4B3SM

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3sM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3sM02
3GQ4A 1L1ZA 1MU5A 5ITTA 4YHHM 3W0FA 3GPPA 2UUAM 5LMNM 4DR4M 1K82A 2HKJA 3T1HM 4DV4M 2VQEM 4JI5M 1TDZA 2UU9M 5ITXA 2OPFA 3U6DA 1Q3CA 2UUBM 1XNQM 5ITXE 1EE8A 1IBMM 4JI4M 4LF4M 5LMUM 4PDIA 1HNWM 1N34M 1R2YA 4LFBM 3U6CA 4MB7A 4DUZM 4DR6M 1PM5A 4YY3M 3GPUA 3GP1A 4G4QA 4OX9M 4DV0M 3GQ5A 5ITYA 2F5SA 3J81S 3U6EA 4B3SM 3U6MA 4LF6M 2XZFA 4DV3M 4DR7M 4ITQA 5ITRA 4X62M 2UXDM 1TDHA 4LF7M 3A42A 2EA0A 3TWKA 3U6PA 1Z5CA 4JI3M 4DR5M 4X64M 1I94M 3SASA 2VQFM 4JI8M 4B3TM 4LF9M 1K3WA 1K3XA 1HNXM 2HHHM 1N36M 1N32M 4K0KM 4G4OA 2F5OA 2ZBKB 4JYAM 1MX0A 4AQYM 1IBKM 1L2CA 4DV5M 3VK7A 1PJIA 3GPYA 5ITQA 4PDGA 3T1YM 3JR5A 2XZUA 4NXMM 4JI6M 3JR4A 3SAVA 1Q39A 3JAMS 3OTOM 3C58A 4X65M 3GO8A 4JI1M 4NRVA 4PCZA 3SAWA 4G4NA 2ZM6M 1L2BA 2F4VM 3GQ3A 5IWAM 3VK8A 1XNRM 4B3MM 1Q3BA 4LF8M 3SBJA 1XC8A 4PD2A 4DV1M 4CISA 1NNJA 1HR0M 4JI7M 2UUCM 5IT9S 2F5PA 1L2DA 3DOAA 3GPXA 2OQ4A 4G4RA 1XMQM 4X66M 1PJJA 1KFVA 4JI2M 2F5NA 2UXCM 4JV5M 1Z59A 1R2ZA 2UXBM 3J80S 3TWMA 1HNZM 4NXNM 2E5LM 1L1TA 1FJGM 5ITUA 5A2QS 3SARA 2Q2EB 4DV6M 1Z5BA 4NRWA 1IBLM 4B3RM 4LFAM 4DR2M 1N33M 4JI0M 1XMOM 4DR1M 1Z5AA 3SATA 3U6OA 5FLXS 4LF5M 3U6QA 3A45A 3A46A 4DR3M 4GKJM 5BR8M 3U6SA 3J7AS 4LFCM 4DV7M 3SAUA 3U6LA 4DUYM 1J5EM 2F5QA 3TWLA 4GKKM 4KHPM 4DV2M
chains in the Genus database with same CATH superfamily
1QAOA 2R0IA 3L27A 5ITTA 2LVNC 2JY5A 4YHHM 1AIPC 4QHSA 3GPPA 2UUAM 2WZJA 3AOEA 1VDDA 3R8FA 2L09A 2C98A 1DGBA 4L8RC 1WJ7A 2JY6B 2KXEA 1TDZA 3IHPA 2XSZA 2YFQA 5ITXA 3TE6A 4IJFA 4AZFA 4F1IA 3TL4X 2OPFA 3KOWE 4LGYA 3UMMA 3GLGA 1Q3CA 5EP3A 4KT0F 3B9PA 1IBMM 1JR3A 3LVVA 5LMUM 1UFZA 2L4EA 2LVOC 1TR8A 3J7BA 1HNWM 3GRYA 3I04M 4DUZM 1IN7A 4G6ZA 3GPUA 3EIEA 3PNVA 3LQQA 4II7A 4B08A 2EO2A 2F5SA 4MH0E 3F92A 4S12A 1QVRA 3VKHA 2CEAA 4GHAA 4FWHA 1QANA 4G3OA 4LRSA 5ITRA 1TDHA 2OOAA 4IBEA 3VKGA 2QBYB 2YR0A 3WHKA 5DNYA 1GL7A 1G4AE 2JWSA 2MJ5B 3HGIA 1IN8A 3FUWA 4MGIE 5EP2A 5JI2E 4DR5M 1ZMUA 2QZ4A 1ZMWA 3FYDA 5DYIA 3AV0A 2Z4SA 3T15A 2JZ0A 4LF9M 2DAGA 1K3XA 1NJGA 2VIIA 4G4OA 3EIHA 3GLIE 2F5OA 3A98B 3HJQA 5FTJA 4LG2A 3FE3A 1OTRA 4JYAM 2JP7A 2LBCA 2WSFF 3PFIA 4R71A 2APLA 1L2CA 4DV5M 3L25A 4JXJA 1GABA 2V1UA 4QNRA 3SHGB 2BJWA 1QZEA 4PDGA 3KXEC 4GH9A 4JI6M 1EFUB 3K92A 1Q39A 4IBIA 2EUCA 1VEKA 2B3TA 4CGYB 2DI0A 2Z3XA 3KS8A 1JR3D 3L29A 2D7GA 2ZTCA 4LJ4A 3GO8A 1WXQA 2QBYA 1DGHB 5FTKA 1QDRA 1DO2A 5KPRA 2Y21A 4AKGA 2W82A 4XK8F 4B3MM 2FS1A 3GLFA 2O5RA 1XC8A 1SXJB 4IIWA 4WURA 2QQ8A 3FYCA 4AG5A 4DV1M 3R9XB 1G59A 4M9XA 3HKPA 1G71A 1NHGC 1L2DA 3GRUA 3GRVA 3GPXA 4JI2M 1AUAA 4LZJA 1QDTA 1NV9A 2VDBB 2GNOA 3DZDA 5F3WA 1DGHA 2MGWA 4LJ9A 2EKKA 4FW9A 2E5LM 1IXSA 2DHRA 3VDPA 1E32A 1ZMVA 3W67A 4IBCA 2Q2EB 4DV6M 1EIJA 1OJLA 3HY5A 1IBLM 2JZ1A 2Z7JA 3J27B 4I5SA 4ZPXA 3GLIA 4LFAM 3PNYA 3W0LB 4B3RM 2H1RA 2DWZB 1SXJD 3HWSA 4NC6A 4DR1M 1QUSA 2J7OA 4LGMA 4LF5M 2LXEA 3AOGA 3U6QA 5BR8M 3U6SA 4RF0A 1D0KA 1XB2B 3C3DA 4DV7M 4DUYM 7CATA 1OIZA 3U6LA 4LFCM 4LY6A 4Z6YA 1L1ZA 2QCUA 1LTMA 1MU5A 4A3VB 3K9PA 2C9CA 2FOIC 3KS4A 2RKOA 4CJ6A 2Y20A 2JA2A 2I7PA 2XFSA 2K47A 4AW4A 2NQ8C 1QAMA 1IQPA 1PJSA 1IFYA 1PJTA 1I4WA 4PDIA 4L15A 2KZUA 3U60B 2X8AA 3FUUA 4M9SA 2KEBA 2Z8YM 2AHMA 2Y0QA 2LTUA 4HEOA 2L2DA 4BBAA 1GLNA 4YY3M 3KP0E 1V33A 4IJEA 1XWIA 2RGOA 4G4QA 4DV0M 3NBXX 4OX9M 2LVPC 5ITYA 5DYGA 1R4GA 4MGYE 3B7ZA 4QHTA 3U6MA 1E9RA 1V92A 4LF6M 2QNJA 2XEPA 1PRBA 4DR7M 4WP2A 5EXPA 4D80A 2UXDM 3M0EA 3SFZA 2O25A 3RGSA 3H4MA 4R7GA 3U6PA 1OFHA 3DFZA 4JI3M 1OQYA 4FWGA 1I94M 3SASA 3UZUA 2FNAA 3BOSA 3RFWA 3U5ZB 1R6BX 3B74A 1GKIA 3K2LA 2HHHM 4XBOA 3GLGB 3U60A 4K0KM 1W5TA 3B7QA 1TTEA 3GLGE 3AL0C 2KZSA 1VEGA 3ZC7B 3GPYA 1IN4A 4FCWA 3T6PA 1X37A 4NOOB 2Z4RA 1OIPA 1Y8GA 2KW0A 3JR5A 2XZUA 1QUTA 2QP9X 3JAMS 3CF2A 1D0LA 1MN3A 4JN6A 3UK6A 3C58A 1XXHA 4TUWA 4X65M 1H6UA 4P17A 2MROB 2C5RA 2DZOB 