4B3SM

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3sM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3sM02
3SAWA 1N33M 4GKJM 5ITXE 2OPFA 4DR3M 4JYAM 3U6DA 5FLXS 5IT9S 4DR6M 3GQ5A 3C58A 1Q3BA 3OTOM 4DR5M 4DV3M 3GO8A 4LFBM 3JR4A 4DV7M 1MX0A 2UXCM 2UUBM 4PDIA 2ZBKB 3SAVA 3SATA 4DV4M 3GPYA 4LF7M 3JAMS 4LF6M 4LF4M 1FJGM 4CISA 4YY3M 2UXBM 4JI0M 5ITQA 2ZM6M 1IBLM 1L2BA 3T1HM 3A42A 4DV5M 2EA0A 4NXMM 1HNWM 3GPPA 3GPXA 2UUAM 3U6EA 3A46A 1K3XA 1N34M 1KFVA 2F5QA 4OX9M 1L1ZA 4LFAM 1HNXM 3SARA 4K0KM 4ITQA 4X65M 3SASA 4DR7M 4YHHM 3VK7A 3VK8A 3TWKA 1Q3CA 4DV6M 4B3RM 4G4NA 1Q39A 1IBKM 1XNQM 3U6PA 4MB7A 1PJIA 2UUCM 5ITTA 4G4RA 3U6SA 3W0FA 4G4QA 1XMQM 4GKKM 4NRWA 4X62M 5LMUM 4JV5M 3GP1A 2HHHM 4PDGA 5ITRA 4DV0M 3J80S 2XZUA 3TWMA 4LF5M 3U6OA 4NRVA 5ITXA 2VQFM 1R2YA 1EE8A 1PJJA 4JI2M 4B3TM 4DUZM 4B3SM 3U6LA 3SAUA 5ITYA 5A2QS 4DR2M 5LMNM 3T1YM 3J81S 2VQEM 1PM5A 3GQ4A 1Z59A 1N36M 4JI8M 4LFCM 3DOAA 3J7AS 1MU5A 1TDHA 1L2DA 4DV1M 4JI7M 3GQ3A 4X66M 1I94M 1XNRM 5IWAM 3JR5A 4DUYM 2E5LM 4LF8M 3A45A 4JI5M 1HNZM 3U6MA 4AQYM 1TDZA 4DR4M 1Z5BA 3TWLA 1Z5CA 1L1TA 1N32M 4DR1M 1XC8A 1J5EM 4JI1M 5BR8M 4G4OA 3U6CA 2F5OA 1HR0M 2UXDM 2F5SA 2XZFA 2Q2EB 1K3WA 3U6QA 3GPUA 4NXNM 1NNJA 2F5NA 4B3MM 4JI6M 4PD2A 4X64M 4LF9M 4DV2M 2HKJA 4KHPM 1IBMM 3SBJA 1XMOM 1L2CA 2F5PA 4JI4M 2UU9M 2F4VM 4JI3M 2OQ4A 4PCZA 1K82A 1R2ZA 5ITUA 1Z5AA
chains in the Genus database with same CATH superfamily
2R44A 1T3TA 2YR0A 3MMPA 4IBIA 5F3WA 5ITXE 4DR3M 2C9CA 2Y0QA 5FLXS 2G3QA 4R71A 1IXSB 3E46A 5JI2E 3B7NA 3FYDA 3HU3A 3J27B 4G6ZA 4FVMA 2DWNA 4DV3M 3L26A 4LFBM 1DV0A 3KS4A 3B89A 4AI6A 1MX0A 2LH0A 1Y8GA 5DYGA 4GEWA 2UXCM 2K6BA 2HCBA 4L78A 2JZ0A 1YSYA 4IBBA 1FNNA 2Z8YM 2OO9A 2JNHA 4CISA 2H1RA 1NV8A 2C96A 2Y21A 4AKGA 1IBLM 3KP1E 4B7FA 1L2BA 2KA6B 4QOSA 4D80A 4DV5M 1OKSA 3T1HM 4IJEA 2WSFF 5JI3E 2DAKA 1NO1A 3WHLA 1DGBA 1N34M 1KFVA 4FCVA 4K0KM 1L1ZA 4LFAM 2I7NA 2A5YB 2WZJA 3T6PA 5FTLA 2QBYA 4DR7M 3H4MA 1JR3E 1Q3CA 3VKGA 1DGHA 2EUCA 1PGYA 2EO2A 4KLNA 4B3RM 3LVWA 4IBKA 4F2LA 5ITTA 3KW6A 4IIWA 2HWJA 5IZ7D 2J7OA 2K9DA 3HWSA 4A3VB 4G4QA 3Q8GA 3V76A 2DZNB 3B9PA 2H5XA 1Z6TA 3FRHA 4R7GA 2YFQA 3GP1A 4AZFA 2R4EA 2O5RA 3D8BA 2LHCA 4DV0M 5GKNA 2XZUA 4FWHA 1WGLA 4IBJA 3TWMA 1OAOC 1JR3D 4TUWA 3IHPA 3GRVA 1GLNA 2V6ZM 4NRVA 2BWEA 3KVWA 4QOZC 2Z7JA 1DGFA 1EE8A 2CHQA 1PJJA 1IN7A 3SMPA 4B3TM 3T38A 3GLHA 5A2QS 3AKZA 1TR8A 3L29A 4MH0E 3A98B 2QZ4A 1PM5A 1XHBA 1NNUC 2KXEA 4JI8M 1DGHB 4LFCM 4Y28F 2DZOB 1TDHA 2CV2A 4I5SA 1XNRM 4X66M 3DZDA 