4B3SM

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3sM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3sM02
4DR6M 2XZUA 1Q3CA 2XZFA 1K82A 4JI8M 4X66M 5ITYA 5ITRA 2OPFA 4DUZM 2Q2EB 5LMNM 1N32M 4MB7A 4PDGA 4NXMM 4LF6M 2E5LM 1R2YA 4PCZA 4DR7M 4G4OA 1MU5A 3J80S 3GQ3A 3J81S 2VQFM 3SAUA 4DV0M 3U6QA 4JI4M 4GKKM 2UXCM 4NXNM 2EA0A 5ITXE 1L2CA 4NRVA 4X64M 4G4QA 4JI2M 5BR8M 3GPXA 4G4NA 3A45A 1Q39A 1L1TA 4LF9M 3SBJA 4DV5M 4CISA 1XC8A 1FJGM 3TWKA 4B3SM 3T1HM 4DV4M 3T1YM 1L2BA 3SAVA 1XNQM 3GP1A 4PDIA 4X65M 5IWAM 4OX9M 3U6OA 2UUBM 5FLXS 1Q3BA 3SARA 3JR5A 3U6EA 1PJIA 5LMUM 3TWLA 1IBLM 3SASA 2HHHM 1I94M 1K3XA 5ITQA 3VK7A 3GPPA 3U6SA 4LFCM 5IT9S 1N36M 2F5PA 4K0KM 4JI3M 2UUCM 2VQEM 2ZBKB 1PJJA 1Z59A 1R2ZA 4B3TM 1XNRM 4JI5M 1NNJA 1K3WA 2HKJA 3GPUA 4X62M 3JAMS 3GQ5A 1N33M 1Z5BA 3DOAA 3JR4A 2UXDM 5ITXA 3GO8A 1HNWM 4DUYM 4KHPM 1Z5AA 2UUAM 3W0FA 3GPYA 4DR2M 4DR1M 3U6PA 3SAWA 2F5SA 4DV3M 3U6DA 1IBMM 4JI1M 2OQ4A 4DV7M 3U6CA 3J7AS 1HR0M 3A46A 4DR5M 1TDHA 4YHHM 4GKJM 3GQ4A 1L2DA 4NRWA 1XMOM 4LF4M 4JV5M 4JI6M 5ITTA 4PD2A 2F5NA 4G4RA 2F5OA 4JYAM 3SATA 1HNZM 1L1ZA 4JI7M 4B3RM 4DR4M 1EE8A 3TWMA 4LF8M 4ITQA 4JI0M 2F5QA 5A2QS 3VK8A 1N34M 3A42A 3C58A 4DV1M 1J5EM 1Z5CA 2ZM6M 3U6LA 1HNXM 2F4VM 2UXBM 1XMQM 2UU9M 4DV6M 4DV2M 4B3MM 4LF5M 5ITUA 3OTOM 4LFBM 1PM5A 1KFVA 1MX0A 4LF7M 4LFAM 1TDZA 3U6MA 4YY3M 4DR3M 1IBKM 4AQYM
chains in the Genus database with same CATH superfamily
1NVMA 3D8BA 4DR6M 3VKHA 1Q3CA 2CHGA 2LVNC 4HL4A 3KFUG 1XHBA 1N32M 4LJ4A 2KNZA 2E5LM 4PCZA 3NBIA 1OFHA 1MU5A 4FD2A 4G4OA 1WIVA 4GHAA 4JI4M 2VIIA 3SAUA 4DV0M 2KNVA 2UXCM 3I01M 3M7GA 4IBGA 2O25A 3T38A 2BJWA 4R3DA 3E21A 2MROB 1PJSA 3R8FA 4LF9M 2Y20A 4DV5M 1G41A 1XC8A 1D0MA 5DFLA 4CISA 3KDSE 1L2BA 4II7A 1NV9A 1FNNA 4UN2B 2R4JA 2BWBA 2D7GA 4G6ZA 3W0LB 5IWAM 3PNVA 1SXJE 3K92A 5JI2E 4LY6A 2ZTDA 3B7QA 4D81A 1TF0B 1YE9A 2FOIC 2L09A 3U6EA 3U6CA 3VDPA 2K6BA 3HGIA 3KSJA 2CP8A 1WHCA 5H37D 1GABA 2OO9A 2HCBA 3FE3A 1D2NA 5EXSA 3U60A 3GPPA 3U6SA 3VK7A 4B08A 5F3WA 4FCVA 1GKIA 1TH2A 2MR9A 1NY6A 2F5PA 1VDLA 4K0KM 1IN5A 4JI3M 2UUCM 3AFHA 2QSFX 4GC9A 1Z59A 4HLQA 2J7OA 3UK6A 4GRIA 5FTKA 4B3TM 2QNJA 3GPUA 2MGWA 2FH0A 1NV8A 2WZJA 3GRRA 1VEGA 4X62M 1N33M 2L7IA 4AW4A 1F4IA 3HJQA 4CGYB 4P17A 3UMMA 1G8PA 3B7ZA 3UGJA 2RRUA 1C1KA 3LVVA 1IN4A 3AJIB 4LJ8A 2YQZA 1SG9A 5FTNA 2F5SA 1GJTA 4FW9A 3R9XB 2LBCA 2WSEF 4OW0A 4DV3M 3LCUA 3U6DA 2L7HA 2D7EA 5DYGA 3FTFA 3FTEA 1YUBA 3HHYA 1NNUC 3BBZA 5EXPA 4I8OA 1WR1B 4JI1M 2KW0A 3FYCA 1IN7A 4GEWA 4DV7M 1L2DA 2FS1A 3SYKA 4JI6M 3VKGA 3I4YA 1OQYA 3BXWA 3EIHA 1DGHA 3GLHA 3PNYA 2F5OA 3M6AA 4JI7M 3I4VA 1HNZM 1E94E 3SMSA 4B3RM 1G59A 5C18A 1EE8A 3KW6A 4Z8XA 2ZANA 3B89A 2CV2A 4MH0E 4QNMA 4JI0M 3AOEC 3RE8A 3WHLA 4OVZB 3KSXA 4GH9A 3LCVB 1VDDA 3KS4A 1Q02A 2K47A 3QWLA 4B7GA 2OOAA 2YNMD 3FRIA 1EFUB 1SXJC 4L16A 3U5ZA 2QHOB 3LQRA 4RNAA 3UZUA 1WXQA 3TL4X 1R4GA 4I4LA 4LZZA 3OTOM 4WURA 4LFBM 1A5TA 5KQDA 4KLNA 5FTLA 3QYEA 4GHLA 2MH8A 3GLGB 3W68A 2R46A 2LVPC 1QAOA 1OIZA 2J5YA 4DR7M 2Z3XA 1W5SA 3K1JA 4AZFA 3TPZA 3LMMA 1JR3D 3NWLA 2XZUA 4MM3B 2XZFA 1LV7A 4DUZM 1UFZA 2Q2EB 2APLA 2R18A 2XFSA 3HZJA 5E6JA 4ANRA 2QPAA 2KDLA 4PDGA 4LF6M 5JI3E 1VG5A 1GL6A 4AKGA 2VQFM 4RF1A 3U6QA 1P3QQ 4NXNM 1L2CA 1TH3A 4LJAA 4G4QA 2G8LA 3NBXX 5BR8M 3SFZA 3A45A 3J27B 4G4NA 1J09A 2BJVA 2KEBA 1UM8A 1FJGM 2DAMA 3VFDA 2I7NA 4DV4M 3SAVA 2W82A 2LWXA 4D80A 4W5WA 5DYIA 2DI0A 2CEAA 3GRUA 1GO5A 2JA2A 2L4FA 1VEJA 5FLXS 4IBCA 3HHWA 1J7KA 2CWBA 3GLFA 3GLIB 4IJEA 4XBOA 3SARA 3FRHA 2VF7A 1ZMUA 3L28A 2C98A 4IIWA 2J7NA 1JR3A 5KPRA 5LMNM 2R62A 1BVSA 1LTMA 3HHXA 4WW0A 1IBLM 2HHHM 3CF0A 3GLHE 2DENA 5EJCA 3B9PA 1IN8A 2AHMA 1DGBA 1OFIA 5IT9S 3FD9A 3U61A 1XXHA 2DZLA 1C7YA 3K9PA 2ZBKB 1MN3A 1R2ZA 4NOOB 4JI5M 1IQPA 2HKJA 3SHFA 1OAIA 2C99A 4JXJA 3GQ5A 3DOAA 3JR4A 4GITA 3AL0C 5ITXA 3GO8A 1VEKA 3IG5A 4M9ZA 2DAGA 2R6FA 4QNRA 2DXIA 4IBJA 4HEOA 2UUAM 3W0FA 2B3TA 3GPYA 