1DGGA 1OAOC 4IBGA 4PCZA 3ILKA 3KSXA 4EIWA 4G4NA 3SAWA 3VK8A 3AKZA 2XSZD 1YLAA 3BXWA 4AI6A 3HZJA 5EP1A 1SXJC 2OO9A 4LJ7A 5EP4A 2KNVA 4WW0A 3SBJA 2QENA 1QYRA 2KRKA 3HJ8A 5EJCA 1J09A 4JI7M 5E26A 3FTEA 2DAMA 2JUJA 1KFVA 4G4RA 1XMQM 2K0BX 1Z59A 2LVAA 1NNUC 3CF6E 3E46A 2KNAA 3I51A 4Q7JA 4NXNM 2XFTA 3UJNA 1HJPA 1OAIA 3FRIA 2L7HA 4QNMA 3ZCBB 1FJGM 3SMSA 4CHTB 5A2QS 4GRIA 2BWEA 1IN5A 4I8OA 2C96A 1HQCA 1Z5BA 4LJ6A 2P5TA 3MJ5A 4IBFA 1N33M 3KFUG 1N75A 1NHWC 3LW5F 2HWJA 2RRUA 1CUKA 4Z8XA 3SATA 2XH9A 3MMPA 3U6OA 1IY1A 5GKNA 3VLFB 3HHZA 4DR3M 3FTFA 3E9SA 1S3SA 1VEJA 4KO8A 3SAUA 4GKKM 1J5EM 1JR3E 2BNKA 3TWLA 2R44A 3MHVC 4DV2M 2L7IA 4FVMA 3GQ4A 3ZQJA 1PGYA 1WR1B 3W0FA 3W68A 5LMNM 4D82A 4DR4M 5EQTA 2HKJA 2YNMD 2LWXA 4LRTA 4GC9A 4M9ZA 3C3EA 5IZ7D 4JI5M 1QQWA 2UU9M 2QSFX 3HU2A 2L6OA 4GITA 3FTDA 5IREB 3KOXE 1LV7A 3SYLA 1XNQM 1DGFA 2C9OA 3IG8A 3T38A 3PVSA 4PT5A 3AJIB 2BWBA 3J2PB 2DKLA 1XXHB 2J5YA 3NWLA 1TH3A 1NV8A 2D7HA 1R2YA 3U6CA 3Q8XA 4MB7A 4L78A 2KHHA 3CF0A 3GLFE 2R18A 4AKHA 4FCTA 3GP1A 5DFLA 4B7FA 1JQJC 3QAUA 2G3QA 4NSRA 3QWLA 3J81S 1FNNA 1OKSA 3SHFA 3LVWA 4FWDA 1GJTA 2K9DA 2XZFA 3TQSA 4DV3M 1YSYA 3FUXA 2WSCF 2R6FA 1XHBA 3FKEA 4B7HA 4X62M 1G8PA 2BJVA 4OVZB 1GO5A 2CV0A 1L8QA 3TWKA 1Z5CA 1RU3A 1Q02A 2DAIA 4R3DA 4X64M 1KYIA 4M0WA 4B7GA 2VQFM 3NBIA 2DXIA 3PXGA 2V6ZM 1HNXM 3AOEC 4RKUF 2OOBA 1N36M 4RNAA 2DHYA 1TH2A 3U61A 1E94E 2ZAOA 3U5ZA 1MX0A 1IBKM 1R7RA 1SXJE 2CFOA 3CTWB 3FUTA 5EXXA 3T1YM 2HCBA 4NXMM 3VFDA 3JR4A 4IBJA 4KLNA 2YQZA 3SAVA 1ORYB 3UGJA 4NL4H 1WHCA 1MJGM 2CHVA 2DNAA 1NSFA 5KQ8A 2LNHC 2DENA 4JI1M 2HL7A 3HHYA 1JB0F 2RGHA 1C1KA 2ZM6M 3Q8GA 3K9OA 1L2BA 2F4VM 2CHQA 5IWAM 1XNRM 3SMPA 1NO1A 2R45A 3FTCA 1R5LA 2CP8A 3L2AA 1V34A 3RE8A 3SC3A 3L26A 2DWLA 1F4IA 4PD2A 5E6JA 4CISA 2DAKA 3HU3A 2G8LA 3M6AA 4LJAA 1NNJA 1WGLA 1NY6A 1IY0A 2KRUA 3LCVB 4LJ5A 2F5PA 4CIZA 1PJJA 2OQ4A 4AKIA 1KSFX 1D2NA 4W5WA 3V76A 2FFJA 1N77A 4JV5M 2UXCM 3FUVA 1R2ZA 2CE7A 2UXBM 2FE8A 3LQRA 4GIPA 2WSEF 1L1TA 1IXRC 2XLJA 1E9SA 1ZV1A 5ITUA 1ZQ9A 3D8BA 2D7EA 3GLFB 4REZA 2CRUA 5KQDA 4NRWA 1NY5A 2MR9A 3I01M 4I81A 2JY8A 4Y28F 4DR2M 4JI0M 1D0MA 3WHLA 1NVMA 3B89A 5FTNA 2LH0A 1QZMA 4MGZE 3KSJA 1XMOM 5KPTA 3KP1E 3HJSA 4P16A 3A45A 3A46A 5FTLA 4GKJM 4RF1A 2DZNB 1IXZA 1SXJA 3VDUA 8CATA 1TF0B 1IXSB 1IM2A 2X4AA 2X49A 4GMQA 3KW6A 5EXTA 2DWNA 3KOYE 3RGPA 2J7NA 1VQ1A 1GVNA 3HU1A 3I4VA 1K82A 5BPVA 1GL6A 3D8LA 4XGIA 4DV4M 3T1HM 2VQEM 2L4FA 3E4RA 3AFHA 4FD2A 3CGWA 2CWBA 3MK6A 3U6DA 3HHXA 1N78A 4F2LA 1WGNA 3GLHE 5FSWA 5ITXE 1EE8A 2UUBM 1G3IA 4JI4M 3GLHB 1UM8A 3IECA 2ZANA 4LF4M 4NSOB 2R4EA 3QYBA 1N34M 1P3QQ 4LFBM 4DR6M 3DA1A 4MGHA 1PM5A 1HQYE 3KOZE 2DWMA 4IBDA 1WIVA 4OU7A 2CV2A 3GQ5A 2XGNA 4LJ8A 3B7NA 4HL4A 2LVQD 4I4LA 1TGUA 4KODA 3U6EA 2ZAMA 2K6BA 4B3SM 4GC5A 4MGKE 4ITQA 2G5GX 1T3TA 4LF7M 2KDLA 3A42A 4IBBA 2EA0A 5L8RF 1VG5A 2R62A 3K1JA 4BLCA 3I4YA 1PJQA 3H4JA 4DBGB 2LHCA 1IN6A 4JI8M 2FH0A 3U61B 4B3TM 1YE9A 1K3WA 5C18A 5KPZA 4BB9A 3E21A 1N32M 1SG9A 2ZBKB 4ANRA 4FCVA 3QYEA 2LHGA 4IBKA 4L6V6 1T43A 4AQYM 1VDLA 2XF3A 2HAKA 3VK7A 1PJIA 2DZLA 3K8ZA 2QHOB 5KO3A 2KNZA 3FD9A 5ITQA 2VF8A 2DAEA 2A5YB 2KA6B 3C9PA 2CV1A 1HT1E 4HLQA 4L4UA 4UN2B 3OTOM 3SYKA 4GHLA 3LMMA 2M5ZA 1C7YA 3HX3A 3KDSE 1OFIA 3L28A 4QOZC 1DV0A 2JXNA 2V1CA 3M7GA 4NRVA 1NJFA 4OW0A 2O01F 5EXSA 1IY2A 3GQ3A 4GEWA 2EJSA 4QOSA 1Q3BA 4LF8M 1HT2E 2MH8A 4LZZA 5C1BA 3BBZA 2CUZA 2VF7A 2H5XA 2N35A 4AG6A 1Z6TA 1TH4A 1HR0M 3KVWA 3ZH9B 2UUCM 3GLHA 5IT9S 2DVWB 1G41A 3DOAA 4D81A 4X66M 3HHWA 5FTMA 2F5NA 1DO0A 4L16A 5JI3E 4LCBA 1J7KA 3GRRA 5H37D 2M60A 4OVZA 3THGA 1YUBA 3J80S 3TWMA 3TPZA 1HNZM 4MM3B 3GLIB 2C99A 2I7NA 1QAQA 1GJSA 1BVSA 2JNHA 3SARA 2JY7A 3IG5A 1A5TA 2QPAA 2ERCA 2Y0TA 3LCUA 4M0DA 1W5SA 1ZAEA 2R46A 1Z5AA 5FLXS 2CHGA 2EKFA 2R4JA 1T6OA 2ZTDA 3FRHA 3J7AS 4KHPM 2GQFA 2F5QA 2R65A 1XXHE
chains in the Genus database with same CATH topology