2XF3A 4Z6YA 5E6JA 4CGYB 2L7IA 2RGHA 3JR5A 2KRUA 3PVSA 5FTJA 1HT2E 1WHCA 1HNZM 1T6OA 1BVSA 2DVWB 2C9OA 1QAOA 1E9RA 2ZTDA 3UMMA 1Z5BA 4XK8F 3HHZA 4AG5A 1TTEA 4LJ8A 1IN6A 5EXTA 4JI1M 1OJLA 4G4OA 3U6CA 2NQ8C 3TE6A 1XXHE 2C98A 2AHMA 3C3DA 1SXJE 2APLA 2Q2EB 3ZQJA 1K3WA 2R6FA 3U6QA 3CGWA 1QZEA 3MK6A 3LQRA 3T15A 1AUAA 1WGNA 1V33A 2MROB 4GH9A 1C7YA 1YE9A 2KHHA 2D7HA 2HKJA 3FTEA 2KRKA 1IBMM 1TH2A 2WSEF 2UU9M 1IXRC 2F4VM 2DHYA 3VDPA 4PCZA 2OQ4A 1R2ZA 3LW5F 3AOGA 4MM3B 3W67A 5ITUA 1OIZA 2OPFA 1SXJD 2GNOA 5KO3A 2K47A 3EIEA 3KSJA 4FD2A 3WHKA 1E32A 1IN4A 1GKIA 3RFWA 4DR6M 3C58A 1Q3BA 4G3OA 1D0MA 3CF0A 2JY6B 2R65A 3BXWA 2N35A 3ILKA 4DR5M 3FKEA 1KYIA 3GRRA 3PXGA 3HU1A 4M0DA 2ZBKB 5C18A 1OFHA 1RU3A 4M0WA 3SAVA 4OW0A 3SATA 1QANA 4RKUF 3J2PB 3LVVA 2VDBB 1FJGM 2UXBM 1ZAEA 2ZM6M 2VF8A 3QYEA 3GLIE 3SHFA 3A42A 2EA0A 3SHGB 1ORYB 5EP1A 1UFZA 2XFSA 3GRUA 4FW9A 1N77A 4NL4H 3U6EA 3A46A 1KSFX 1VG5A 2ZANA 4LRTA 1K3XA 1HNXM 2B3TA 2EKFA 2F5QA 4ITQA 1W5TA 2FE8A 4FCTA 2JP7A 5DNYA 4X65M 2LNHC 2BJVA 2Z4SA 3VK7A 3VK8A 5EP2A 1NVMA 3FUUA 1WJ7A 1PJQA 1Q39A 4G4NA 2R0IA 2VF7A 2CWBA 1IBKM 4MB7A 1ZMVA 2L6OA 4G4RA 5IREB 1PRBA 2R46A 2KNZA 1OAIA 2R18A 1N78A 3VKHA 3FRIA 4JN6A 1XMQM 1NHWC 4GKKM 4LZJA 2DAGA 3K8ZA 2JXNA 1NJFA 3NBXX 4B08A 1DGGA 2M5ZA 5ITRA 3NBIA 2HHHM 2DWLA 2KNAA 4CIZA 3K9PA 2CFOA 3AFHA 2Y0TA 3U6OA 3KOWE 4RF1A 1CUKA 2DENA 1IN8A 1EFUB 3FYCA 2ZTCA 3KP0E 4LGYA 1R2YA 5EXXA 3QAUA 4AW4A 1ZMWA 3GLHE 3SMSA 3U6LA 3U5ZB 3SAUA 5ITYA 4D81A 4B3SM 1XXHB 4DR2M 4HLQA 5LMNM 3E9SA 4FWGA 5KPRA 2KZSA 3B7ZA 4M9SA 1Z59A 2FH0A 1QYRA 2G8LA 3PNYA 3LMMA 3TL4X 4OU7A 3PFIA 5EP3A 1TH3A 2KEBA 3DOAA 1JQJC 2XEPA 1SXJC 3VDUA 4AKIA 1HQCA 1OQYA 2QENA 4DV1M 4JI7M 3LCUA 1I94M 5EJCA 2QNJA 5IWAM 3FUXA 4L8RC 1D2NA 3KFUG 4LF8M 2KNVA 1I4WA 3KOZE 1E9SA 3QYBA 2K0BX 2R45A 3U6MA 3I01M 3FUWA 5DFLA 3M6AA 2LVPC 3TWLA 2DNAA 1N32M 4LJ6A 1DO2A 1GL7A 3ZCBB 4DR1M 2R4JA 1J5EM 1QVRA 3GRYA 2FS1A 3I4YA 5FTMA 3W0LB 1J7KA 1XXHA 1IFYA 3TPZA 3TQSA 3U5ZA 2XZFA 4IBFA 4PT5A 2L7HA 2DWZB 2WSCF 4I8OA 2ZAOA 4NXNM 3FE3A 3GLIA 1NNJA 1V34A 2F5NA 1G59A 1R4GA 4JI6M 4QHSA 4BLCA 4JXJA 4DV2M 2L4EA 1N75A 1WXQA 1R7RA 4KHPM 1XMOM 1X37A 3EIHA 4M9ZA 1S3SA 4LJ5A 1K82A 4GITA 1G71A 3M0EA 1N33M 2DAIA 1D0LA 4FWDA 4WW0A 3KDSE 4NSRA 4GHAA 4AG6A 4JYAM 1GO5A 1R5LA 4HL4A 3HJ8A 1E94E 1W5SA 3GLFE 1G8PA 2V1UA 1GABA 4MGKE 3GO8A 2Z4RA 4GC9A 4LJ7A 2XSZA 3JR4A 4DV7M 3SYKA 4B7GA 2JY8A 5FTKA 2UUBM 1JB0F 4PDIA 1HJPA 2G5GX 3MJ5A 5KPZA 3GPYA 4DV4M 3B74A 4LF7M 3VLFB 2JA2A 3JAMS 2BJWA 4MGIE 