;  1QAN A;  3FYC A;  2X8A A;  3GLG E;  3PNY A;  4JI5 M;  3ZQJ A;  1OKS A;  2VQE M;  4OU7 A;  4GKK M;  2FFJ A;  4PT5 A;  5IZ7 D;  4JI7 M;  1TDZ A;  2DZL A;  2CP8 A;  1XHB A;  1JR3 D;  4M0W A;  4GH9 A;  1JR3 A;  3F92 A;  4RNA A;  1GL7 A;  4YY3 M;  2DAM A;  2KNZ A;  1K82 A;  2JY5 A;  5ITT A;  2YR0 A;  3NWL A;  2QNJ A;  4I8O A;  3H4J A;  4LJA A;  2NQ8 C;  4LFA M;  2FS1 A;  3SBJ A;  2R45 A;  2WSF F;  3FYD A;  4Q7J A;  1E94 E;  3C3D A;  5EXP A;  2K47 A;  4DUZ M;  4LJ8 A;  4LF4 M;  1SXJ D;  4WP2 A;  2XZF A;  5KQD A;  2HL7 A;  4II7 A;  4JI1 M;  3HJS A;  2EKK A;  3R8F A;  3BOS A;  1GO5 A;  3QYE A;  4LG2 A;  5BPV A;  1GAB A;  2I7N A;  1T3T A;  2MR9 A;  2R6F A;  3B89 A;  3KP1 E;  5ITQ A;  2L09 A;  3TPZ A;  3GLI E;  3J7B A;  1VEJ A;  2C96 A;  3E4R A;  1NV8 A;  4PCZ A;  1Z5C A;  4IBI A;  3KS4 A;  1ZMW A;  2CHG A;  3KW6 A;  4G4R A;  3C58 A;  2C5R A;  1PJI A;  3DA1 A;  1PGY A;  3GLF A;  1C7Y A;  4MGY E;  4AI6 A;  2UU9 M;  2Z4S A;  4RF1 A;  2DVW B;  2GQF A;  3LQQ A;  3JAM S;  4OVZ B;  1G59 A;  1WXQ A;  4L16 A;  2W82 A;  3E46 A;  4CHT B;  3B9P A;  4GHA A;  3KOW E;  1J7K A;  2LVP C;  1Y8G A;  5A2Q S;  3MMP A;  1TH3 A;  2MGW A;  4B7H A;  3U6O A;  2F5N A;  3ILK A;  3HHY A;  2LNH C;  4JI8 M;  5C1B A;  3NBX X;  2QP9 X;  1OJL A;  1IXS A;  1NV9 A;  3AV0 A;  3RGS A;  3U61 B;  3NBI A;  4JXJ A;  1XB2 B;  3A45 A;  1Z5B A;  1QAM A;  2X4A A;  3SAU A;  1DO2 A;  5LMN M;  3U6S A;  5EXT A;  1MN3 A;  2B3T A;  2DAI A;  4DV5 M;  1Q3C A;  1PJT A;  4FWH A;  1MU5 A;  1QAO A;  4NSO B;  1J5E M;  2VII A;  5IT9 S;  1IN7 A;  3M6A A;  2K6B A;  4G4O A;  4LZZ A;  2DWM A;  1IN8 A;  2HKJ A;  1R5L A;  3CF2 A;  1G4A E;  1OTR A;  1R7R A;  3HZJ A;  2MRO B;  2CV1 A;  3FTF A;  1C1K A;  1R6B X;  3LW5 F;  4YHH M;  1FJG M;  2RGH A;  5IWA M;  5ITX A;  1ZV1 A;  1NY6 A;  3RGP A;  3TWL A;  3D8B A;  4MGI E;  4DR3 M;  4FCV A;  2BJW A;  3CF0 A;  1PJQ A;  5EP4 A;  4NC6 A;  2RGO A;  1GVN A;  4LJ4 A;  3GP1 A;  4DV7 M;  1N34 M;  3AFH A;  2LVQ D;  5E6J A;  2CWB A;  2KA6 B;  5GKN A;  3T15 A;  3U5Z A;  4KOD A;  3IG5 A;  3HJ8 A;  3V76 A;  4GEW A;  4LJ5 A;  4LF9 M;  2KZS A;  2C9C A;  3ZH9 B;  4R7G A;  1ORY B;  4FWD A; 
#chains in the Genus database with same CATH homology