3FUTA 2XLJA 3HKPA 3SAWA 2QBYA 2Y0TA 1IXSA 1WGLA 3HY5A 1QAQA 3KOZE 4L78A 1IBMM 4QOSA 1G4AE 3KOYE 2OQ4A 2X8AA 4IBBA 2CHQA 2JZ0A 1OTRA 3J7AS 4CIZA 2KRUA 3M0EA 2H1RA 4IBDA 1ORYB 4LGYA 5EP1A 2A5YB 2JUJA 2WSFF 1TR8A 5BPVA 4YHHM 3KOXE 3A46A 4DR5M 3HHZA 2KNAA 4GKJM 1ZMWA 2CE7A 1XMOM 1W5TA 1DGGA 2ZAMA 2V6ZM 4LF4M 4BB9A 4I81A 4G4RA 4LJ9A 2N35A 5IREB 4IJFA 4F1IA 3VLFB 4DR4M 4BBAA 1X37A 3FUVA 2LVQD 1DO2A 2RGHA 1XWIA 5A2QS 2G5GX 1WGNA 2DKLA 3A42A 3C58A 2FFJA 4MGIE 3RGSA 1HNXM 5FTJA 1TH4A 1OJLA 2EUCA 2DWZB 3I04M 3LW5F 4B3MM 3SMPA 1VQ1A 8CATA 5ITUA 3GLFE 4LF5M 4CHTB 5E26A 1MX0A 3DZDA 1IY2A 1TDZA 1V34A 1JR3E 4YY3M 1WJ7A 3E46A 2L2DA 3MK6A 2ZTCA 2VDBB 2O5RA 5IZ7D 3H4JA 3A98B 1SXJB 1R5LA 2CFOA 2C5RA 3TQSA 1NSFA 2LHGA 1QZEA 1GLNA 4LRSA 1XXHE 5ITRA 3Q8XA 2OPFA 1ZMVA 2DNAA 4MB7A 2QQ8A 2LH0A 4GIPA 1R2YA 1GJSA 5C1BA 3ZH9B 2WSCF 3J80S 1TGUA 4GMQA 3GQ3A 4GKKM 2P5TA 1QYRA 5ITXE 1S3SA 2Y0QA 7CATA 2QP9X 2XSZD 2Z4RA 3GPXA 4LRTA 3QAUA 1L1TA 1GL7A 3TWKA 2R44A 3T1HM 3T1YM 4NSOB 1KYIA 1NY5A 1QANA 1QQWA 2JY5A 5EP4A 3U6OA 1YSYA 1Q3BA 2CHVA 4IBFA 4LGMA 1OAOC 1IM2A 1JQJC 5LMUM 2JP7A 4FVMA 2HL7A 4CJ6A 3L25A 2DZNB 2JY7A 4Z6YA 2M60A 4IBIA 3SHGB 1PGYA 4M0WA 3L26A 5ITQA 2O01F 3ZCBB 3FTCA 3HX3A 4F2LA 4LFCM 4LJ5A 4ZPXA 3T6PA 4LJ7A 1N36M 2KZUA 3W67A 1PJJA 4QOZC 3FTDA 1Z6TA 2XEPA 2LHCA 1L8QA 1XNRM 1PJTA 4L6V6 4LJ6A 4OVZA 1NNJA 2XSZA 2KHHA 4MGHA 1T3TA 4AG6A 5FTMA 1Z5BA 3JAMS 2DAIA 3LVWA 2ERCA 2EO2A 1QDRA 2JWSA 4I5SA 1HNWM 3IECA 4DUYM 2QCUA 1NHWC 4FWHA 4L15A 4KHPM 1E32A 1Z5AA 3C9PA 4FCWA 1AIPC 1RU3A 1MJGM 2R45A 4KODA 4AG5A 2Z4SA 4DBGB 2DWNA 3RFWA 2L6OA 1KSFX 1OKSA 3BOSA 3E9SA 3GLGA 3FYDA 4FCTA 1NJFA 1YLAA 1HT1E 5EXXA 3SYLA 1N77A 3ZQJA 2C9CA 4RF0A 1D0LA 5L8RF 4AKHA 4FWDA 1QZMA 3C3EA 1HR0M 1IY1A 2R0IA 1TDHA 2X49A 2ZAOA 4NRWA 2L4EA 4XK8F 4XGIA 2Z8YM 5ITTA 3KVWA 1E9SA 5KPZA 2CV0A 4WP2A 1EIJA 2DAEA 2C96A 5EP2A 1NJGA 3KXEC 3RGPA 1L1ZA 1D0KA 2DVWB 3U60B 2EJSA 4MGYE 2DWLA 4G3OA 5EQTA 2LVAA 3KP0E 2LTUA 1N78A 1H6UA 4IBKA 4IBEA 5GKNA 3TWMA 4LF8M 4ITQA 3DFZA 2F5QA 3PVSA 1ZAEA 3FKEA 1DGFA 1NHGC 2G3QA 3QYBA 1G71A 3HU1A 1IN6A 1PRBA 4DV1M 2MJ5B 2V1UA 1Z5CA 2DAKA 2ZM6M 3GRVA 1PJQA 2UXBM 1V33A 5KO3A 2XH9A 2UU9M 1ZQ9A 4R7GA 4DV2M 2GNOA 2R65A 4R71A 3GLIA 4KT0F 1KFVA 1OIPA 3D8LA 2JY8A 4QHSA 3ILKA 4MGKE 3CF2A 2JY6B 3HJSA 1IY0A 1CUKA 1IBKM 2XGNA 2C9OA 3DA1A 3PFIA 1JB0F 4FWGA 1GVNA 1K82A 4JI8M 4X66M 3B7NA 5ITYA 2FNAA 1HQYE 4NXMM 2GQFA 2VF8A 4BLCA 4LZJA 4TUWA 1DGHB 3GLHB 3IG8A 4M0DA 4D82A 3FUUA 2KZSA 4S12A 3J81S 2KRKA 1E9RA 2EA0A 2HWJA 2DWMA 4NRVA 4X64M 2D7HA 1R7RA 3Q8GA 4JI2M 1Q39A 3B74A 4Q7JA 5FSWA 3CTWB 1AUAA 1T43A 1V92A 3ZC7B 4EIWA 3SBJA 4LG2A 4B3SM 3FUXA 4Y28F 5EP3A 3GLGE 2I7PA 1XNQM 4A3VB 3GP1A 2YFQA 2M5ZA 4PDIA 4X65M 3U5ZB 4KO8A 3L2AA 2UUBM 2FE8A 4OX9M 3MHVC 4B7FA 2HAKA 1HT2E 4NL4H 2BNKA 3JR5A 4P16A 3J2PB 1HJPA 1PJIA 1SXJD 3TWLA 1IXRC 3K2LA 3SASA 3LQQA 4RKUF 1IFYA 2KXEA 3TE6A 1K3XA 1I94M 1QAMA 4AKIA 1N75A 1NO1A 2JZ1A 2CV1A 3K8ZA 1HQCA 5EXTA 1Y8GA 2VQEM 1R6BX 2X4AA 3KS8A 4M9SA 1K3WA 5KPTA 3HJ8A 2UXDM 2H5XA 3CGWA 2DHYA 3THGA 2V1CA 4NSRA 1QDTA 1G3IA 2QZ4A 2EKFA 2RKOA 3GRYA 3HWSA 3AOEA 2KA6B 3GLIE 4DR1M 4DR2M 3U6PA 3WHKA 1XB2B 4L4UA 3FUWA 2RGOA 3I51A 2JNHA 2Z7JA 1I4WA 4NC6A 4PT5A 4B7HA 2JXNA 3F92A 1SXJA 4JN6A 4QHTA 3MMPA 1QVRA 3GLFB 3AOGA 4M9XA 3HU2A 2CUZA 2XF3A 4L8RC 3AKZA 4GC5A 3L29A 3GQ4A 4JV5M 3T15A 1T6OA 2K0BX 3UJNA 3KOWE 4PD2A 1QUSA 1QUTA 3L27A 1DO0A 2F5NA 4JYAM 2EKKA 3SATA 2LXEA 3HU3A 3J7BA 2DHRA 3CF6E 2NQ8C 4LCBA 3SC3A 3PXGA 5DNYA 3U61B 1XXHB 3C3DA 2K9DA 3E4RA 2DZOB 1TTEA 3H4MA 3VK8A 3IHPA 1DV0A 3AV0A 1N34M 2YR0A 4MGZE 1J5EM 3V76A 3U6LA 2QENA 2F4VM 3K9OA 3MJ5A 1ZV1A 1XMQM 3VDUA 4DV6M 2LVOC 2LNHC 1IXZA 3EIEA 2XFTA 4REZA 1PM5A 2QBYB 2BWEA 4LF7M 1IXSB 4AI6A 4LFAM 2OOBA 4OU7A 3U6MA 4DR3M 2R4EA 2Y21A 5KQ8A 4AQYM 2CRUA 3KP1E
chains in the Genus database with same CATH topology