1QDTA 2BWBA 3HX3A 1TH4A 2YNMD 3GPPA 2UUAM 2HL7A 3IG5A 4REZA 2KW0A 2O01F 4OX9M 4MGZE 1ZV1A 3SARA 1ZMUA 5EQTA 1IY0A 2C99A 2LXEA 4LZZA 1V92A 3SASA 2QP9X 4YHHM 3FTFA 2KDLA 4KT0F 1VEGA 1NY5A 3TWKA 3U60A 4I4LA 2QHOB 5KQDA 3F92A 3I51A 1PJTA 2CHGA 1GVNA 4L6V6 4LJ9A 5H37D 3U6PA 4OVZB 1QUSA 3U6SA 3GLGB 3J7BA 4GRIA 2CEAA 4DBGB 3K92A 2RGOA 1IXZA 1HQYE 2HAKA 1NJGA 1R6BX 1XWIA 1YLAA 4JV5M 3HJSA 3HJQA 3I04M 3W68A 4PDGA 1UM8A 2ZAMA 3M7GA 4IBCA 4IBEA 2X4AA 3AOEC 3SFZA 1TF0B 3UK6A 3L28A 5ITXA 4LY6A 1H6UA 4JI2M 1P3QQ 3KOYE 4IBGA 4DUZM 1G3IA 1IM2A 5EXSA 3HZJA 3HHXA 5BPVA 4IBDA 4B7HA 2EKKA 3LQQA 1IQPA 3KOXE 1NHGC 2DZLA 1QDRA 1WR1B 1SXJA 4L16A 3J81S 3H4JA 3GQ4A 1N36M 2W82A 2LVAA 4II7A 2DXIA 4NSOB 3FTDA 3C3EA 2XGNA 2YQZA 2CRUA 3GQ3A 4I81A 4BB9A 4OVZA 2DWMA 1C1KA 2DI0A 3A45A 2Y20A 5E26A 1IN5A 2QPAA 2CV0A 2EJSA 4Q7JA 2DKLA 4MGYE 2R62A 4QHTA 4GHLA 1GJTA 4DR4M 3E21A 1D0KA 1Z5CA 2D7GA 1J09A 3Q8XA 1MN3A 5EP4A 1XC8A 3IG8A 4RNAA 3R9XB 3UJNA 4UN2B 4P17A 4BBAA 3GLGA 2F5OA 3AL0C 2FFJA 3GLHB 3K2LA 2X8AA 1DO0A 1QAMA 3FTCA 4XBOA 3L25A 2CP8A 3HHYA 1VDLA 2CE7A 2MJ5B 3KS8A 1IY1A 4QNRA 2OOAA 3CTWB 3UZUA 4ANRA 4PD2A 4X64M 4LRSA 1IY2A 3HY5A 5EXPA 3U61B 4LCBA 2RRUA 4M9XA 1L2CA 2F5PA 4JI4M 1G41A 4XGIA 4Z8XA 3DA1A 2KZUA 2P5TA 1LTMA 2CHVA 1Z5AA 4ZPXA 5C1BA 1NY6A 1Q02A 1HT1E 2QSFX 1NV9A 4IJFA 3SAWA 4GKJM 3HU2A 4AKHA 2LTUA 3U6DA 4CHTB 5IT9S 4NOOB 3GQ5A 1SG9A 3QWLA 1OTRA 3OTOM 1GL6A 2CUZA 3L2AA 4LJ4A 2J5YA 1IXSA 2DAEA 2MGWA 3RE8A 2J7NA 3NWLA 5FSWA 1JR3A 2XH9A 2QQ8A 2CV1A 3FUVA 3L27A 5KQ8A 4LF6M 1VEJA 4LF4M 2QCUA 3AOEA 2VIIA 4YY3M 3LCVB 4JI0M 5ITQA 4LGMA 7CATA 2Z3XA 4NXMM 1HNWM 3GPXA 3SYLA 3GLGE 1OIPA 3C9PA 2ERCA 4F1IA 3U61A 3FUTA 3IECA 2I7PA 2XLJA 3HKPA 1LV7A 2L09A 2L4FA 4GIPA 2LVOC 4W5WA 4DV6M 4LG2A 2OOBA 1YUBA 4S12A 4WURA 1XNQM 1PJIA 2UUCM 3MHVC 2LVNC 4KODA 4NC6A 3W0FA 3U60B 3GLFB 2C5RA 4NRWA 4X62M 1PJSA 1QAQA 4EIWA 3GLIB 5LMUM 4HEOA 3SC3A 2LWXA 3K9OA 3KSXA 3J80S 3KXEC 3VFDA 1XB2B 4L15A 4D82A 4LF5M 3HHWA 5KPTA 1TGUA 1VEKA 2RKOA 2VQFM 2V1CA 4WP2A 1SXJB 2O25A 5FTNA 3RGPA 2MH8A 2M60A 3T1YM 2DHRA 4CJ6A 2JY7A 2X49A 1EIJA 2VQEM 2L2DA 2FOIC 1G4AE 3CF2A 3ZH9B 3J7AS 2DAMA 1MU5A 1QZMA 1L2DA 3R8FA 1MJGM 2XSZD 3CF6E 3BBZA 3THGA 2LVQD 1AIPC 1ZQ9A 3D8LA 4DUYM 1WIVA 2XFTA 2E5LM 1VDDA 1T43A 1QUTA 3E4RA 2LBCA 3K1JA 1F4IA 4QNMA 4FCWA 4AQYM 3I4VA 5DYIA 1TDZA 1OFIA 5L8RF 3ZC7B 1L1TA 3HGIA 3UGJA 4L4UA 3B7QA 5BR8M 2LHGA 2JY5A 3AV0A 2JZ1A 4GMQA 1HR0M 2MR9A 3GLFA 2UXDM 1A5TA 1VQ1A 2QBYB 2JUJA 2F5SA 2BNKA 2FNAA 1GJSA 4P16A 1NSFA 3DFZA 3GPUA 2D7EA 1QQWA 4B3MM 1L8QA 3RGSA 4GC5A 3BOSA 3AJIB 4LF9M 8CATA 3PNVA 4R3DA 3SBJA 4RF0A 2GQFA 4MGHA 4JI3M 4LJAA 2JWSA 3FD9A 4JI5M 4KO8A