1QAOA 3L27A 5ITTA 4YHHM 4QHSA 3GPPA 2UUAM 3AOEA 1VDDA 2L09A 2C98A 1DGBA 4L8RC 2KXEA 1TDZA 2XSZA 2YFQA 5ITXA 3TE6A 4IJFA 4AZFA 3TL4X 2OPFA 3KOWE 4LGYA 3UMMA 3GLGA 1Q3CA 5EP3A 1IBMM 3B9PA 1JR3A 3LVVA 5LMUM 3J7BA 1HNWM 3GRYA 4DUZM 1IN7A 4G6ZA 3GPUA 3EIEA 3PNVA 3LQQA 4II7A 4B08A 2EO2A 2F5SA 4MH0E 4S12A 1QVRA 3VKHA 2CEAA 4GHAA 4FWHA 1QANA 4LRSA 5ITRA 1TDHA 4IBEA 3VKGA 2QBYB 2YR0A 3WHKA 5DNYA 1GL7A 1G4AE 3HGIA 5JI2E 1IN8A 3FUWA 4MGIE 5EP2A 4DR5M 2QZ4A 3FYDA 5DYIA 3AV0A 2Z4SA 3T15A 4LF9M 1K3XA 1NJGA 2VIIA 4G4OA 3EIHA 2F5OA 3A98B 3HJQA 5FTJA 4LG2A 4JYAM 3PFIA 1L2CA 4DV5M 3L25A 4JXJA 2V1UA 4QNRA 3SHGB 2BJWA 4PDGA 3KXEC 4GH9A 4JI6M 3K92A 1Q39A 4IBIA 2EUCA 4CGYB 2Z3XA 3KS8A 1JR3D 3L29A 2D7GA 4LJ4A 3GO8A 1WXQA 2QBYA 1DGHB 5FTKA 1DO2A 5KPRA 2Y21A 4AKGA 2W82A 4B3MM 3GLFA 2O5RA 1XC8A 1SXJB 4IIWA 4WURA 3FYCA 4AG5A 4DV1M 3R9XB 1G59A 4M9XA 3HKPA 1NHGC 1L2DA 3GRUA 3GRVA 3GPXA 4JI2M 4LZJA 3DZDA 5F3WA 1DGHA 4LJ9A 4FW9A 2E5LM 2DHRA 3VDPA 1E32A 4IBCA 2Q2EB 4DV6M 1OJLA 1IBLM 3J27B 2Z7JA 4I5SA 4ZPXA 3GLIA 4B3RM 4LFAM 3PNYA 3W0LB 2H1RA 2DWZB 1SXJD 3HWSA 4DR1M 2J7OA 4LGMA 4LF5M 2LXEA 3AOGA 3U6QA 5BR8M 3U6SA 4RF0A 4LFCM 4DV7M 3U6LA 4DUYM 7CATA 4LY6A 4Z6YA 1L1ZA 2QCUA 1MU5A 4A3VB 2C9CA 2FOIC 3KS4A 2RKOA 2Y20A 2JA2A 2I7PA 2XFSA 2K47A 4AW4A 2NQ8C 1QAMA 1IQPA 1I4WA 4PDIA 4L15A 2KZUA 3U60B 2X8AA 3FUUA 4M9SA 2KEBA 2AHMA 2Y0QA 4BBAA 1GLNA 4YY3M 3KP0E 4IJEA 4G4QA 1XWIA 2RGOA 4OX9M 4DV0M 5ITYA 5DYGA 4MGYE 4QHTA 3U6MA 1E9RA 4LF6M 2XEPA 4DR7M 5EXPA 4D80A 2UXDM 3M0EA 3SFZA 3RGSA 3H4MA 4R7GA 3U6PA 1OFHA 3DFZA 4JI3M 4FWGA 1I94M 3SASA 3UZUA 2FNAA 3BOSA 3RFWA 3U5ZB 1R6BX 2HHHM 1GKIA 3K2LA 4XBOA 3GLGB 3U60A 4K0KM 1W5TA 3AL0C 2KZSA 3ZC7B 3GPYA 1IN4A 4FCWA 1X37A 4NOOB 2Z4RA 2KW0A 3JR5A 2XZUA 2QP9X 3JAMS 3CF2A 4JN6A 3C58A 4TUWA 3UK6A 1XXHA 4X65M 1H6UA 2C5RA 2DZOB 1DGGA 4IBGA 4PCZA 3SAWA 3ILKA 3KSXA 4EIWA 4G4NA 3VK8A 3AKZA 2XSZD 4AI6A 5EP1A 1SXJC 4LJ7A 5EP4A 4WW0A 3SBJA 2QENA 1QYRA 2KRKA 3HJ8A 5EJCA 1J09A 4JI7M 5E26A 3FTEA 1KFVA 4G4RA 1XMQM 1Z59A 3CF6E 1NNUC 3I51A 3UJNA 3R8FA 4NXNM 2XFTA 4QNMA 3ZCBB 2L7HA 1FJGM 3SMSA 4CHTB 5A2QS 4GRIA 1IN5A 4I8OA 2C96A 1HQCA 1Z5BA 4LJ6A 2P5TA 3MJ5A 4IBFA 1N33M 3KFUG 1N75A 1NHWC 4Z8XA 3SATA 2XH9A 3U6OA 1IY1A 5GKNA 3VLFB 3HHZA 4DR3M 3FTFA 3E9SA 1S3SA 4KO8A 3SAUA 4GKKM 1J5EM 2BNKA 3TWLA 3MHVC 4DV2M 2L7IA 4FVMA 3GQ4A 3W0FA 5LMNM 4D82A 4DR4M 5EQTA 2HKJA 2YNMD 2LWXA 4LRTA 4GC9A 4M9ZA 5IZ7D 4JI5M 1QQWA 2UU9M 3HU2A 2L6OA 4GITA 3FTDA 5IREB 3KOXE 1LV7A 3SYLA 1XNQM 1DGFA 2C9OA 3IG8A 3T38A 3PVSA 4PT5A 3AJIB 3J2PB 1XXHB 3NWLA 1TH3A 2D7HA 1R2YA 3U6CA 3Q8XA 4MB7A 4L78A 3CF0A 2R18A 4AKHA 4FCTA 3GP1A 4B7FA 1JQJC 3QAUA 4NSRA 3QWLA 3J81S 1FNNA 3SHFA 3LVWA 4FWDA 2XZFA 3TQSA 4DV3M 1YSYA 3FUXA 3FKEA 1XHBA 4B7HA 4X62M 1G8PA 2BJVA 4OVZB 2CV0A 1L8QA 3TWKA 1Z5CA 4R3DA 4X64M 1KYIA 4M0WA 4B7GA 2VQFM 3NBIA 2DXIA 3PXGA 2V6ZM 1HNXM 3AOEC 1N36M 4RNAA 1TH2A 3U61A 1E94E 2ZAOA 3U5ZA 1MX0A 1IBKM 1R7RA 1SXJE 2CFOA 3CTWB 3FUTA 5EXXA 3T1YM 2HCBA 4NXMM 3VFDA 3JR4A 4IBJA 4KLNA 2YQZA 3SAVA 1ORYB 3UGJA 4NL4H 2CHVA 1NSFA 5KQ8A 2LNHC 4JI1M 2HL7A 3HHYA 2RGHA 1C1KA 2ZM6M 1L2BA 2F4VM 2CHQA 5IWAM 1XNRM 3SMPA 3FTCA 2R45A 3L2AA 3SC3A 3RE8A 3L26A 2DWLA 4PD2A 5E6JA 4CISA 3HU3A 2G8LA 3M6AA 4LJAA 1NNJA 1NY6A 1IY0A 2KRUA 2F5PA 4LJ5A 1PJJA 2OQ4A 4AKIA 1KSFX 1D2NA 4W5WA 2FFJA 1N77A 4JV5M 2UXCM 3FUVA 1R2ZA 2CE7A 2UXBM 2FE8A 3LQRA 4GIPA 1L1TA 1IXRC 2XLJA 1E9SA 5ITUA 1ZQ9A 3D8BA 2D7EA 3GLFB 4REZA 5KQDA 4NRWA 1NY5A 4I81A 4DR2M 4JI0M 3WHLA 1NVMA 5FTNA 2LH0A 1QZMA 4MGZE 3KSJA 1XMOM 5KPTA 3KP1E 3HJSA 4P16A 3A45A 3A46A 5FTLA 4GKJM 4RF1A 2DZNB 1IXZA 1SXJA 3VDUA 8CATA 1IXSB 2X49A 1IM2A 2X4AA 4GMQA 3KW6A 5EXTA 2DWNA 3KOYE 3RGPA 2J7NA 1GVNA 3HU1A 3I4VA 1K82A 5BPVA 1GL6A 3D8LA 4XGIA 4DV4M 3T1HM 2VQEM 3E4RA 3AFHA 4FD2A 3MK6A 3U6DA 1N78A 3HHXA 5FSWA 2UUBM 5ITXE 1EE8A 4JI4M 1G3IA 3GLHB 1UM8A 4LF4M 2ZANA 4NSOB 2R4EA 1N34M 4LFBM 4DR6M 3DA1A 4MGHA 1PM5A 1HQYE 