1NVMA 3D8BA 4DR6M 3VKHA 1Q3CA 2CHGA 4HL4A 3KFUG 1XHBA 1N32M 4LJ4A 2E5LM 4PCZA 3NBIA 1OFHA 1MU5A 4FD2A 4G4OA 4GHAA 4JI4M 2VIIA 3SAUA 4DV0M 2UXCM 3M7GA 4IBGA 3T38A 2BJWA 4R3DA 3R8FA 4LF9M 2Y20A 4DV5M 1G41A 1XC8A 4CISA 3KDSE 1L2BA 4II7A 1FNNA 2R4JA 2D7GA 4G6ZA 3W0LB 5IWAM 3PNVA 1SXJE 3K92A 5JI2E 4LY6A 4D81A 1YE9A 2FOIC 2L09A 3U6EA 3VDPA 3HGIA 3KSJA 5H37D 2HCBA 1D2NA 5EXSA 3U60A 3GPPA 3U6SA 3VK7A 4B08A 5F3WA 4FCVA 1GKIA 1TH2A 2F5PA 1NY6A 4K0KM 1IN5A 4JI3M 2UUCM 3AFHA 4GC9A 1Z59A 4HLQA 2J7OA 3UK6A 4GRIA 5FTKA 4B3TM 3GPUA 3GRRA 4X62M 1N33M 2L7IA 4AW4A 3HJQA 4CGYB 3UMMA 1G8PA 3UGJA 1C1KA 3LVVA 1IN4A 3AJIB 4LJ8A 2YQZA 5FTNA 2F5SA 4FW9A 3R9XB 4OW0A 4DV3M 3U6DA 2L7HA 2D7EA 5DYGA 3FTFA 3FTEA 1YUBA 3HHYA 1NNUC 5EXPA 4JI1M 4I8OA 2KW0A 3FYCA 1IN7A 1L2DA 3SYKA 4JI6M 3VKGA 3I4YA 3EIHA 1DGHA 3GLHA 3PNYA 2F5OA 3M6AA 4JI7M 3I4VA 1HNZM 1E94E 3SMSA 4B3RM 1G59A 5C18A 1EE8A 3KW6A 4Z8XA 2ZANA 2CV2A 4MH0E 4QNMA 4JI0M 3AOEC 3RE8A 3WHLA 4OVZB 3KSXA 4GH9A 1VDDA 3KS4A 2K47A 3QWLA 4B7GA 2YNMD 1SXJC 4L16A 3U5ZA 3LQRA 4RNAA 3UZUA 1WXQA 3TL4X 4I4LA 4LZZA 3OTOM 4WURA 4LFBM 5KQDA 4KLNA 5FTLA 4GHLA 3GLGB 2R46A 1QAOA 4DR7M 2Z3XA 3K1JA 1W5SA 4AZFA 3TPZA 3LMMA 1JR3D 3NWLA 2XZUA 4MM3B 2XZFA 1LV7A 4DUZM 2Q2EB 2XFSA 5E6JA 2R18A 5LMNM 4PDGA 2QPAA 4LF6M 5JI3E 1GL6A 4AKGA 2VQFM 4RF1A 3U6QA 4NXNM 1L2CA 1TH3A 4LJAA 4G4QA 2G8LA 5BR8M 3SFZA 3A45A 3J27B 4G4NA 1J09A 2BJVA 2KEBA 1UM8A 1FJGM 3VFDA 2I7NA 4DV4M 3SAVA 2W82A 2LWXA 4D80A 4W5WA 5DYIA 2CEAA 3GRUA 2JA2A 5FLXS 4IBCA 3HHWA 1J7KA 3GLFA 3GLIB 3SARA 4IJEA 4XBOA 5KPRA 3L28A 2C98A 4IIWA 2J7NA 1JR3A 2R62A 4WW0A 3HHXA 1IBLM 2HHHM 3CF0A 5EJCA 3B9PA 1IN8A 2AHMA 1DGBA 1OFIA 5IT9S 3FD9A 3U61A 1XXHA 2ZBKB 1R2ZA 4NOOB 4JI5M 1IQPA 2HKJA 3SHFA 2C99A 4JXJA 3GQ5A 3DOAA 3JR4A 4GITA 3AL0C 5ITXA 3GO8A 3IG5A 4M9ZA 4QNRA 2DXIA 4IBJA 2UUAM 3W0FA 3GPYA 3FUTA 2XLJA 3HKPA 3SAWA 2QBYA 2Y0TA 3KOZE 1QAQA 4L78A 1IBMM 4QOSA 1G4AE 3KOYE 2OQ4A 2X8AA 4IBBA 2CHQA 3J7AS 2KRUA 3M0EA 2H1RA 4IBDA 1ORYB 4LGYA 5EP1A 2A5YB 5BPVA 3A46A 4DR5M 4YHHM 3KOXE 4GKJM 3HHZA 2CE7A 1XMOM 1W5TA 1DGGA 2ZAMA 2V6ZM 4LF4M 4BB9A 4I81A 4G4RA 4LJ9A 5IREB 4IJFA 3VLFB 4DR4M 4BBAA 1X37A 3FUVA 1DO2A 2RGHA 1XWIA 5A2QS 2G5GX 3A42A 3C58A 2FFJA 4MGIE 3RGSA 1HNXM 5FTJA 1TH4A 1OJLA 2EUCA 2DWZB 4B3MM 3SMPA 8CATA 5ITUA 4LF5M 4CHTB 5E26A 1MX0A 3DZDA 1IY2A 1TDZA 4YY3M 3MK6A 2O5RA 5IZ7D 3A98B 1SXJB 2CFOA 2C5RA 3TQSA 1NSFA 1GLNA 4LRSA 5ITRA 2OPFA 3Q8XA 4MB7A 2LH0A 4GIPA 1R2YA 5C1BA 3ZH9B 3J80S 3GQ3A 1TGUA 4GMQA 4GKKM 2P5TA 1QYRA 5ITXE 1S3SA 2Y0QA 7CATA 2QP9X 2XSZD 2Z4RA 3GPXA 4LRTA 3QAUA 1L1TA 1GL7A 3TWKA 3T1HM 3T1YM 4NSOB 1KYIA 1NY5A 1QANA 1QQWA 5EP4A 3U6OA 1YSYA 1Q3BA 2CHVA 4IBFA 4LGMA 1IM2A 1JQJC 5LMUM 4FVMA 2HL7A 3L25A 2DZNB 4Z6YA 2M60A 4IBIA 3SHGB 4M0WA 3L26A 5ITQA 3ZCBB 3FTCA 4LFCM 4LJ5A 4ZPXA 1N36M 4LJ7A 2KZUA 1PJJA 4QOZC 3FTDA 1Z6TA 2XEPA 1L8QA 1XNRM 4OVZA 4LJ6A 1NNJA 2XSZA 4MGHA 4AG6A 1T3TA 3JAMS 5FTMA 1Z5BA 3LVWA 2ERCA 2EO2A 1HNWM 4I5SA 4DUYM 2QCUA 1NHWC 4FWHA 4L15A 4KHPM 1E32A 1Z5AA 4FCWA 4KODA 2R45A 4AG5A 2DWNA 2Z4SA 3RFWA 2L6OA 1KSFX 3BOSA 3E9SA 3GLGA 3FYDA 4FCTA 1NJFA 1N77A 1HT1E 5EXXA 3SYLA 2C9CA 4RF0A 4AKHA 4FWDA 1QZMA 1HR0M 1IY1A 1TDHA 2X49A 2ZAOA 4NRWA 4XGIA 5ITTA 3KVWA 1E9SA 5KPZA 2CV0A 2C96A 5EP2A 1NJGA 3KXEC 3RGPA 1L1ZA 2DVWB 3U60B 4MGYE 2DWLA 5EQTA 3KP0E 1N78A 1H6UA 4IBKA 4IBEA 5GKNA 3TWMA 4LF8M 4ITQA 3DFZA 2F5QA 3PVSA 1ZAEA 3FKEA 1DGFA 1NHGC 3HU1A 1IN6A 4DV1M 2V1UA 1Z5CA 2ZM6M 3GRVA 2UXBM 5KO3A 2XH9A 2UU9M 1ZQ9A 4R7GA 4DV2M 2R65A 3GLIA 1KFVA 3D8LA 4QHSA 3ILKA 4MGKE 3CF2A 3HJSA 1IY0A 1IBKM 2XGNA 2C9OA 3DA1A 3PFIA 4FWGA 1GVNA 1K82A 4JI8M 4X66M 5ITYA 2FNAA 1HQYE 4NXMM 4TUWA 4BLCA 4LZJA 1DGHB 3GLHB 3IG8A 4M0DA 4D82A 3FUUA 2KZSA 4S12A 3J81S 2KRKA 1E9RA 2EA0A 2DWMA 4NRVA 4X64M 2D7HA 1R7RA 4JI2M 1Q39A 5FSWA 3CTWB 3ZC7B 3SBJA 4LG2A 4EIWA 4B3SM 3FUXA 5EP3A 1XNQM 2I7PA 4A3VB 3GP1A 2YFQA 2M5ZA 4PDIA 4X65M 3U5ZB 4KO8A 3L2AA 2UUBM 