 1MX0 A;  1TH4 A;  2J7O A;  3FKE A;  4HL4 A;  4REZ A;  1DGH A;  3VK8 A;  4LJ7 A;  2BJV A;  3FUT A;  3VKH A;  3K1J A;  4MGK E;  3FUU A;  1ZAE A;  3I4V A;  3VFD A;  4W5W A;  4LFC M;  1GLN A;  4L78 A;  2F5Q A;  4L8R C;  1QYR A;  3J7A S;  4JYA M;  2UUB M;  3J2P B;  5KPR A;  2F5S A;  3GLG A;  4AQY M;  1TH2 A;  1EE8 A;  1L2C A;  1G8P A;  1Z59 A;  2JA2 A;  4MH0 E;  3U60 B;  3AL0 C;  4GMQ A;  3UMM A;  1IBK M;  4M9X A;  2LXE A;  2VQF M;  5EXX A;  3GRR A;  1NJG A;  3CTW B;  4B3R M;  2C98 A;  4G6Z A;  3WHL A;  1ZQ9 A;  4QHS A;  4G4Q A;  1IY1 A;  2CHQ A;  4DR5 M;  3HHZ A;  4LJ9 A;  3AOG A;  4IBE A;  2QBY A;  4LF8 M;  3TQS A;  3GPU A;  1IM2 A;  4OW0 A;  3PVS A;  4GC9 A;  4LZJ A;  1R2Z A;  3KP0 E;  3TL4 X;  4DR7 M;  3SYK A;  5FTN A;  4IJF A;  1L1T A;  4L4U A;  4FVM A;  4B3S M;  3AOE A;  4QOZ C;  4KO8 A;  3U6P A;  4AW4 A;  1PJJ A;  1HNW M;  1HT2 E;  4HLQ A;  1ORY B;  1DGF A;  1IN6 A;  2V6Z M;  3FUX A;  1LV7 A;  3L2A A;  3HJQ A;  4B7G A;  4KHP M;  4LY6 A;  3GO8 A;  4NL4 H;  5H37 D;  3A46 A;  3T38 A;  3GQ5 A;  4JI0 M;  1SXJ B;  1NHW C;  4I4L A;  4X65 M;  1NJF A;  1J09 A;  1D2N A;  4PDI A;  3KXE C;  4X64 M;  1E32 A;  1Q3B A;  4GHL A;  1G3I A;  1NVM A;  2KXE A;  3KVW A;  3MHV C;  1N77 A;  2UXC M;  2L7H A;  1L8Q A;  2M60 A;  5FSW A;  3SYL A;  2DXI A;  4IBK A;  5KPT A;  3HKP A;  2XFT A;  4I81 A;  2CFO A;  2D7H A;  2FOI C;  3IG8 A;  3L27 A;  4FCW A;  4X62 M;  4ITQ A;  1E9S A;  1OFI A;  3KOZ E;  3TE6 A;  2XF3 A;  3AJI B;  4IJE A;  2EO2 A;  4QNM A;  2ZBK B;  3H4M A;  4AG6 A;  1XXH A;  4JN6 A;  3RFW A;  1N36 M;  3W0L B;  4JV5 M;  1IBM M;  1IXS B;  4ZPX A;  5DYG A;  3KS8 A;  3SAS A;  4NXN M;  4DR6 M;  8CAT A;  1IY0 A;  5EXS A;  1K3W A;  1DGG A;  4WUR A;  1SXJ E;  3JR5 A;  5ITU A;  2XZU A;  3UGJ A;  2DWL A;  1IN5 A;  3HGI A;  4FW9 A;  2H1R A;  2A5Y B;  2O5R A;  4LGM A;  1HQY E;  3KSJ A;  4R3D A;  3PXG A;  1K3X A;  3GPX A;  4FWG A;  4QOS A;  5EP3 A;  2QCU A;  3HU3 A;  3QWL A;  2E5L M;  3L25 A;  2XLJ A;  3AOE C;  1NHG C;  3HU2 A;  4JI3 M;  2KEB A;  2OQ4 A;  2Z4R A;  1TDH A;  1QVR A;  1PM5 A;  1N33 M;  3U6E A;  2OPF A;  2KRU A;  4AKI A;  5KO3 A;  4G4N A;  4JI4 M;  4MGZ E;  2R46 A;  1L2D A;  3GPY A;  3LVW A;  3VKG A;  1I94 M;  2Y21 A;  4IBG A;  2FNA A;  3UJN A;  1X37 A;  3FUV A;  3GLH A;  1DO0 A;  3GRU A;  1N75 A;  1DGH B;  4IBF A;  4QHT A;  3UZU A;  5FTL A;  1DGB A;  1GKI A;  3T1H M;  1W5T A;  4GRI A;  5KPZ A;  1IQP A;  5EQT A;  2HHH M;  1XC8 A;  