3KOZE 2DWMA 4IBDA 4OU7A 2CV2A 3GQ5A 2XGNA 4LJ8A 4HL4A 4I4LA 1TGUA 4KODA 3U6EA 2ZAMA 4B3SM 4GC5A 4MGKE 4ITQA 2G5GX 1T3TA 4LF7M 3A42A 4IBBA 2EA0A 2R62A 3K1JA 4BLCA 3I4YA 1IN6A 4JI8M 3U61B 4B3TM 1YE9A 1K3WA 5C18A 5KPZA 4BB9A 1N32M 2ZBKB 4FCVA 4IBKA 4AQYM 2XF3A 3VK7A 1PJIA 3K8ZA 5KO3A 3FD9A 5ITQA 2A5YB 2KA6B 2CV1A 1HT1E 4HLQA 4L4UA 3OTOM 4GHLA 3SYKA 3LMMA 2M5ZA 3KDSE 3L28A 1OFIA 4QOZC 2V1CA 3M7GA 4NRVA 1NJFA 4OW0A 5EXSA 1IY2A 3GQ3A 4QOSA 1Q3BA 4LF8M 1HT2E 4LZZA 5C1BA 2CUZA 4AG6A 1Z6TA 1TH4A 1HR0M 3KVWA 3ZH9B 2UUCM 3GLHA 5IT9S 2DVWB 1G41A 3DOAA 4D81A 4X66M 3HHWA 5FTMA 2F5NA 1DO0A 4L16A 5JI3E 4LCBA 1J7KA 3GRRA 5H37D 2M60A 4OVZA 3THGA 1YUBA 3J80S 3TWMA 3TPZA 1HNZM 4MM3B 3GLIB 2C99A 2I7NA 1QAQA 3SARA 3IG5A 2QPAA 2ERCA 2Y0TA 4M0DA 1W5SA 1ZAEA 2R46A 1Z5AA 5FLXS 2CHGA 2R4JA 3J7AS 4KHPM 2F5QA 2R65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ4 A;  1L1Z A;  1MU5 A;  5ITT A;  4YHH M;  3W0F A;  3GPP A;  2UUA M;  5LMN M;  4DR4 M;  1K82 A;  2HKJ A;  3T1H M;  4DV4 M;  2VQE M;  4JI5 M;  1TDZ A;  2UU9 M;  5ITX A;  2OPF A;  3U6D A;  1Q3C A;  2UUB M;  1XNQ M;  5ITX E;  1EE8 A;  1IBM M;  4JI4 M;  4LF4 M;  5LMU M;  4PDI A;  1HNW M;  1N34 M;  1R2Y A;  4LFB M;  3U6C A;  4MB7 A;  4DUZ M;  4DR6 M;  1PM5 A;  4YY3 M;  3GPU A;  3GP1 A;  4G4Q A;  4OX9 M;  4DV0 M;  3GQ5 A;  5ITY A;  2F5S A;  3J81 S;  3U6E A;  4B3S M;  3U6M A;  4LF6 M;  2XZF A;  4DV3 M;  4DR7 M;  4ITQ A;  5ITR A;  4X62 M;  2UXD M;  1TDH A;  4LF7 M;  3A42 A;  2EA0 A;  3TWK A;  3U6P A;  1Z5C A;  4JI3 M;  4DR5 M;  4X64 M;  1I94 M;  3SAS A;  2VQF M;  4JI8 M;  4B3T M;  4LF9 M;  1K3W A;  1K3X A;  1HNX M;  2HHH M;  1N36 M;  1N32 M;  4K0K M;  4G4O A;  2F5O A;  2ZBK B;  4JYA M;  1MX0 A;  4AQY M;  1IBK M;  1L2C A;  4DV5 M;  3VK7 A;  1PJI A;  3GPY A;  5ITQ A;  4PDG A;  3T1Y M;  3JR5 A;  2XZU A;  4NXM M;  4JI6 M;  3JR4 A;  3SAV A;  1Q39 A;  3JAM S;  3OTO M;  3C58 A;  4X65 M;  3GO8 A;  4JI1 M;  4NRV A;  4PCZ A;  3SAW A;  4G4N A;  2ZM6 M;  1L2B A;  2F4V M;  3GQ3 A;  5IWA M;  3VK8 A;  1XNR M;  4B3M M;  1Q3B A;  4LF8 M;  3SBJ A;  1XC8 A;  4PD2 A;  4DV1 M;  4CIS A;  1NNJ A;  1HR0 M;  4JI7 M;  2UUC M;  5IT9 S;  2F5P A;  1L2D A;  3DOA A;  3GPX A;  2OQ4 A;  4G4R A;  1XMQ M;  4X66 M;  1PJJ A;  1KFV A;  4JI2 M;  2F5N A;  2UXC M;  4JV5 M;  1Z59 A;  1R2Z A;  2UXB M;  3J80 S;  3TWM A;  1HNZ M;  4NXN M;  2E5L M;  1L1T A;  1FJG M;  5ITU A;  5A2Q S;  3SAR A;  2Q2E B;  4DV6 M;  1Z5B A;  4NRW A;  1IBL M;  4B3R M;  4LFA M;  4DR2 M;  1N33 M;  4JI0 M;  1XMO M;  4DR1 M;  1Z5A A;  3SAT A;  3U6O A;  5FLX S;  4LF5 M;  3U6Q A;  3A45 A;  3A46 A;  4DR3 M;  4GKJ M;  5BR8 M;  3U6S A;  3J7A S;  4LFC M;  4DV7 M;  3SAU A;  3U6L A;  4DUY M;  1J5E M;  2F5Q A;  3TWL A;  4GKK M;  4KHP M;  4DV2 M; 
#chains in the Genus database with same CATH topology
 1QAO A;  2R0I A;  3L27 A;  5ITT A;  2LVN C;  2JY5 A;  4YHH M;  1AIP C;  4QHS A;  3GPP A;  2UUA M;  2WZJ A;  3AOE A;  1VDD A;  3R8F A;  2L09 A;  2C98 A;  1DGB A;  4L8R C;  1WJ7 A;  2JY6 B;  2KXE A;  1TDZ A;  3IHP A;  2XSZ A;  2YFQ A;  5ITX A;  3TE6 A;  4IJF A;  4AZF A;  4F1I A;  3TL4 X;  2OPF A;  3KOW E;  4LGY A;  3UMM A;  3GLG A;  1Q3C A;  5EP3 A;  4KT0 F;  3B9P A;  1IBM M;  1JR3 A;  3LVV A;  5LMU M;  1UFZ A;  2L4E A;  2LVO C;  1TR8 A;  3J7B A;  1HNW M;  3GRY A;  3I04 M;  4DUZ M;  1IN7 A;  4G6Z A;  3GPU A;  3EIE A;  3PNV A;  3LQQ A;  4II7 A;  4B08 A;  2EO2 A;  2F5S A;  4MH0 E;  3F92 A;  4S12 A;  1QVR A;  3VKH A;  2CEA A;  4GHA A;  4FWH A;  1QAN A;  4G3O A;  4LRS A;  5ITR A;  1TDH A;  2OOA A;  4IBE A;  3VKG A;  2QBY B;  2YR0 A;  3WHK A;  5DNY A;  1GL7 A;  1G4A E;  2JWS A;  2MJ5 B;  3HGI A;  1IN8 A;  3FUW A;  4MGI E;  5EP2 A;  5JI2 E;  4DR5 M;  1ZMU A;  2QZ4 A;  1ZMW A;  3FYD A;  5DYI A;  3AV0 A;  2Z4S A;  3T15 A;  2JZ0 A;  4LF9 M;  2DAG A;  1K3X A;  1NJG A;  2VII A;  4G4O A;  3EIH A;  3GLI E;  2F5O A;  