chains in the Genus database with same CATH topology
5F3WA 1T3TA 2YR0A 4IBIA 5ITXE 4DR3M 2C9CA 2Y0QA 5FLXS 1IXSB 5JI2E 3FYDA 3HU3A 3J27B 4G6ZA 4FVMA 2DWNA 4DV3M 3L26A 4LFBM 3KS4A 4AI6A 1MX0A 2LH0A 5DYGA 2UXCM 2HCBA 4L78A 1YSYA 4IBBA 1FNNA 4CISA 2H1RA 2C96A 2Y21A 4AKGA 1IBLM 3KP1E 4B7FA 1L2BA 2KA6B 4QOSA 4D80A 4DV5M 3T1HM 4IJEA 5JI3E 3WHLA 1DGBA 1N34M 1KFVA 4FCVA 4K0KM 1L1ZA 4LFAM 2I7NA 2A5YB 5FTLA 2QBYA 4DR7M 3H4MA 1Q3CA 3VKGA 1DGHA 2EUCA 2EO2A 4KLNA 4B3RM 3LVWA 4IBKA 5ITTA 3KW6A 4IIWA 5IZ7D 2J7OA 3HWSA 4A3VB 4G4QA 2DZNB 3B9PA 1Z6TA 4R7GA 2YFQA 3GP1A 4AZFA 2R4EA 2O5RA 3D8BA 4DV0M 2XZUA 5GKNA 4FWHA 4IBJA 3TWMA 4TUWA 1JR3D 3GRVA 1GLNA 2V6ZM 4NRVA 3KVWA 4QOZC 2Z7JA 1DGFA 1EE8A 2CHQA 1PJJA 1IN7A 3SMPA 4B3TM 3T38A 3GLHA 5A2QS 3AKZA 3L29A 4MH0E 3A98B 2QZ4A 1PM5A 1XHBA 1NNUC 2KXEA 4JI8M 1DGHB 4LFCM 2DZOB 1TDHA 2CV2A 4I5SA 1XNRM 4X66M 3DZDA 2XF3A 4Z6YA 5E6JA 4CGYB 2L7IA 2RGHA 3JR5A 2KRUA 3PVSA 5FTJA 1HT2E 1HNZM 2DVWB 2C9OA 1QAOA 1E9RA 3UMMA 3HHZA 1Z5BA 4AG5A 4LJ8A 1IN6A 5EXTA 4JI1M 1OJLA 4G4OA 3U6CA 2NQ8C 3TE6A 2C98A 2AHMA 1SXJE 2Q2EB 1K3WA 3U6QA 3T15A 3MK6A 3LQRA 4GH9A 1YE9A 2D7HA 2HKJA 3FTEA 2KRKA 1IBMM 1TH2A 2UU9M 1IXRC 2F4VM 3VDPA 2OQ4A 4PCZA 1R2ZA 5ITUA 3AOGA 4MM3B 2OPFA 1SXJD 5KO3A 2K47A 3EIEA 3KSJA 4FD2A 3WHKA 1E32A 1IN4A 1GKIA 3RFWA 4DR6M 3C58A 1Q3BA 3CF0A 2R65A 3ILKA 4DR5M 3FKEA 1KYIA 3GRRA 3PXGA 3HU1A 4M0DA 2ZBKB 5C18A 1OFHA 4M0WA 3SAVA 3SATA 4OW0A 1QANA 3J2PB 3LVVA 1FJGM 2UXBM 1ZAEA 2ZM6M 3SHFA 3A42A 2EA0A 3SHGB 1ORYB 5EP1A 2XFSA 3GRUA 4FW9A 1N77A 4NL4H 3U6EA 3A46A 1KSFX 2ZANA 4LRTA 1K3XA 2F5QA 1HNXM 4ITQA 1W5TA 2FE8A 4FCTA 5DNYA 4X65M 2LNHC 2BJVA 2Z4SA 3VK7A 3VK8A 5EP2A 1NVMA 3FUUA 4G4NA 1Q39A 1IBKM 4MB7A 2L6OA 4G4RA 5IREB 1N78A 2R46A 2R18A 3VKHA 4JN6A 1XMQM 1NHWC 4GKKM 4LZJA 3K8ZA 4B08A 1NJFA 1DGGA 2M5ZA 5ITRA 3NBIA 2HHHM 2DWLA 2CFOA 3AFHA 2Y0TA 3U6OA 3KOWE 4RF1A 1R2YA 3KFUG 1IN8A 3FYCA 3KP0E 4LGYA 5EXXA 3QAUA 4AW4A 4B3SM 3SMSA 3U6LA 3U5ZB 3SAUA 5ITYA 4D81A 1XXHB 4DR2M 4HLQA 5LMNM 4FWGA 3E9SA 5KPRA 2KZSA 4M9SA 1Z59A 1QYRA 2G8LA 3PNYA 3LMMA 3TL4X 4OU7A 3PFIA 5EP3A 1TH3A 2KEBA 3DOAA 1JQJC 2XEPA 1SXJC 3VDUA 4AKIA 1HQCA 2QENA 4DV1M 4JI7M 1I94M 5EJCA 5IWAM 3FUXA 4L8RC 1D2NA 4LF8M 1I4WA 3KOZE 1E9SA 2R45A 3U6MA 3FUWA 3M6AA 3TWLA 1N32M 4LJ6A 1DO2A 1GL7A 3ZCBB 4DR1M 2R4JA 1J5EM 1QVRA 3GRYA 3I4YA 5FTMA 