2FE8A 4OX9M 3MHVC 4B7FA 1HT2E 4NL4H 2BNKA 3JR5A 4P16A 3J2PB 1PJIA 1SXJD 3TWLA 1IXRC 3K2LA 3SASA 3LQQA 2KXEA 3TE6A 1K3XA 1I94M 1QAMA 4AKIA 1N75A 2CV1A 3K8ZA 1HQCA 5EXTA 2VQEM 1R6BX 2X4AA 3KS8A 4M9SA 1K3WA 5KPTA 3HJ8A 2UXDM 3THGA 2V1CA 4NSRA 1G3IA 2QZ4A 2RKOA 3GRYA 3HWSA 4DR1M 3AOEA 2KA6B 4DR2M 3U6PA 3WHKA 4L4UA 3FUWA 2RGOA 3I51A 2Z7JA 1I4WA 4PT5A 4B7HA 4DV7M 4JN6A 1SXJA 4QHTA 3U6CA 3GLFB 1QVRA 3AOGA 4M9XA 3HU2A 2CUZA 2XF3A 4L8RC 3AKZA 4GC5A 3L29A 3GQ4A 4JV5M 3T15A 3UJNA 3KOWE 4PD2A 3L27A 1DO0A 2F5NA 4JYAM 3SATA 2LXEA 3HU3A 3J7BA 2DHRA 3CF6E 2NQ8C 4LCBA 3SC3A 3PXGA 5DNYA 3U61B 1XXHB 3E4RA 2DZOB 3H4MA 3VK8A 3AV0A 1N34M 2YR0A 4MGZE 1J5EM 3U6LA 2QENA 2F4VM 3MJ5A 1XMQM 3VDUA 4DV6M 2LNHC 1IXZA 3EIEA 2XFTA 4REZA 1PM5A 2QBYB 4LF7M 1IXSB 4AI6A 4LFAM 4OU7A 3U6MA 4DR3M 2R4EA 2Y21A 5KQ8A 4AQYM 3KP1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 M;  2XZU A;  1Q3C A;  2XZF A;  1K82 A;  4JI8 M;  4X66 M;  5ITY A;  5ITR A;  2OPF A;  4DUZ M;  2Q2E B;  5LMN M;  1N32 M;  4MB7 A;  4PDG A;  4NXM M;  4LF6 M;  2E5L M;  1R2Y A;  4PCZ A;  4DR7 M;  4G4O A;  1MU5 A;  3J80 S;  3GQ3 A;  3J81 S;  2VQF M;  3SAU A;  4DV0 M;  3U6Q A;  4JI4 M;  4GKK M;  2UXC M;  4NXN M;  2EA0 A;  5ITX E;  1L2C A;  4NRV A;  4X64 M;  4G4Q A;  4JI2 M;  5BR8 M;  3GPX A;  4G4N A;  3A45 A;  1Q39 A;  1L1T A;  4LF9 M;  3SBJ A;  4DV5 M;  4CIS A;  1XC8 A;  1FJG M;  3TWK A;  4B3S M;  3T1H M;  4DV4 M;  3T1Y M;  1L2B A;  3SAV A;  1XNQ M;  3GP1 A;  4PDI A;  4X65 M;  5IWA M;  4OX9 M;  3U6O A;  2UUB M;  5FLX S;  1Q3B A;  3SAR A;  3JR5 A;  3U6E A;  1PJI A;  5LMU M;  3TWL A;  1IBL M;  3SAS A;  2HHH M;  1I94 M;  1K3X A;  5ITQ A;  3VK7 A;  3GPP A;  3U6S A;  4LFC M;  5IT9 S;  1N36 M;  2F5P A;  4K0K M;  4JI3 M;  2UUC M;  2VQE M;  2ZBK B;  1PJJ A;  1Z59 A;  1R2Z A;  4B3T M;  1XNR M;  4JI5 M;  1NNJ A;  1K3W A;  2HKJ A;  3GPU A;  4X62 M;  3JAM S;  3GQ5 A;  1N33 M;  1Z5B A;  3DOA A;  3JR4 A;  2UXD M;  5ITX A;  3GO8 A;  1HNW M;  4DUY M;  4KHP M;  1Z5A A;  2UUA M;  3W0F A;  3GPY A;  4DR2 M;  4DR1 M;  3U6P A;  3SAW A;  2F5S A;  4DV3 M;  3U6D A;  1IBM M;  4JI1 M;  2OQ4 A;  4DV7 M;  3U6C A;  3J7A S;  1HR0 M;  3A46 A;  4DR5 M;  1TDH A;  4YHH M;  4GKJ M;  3GQ4 A;  1L2D A;  4NRW A;  1XMO M;  4LF4 M;  4JV5 M;  4JI6 M;  5ITT A;  4PD2 A;  2F5N A;  4G4R A;  2F5O A;  4JYA M;  3SAT A;  1HNZ M;  1L1Z A;  4JI7 M;  4B3R M;  4DR4 M;  1EE8 A;  3TWM A;  4LF8 M;  4ITQ A;  4JI0 M;  2F5Q A;  5A2Q S;  3VK8 A;  1N34 M;  3A42 A;  3C58 A;  4DV1 M;  1J5E M;  1Z5C A;  2ZM6 M;  3U6L A;  1HNX M;  2F4V M;  2UXB M;  1XMQ M;  2UU9 M;  4DV6 M;  4DV2 M;  4B3M M;  4LF5 M;  5ITU A;  3OTO M;  4LFB M;  1PM5 A;  1KFV A;  1MX0 A;  4LF7 M;  4LFA M;  1TDZ A;  3U6M A;  4YY3 M;  4DR3 M;  1IBK M;  4AQY M; 
#chains in the Genus database with same CATH topology
 1NVM A;  3D8B A;  4DR6 M;  3VKH A;  1Q3C A;  2CHG A;  2LVN C;  4HL4 A;  3KFU G;  1XHB A;  1N32 M;  4LJ4 A;  2KNZ A;  2E5L M;  4PCZ A;  3NBI A;  1OFH A;  1MU5 A;  4FD2 A;  4G4O A;  1WIV A;  4GHA A;  4JI4 M;  2VII A;  3SAU A;  4DV0 M;  2KNV A;  2UXC M;  3I01 M;  3M7G A;  4IBG A;  2O25 A;  3T38 A;  2BJW A;  4R3D A;  3E21 A;  2MRO B;  1PJS A;  3R8F A;  4LF9 M;  2Y20 A;  4DV5 M;  1G41 A;  1XC8 A;  1D0M A;  5DFL A;  4CIS A;  3KDS E;  1L2B A;  4II7 A;  1NV9 A;  1FNN A;  4UN2 B;  2R4J A;  2BWB A;  2D7G A;  4G6Z A;  3W0L B;  5IWA M;  3PNV A;  1SXJ E;  3K92 A;  5JI2 E;  4LY6 A;  2ZTD A;  3B7Q A;  4D81 A;  1TF0 B;  1YE9 A;  2FOI C;  2L09 A;  3U6E A;  3U6C A;  3VDP A;  2K6B A;  3HGI A;  3KSJ A;  2CP8 A;  1WHC A;  5H37 D;  1GAB A;  2OO9 A;  2HCB A;  3FE3 A;  1D2N A;  5EXS A;  3U60 A;  3GPP A;  3U6S A;  3VK7 A;  4B08 A;  5F3W A;  4FCV A;  1GKI A;  1TH2 A;  2MR9 A;  1NY6 A;  2F5P A;  1VDL A;  4K0K M;  1IN5 A;  4JI3 M;  2UUC M;  3AFH A;  2QSF X;  4GC9 A;  1Z59 A;  4HLQ A;  2J7O A;  3UK6 A;  4GRI A;  5FTK A;  4B3T M;  