3A98 B;  3HJQ A;  5FTJ A;  4LG2 A;  3FE3 A;  1OTR A;  4JYA M;  2JP7 A;  2LBC A;  2WSF F;  3PFI A;  4R71 A;  2APL A;  1L2C A;  4DV5 M;  3L25 A;  4JXJ A;  1GAB A;  2V1U A;  4QNR A;  3SHG B;  2BJW A;  1QZE A;  4PDG A;  3KXE C;  4GH9 A;  4JI6 M;  1EFU B;  3K92 A;  1Q39 A;  4IBI A;  2EUC A;  1VEK A;  2B3T A;  4CGY B;  2DI0 A;  2Z3X A;  3KS8 A;  1JR3 D;  3L29 A;  2D7G A;  2ZTC A;  4LJ4 A;  3GO8 A;  1WXQ A;  2QBY A;  1DGH B;  5FTK A;  1QDR A;  1DO2 A;  5KPR A;  2Y21 A;  4AKG A;  2W82 A;  4XK8 F;  4B3M M;  2FS1 A;  3GLF A;  2O5R A;  1XC8 A;  1SXJ B;  4IIW A;  4WUR A;  2QQ8 A;  3FYC A;  4AG5 A;  4DV1 M;  3R9X B;  1G59 A;  4M9X A;  3HKP A;  1G71 A;  1NHG C;  1L2D A;  3GRU A;  3GRV A;  3GPX A;  4JI2 M;  1AUA A;  4LZJ A;  1QDT A;  1NV9 A;  2VDB B;  2GNO A;  3DZD A;  5F3W A;  1DGH A;  2MGW A;  4LJ9 A;  2EKK A;  4FW9 A;  2E5L M;  1IXS A;  2DHR A;  3VDP A;  1E32 A;  1ZMV A;  3W67 A;  4IBC A;  2Q2E B;  4DV6 M;  1EIJ A;  1OJL A;  3HY5 A;  1IBL M;  2JZ1 A;  2Z7J A;  3J27 B;  4I5S A;  4ZPX A;  3GLI A;  4LFA M;  3PNY A;  3W0L B;  4B3R M;  2H1R A;  2DWZ B;  1SXJ D;  3HWS A;  4NC6 A;  4DR1 M;  1QUS A;  2J7O A;  4LGM A;  4LF5 M;  2LXE A;  3AOG A;  3U6Q A;  5BR8 M;  3U6S A;  4RF0 A;  1D0K A;  1XB2 B;  3C3D A;  4DV7 M;  4DUY M;  7CAT A;  1OIZ A;  3U6L A;  4LFC M;  4LY6 A;  4Z6Y A;  1L1Z A;  2QCU A;  1LTM A;  1MU5 A;  4A3V B;  3K9P A;  2C9C A;  2FOI C;  3KS4 A;  2RKO A;  4CJ6 A;  2Y20 A;  2JA2 A;  2I7P A;  2XFS A;  2K47 A;  4AW4 A;  2NQ8 C;  1QAM A;  1IQP A;  1PJS A;  1IFY A;  1PJT A;  1I4W A;  4PDI A;  4L15 A;  2KZU A;  3U60 B;  2X8A A;  3FUU A;  4M9S A;  2KEB A;  2Z8Y M;  2AHM A;  2Y0Q A;  2LTU A;  4HEO A;  2L2D A;  4BBA A;  1GLN A;  4YY3 M;  3KP0 E;  1V33 A;  4IJE A;  1XWI A;  2RGO A;  4G4Q A;  4DV0 M;  3NBX X;  4OX9 M;  2LVP C;  5ITY A;  5DYG A;  1R4G A;  4MGY E;  3B7Z A;  4QHT A;  3U6M A;  1E9R A;  1V92 A;  4LF6 M;  2QNJ A;  2XEP A;  1PRB A;  4DR7 M;  4WP2 A;  5EXP A;  4D80 A;  2UXD M;  3M0E A;  3SFZ A;  2O25 A;  3RGS A;  3H4M A;  4R7G A;  3U6P A;  1OFH A;  3DFZ A;  4JI3 M;  1OQY A;  4FWG A;  1I94 M;  3SAS A;  3UZU A;  2FNA A;  3BOS A;  3RFW A;  3U5Z B;  1R6B X;  3B74 A;  1GKI A;  3K2L A;  2HHH M;  4XBO A;  3GLG B;  3U60 A;  4K0K M;  1W5T A;  3B7Q A;  1TTE A;  3GLG E;  3AL0 C;  2KZS A;  1VEG A;  3ZC7 B;  3GPY A;  1IN4 A;  4FCW A;  3T6P A;  1X37 A;  4NOO B;  2Z4R A;  1OIP A;  1Y8G A;  2KW0 A;  3JR5 A;  2XZU A;  1QUT A;  2QP9 X;  3JAM S;  3CF2 A;  1D0L A;  1MN3 A;  4JN6 A;  3UK6 A;  3C58 A;  1XXH A;  4TUW A;  4X65 M;  1H6U A;  4P17 A;  2MRO B;  2C5R A;  2DZO B;  1DGG A;  1OAO C;  4IBG A;  4PCZ A;  3ILK A;  3KSX A;  4EIW A;  4G4N A;  3SAW A;  3VK8 A;  3AKZ A;  2XSZ D;  1YLA A;  3BXW A;  4AI6 A;  3HZJ A;  5EP1 A;  1SXJ C;  2OO9 A;  4LJ7 A;  5EP4 A;  2KNV A;  4WW0 A;  3SBJ A;  2QEN A;  1QYR A;  2KRK A;  3HJ8 A;  5EJC A;  1J09 A;  4JI7 M;  5E26 A;  3FTE A;  2DAM A;  2JUJ A;  1KFV A;  4G4R A;  1XMQ M;  2K0B X;  1Z59 A;  2LVA A;  1NNU C;  3CF6 E;  3E46 A;  2KNA A;  3I51 A;  4Q7J A;  4NXN M;  2XFT A;  3UJN A;  1HJP A;  1OAI A;  3FRI A;  2L7H A;  4QNM A;  3ZCB B;  1FJG M;  3SMS A;  4CHT B;  5A2Q S;  4GRI A;  2BWE A;  1IN5 A;  4I8O A;  2C96 A;  1HQC A;  1Z5B A;  4LJ6 A;  2P5T A;  3MJ5 A;  4IBF A;  1N33 M;  3KFU G;  1N75 A;  1NHW C;  3LW5 F;  2HWJ A;  2RRU A;  1CUK A;  4Z8X A;  3SAT A;  2XH9 A;  3MMP A;  3U6O A;  1IY1 A;  5GKN A;  3VLF B;  3HHZ A;  4DR3 M;  3FTF A;  3E9S A;  1S3S A;  1VEJ A;  4KO8 A;  3SAU A;  4GKK M;  1J5E M;  1JR3 E;  2BNK A;  3TWL A;  2R44 A;  3MHV C;  4DV2 M;  2L7I A;  4FVM A;  3GQ4 A;  3ZQJ A;  1PGY A;  1WR1 B;  3W0F A;  3W68 A;  5LMN M;  4D82 A;  4DR4 M;  5EQT A;  2HKJ A;  2YNM D;  2LWX A;  4LRT A;  4GC9 A;  4M9Z A;  3C3E A;  5IZ7 D;  4JI5 M;  1QQW A;  2UU9 M;  2QSF X;  3HU2 A;  2L6O A;  4GIT A;  3FTD A;  5IRE B;  3KOX E;  1LV7 A;  3SYL A;  1XNQ M;  