2Y0Q A;  1QQW A;  3SHG B;  4MGH A;  3GRY A;  1IXR C;  3M7G A;  4EIW A;  3JR4 A;  4IBC A;  3R9X B;  3GLG B;  1QAQ A;  2J7N A;  3M0E A;  5EJC A;  2I7P A;  4LF6 M;  4PDG A;  1XNQ M;  3HHW A;  1KYI A;  2D7G A;  3DFZ A;  2UXB M;  4DV6 M;  1YUB A;  4FD2 A;  4S12 A;  5DNY A;  2ZAM A;  1HNX M;  2XEP A;  1YE9 A;  2QBY B;  3PFI A;  4B3T M;  4DR1 M;  1Z6T A;  2X49 A;  3FTC A;  4LGY A;  2KZU A;  4LF5 M;  4D82 A;  2DHR A;  1XMO M;  4Z6Y A;  2XFS A;  1FNN A;  2G5G X;  1HNZ M;  4NRW A;  3ZC7 B;  3FTD A;  4XGI A;  1Z5A A;  3EIE A;  3FUW A;  3THG A;  5E26 A;  1XNR M;  3GLI A;  2R18 A;  4B3M M;  3SAR A;  1UM8 A;  2QZ4 A;  4GIT A;  2KW0 A;  1YSY A;  1IY2 A;  2Z3X A;  2ZAN A;  1TGU A;  2XGN A;  4M9Z A;  2ZM6 M;  5DYI A;  3E9S A;  3J80 S;  2CV0 A;  2D7E A;  2CUZ A;  4CIS A;  2BNK A;  1HQC A;  2R62 A;  3WHK A;  3U6Q A;  2XH9 A;  4K0K M;  2R65 A;  3L28 A;  3L29 A;  5JI3 E;  3GLF B;  4KLN A;  3HU1 A;  3A98 B;  4MB7 A;  4AKG A;  1SXJ A;  1GL6 A;  2DZN B;  3K8Z A;  3DOA A;  4DV4 M;  1IN4 A;  2C9O A;  4WW0 A;  4JI6 M;  2DWN A;  4D80 A;  5JI2 E;  1L1Z A;  3PNV A;  4NSR A;  3OTO M;  1G41 A;  1E9R A;  1W5S A;  2DWZ B;  1XXH B;  3UK6 A;  4DR4 M;  5FTK A;  2CV2 A;  5KQ8 A;  4B08 A;  2FE8 A;  3FD9 A;  4PD2 A;  3U6D A;  2XSZ D;  2C99 A;  2XSZ A;  4DV1 M;  1N32 M;  4IIW A;  4OVZ A;  4OX9 M;  5ITY A;  3LMM A;  4L15 A;  1IBL M;  2CHV A;  3W0F A;  5FLX S;  3SMP A;  4CGY B;  5BR8 M;  3VDP A;  2UUA M;  4FCT A;  1H6U A;  2L7I A;  2UUC M;  4IBD A;  3GPP A;  3AKZ A;  2V1U A;  4LRT A;  4GIP A;  2LWX A;  3U61 A;  3MJ5 A;  3GQ4 A;  2F4V M;  2CEA A;  2ZAO A;  3KSX A;  2P5T A;  4NXM M;  4AKH A;  3KFU G;  2CE7 A;  3D8L A;  2R4J A;  2KRK A;  3VLF B;  1KSF X;  4A3V B;  4LRS A;  3SAV A;  3SC3 A;  4IBB A;  1Q39 A;  3LVV A;  5EP2 A;  2HCB A;  3DZD A;  3QAU A;  4LJ6 A;  4P16 A;  4AG5 A;  3KOX E;  4QNR A;  3Q8X A;  3K2L A;  4GC5 A;  3GQ3 A;  4I5S A;  3U5Z B;  4B7F A;  2F5P A;  4M0D A;  1N78 A;  4MM3 B;  3K92 A;  1I4W A;  4DUY M;  1XWI A;  5LMU M;  4NRV A;  3TWK A;  5C18 A;  5IRE B;  4X66 M;  4DV0 M;  2L6O A;  2ERC A;  2YFQ A;  3SHF A;  3GLH B;  4D81 A;  3GRV A;  1R2Y A;  3U6L A;  4LF7 M;  1NSF A;  4M9S A;  4RF0 A;  1XMQ M;  1HT1 E;  1IXZ A;  1KFV A;  4TUW A;  1NY5 A;  4GKJ M;  1SXJ C;  3FTE A;  3ZCB B;  3SFZ A;  3KOY E;  5F3W A;  3VDU A;  3LQR A;  4LCB A;  2DZO B;  