2QNJ A;  3GPU A;  2MGW A;  2FH0 A;  1NV8 A;  2WZJ A;  3GRR A;  1VEG A;  4X62 M;  1N33 M;  2L7I A;  4AW4 A;  1F4I A;  3HJQ A;  4CGY B;  4P17 A;  3UMM A;  1G8P A;  3B7Z A;  3UGJ A;  2RRU A;  1C1K A;  3LVV A;  1IN4 A;  3AJI B;  4LJ8 A;  2YQZ A;  1SG9 A;  5FTN A;  2F5S A;  1GJT A;  4FW9 A;  3R9X B;  2LBC A;  2WSE F;  4OW0 A;  4DV3 M;  3LCU A;  3U6D A;  2L7H A;  2D7E A;  5DYG A;  3FTF A;  3FTE A;  1YUB A;  3HHY A;  1NNU C;  3BBZ A;  5EXP A;  4I8O A;  1WR1 B;  4JI1 M;  2KW0 A;  3FYC A;  1IN7 A;  4GEW A;  4DV7 M;  1L2D A;  2FS1 A;  3SYK A;  4JI6 M;  3VKG A;  3I4Y A;  1OQY A;  3BXW A;  3EIH A;  1DGH A;  3GLH A;  3PNY A;  2F5O A;  3M6A A;  4JI7 M;  3I4V A;  1HNZ M;  1E94 E;  3SMS A;  4B3R M;  1G59 A;  5C18 A;  1EE8 A;  3KW6 A;  4Z8X A;  2ZAN A;  3B89 A;  2CV2 A;  4MH0 E;  4QNM A;  4JI0 M;  3AOE C;  3RE8 A;  3WHL A;  4OVZ B;  3KSX A;  4GH9 A;  3LCV B;  1VDD A;  3KS4 A;  1Q02 A;  2K47 A;  3QWL A;  4B7G A;  2OOA A;  2YNM D;  3FRI A;  1EFU B;  1SXJ C;  4L16 A;  3U5Z A;  2QHO B;  3LQR A;  4RNA A;  3UZU A;  1WXQ A;  3TL4 X;  1R4G A;  4I4L A;  4LZZ A;  3OTO M;  4WUR A;  4LFB M;  1A5T A;  5KQD A;  4KLN A;  5FTL A;  3QYE A;  4GHL A;  2MH8 A;  3GLG B;  3W68 A;  2R46 A;  2LVP C;  1QAO A;  1OIZ A;  2J5Y A;  4DR7 M;  2Z3X A;  1W5S A;  3K1J A;  4AZF A;  3TPZ A;  3LMM A;  1JR3 D;  3NWL A;  2XZU A;  4MM3 B;  2XZF A;  1LV7 A;  4DUZ M;  1UFZ A;  2Q2E B;  2APL A;  2R18 A;  2XFS A;  3HZJ A;  5E6J A;  4ANR A;  2QPA A;  2KDL A;  4PDG A;  4LF6 M;  5JI3 E;  1VG5 A;  1GL6 A;  4AKG A;  2VQF M;  4RF1 A;  3U6Q A;  1P3Q Q;  4NXN M;  1L2C A;  1TH3 A;  4LJA A;  4G4Q A;  2G8L A;  3NBX X;  5BR8 M;  3SFZ A;  3A45 A;  3J27 B;  4G4N A;  1J09 A;  2BJV A;  2KEB A;  1UM8 A;  1FJG M;  2DAM A;  3VFD A;  2I7N A;  4DV4 M;  3SAV A;  2W82 A;  2LWX A;  4D80 A;  4W5W A;  5DYI A;  2DI0 A;  2CEA A;  3GRU A;  1GO5 A;  2JA2 A;  2L4F A;  1VEJ A;  5FLX S;  4IBC A;  3HHW A;  1J7K A;  2CWB A;  3GLF A;  3GLI B;  4IJE A;  4XBO A;  3SAR A;  3FRH A;  2VF7 A;  1ZMU A;  3L28 A;  2C98 A;  4IIW A;  2J7N A;  1JR3 A;  5KPR A;  5LMN M;  2R62 A;  1BVS A;  1LTM A;  3HHX A;  4WW0 A;  1IBL M;  2HHH M;  3CF0 A;  3GLH E;  2DEN A;  5EJC A;  3B9P A;  1IN8 A;  2AHM A;  1DGB A;  1OFI A;  5IT9 S;  3FD9 A;  3U61 A;  1XXH A;  2DZL A;  1C7Y A;  3K9P A;  2ZBK B;  1MN3 A;  1R2Z A;  4NOO B;  4JI5 M;  1IQP A;  2HKJ A;  3SHF A;  1OAI A;  2C99 A;  4JXJ A;  3GQ5 A;  3DOA A;  3JR4 A;  4GIT A;  3AL0 C;  5ITX A;  3GO8 A;  1VEK A;  3IG5 A;  4M9Z A;  2DAG A;  2R6F A;  4QNR A;  2DXI A;  4IBJ A;  4HEO A;  2UUA M;  3W0F A;  2B3T A;  3GPY A;  3FUT A;  2XLJ A;  3HKP A;  3SAW A;  2QBY A;  2Y0T A;  1IXS A;  1WGL A;  3HY5 A;  1QAQ A;  3KOZ E;  4L78 A;  1IBM M;  4QOS A;  1G4A E;  3KOY E;  2OQ4 A;  2X8A A;  4IBB A;  2CHQ A;  2JZ0 A;  1OTR A;  3J7A S;  4CIZ A;  2KRU A;  3M0E A;  2H1R A;  4IBD A;  1ORY B;  4LGY A;  5EP1 A;  2A5Y B;  2JUJ A;  2WSF F;  1TR8 A;  5BPV A;  4YHH M;  3KOX E;  3A46 A;  4DR5 M;  3HHZ A;  2KNA A;  4GKJ M;  1ZMW A;  2CE7 A;  1XMO M;  1W5T A;  1DGG A;  2ZAM A;  2V6Z M;  4LF4 M;  4BB9 A;  4I81 A;  4G4R A;  4LJ9 A;  2N35 A;  5IRE B;  4IJF A;  4F1I A;  3VLF B;  4DR4 M;  4BBA A;  1X37 A;  3FUV A;  2LVQ D;  1DO2 A;  2RGH A;  1XWI A;  5A2Q S;  2G5G X;  1WGN A;  2DKL A;  3A42 A;  3C58 A;  2FFJ A;  4MGI E;  3RGS A;  1HNX M;  5FTJ A;  1TH4 A;  1OJL A;  2EUC A;  2DWZ B;  3I04 M;  3LW5 F;  4B3M M;  3SMP A;  1VQ1 A;  8CAT A;  5ITU A;  3GLF E;  4LF5 M;  4CHT B;  5E26 A;  1MX0 A;  3DZD A;  1IY2 A;  1TDZ A;  1V34 A;  1JR3 E;  4YY3 M;  1WJ7 A;  3E46 A;  2L2D A;  3MK6 A;  2ZTC A;  2VDB B;  2O5R A;  5IZ7 D;  3H4J A;  3A98 B;  1SXJ B;  1R5L A;  2CFO A;  2C5R A;  3TQS A;  1NSF A;  2LHG A;  1QZE A;  1GLN A;  4LRS A;  1XXH E;  5ITR A;  3Q8X A;  2OPF A;  1ZMV A;  2DNA A;  4MB7 A;  2QQ8 A;  2LH0 A;  4GIP A;  1R2Y A;  1GJS A;  5C1B A;  3ZH9 B;  2WSC F;  