1DGF A;  2C9O A;  3IG8 A;  3T38 A;  3PVS A;  4PT5 A;  3AJI B;  2BWB A;  3J2P B;  2DKL A;  1XXH B;  2J5Y A;  3NWL A;  1TH3 A;  1NV8 A;  2D7H A;  1R2Y A;  3U6C A;  3Q8X A;  4MB7 A;  4L78 A;  2KHH A;  3CF0 A;  3GLF E;  2R18 A;  4AKH A;  4FCT A;  3GP1 A;  5DFL A;  4B7F A;  1JQJ C;  3QAU A;  2G3Q A;  4NSR A;  3QWL A;  3J81 S;  1FNN A;  1OKS A;  3SHF A;  3LVW A;  4FWD A;  1GJT A;  2K9D A;  2XZF A;  3TQS A;  4DV3 M;  1YSY A;  3FUX A;  2WSC F;  2R6F A;  1XHB A;  3FKE A;  4B7H A;  4X62 M;  1G8P A;  2BJV A;  4OVZ B;  1GO5 A;  2CV0 A;  1L8Q A;  3TWK A;  1Z5C A;  1RU3 A;  1Q02 A;  2DAI A;  4R3D A;  4X64 M;  1KYI A;  4M0W A;  4B7G A;  2VQF M;  3NBI A;  2DXI A;  3PXG A;  2V6Z M;  1HNX M;  3AOE C;  4RKU F;  2OOB A;  1N36 M;  4RNA A;  2DHY A;  1TH2 A;  3U61 A;  1E94 E;  2ZAO A;  3U5Z A;  1MX0 A;  1IBK M;  1R7R A;  1SXJ E;  2CFO A;  3CTW B;  3FUT A;  5EXX A;  3T1Y M;  2HCB A;  4NXM M;  3VFD A;  3JR4 A;  4IBJ A;  4KLN A;  2YQZ A;  3SAV A;  1ORY B;  3UGJ A;  4NL4 H;  1WHC A;  1MJG M;  2CHV A;  2DNA A;  1NSF A;  5KQ8 A;  2LNH C;  2DEN A;  4JI1 M;  2HL7 A;  3HHY A;  1JB0 F;  2RGH A;  1C1K A;  2ZM6 M;  3Q8G A;  3K9O A;  1L2B A;  2F4V M;  2CHQ A;  5IWA M;  1XNR M;  3SMP A;  1NO1 A;  2R45 A;  3FTC A;  1R5L A;  2CP8 A;  3L2A A;  1V34 A;  3RE8 A;  3SC3 A;  3L26 A;  2DWL A;  1F4I A;  4PD2 A;  5E6J A;  4CIS A;  2DAK A;  3HU3 A;  2G8L A;  3M6A A;  4LJA A;  1NNJ A;  1WGL A;  1NY6 A;  1IY0 A;  2KRU A;  3LCV B;  4LJ5 A;  2F5P A;  4CIZ A;  1PJJ A;  2OQ4 A;  4AKI A;  1KSF X;  1D2N A;  4W5W A;  3V76 A;  2FFJ A;  1N77 A;  4JV5 M;  2UXC M;  3FUV A;  1R2Z A;  2CE7 A;  2UXB M;  2FE8 A;  3LQR A;  4GIP A;  2WSE F;  1L1T A;  1IXR C;  2XLJ A;  1E9S A;  1ZV1 A;  5ITU A;  1ZQ9 A;  3D8B A;  2D7E A;  3GLF B;  4REZ A;  2CRU A;  5KQD A;  4NRW A;  1NY5 A;  2MR9 A;  3I01 M;  4I81 A;  2JY8 A;  4Y28 F;  4DR2 M;  4JI0 M;  1D0M A;  3WHL A;  1NVM A;  3B89 A;  5FTN A;  2LH0 A;  1QZM A;  4MGZ E;  3KSJ A;  1XMO M;  5KPT A;  3KP1 E;  3HJS A;  4P16 A;  3A45 A;  3A46 A;  5FTL A;  4GKJ M;  4RF1 A;  2DZN B;  1IXZ A;  1SXJ A;  3VDU A;  8CAT A;  1TF0 B;  1IXS B;  1IM2 A;  2X4A A;  2X49 A;  4GMQ A;  3KW6 A;  5EXT A;  2DWN A;  3KOY E;  3RGP A;  2J7N A;  1VQ1 A;  1GVN A;  3HU1 A;  3I4V A;  1K82 A;  5BPV A;  1GL6 A;  3D8L A;  4XGI A;  4DV4 M;  3T1H M;  2VQE M;  2L4F A;  3E4R A;  3AFH A;  4FD2 A;  3CGW A;  2CWB A;  3MK6 A;  3U6D A;  3HHX A;  1N78 A;  4F2L A;  1WGN A;  3GLH E;  5FSW A;  5ITX E;  1EE8 A;  2UUB M;  1G3I A;  4JI4 M;  3GLH B;  1UM8 A;  3IEC A;  2ZAN A;  4LF4 M;  4NSO B;  2R4E A;  3QYB A;  1N34 M;  1P3Q Q;  4LFB M;  4DR6 M;  3DA1 A;  4MGH A;  1PM5 A;  1HQY E;  3KOZ E;  2DWM A;  4IBD A;  1WIV A;  4OU7 A;  2CV2 A;  3GQ5 A;  2XGN A;  4LJ8 A;  3B7N A;  4HL4 A;  2LVQ D;  4I4L A;  1TGU A;  4KOD A;  3U6E A;  2ZAM A;  2K6B A;  4B3S M;  4GC5 A;  4MGK E;  4ITQ A;  2G5G X;  1T3T A;  4LF7 M;  2KDL A;  3A42 A;  4IBB A;  2EA0 A;  5L8R F;  1VG5 A;  2R62 A;  3K1J A;  4BLC A;  3I4Y A;  1PJQ A;  3H4J A;  4DBG B;  2LHC A;  1IN6 A;  4JI8 M;  2FH0 A;  3U61 B;  4B3T M;  1YE9 A;  1K3W A;  5C18 A;  5KPZ A;  4BB9 A;  3E21 A;  1N32 M;  1SG9 A;  2ZBK B;  4ANR A;  4FCV A;  3QYE A;  2LHG A;  4IBK A;  4L6V 6;  1T43 A;  4AQY M;  1VDL A;  2XF3 A;  2HAK A;  3VK7 A;  1PJI A;  2DZL A;  3K8Z A;  2QHO B;  5KO3 A;  2KNZ A;  3FD9 A;  5ITQ A;  2VF8 A;  2DAE A;  2A5Y B;  2KA6 B;  3C9P A;  2CV1 A;  1HT1 E;  4HLQ A;  4L4U A;  4UN2 B;  3OTO M;  3SYK A;  4GHL A;  3LMM A;  2M5Z A;  1C7Y A;  3HX3 A;  3KDS E;  1OFI A;  3L28 A;  4QOZ C;  1DV0 A;  2JXN A;  2V1C A;  3M7G A;  4NRV A;  1NJF A;  4OW0 A;  2O01 F;  5EXS A;  1IY2 A;  3GQ3 A;  4GEW A;  2EJS A;  4QOS A;  1Q3B A;  4LF8 M;  1HT2 E;  2MH8 A;  4LZZ A;  5C1B A;  3BBZ A;  2CUZ A;  2VF7 A;  2H5X A;  2N35 A;  4AG6 A;  1Z6T A;  1TH4 A;  1HR0 M;  3KVW A;  3ZH9 B;  2UUC M;  3GLH A;  5IT9 S;  2DVW B;  1G41 A;  3DOA A;  4D81 A;  4X66 M;  3HHW A;  5FTM A;  2F5N A;  1DO0 A;  4L16 A;  5JI3 E;  4LCB A;  1J7K A;  3GRR A;  5H37 D;  2M60 A;  4OVZ A;  3THG A;  1YUB A;  3J80 S;  3TWM A;  3TPZ A;  1HNZ M;  4MM3 B;  3GLI B;  2C99 A;  2I7N A;  1QAQ A;  1GJS A;  1BVS A;  2JNH A;  3SAR A;  2JY7 A;  3IG5 A;  1A5T A;  2QPA A;  2ERC A;  2Y0T A;  3LCU A;  4M0D A;  1W5S A;  1ZAE A;  2R46 A;  1Z5A A;  5FLX S;  2CHG A;  2EKF A;  2R4J A;  1T6O A;  2ZTD A;  3FRH A;  3J7A S;  4KHP M;  2GQF A;  2F5Q A;  2R65 A;  1XXH E; 