5ITX E;  4DR2 M;  3SMS A;  3VK7 A;  2LH0 A;  3J81 S;  1HR0 M;  2EUC A;  3U6C A;  1S3S A;  3T1Y M;  2V1C A;  1OFH A;  2M5Z A;  1VDD A;  3EIH A;  4DV3 M;  3CF6 E;  5EP1 A;  2YQZ A;  5ITR A;  3U6M A;  4LFB M;  4NOO B;  4AZF A;  1NNJ A;  2UXD M;  3KDS E;  3A42 A;  3U60 A;  3L26 A;  3TWM A;  3HWS A;  2YNM D;  2Y0T A;  3HHX A;  3MK6 A;  3SAT A;  1NNU C;  4XBO A;  2R4E A;  4IBJ A;  1QZM A;  4BB9 A;  2RKO A;  3RE8 A;  3I4Y A;  7CAT A;  4Z8X A;  3J27 B;  2G8L A;  4BBA A;  1JQJ C;  2QPA A;  5FTM A;  2EA0 A;  3GLI B;  2QEN A;  2F5O A;  4DV2 M;  2AHM A;  2Y20 A;  2Z7J A;  3I51 A;  4BLC A;  1L2B A;  3SAW A;  4JI2 M;  5FTJ A;  1QAN A;  3FYC A;  2X8A A;  3PNY A;  4JI5 M;  2VQE M;  4OU7 A;  4GKK M;  2FFJ A;  4PT5 A;  5IZ7 D;  4JI7 M;  1TDZ A;  1XHB A;  1JR3 D;  4M0W A;  4GH9 A;  1JR3 A;  4RNA A;  1GL7 A;  4YY3 M;  1K82 A;  5ITT A;  2YR0 A;  3NWL A;  4I8O A;  4LFA M;  4LJA A;  2NQ8 C;  3SBJ A;  2R45 A;  3FYD A;  1E94 E;  5EXP A;  2K47 A;  4DUZ M;  4LJ8 A;  4LF4 M;  1SXJ D;  2XZF A;  5KQD A;  2HL7 A;  4II7 A;  4JI1 M;  3HJS A;  3R8F A;  3BOS A;  4LG2 A;  5BPV A;  2I7N A;  1T3T A;  3KP1 E;  5ITQ A;  2L09 A;  3TPZ A;  3J7B A;  2C96 A;  3E4R A;  4PCZ A;  1Z5C A;  4IBI A;  3KS4 A;  2CHG A;  3KW6 A;  4G4R A;  3C58 A;  2C5R A;  1PJI A;  3DA1 A;  4AI6 A;  3GLF A;  4MGY E;  2UU9 M;  2Z4S A;  4RF1 A;  2DVW B;  3LQQ A;  3JAM S;  4OVZ B;  1G59 A;  1WXQ A;  4L16 A;  2W82 A;  4CHT B;  3B9P A;  4GHA A;  3KOW E;  1J7K A;  5A2Q S;  1TH3 A;  4B7H A;  3U6O A;  2F5N A;  3ILK A;  3HHY A;  2LNH C;  4JI8 M;  5C1B A;  2QP9 X;  1OJL A;  3AV0 A;  3RGS A;  3U61 B;  3NBI A;  4JXJ A;  3A45 A;  1Z5B A;  1QAM A;  2X4A A;  3SAU A;  1DO2 A;  5LMN M;  3U6S A;  5EXT A;  4DV5 M;  1Q3C A;  4FWH A;  1MU5 A;  1QAO A;  4NSO B;  1J5E M;  2VII A;  5IT9 S;  1IN7 A;  3M6A A;  4G4O A;  2DWM A;  4LZZ A;  1IN8 A;  2HKJ A;  3CF2 A;  1G4A E;  1R7R A;  2CV1 A;  3FTF A;  1C1K A;  1R6B X;  4YHH M;  1FJG M;  2RGH A;  5IWA M;  5ITX A;  3RGP A;  1NY6 A;  3TWL A;  4DR3 M;  3D8B A;  4MGI E;  4FCV A;  2BJW A;  3CF0 A;  5EP4 A;  2RGO A;  1GVN A;  4LJ4 A;  3GP1 A;  4DV7 M;  1N34 M;  3AFH A;  5E6J A;  2KA6 B;  5GKN A;  3T15 A;  3U5Z A;  4KOD A;  3IG5 A;  3HJ8 A;  4LJ5 A;  4LF9 M;  2KZS A;  2C9C A;  3ZH9 B;  4R7G A;  2Q2E B;  4FWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...