3J80 S;  1TGU A;  4GMQ A;  3GQ3 A;  4GKK M;  2P5T A;  1QYR A;  5ITX E;  1S3S A;  2Y0Q A;  7CAT A;  2QP9 X;  2XSZ D;  2Z4R A;  3GPX A;  4LRT A;  3QAU A;  1L1T A;  1GL7 A;  3TWK A;  2R44 A;  3T1H M;  3T1Y M;  4NSO B;  1KYI A;  1NY5 A;  1QAN A;  1QQW A;  2JY5 A;  5EP4 A;  3U6O A;  1YSY A;  1Q3B A;  2CHV A;  4IBF A;  4LGM A;  1OAO C;  1IM2 A;  1JQJ C;  5LMU M;  2JP7 A;  4FVM A;  2HL7 A;  4CJ6 A;  3L25 A;  2DZN B;  2JY7 A;  4Z6Y A;  2M60 A;  4IBI A;  3SHG B;  1PGY A;  4M0W A;  3L26 A;  5ITQ A;  2O01 F;  3ZCB B;  3FTC A;  3HX3 A;  4F2L A;  4LFC M;  4LJ5 A;  4ZPX A;  3T6P A;  4LJ7 A;  1N36 M;  2KZU A;  3W67 A;  1PJJ A;  4QOZ C;  3FTD A;  1Z6T A;  2XEP A;  2LHC A;  1L8Q A;  1XNR M;  1PJT A;  4L6V 6;  4LJ6 A;  4OVZ A;  1NNJ A;  2XSZ A;  2KHH A;  4MGH A;  1T3T A;  4AG6 A;  5FTM A;  1Z5B A;  3JAM S;  2DAI A;  3LVW A;  2ERC A;  2EO2 A;  1QDR A;  2JWS A;  4I5S A;  1HNW M;  3IEC A;  4DUY M;  2QCU A;  1NHW C;  4FWH A;  4L15 A;  4KHP M;  1E32 A;  1Z5A A;  3C9P A;  4FCW A;  1AIP C;  1RU3 A;  1MJG M;  2R45 A;  4KOD A;  4AG5 A;  2Z4S A;  4DBG B;  2DWN A;  3RFW A;  2L6O A;  1KSF X;  1OKS A;  3BOS A;  3E9S A;  3GLG A;  3FYD A;  4FCT A;  1NJF A;  1YLA A;  1HT1 E;  5EXX A;  3SYL A;  1N77 A;  3ZQJ A;  2C9C A;  4RF0 A;  1D0L A;  5L8R F;  4AKH A;  4FWD A;  1QZM A;  3C3E A;  1HR0 M;  1IY1 A;  2R0I A;  1TDH A;  2X49 A;  2ZAO A;  4NRW A;  2L4E A;  4XK8 F;  4XGI A;  2Z8Y M;  5ITT A;  3KVW A;  1E9S A;  5KPZ A;  2CV0 A;  4WP2 A;  1EIJ A;  2DAE A;  2C96 A;  5EP2 A;  1NJG A;  3KXE C;  3RGP A;  1L1Z A;  1D0K A;  2DVW B;  3U60 B;  2EJS A;  4MGY E;  2DWL A;  4G3O A;  5EQT A;  2LVA A;  3KP0 E;  2LTU A;  1N78 A;  1H6U A;  4IBK A;  4IBE A;  5GKN A;  3TWM A;  4LF8 M;  4ITQ A;  3DFZ A;  2F5Q A;  3PVS A;  1ZAE A;  3FKE A;  1DGF A;  1NHG C;  2G3Q A;  3QYB A;  1G71 A;  3HU1 A;  1IN6 A;  1PRB A;  4DV1 M;  2MJ5 B;  2V1U A;  1Z5C A;  2DAK A;  2ZM6 M;  3GRV A;  1PJQ A;  2UXB M;  1V33 A;  5KO3 A;  2XH9 A;  2UU9 M;  1ZQ9 A;  4R7G A;  4DV2 M;  2GNO A;  2R65 A;  4R71 A;  3GLI A;  4KT0 F;  1KFV A;  1OIP A;  3D8L A;  2JY8 A;  4QHS A;  3ILK A;  4MGK E;  3CF2 A;  2JY6 B;  3HJS A;  1IY0 A;  1CUK A;  1IBK M;  2XGN A;  2C9O A;  3DA1 A;  3PFI A;  1JB0 F;  4FWG A;  1GVN A;  1K82 A;  4JI8 M;  4X66 M;  3B7N A;  5ITY A;  2FNA A;  1HQY E;  4NXM M;  2GQF A;  2VF8 A;  4BLC A;  4LZJ A;  4TUW A;  1DGH B;  3GLH B;  3IG8 A;  4M0D A;  4D82 A;  3FUU A;  2KZS A;  4S12 A;  3J81 S;  2KRK A;  1E9R A;  2EA0 A;  2HWJ A;  2DWM A;  4NRV A;  4X64 M;  2D7H A;  1R7R A;  3Q8G A;  4JI2 M;  1Q39 A;  3B74 A;  4Q7J A;  5FSW A;  3CTW B;  1AUA A;  1T43 A;  1V92 A;  3ZC7 B;  4EIW A;  3SBJ A;  4LG2 A;  4B3S M;  3FUX A;  4Y28 F;  5EP3 A;  3GLG E;  2I7P A;  1XNQ M;  4A3V B;  3GP1 A;  2YFQ A;  2M5Z A;  4PDI A;  4X65 M;  3U5Z B;  4KO8 A;  3L2A A;  2UUB M;  2FE8 A;  4OX9 M;  3MHV C;  4B7F A;  2HAK A;  1HT2 E;  4NL4 H;  2BNK A;  3JR5 A;  4P16 A;  3J2P B;  1HJP A;  1PJI A;  1SXJ D;  3TWL A;  1IXR C;  3K2L A;  3SAS A;  3LQQ A;  4RKU F;  1IFY A;  2KXE A;  3TE6 A;  1K3X A;  1I94 M;  1QAM A;  4AKI A;  1N75 A;  1NO1 A;  2JZ1 A;  2CV1 A;  3K8Z A;  1HQC A;  5EXT A;  1Y8G A;  2VQE M;  1R6B X;  2X4A A;  3KS8 A;  4M9S A;  1K3W A;  5KPT A;  3HJ8 A;  2UXD M;  2H5X A;  3CGW A;  2DHY A;  3THG A;  2V1C A;  4NSR A;  1QDT A;  1G3I A;  2QZ4 A;  2EKF A;  2RKO A;  3GRY A;  3HWS A;  3AOE A;  2KA6 B;  3GLI E;  4DR1 M;  4DR2 M;  3U6P A;  3WHK A;  1XB2 B;  4L4U A;  3FUW A;  2RGO A;  3I51 A;  2JNH A;  2Z7J A;  1I4W A;  4NC6 A;  4PT5 A;  4B7H A;  2JXN A;  3F92 A;  1SXJ A;  4JN6 A;  4QHT A;  3MMP A;  1QVR A;  3GLF B;  3AOG A;  4M9X A;  3HU2 A;  2CUZ A;  2XF3 A;  4L8R C;  3AKZ A;  4GC5 A;  3L29 A;  3GQ4 A;  4JV5 M;  3T15 A;  1T6O A;  2K0B X;  3UJN A;  3KOW E;  4PD2 A;  1QUS A;  1QUT A;  3L27 A;  1DO0 A;  2F5N A;  4JYA M;  2EKK A;  3SAT A;  2LXE A;  3HU3 A;  3J7B A;  2DHR A;  3CF6 E;  2NQ8 C;  4LCB A;  3SC3 A;  3PXG A;  5DNY A;  3U61 B;  1XXH B;  3C3D A;  2K9D A;  3E4R A;  2DZO B;  1TTE A;  3H4M A;  3VK8 A;  3IHP A;  1DV0 A;  3AV0 A;  1N34 M;  2YR0 A;  4MGZ E;  1J5E M;  3V76 A;  3U6L A;  2QEN A;  2F4V M;  3K9O A;  3MJ5 A;  1ZV1 A;  1XMQ M;  3VDU A;  4DV6 M;  2LVO C;  2LNH C;  1IXZ A;  3EIE A;  2XFT A;  4REZ A;  1PM5 A;  2QBY B;  2BWE A;  4LF7 M;  1IXS B;  4AI6 A;  4LFA M;  2OOB A;  4OU7 A;  3U6M A;  4DR3 M;  2R4E A;  2Y21 A;  5KQ8 A;  4AQY M;  2CRU A;  3KP1 E; 