#chains in the Genus database with same CATH homology
 1QAO A;  3L27 A;  5ITT A;  4YHH M;  4QHS A;  3GPP A;  2UUA M;  3AOE A;  1VDD A;  2L09 A;  2C98 A;  1DGB A;  4L8R C;  2KXE A;  1TDZ A;  2XSZ A;  2YFQ A;  5ITX A;  3TE6 A;  4IJF A;  4AZF A;  3TL4 X;  2OPF A;  3KOW E;  4LGY A;  3UMM A;  3GLG A;  1Q3C A;  5EP3 A;  1IBM M;  3B9P A;  1JR3 A;  3LVV A;  5LMU M;  3J7B A;  1HNW M;  3GRY A;  4DUZ M;  1IN7 A;  4G6Z A;  3GPU A;  3EIE A;  3PNV A;  3LQQ A;  4II7 A;  4B08 A;  2EO2 A;  2F5S A;  4MH0 E;  4S12 A;  1QVR A;  3VKH A;  2CEA A;  4GHA A;  4FWH A;  1QAN A;  4LRS A;  5ITR A;  1TDH A;  4IBE A;  3VKG A;  2QBY B;  2YR0 A;  3WHK A;  5DNY A;  1GL7 A;  1G4A E;  3HGI A;  5JI2 E;  1IN8 A;  3FUW A;  4MGI E;  5EP2 A;  4DR5 M;  2QZ4 A;  3FYD A;  5DYI A;  3AV0 A;  2Z4S A;  3T15 A;  4LF9 M;  1K3X A;  1NJG A;  2VII A;  4G4O A;  3EIH A;  2F5O A;  3A98 B;  3HJQ A;  5FTJ A;  4LG2 A;  4JYA M;  3PFI A;  1L2C A;  4DV5 M;  3L25 A;  4JXJ A;  2V1U A;  4QNR A;  3SHG B;  2BJW A;  4PDG A;  3KXE C;  4GH9 A;  4JI6 M;  3K92 A;  1Q39 A;  4IBI A;  2EUC A;  4CGY B;  2Z3X A;  3KS8 A;  1JR3 D;  3L29 A;  2D7G A;  4LJ4 A;  3GO8 A;  1WXQ A;  2QBY A;  1DGH B;  5FTK A;  1DO2 A;  5KPR A;  2Y21 A;  4AKG A;  2W82 A;  4B3M M;  3GLF A;  2O5R A;  1XC8 A;  1SXJ B;  4IIW A;  4WUR A;  3FYC A;  4AG5 A;  4DV1 M;  3R9X B;  1G59 A;  4M9X A;  3HKP A;  1NHG C;  1L2D A;  3GRU A;  3GRV A;  3GPX A;  4JI2 M;  4LZJ A;  3DZD A;  5F3W A;  1DGH A;  4LJ9 A;  4FW9 A;  2E5L M;  2DHR A;  3VDP A;  1E32 A;  4IBC A;  2Q2E B;  4DV6 M;  1OJL A;  1IBL M;  3J27 B;  2Z7J A;  4I5S A;  4ZPX A;  3GLI A;  4B3R M;  4LFA M;  3PNY A;  3W0L B;  2H1R A;  2DWZ B;  1SXJ D;  3HWS A;  4DR1 M;  2J7O A;  4LGM A;  4LF5 M;  2LXE A;  3AOG A;  3U6Q A;  5BR8 M;  3U6S A;  4RF0 A;  4LFC M;  4DV7 M;  3U6L A;  4DUY M;  7CAT A;  4LY6 A;  4Z6Y A;  1L1Z A;  2QCU A;  1MU5 A;  4A3V B;  2C9C A;  2FOI C;  3KS4 A;  2RKO A;  2Y20 A;  2JA2 A;  2I7P A;  2XFS A;  2K47 A;  4AW4 A;  2NQ8 C;  1QAM A;  1IQP A;  1I4W A;  4PDI A;  4L15 A;  2KZU A;  3U60 B;  2X8A A;  3FUU A;  4M9S A;  2KEB A;  2AHM A;  2Y0Q A;  4BBA A;  1GLN A;  4YY3 M;  3KP0 E;  4IJE A;  4G4Q A;  1XWI A;  2RGO A;  4OX9 M;  4DV0 M;  5ITY A;  5DYG A;  4MGY E;  4QHT A;  3U6M A;  1E9R A;  4LF6 M;  2XEP A;  4DR7 M;  5EXP A;  4D80 A;  2UXD M;  3M0E A;  3SFZ A;  3RGS A;  3H4M A;  4R7G A;  3U6P A;  1OFH A;  3DFZ A;  4JI3 M;  4FWG A;  1I94 M;  3SAS A;  3UZU A;  2FNA A;  3BOS A;  3RFW A;  3U5Z B;  1R6B X;  2HHH M;  1GKI A;  3K2L A;  4XBO A;  3GLG B;  3U60 A;  4K0K M;  1W5T A;  3AL0 C;  2KZS A;  3ZC7 B;  3GPY A;  1IN4 A;  4FCW A;  1X37 A;  4NOO B;  2Z4R A;  2KW0 A;  3JR5 A;  2XZU A;  2QP9 X;  3JAM S;  3CF2 A;  4JN6 A;  3C58 A;  4TUW A;  3UK6 A;  1XXH A;  4X65 M;  1H6U A;  2C5R A;  2DZO B;  1DGG A;  4IBG A;  4PCZ A;  3SAW A;  3ILK A;  3KSX A;  4EIW A;  4G4N A;  3VK8 A;  3AKZ A;  2XSZ D;  4AI6 A;  5EP1 A;  1SXJ C;  4LJ7 A;  5EP4 A;  4WW0 A;  3SBJ A;  2QEN A;  1QYR A;  2KRK A;  3HJ8 A;  5EJC A;  1J09 A;  4JI7 M;  5E26 A;  3FTE A;  1KFV A;  4G4R A;  1XMQ M;  1Z59 A;  3CF6 E;  1NNU C;  3I51 A;  3UJN A;  3R8F A;  4NXN M;  2XFT A;  4QNM A;  3ZCB B;  2L7H A;  1FJG M;  3SMS A;  4CHT B;  5A2Q S;  4GRI A;  1IN5 A;  4I8O A;  2C96 A;  1HQC A;  1Z5B A;  4LJ6 A;  2P5T A;  3MJ5 A;  4IBF A;  1N33 M;  3KFU G;  1N75 A;  1NHW