3W0LB 1J7KA 1XXHA 3TPZA 3TQSA 3U5ZA 2XZFA 4IBFA 4PT5A 2L7HA 2DWZB 4I8OA 4NXNM 2ZAOA 3GLIA 1NNJA 2F5NA 1G59A 4JI6M 4QHSA 4BLCA 4JXJA 4DV2M 1N75A 1WXQA 1R7RA 4KHPM 1XMOM 1X37A 3EIHA 4M9ZA 1S3SA 4LJ5A 1K82A 4GITA 3M0EA 1N33M 4FWDA 4WW0A 3KDSE 4NSRA 4GHAA 4AG6A 4JYAM 4HL4A 3HJ8A 1E94E 1W5SA 2V1UA 4MGKE 3GO8A 2Z4RA 4GC9A 4LJ7A 2XSZA 3JR4A 4DV7M 3SYKA 4B7GA 5FTKA 2UUBM 4PDIA 2G5GX 3MJ5A 5KPZA 3GPYA 4DV4M 4LF7M 3VLFB 2JA2A 3JAMS 2BJWA 4MGIE 1TH4A 2YNMD 3GPPA 2UUAM 2HL7A 3IG5A 4REZA 2KW0A 4OX9M 4MGZE 3SARA 5EQTA 1IY0A 2C99A 2LXEA 4LZZA 3SASA 2QP9X 4YHHM 3FTFA 3U60A 1NY5A 3TWKA 4I4LA 5KQDA 3I51A 4LJ9A 2CHGA 1GVNA 5H37D 3U6PA 4OVZB 3U6SA 3GLGB 3J7BA 4GRIA 2CEAA 3K92A 2RGOA 1IXZA 1HQYE 1NJGA 1R6BX 1XWIA 4JV5M 3HJSA 3HJQA 4PDGA 1UM8A 2ZAMA 3M7GA 4IBCA 4IBEA 2X4AA 3AOEC 3SFZA 3UK6A 3L28A 5ITXA 4LY6A 1H6UA 4JI2M 3KOYE 4IBGA 4DUZM 1G3IA 1IM2A 5EXSA 3HHXA 5BPVA 4IBDA 4B7HA 3LQQA 1IQPA 3KOXE 1NHGC 4L16A 3J81S 1SXJA 1N36M 3GQ4A 2W82A 4II7A 2DXIA 4NSOB 3FTDA 2XGNA 2YQZA 3GQ3A 4I81A 4BB9A 4OVZA 2DWMA 1C1KA 3A45A 2Y20A 5E26A 1IN5A 2QPAA 2CV0A 4MGYE 2R62A 4QHTA 4GHLA 4DR4M 5EP4A 1Z5CA 3Q8XA 2D7GA 1J09A 1XC8A 3IG8A 4RNAA 3R9XB 3UJNA 4BBAA 3GLGA 2F5OA 3AL0C 2FFJA 3GLHB 3K2LA 2X8AA 1DO0A 1QAMA 3FTCA 4XBOA 3L25A 3HHYA 3KS8A 2CE7A 1IY1A 4QNRA 3CTWB 3UZUA 4PD2A 4X64M 4LRSA 1IY2A 3U61B 5EXPA 4LCBA 4M9XA 1L2CA 2F5PA 4JI4M 1G41A 4XGIA 4Z8XA 3DA1A 2KZUA 2P5TA 5C1BA 2CHVA 1Z5AA 4ZPXA 3SAWA 1NY6A 1HT1E 4IJFA 4GKJM 4AKHA 3HU2A 3U6DA 4CHTB 5IT9S 4NOOB 3GQ5A 3QWLA 3OTOM 1GL6A 2CUZA 3L2AA 4LJ4A 3RE8A 2J7NA 3NWLA 5FSWA 1JR3A 2XH9A 2CV1A 3FUVA 3L27A 5KQ8A 4LF6M 4LF4M 2QCUA 3AOEA 2VIIA 4YY3M 4JI0M 5ITQA 4LGMA 7CATA 2Z3XA 4NXMM 1HNWM 3GPXA 3SYLA 2ERCA 3U61A 3FUTA 2I7PA 2XLJA 3HKPA 1LV7A 2L09A 4GIPA 4W5WA 4DV6M 4LG2A 1YUBA 4S12A 4WURA 1XNQM 1PJIA 2UUCM 3MHVC 4KODA 3W0FA 3U60B 2C5RA 3GLFB 4NRWA 4X62M 1QAQA 4EIWA 3GLIB 5LMUM 3SC3A 2LWXA 3KSXA 3J80S 3KXEC 3VFDA 4L15A 4D82A 4LF5M 3HHWA 5KPTA 1TGUA 2RKOA 2VQFM 2V1CA 1SXJB 5FTNA 3RGPA 2M60A 3T1YM 2DHRA 2X49A 2VQEM 2FOIC 1G4AE 3CF2A 3ZH9B 3J7AS 1MU5A 1QZMA 1L2DA 3R8FA 2XSZD 3CF6E 3THGA 1ZQ9A 3D8LA 4DUYM 2XFTA 2E5LM 1VDDA 3E4RA 3K1JA 4QNMA 4FCWA 4AQYM 3I4VA 5DYIA 1TDZA 1OFIA 3ZC7B 1L1TA 3HGIA 3UGJA 4L4UA 5BR8M 3AV0A 4GMQA 1HR0M 3GLFA 2UXDM 2QBYB 2F5SA 2BNKA 2FNAA 4P16A 1NSFA 3DFZA 3GPUA 2D7EA 1QQWA 4B3MM 1L8QA 3RGSA 4GC5A 3BOSA 3AJIB 4LF9M 8CATA 3PNVA 4R3DA 3SBJA 4RF0A 4MGHA 4JI3M 4LJAA 1G8PA 3FD9A 4JI5M 4KO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAW A;  1N33 M;  4GKJ M;  5ITX E;  2OPF A;  4DR3 M;  4JYA M;  3U6D A;  5FLX S;  5IT9 S;  4DR6 M;  3GQ5 A;  3C58 A;  1Q3B A;  3OTO M;  4DR5 M;  4DV3 M;  3GO8 A;  4LFB M;  3JR4 A;  4DV7 M;  1MX0 A;  2UXC M;  2UUB M;  4PDI A;  2ZBK B;  3SAV A;  3SAT A;  4DV4 M;  3GPY A;  4LF7 M;  3JAM S;  4LF6 M;  4LF4 M;  1FJG M;  4CIS A;  4YY3 M;  2UXB M;  4JI0 M;  5ITQ A;  2ZM6 M;  1IBL M;  1L2B A;  3T1H M;  3A42 A;  4DV5 M;  2EA0 A;  4NXM M;  1HNW M;  3GPP A;  3GPX A;  2UUA M;  3U6E A;  3A46 A;  1K3X A;  1N34 M;  1KFV A;  2F5Q A;  4OX9 M;  1L1Z A;  4LFA M;  1HNX M;  3SAR A;  4K0K M;  4ITQ A;  4X65 M;  3SAS A;  4DR7 M;  4YHH M;  3VK7 A;  3VK8 A;  3TWK A;  1Q3C A;  4DV6 M;  4B3R M;  4G4N A;  1Q39 A;  1IBK M;  1XNQ M;  3U6P A;  4MB7 A;  1PJI A;  2UUC M;  5ITT A;  4G4R A;  3U6S A;  3W0F A;  4G4Q A;  1XMQ M;  4GKK M;  4NRW A;  4X62 M;  5LMU M;  4JV5 M;  3GP1 A;  2HHH M;  4PDG A;  5ITR A;  4DV0 M;  3J80 S;  2XZU A;  3TWM A;  4LF5 M;  3U6O A;  4NRV A;  5ITX A;  2VQF M;  1R2Y A;  1EE8 A;  1PJJ A;  4JI2 M;  4B3T M;  4DUZ M;  4B3S M;  3U6L A;  3SAU A;  5ITY A;  5A2Q S;  4DR2 M;  5LMN M;  3T1Y M;  3J81 S;  2VQE M;  1PM5 A;  3GQ4 A;  1Z59 A;  1N36 M;  4JI8 M;  4LFC M;  3DOA A;  3J7A S;  1MU5 A;  1TDH A;  1L2D A;  4DV1 M;  4JI7 M;  3GQ3 A;  4X66 M;  1I94 M;  1XNR M;  5IWA M;  3JR5 A;  4DUY M;  2E5L M;  4LF8 M;  3A45 A;  4JI5 M;  1HNZ M;  3U6M A;  4AQY M;  1TDZ A;  4DR4 M;  1Z5B A;  3TWL A;  1Z5C A;  1L1T A;  1N32 M;  4DR1 M;  1XC8 A;  1J5E M;  4JI1 M;  5BR8 M;  4G4O A;  3U6C A;  2F5O A;  1HR0 M;  2UXD M;  2F5S A;  2XZF A;  2Q2E B;  1K3W A;  3U6Q A;  3GPU A;  4NXN M;  1NNJ A;  2F5N A;  4B3M M;  4JI6 M;  4PD2 A;  4X64 M;  4LF9 M;  4DV2 M;  2HKJ A;  4KHP M;  1IBM M;  3SBJ A;  1XMO M;  1L2C A;  2F5P A;  4JI4 M;  2UU9 M;  2F4V M;  4JI3 M;  2OQ4 A;  4PCZ A;  1K82 A;  1R2Z A;  5ITU A;  1Z5A A; 
#chains in the Genus database with same CATH topology
 2R44 A;  1T3T A;  2YR0 A;  3MMP A;  4IBI A;  5F3W A;  5ITX E;  4DR3 M;  2C9C A;  2Y0Q A;  5FLX S;  2G3Q A;  4R71 A;  1IXS B;  3E46 A;  5JI2 E;  3B7N A;  3FYD A;  3HU3 A;  3J27 B;  4G6Z A;  4FVM A;  2DWN A;  4DV3 M;  3L26 A;  4LFB M;  1DV0 A;  3KS4 A;  3B89 A;  4AI6 A;  1MX0 A;  2LH0 A;  1Y8G A;  5DYG A;  4GEW A;  2UXC M;  2K6B A;  2HCB A;  4L78 A;  2JZ0 A;  1YSY A;  4IBB A;  1FNN A;  2Z8Y M;  2OO9 A;  2JNH A;  4CIS A;  2H1R A;  1NV8 A;  2C96 A;  2Y21 A;  4AKG A;  1IBL M;  3KP1 E;  4B7F A;  1L2B A;  2KA6 B;  4QOS A;  4D80 A;  4DV5 M;  