#chains in the Genus database with same CATH homology
 1NVM A;  3D8B A;  4DR6 M;  3VKH A;  1Q3C A;  2CHG A;  4HL4 A;  3KFU G;  1XHB A;  1N32 M;  4LJ4 A;  2E5L M;  4PCZ A;  3NBI A;  1OFH A;  1MU5 A;  4FD2 A;  4G4O A;  4GHA A;  4JI4 M;  2VII A;  3SAU A;  4DV0 M;  2UXC M;  3M7G A;  4IBG A;  3T38 A;  2BJW A;  4R3D A;  3R8F A;  4LF9 M;  2Y20 A;  4DV5 M;  1G41 A;  1XC8 A;  4CIS A;  3KDS E;  1L2B A;  4II7 A;  1FNN A;  2R4J A;  2D7G A;  4G6Z A;  3W0L B;  5IWA M;  3PNV A;  1SXJ E;  3K92 A;  5JI2 E;  4LY6 A;  4D81 A;  1YE9 A;  2FOI C;  2L09 A;  3U6E A;  3VDP A;  3HGI A;  3KSJ A;  5H37 D;  2HCB A;  1D2N A;  5EXS A;  3U60 A;  3GPP A;  3U6S A;  3VK7 A;  4B08 A;  5F3W A;  4FCV A;  1GKI A;  1TH2 A;  2F5P A;  1NY6 A;  4K0K M;  1IN5 A;  4JI3 M;  2UUC M;  3AFH A;  4GC9 A;  1Z59 A;  4HLQ A;  2J7O A;  3UK6 A;  4GRI A;  5FTK A;  4B3T M;  3GPU A;  3GRR A;  4X62 M;  1N33 M;  2L7I A;  4AW4 A;  3HJQ A;  4CGY B;  3UMM A;  1G8P A;  3UGJ A;  1C1K A;  3LVV A;  1IN4 A;  3AJI B;  4LJ8 A;  2YQZ A;  5FTN A;  2F5S A;  4FW9 A;  3R9X B;  4OW0 A;  4DV3 M;  3U6D A;  2L7H A;  2D7E A;  5DYG A;  3FTF A;  3FTE A;  1YUB A;  3HHY A;  1NNU C;  5EXP A;  4JI1 M;  4I8O A;  2KW0 A;  3FYC A;  1IN7 A;  1L2D A;  3SYK A;  4JI6 M;  3VKG A;  3I4Y A;  3EIH A;  1DGH A;  3GLH A;  3PNY A;  2F5O A;  3M6A A;  4JI7 M;  3I4V A;  1HNZ M;  1E94 E;  3SMS A;  4B3R M;  1G59 A;  5C18 A;  1EE8 A;  3KW6 A;  4Z8X A;  2ZAN A;  2CV2 A;  4MH0 E;  4QNM A;  4JI0 M;  3AOE C;  3RE8 A;  3WHL A;  4OVZ B;  3KSX A;  4GH9 A;  1VDD A;  3KS4 A;  2K47 A;  3QWL A;  4B7G A;  2YNM D;  1SXJ C;  4L16 A;  3U5Z A;  3LQR A;  4RNA A;  3UZU A;  1WXQ A;  3TL4 X;  4I4L A;  4LZZ A;  3OTO M;  4WUR A;  4LFB M;  5KQD A;  4KLN A;  5FTL A;  4GHL A;  3GLG B;  2R46 A;  1QAO A;  4DR7 M;  2Z3X A;  3K1J A;  1W5S A;  4AZF A;  3TPZ A;  3LMM A;  1JR3 D;  3NWL A;  2XZU A;  4MM3 B;  2XZF A;  1LV7 A;  4DUZ M;  2Q2E B;  2XFS A;  5E6J A;  2R18 A;  5LMN M;  4PDG A;  2QPA A;  4LF6 M;  5JI3 E;  1GL6 A;  4AKG A;  2VQF M;  4RF1 A;  3U6Q A;  4NXN M;  1L2C A;  1TH3 A;  4LJA A;  4G4Q A;  2G8L A;  5BR8 M;  3SFZ A;  3A45 A;  3J27 B;  4G4N A;  1J09 A;  2BJV A;  2KEB A;  1UM8 A;  1FJG M;  3VFD A;  2I7N A;  4DV4 M;  3SAV A;  2W82 A;  2LWX A;  4D80 A;  4W5W A;  5DYI A;  2CEA A;  3GRU A;  2JA2 A;  5FLX S;  4IBC A;  3HHW A;  1J7K A;  3GLF A;  3GLI B;  3SAR A;  4IJE A;  4XBO A;  5KPR A;  3L28 A;  2C98 A;  4IIW A;  2J7N A;  1JR3 A;  2R62 A;  4WW0 A;  3HHX A;  1IBL M;  2HHH M;  3CF0 A;  5EJC A;  3B9P A;  1IN8 A;  2AHM A;  1DGB A;  1OFI A;  5IT9 S;  3FD9 A;  3U61 A;  1XXH A;  2ZBK B;  1R2Z A;  4NOO B;  4JI5 M;  1IQP A;  2HKJ A;  3SHF A;  2C99 A;  4JXJ A;  3GQ5 A;  3DOA A;  3JR4 A;  4GIT A;  3AL0 C;  5ITX A;  3GO8 A;  3IG5 A;  4M9Z A;  4QNR A;  2DXI A;  4IBJ A;  2UUA M;  3W0F A;  3GPY A;  3FUT A;  2XLJ A;  3HKP A;  3SAW A;  2QBY A;  2Y0T A;  3KOZ E;  1QAQ A;  4L78 A;  1IBM M;  4QOS A;  1G4A E;  3KOY E;  2OQ4 A;  2X8A A;  4IBB A;  2CHQ A;  3J7A S;  2KRU A;  3M0E A;  2H1R A;  4IBD A;  1ORY B;  4LGY A;  5EP1 A;  2A5Y B;  5BPV A;  3A46 A;  4DR5 M;  4YHH M;  3KOX E;  4GKJ M;  3HHZ A;  2CE7 A;  1XMO M;  1W5T A;  1DGG A;  2ZAM A;  2V6Z M;  4LF4 M;  4BB9 A;  4I81 A;  4G4R A;  4LJ9 A;  5IRE B;  4IJF A;  3VLF B;  4DR4 M;  4BBA A;  1X37 A;  3FUV A;  1DO2 A;  2RGH A;  1XWI A;  5A2Q S;  2G5G