C;  4Z8X A;  3SAT A;  2XH9 A;  3U6O A;  1IY1 A;  5GKN A;  3VLF B;  3HHZ A;  4DR3 M;  3FTF A;  3E9S A;  1S3S A;  4KO8 A;  3SAU A;  4GKK M;  1J5E M;  2BNK A;  3TWL A;  3MHV C;  4DV2 M;  2L7I A;  4FVM A;  3GQ4 A;  3W0F A;  5LMN M;  4D82 A;  4DR4 M;  5EQT A;  2HKJ A;  2YNM D;  2LWX A;  4LRT A;  4GC9 A;  4M9Z A;  5IZ7 D;  4JI5 M;  1QQW A;  2UU9 M;  3HU2 A;  2L6O A;  4GIT A;  3FTD A;  5IRE B;  3KOX E;  1LV7 A;  3SYL A;  1XNQ M;  1DGF A;  2C9O A;  3IG8 A;  3T38 A;  3PVS A;  4PT5 A;  3AJI B;  3J2P B;  1XXH B;  3NWL A;  1TH3 A;  2D7H A;  1R2Y A;  3U6C A;  3Q8X A;  4MB7 A;  4L78 A;  3CF0 A;  2R18 A;  4AKH A;  4FCT A;  3GP1 A;  4B7F A;  1JQJ C;  3QAU A;  4NSR A;  3QWL A;  3J81 S;  1FNN A;  3SHF A;  3LVW A;  4FWD A;  2XZF A;  3TQS A;  4DV3 M;  1YSY A;  3FUX A;  3FKE A;  1XHB A;  4B7H A;  4X62 M;  1G8P A;  2BJV A;  4OVZ B;  2CV0 A;  1L8Q A;  3TWK A;  1Z5C A;  4R3D A;  4X64 M;  1KYI A;  4M0W A;  4B7G A;  2VQF M;  3NBI A;  2DXI A;  3PXG A;  2V6Z M;  1HNX M;  3AOE C;  1N36 M;  4RNA A;  1TH2 A;  3U61 A;  1E94 E;  2ZAO A;  3U5Z A;  1MX0 A;  1IBK M;  1R7R A;  1SXJ E;  2CFO A;  3CTW B;  3FUT A;  5EXX A;  3T1Y M;  2HCB A;  4NXM M;  3VFD A;  3JR4 A;  4IBJ A;  4KLN A;  2YQZ A;  3SAV A;  1ORY B;  3UGJ A;  4NL4 H;  2CHV A;  1NSF A;  5KQ8 A;  2LNH C;  4JI1 M;  2HL7 A;  3HHY A;  2RGH A;  1C1K A;  2ZM6 M;  1L2B A;  2F4V M;  2CHQ A;  5IWA M;  1XNR M;  3SMP A;  3FTC A;  2R45 A;  3L2A A;  3SC3 A;  3RE8 A;  3L26 A;  2DWL A;  4PD2 A;  5E6J A;  4CIS A;  3HU3 A;  2G8L A;  3M6A A;  4LJA A;  1NNJ A;  1NY6 A;  1IY0 A;  2KRU A;  2F5P A;  4LJ5 A;  1PJJ A;  2OQ4 A;  4AKI A;  1KSF X;  1D2N A;  4W5W A;  2FFJ A;  1N77 A;  4JV5 M;  2UXC M;  3FUV A;  1R2Z A;  2CE7 A;  2UXB M;  2FE8 A;  3LQR A;  4GIP A;  1L1T A;  1IXR C;  2XLJ A;  1E9S A;  5ITU A;  1ZQ9 A;  3D8B A;  2D7E A;  3GLF B;  4REZ A;  5KQD A;  4NRW A;  1NY5 A;  4I81 A;  4DR2 M;  4JI0 M;  3WHL A;  1NVM A;  5FTN A;  2LH0 A;  1QZM A;  4MGZ E;  3KSJ A;  1XMO M;  5KPT A;  3KP1 E;  3HJS A;  4P16 A;  3A45 A;  3A46 A;  5FTL A;  4GKJ M;  4RF1 A;  2DZN B;  1IXZ A;  1SXJ A;  3VDU A;  8CAT A;  1IXS B;  2X49 A;  1IM2 A;  2X4A A;  4GMQ A;  3KW6 A;  5EXT A;  2DWN A;  3KOY E;  3RGP A;  2J7N A;  1GVN A;  3HU1 A;  3I4V A;  1K82 A;  5BPV A;  1GL6 A;  3D8L A;  4XGI A;  4DV4 M;  3T1H M;  2VQE M;  3E4R A;  3AFH A;  4FD2 A;  3MK6 A;  3U6D A;  1N78 A;  3HHX A;  5FSW A;  2UUB M;  5ITX E;  1EE8 A;  4JI4 M;  1G3I A;  3GLH B;  1UM8 A;  4LF4 M;  2ZAN A;  4NSO B;  2R4E A;  1N34 M;  4LFB M;  4DR6 M;  3DA1 A;  4MGH A;  1PM5 A;  1HQY E;  3KOZ E;  2DWM A;  4IBD A;  4OU7 A;  2CV2 A;  3GQ5 A;  2XGN A;  4LJ8 A;  4HL4 A;  4I4L A;  1TGU A;  4KOD A;  3U6E A;  2ZAM A;  4B3S M;  4GC5 A;  4MGK E;  4ITQ A;  2G5G X;  1T3T A;  4LF7 M;  3A42 A;  4IBB A;  2EA0 A;  2R62 A;  3K1J A;  4BLC A;  3I4Y A;  1IN6 A;  4JI8 M;  3U61 B;  4B3T M;  1YE9 A;  1K3W A;  5C18 A;  5KPZ A;  4BB9 A;  1N32 M;  2ZBK B;  4FCV A;  4IBK A;  4AQY M;  2XF3 A;  3VK7 A;  1PJI A;  3K8Z A;  5KO3 A;  3FD9 A;  5ITQ A;  2A5Y B;  2KA6 B;  2CV1 A;  1HT1 E;  4HLQ A;  4L4U A;  3OTO M;  4GHL A;  3SYK A;  3LMM A;  2M5Z A;  3KDS E;  3L28 A;  1OFI A;  4QOZ C;  2V1C A;  3M7G A;  4NRV A;  1NJF A;  4OW0 A;  5EXS A;  1IY2 A;  3GQ3 A;  4QOS A;  1Q3B A;  4LF8 M;  1HT2 E;  4LZZ A;  5C1B A;  2CUZ A;  4AG6 A;  1Z6T A;  1TH4 A;  1HR0 M;  3KVW A;  3ZH9 B;  2UUC M;  3GLH A;  5IT9 S;  2DVW B;  1G41 A;  3DOA A;  4D81 A;  4X66 M;  3HHW A;  5FTM A;  2F5N A;  1DO0 A;  4L16 A;  5JI3 E;  4LCB A;  1J7K A;  3GRR A;  5H37 D;  2M60 A;  4OVZ A;  3THG A;  1YUB A;  3J80 S;  3TWM A;  3TPZ A;  1HNZ M;  4MM3 B;  3GLI B;  2C99 A;  2I7N A;  1QAQ A;  3SAR A;  3IG5 A;  2QPA A;  2ERC A;  2Y0T A;  4M0D A;  1W5S A;  1ZAE A;  2R46 A;  1Z5A A;  5FLX S;  2CHG A;  2R4J A;  3J7A S;  4KHP M;  2F5Q A;  2R65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...