1OKS A;  3T1H M;  4IJE A;  2WSF F;  5JI3 E;  2DAK A;  1NO1 A;  3WHL A;  1DGB A;  1N34 M;  1KFV A;  4FCV A;  4K0K M;  1L1Z A;  4LFA M;  2I7N A;  2A5Y B;  2WZJ A;  3T6P A;  5FTL A;  2QBY A;  4DR7 M;  3H4M A;  1JR3 E;  1Q3C A;  3VKG A;  1DGH A;  2EUC A;  1PGY A;  2EO2 A;  4KLN A;  4B3R M;  3LVW A;  4IBK A;  4F2L A;  5ITT A;  3KW6 A;  4IIW A;  2HWJ A;  5IZ7 D;  2J7O A;  2K9D A;  3HWS A;  4A3V B;  4G4Q A;  3Q8G A;  3V76 A;  2DZN B;  3B9P A;  2H5X A;  1Z6T A;  3FRH A;  4R7G A;  2YFQ A;  3GP1 A;  4AZF A;  2R4E A;  2O5R A;  3D8B A;  2LHC A;  4DV0 M;  5GKN A;  2XZU A;  4FWH A;  1WGL A;  4IBJ A;  3TWM A;  1OAO C;  1JR3 D;  4TUW A;  3IHP A;  3GRV A;  1GLN A;  2V6Z M;  4NRV A;  2BWE A;  3KVW A;  4QOZ C;  2Z7J A;  1DGF A;  1EE8 A;  2CHQ A;  1PJJ A;  1IN7 A;  3SMP A;  4B3T M;  3T38 A;  3GLH A;  5A2Q S;  3AKZ A;  1TR8 A;  3L29 A;  4MH0 E;  3A98 B;  2QZ4 A;  1PM5 A;  1XHB A;  1NNU C;  2KXE A;  4JI8 M;  1DGH B;  4LFC M;  4Y28 F;  2DZO B;  1TDH A;  2CV2 A;  4I5S A;  1XNR M;  4X66 M;  3DZD A;  2XF3 A;  4Z6Y A;  5E6J A;  4CGY B;  2L7I A;  2RGH A;  3JR5 A;  2KRU A;  3PVS A;  5FTJ A;  1HT2 E;  1WHC A;  1HNZ M;  1T6O A;  1BVS A;  2DVW B;  2C9O A;  1QAO A;  1E9R A;  2ZTD A;  3UMM A;  1Z5B A;  4XK8 F;  3HHZ A;  4AG5 A;  1TTE A;  4LJ8 A;  1IN6 A;  5EXT A;  4JI1 M;  1OJL A;  4G4O A;  3U6C A;  2NQ8 C;  3TE6 A;  1XXH E;  2C98 A;  2AHM A;  3C3D A;  1SXJ E;  2APL A;  2Q2E B;  3ZQJ A;  1K3W A;  2R6F A;  3U6Q A;  3CGW A;  1QZE A;  3MK6 A;  3LQR A;  3T15 A;  1AUA A;  1WGN A;  1V33 A;  2MRO B;  4GH9 A;  1C7Y A;  1YE9 A;  2KHH A;  2D7H A;  2HKJ A;  3FTE A;  2KRK A;  1IBM M;  1TH2 A;  2WSE F;  2UU9 M;  1IXR C;  2F4V M;  2DHY A;  3VDP A;  4PCZ A;  2OQ4 A;  1R2Z A;  3LW5 F;  3AOG A;  4MM3 B;  3W67 A;  5ITU A;  1OIZ A;  2OPF A;  1SXJ D;  2GNO A;  5KO3 A;  2K47 A;  3EIE A;  3KSJ A;  4FD2 A;  3WHK A;  1E32 A;  1IN4 A;  1GKI A;  3RFW A;  4DR6 M;  3C58 A;  1Q3B A;  4G3O A;  1D0M A;  3CF0 A;  2JY6 B;  2R65 A;  3BXW A;  2N35 A;  3ILK A;  4DR5 M;  3FKE A;  1KYI A;  3GRR A;  3PXG A;  3HU1 A;  4M0D A;  2ZBK B;  5C18 A;  1OFH A;  1RU3 A;  4M0W A;  3SAV A;  4OW0 A;  3SAT A;  1QAN A;  4RKU F;  3J2P B;  3LVV A;  2VDB B;  1FJG M;  2UXB M;  1ZAE A;  2ZM6 M;  2VF8 A;  3QYE A;  3GLI E;  3SHF A;  3A42 A;  2EA0 A;  3SHG B;  1ORY B;  5EP1 A;  1UFZ A;  2XFS A;  3GRU A;  4FW9 A;  1N77 A;  4NL4 H;  3U6E A;  3A46 A;  1KSF X;  1VG5 A;  2ZAN A;  4LRT A;  1K3X A;  1HNX M;  2B3T A;  2EKF A;  2F5Q A;  4ITQ A;  1W5T