X;  3A42 A;  3C58 A;  2FFJ A;  4MGI E;  3RGS A;  1HNX M;  5FTJ A;  1TH4 A;  1OJL A;  2EUC A;  2DWZ B;  4B3M M;  3SMP A;  8CAT A;  5ITU A;  4LF5 M;  4CHT B;  5E26 A;  1MX0 A;  3DZD A;  1IY2 A;  1TDZ A;  4YY3 M;  3MK6 A;  2O5R A;  5IZ7 D;  3A98 B;  1SXJ B;  2CFO A;  2C5R A;  3TQS A;  1NSF A;  1GLN A;  4LRS A;  5ITR A;  2OPF A;  3Q8X A;  4MB7 A;  2LH0 A;  4GIP A;  1R2Y A;  5C1B A;  3ZH9 B;  3J80 S;  3GQ3 A;  1TGU A;  4GMQ A;  4GKK M;  2P5T A;  1QYR A;  5ITX E;  1S3S A;  2Y0Q A;  7CAT A;  2QP9 X;  2XSZ D;  2Z4R A;  3GPX A;  4LRT A;  3QAU A;  1L1T A;  1GL7 A;  3TWK A;  3T1H M;  3T1Y M;  4NSO B;  1KYI A;  1NY5 A;  1QAN A;  1QQW A;  5EP4 A;  3U6O A;  1YSY A;  1Q3B A;  2CHV A;  4IBF A;  4LGM A;  1IM2 A;  1JQJ C;  5LMU M;  4FVM A;  2HL7 A;  3L25 A;  2DZN B;  4Z6Y A;  2M60 A;  4IBI A;  3SHG B;  4M0W A;  3L26 A;  5ITQ A;  3ZCB B;  3FTC A;  4LFC M;  4LJ5 A;  4ZPX A;  1N36 M;  4LJ7 A;  2KZU A;  1PJJ A;  4QOZ C;  3FTD A;  1Z6T A;  2XEP A;  1L8Q A;  1XNR M;  4OVZ A;  4LJ6 A;  1NNJ A;  2XSZ A;  4MGH A;  4AG6 A;  1T3T A;  3JAM S;  5FTM A;  1Z5B A;  3LVW A;  2ERC A;  2EO2 A;  1HNW M;  4I5S A;  4DUY M;  2QCU A;  1NHW C;  4FWH A;  4L15 A;  4KHP M;  1E32 A;  1Z5A A;  4FCW A;  4KOD A;  2R45 A;  4AG5 A;  2DWN A;  2Z4S A;  3RFW A;  2L6O A;  1KSF X;  3BOS A;  3E9S A;  3GLG A;  3FYD A;  4FCT A;  1NJF A;  1N77 A;  1HT1 E;  5EXX A;  3SYL A;  2C9C A;  4RF0 A;  4AKH A;  4FWD A;  1QZM A;  1HR0 M;  1IY1 A;  1TDH A;  2X49 A;  2ZAO A;  4NRW A;  4XGI A;  5ITT A;  3KVW A;  1E9S A;  5KPZ A;  2CV0 A;  2C96 A;  5EP2 A;  1NJG A;  3KXE C;  3RGP A;  1L1Z A;  2DVW B;  3U60 B;  4MGY E;  2DWL A;  5EQT A;  3KP0 E;  1N78 A;  1H6U A;  4IBK A;  4IBE A;  5GKN A;  3TWM A;  4LF8 M;  4ITQ A;  3DFZ A;  2F5Q A;  3PVS A;  1ZAE A;  3FKE A;  1DGF A;  1NHG C;  3HU1 A;  1IN6 A;  4DV1 M;  2V1U A;  1Z5C A;  2ZM6 M;  3GRV A;  2UXB M;  5KO3 A;  2XH9 A;  2UU9 M;  1ZQ9 A;  4R7G A;  4DV2 M;  2R65 A;  3GLI A;  1KFV A;  3D8L A;  4QHS A;  3ILK A;  4MGK E;  3CF2 A;  3HJS A;  1IY0 A;  1IBK M;  2XGN A;  2C9O A;  3DA1 A;  3PFI A;  4FWG A;  1GVN A;  1K82 A;  4JI8 M;  4X66 M;  5ITY A;  2FNA A;  1HQY E;  4NXM M;  4TUW A;  4BLC A;  4LZJ A;  1DGH B;  3GLH B;  3IG8 A;  4M0D A;  4D82 A;  3FUU A;  2KZS A;  4S12 A;  3J81 S;  2KRK A;  1E9R A;  2EA0 A;  2DWM A;  4NRV A;  4X64 M;  2D7H A;  1R7R A;  4JI2 M;  1Q39 A;  5FSW A;  3CTW B;  3ZC7 B;  3SBJ A;  4LG2 A;  4EIW A;  4B3S M;  3FUX A;  5EP3 A;  1XNQ M;  2I7P A;  4A3V B;  3GP1 A;  2YFQ A;  2M5Z A;  4PDI A;  4X65 M;  3U5Z B;  4KO8 A;  3L2A A;  2UUB M;  2FE8 A;  4OX9 M;  3MHV C;  4B7F A;  1HT2 E;  4NL4 H;  2BNK A;  3JR5 A;  4P16 A;  3J2P B;  1PJI A;  1SXJ D;  3TWL A;  1IXR C;  3K2L A;  3SAS A;  3LQQ A;  2KXE A;  3TE6 A;  1K3X A;  1I94 M;  1QAM A;  4AKI A;  1N75 A;  2CV1 A;  3K8Z A;  1HQC A;  5EXT A;  2VQE M;  1R6B X;  2X4A A;  3KS8 A;  4M9S A;  1K3W A;  5KPT A;  3HJ8 A;  2UXD M;  3THG A;  2V1C A;  4NSR A;  1G3I A;  2QZ4 A;  2RKO A;  3GRY A;  3HWS A;  4DR1 M;  3AOE A;  2KA6 B;  4DR2 M;  3U6P A;  3WHK A;  4L4U A;  3FUW A;  2RGO A;  3I51 A;  2Z7J A;  1I4W A;  4PT5 A;  4B7H A;  4DV7 M;  4JN6 A;  1SXJ A;  4QHT A;  3U6C A;  3GLF B;  1QVR A;  3AOG A;  4M9X A;  3HU2 A;  2CUZ A;  2XF3 A;  4L8R C;  3AKZ A;  4GC5 A;  3L29 A;  3GQ4 A;  4JV5 M;  3T15 A;  3UJN A;  3KOW E;  4PD2 A;  3L27 A;  1DO0 A;  2F5N A;  4JYA M;  3SAT A;  2LXE A;  3HU3 A;  3J7B A;  2DHR A;  3CF6 E;  2NQ8 C;  4LCB A;  3SC3 A;  3PXG A;  5DNY A;  3U61 B;  1XXH B;  3E4R A;  2DZO B;  3H4M A;  3VK8 A;  3AV0 A;  1N34 M;  2YR0 A;  4MGZ E;  1J5E M;  3U6L A;  2QEN A;  2F4V M;  3MJ5 A;  1XMQ M;  3VDU A;  4DV6 M;  2LNH C;  1IXZ A;  3EIE A;  2XFT A;  4REZ A;  1PM5 A;  2QBY B;  4LF7 M;  1IXS B;  4AI6 A;  4LFA M;  4OU7 A;  3U6M A;  4DR3 M;  2R4E A;  2Y21 A;  5KQ8 A;  4AQY M;  3KP1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...