A;  2FE8 A;  4FCT A;  2JP7 A;  5DNY A;  4X65 M;  2LNH C;  2BJV A;  2Z4S A;  3VK7 A;  3VK8 A;  5EP2 A;  1NVM A;  3FUU A;  1WJ7 A;  1PJQ A;  1Q39 A;  4G4N A;  2R0I A;  2VF7 A;  2CWB A;  1IBK M;  4MB7 A;  1ZMV A;  2L6O A;  4G4R A;  5IRE B;  1PRB A;  2R46 A;  2KNZ A;  1OAI A;  2R18 A;  1N78 A;  3VKH A;  3FRI A;  4JN6 A;  1XMQ M;  1NHW C;  4GKK M;  4LZJ A;  2DAG A;  3K8Z A;  2JXN A;  1NJF A;  3NBX X;  4B08 A;  1DGG A;  2M5Z A;  5ITR A;  3NBI A;  2HHH M;  2DWL A;  2KNA A;  4CIZ A;  3K9P A;  2CFO A;  3AFH A;  2Y0T A;  3U6O A;  3KOW E;  4RF1 A;  1CUK A;  2DEN A;  1IN8 A;  1EFU B;  3FYC A;  2ZTC A;  3KP0 E;  4LGY A;  1R2Y A;  5EXX A;  3QAU A;  4AW4 A;  1ZMW A;  3GLH E;  3SMS A;  3U6L A;  3U5Z B;  3SAU A;  5ITY A;  4D81 A;  4B3S M;  1XXH B;  4DR2 M;  4HLQ A;  5LMN M;  3E9S A;  4FWG A;  5KPR A;  2KZS A;  3B7Z A;  4M9S A;  1Z59 A;  2FH0 A;  1QYR A;  2G8L A;  3PNY A;  3LMM A;  3TL4 X;  4OU7 A;  3PFI A;  5EP3 A;  1TH3 A;  2KEB A;  3DOA A;  1JQJ C;  2XEP A;  1SXJ C;  3VDU A;  4AKI A;  1HQC A;  1OQY A;  2QEN A;  4DV1 M;  4JI7 M;  3LCU A;  1I94 M;  5EJC A;  2QNJ A;  5IWA M;  3FUX A;  4L8R C;  1D2N A;  3KFU G;  4LF8 M;  2KNV A;  1I4W A;  3KOZ E;  1E9S A;  3QYB A;  2K0B X;  2R45 A;  3U6M A;  3I01 M;  3FUW A;  5DFL A;  3M6A A;  2LVP C;  3TWL A;  2DNA A;  1N32 M;  4LJ6 A;  1DO2 A;  1GL7 A;  3ZCB B;  4DR1 M;  2R4J A;  1J5E M;  1QVR A;  3GRY A;  2FS1 A;  3I4Y A;  5FTM A;  3W0L B;  1J7K A;  1XXH A;  1IFY A;  3TPZ A;  3TQS A;  3U5Z A;  2XZF A;  4IBF A;  4PT5 A;  2L7H A;  2DWZ B;  2WSC F;  4I8O A;  2ZAO A;  4NXN M;  3FE3 A;  3GLI A;  1NNJ A;  1V34 A;  2F5N A;  1G59 A;  1R4G A;  4JI6 M;  4QHS A;  4BLC A;  4JXJ A;  4DV2 M;  2L4E A;  1N75 A;  1WXQ A;  1R7R A;  4KHP M;  1XMO M;  1X37 A;  3EIH A;  4M9Z A;  1S3S A;  4LJ5 A;  1K82 A;  4GIT A;  1G71 A;  3M0E A;  1N33 M;  2DAI A;  1D0L A;  4FWD A;  4WW0 A;  3KDS E;  4NSR A;  4GHA A;  4AG6 A;  4JYA M;  1GO5 A;  1R5L A;  4HL4 A;  3HJ8 A;  1E94 E;  1W5S A;  3GLF E;  1G8P A;  2V1U A;  1GAB A;  4MGK E;  3GO8 A;  2Z4R A;  4GC9 A;  4LJ7 A;  2XSZ A;  3JR4 A;  4DV7 M;  3SYK A;  4B7G A;  2JY8 A;  5FTK A;  2UUB M;  1JB0 F;  4PDI A;  1HJP A;  2G5G X;  3MJ5 A;  5KPZ A;  3GPY A;  4DV4 M;  3B74 A;  4LF7 M;  3VLF B;  2JA2 A;  3JAM S;  2BJW A;  4MGI E;  1QDT A;  2BWB A;  3HX3 A;  1TH4 A;  2YNM D;  3GPP A;  2UUA M;  2HL7 A;  3IG5 A;  4REZ A;  2KW0 A;  2O01 F;  4OX9 M;  4MGZ E;  1ZV1 A;  3SAR A;  1ZMU A;  5EQT A;  1IY0 A;  2C99 A;  2LXE A;  4LZZ A;  1V92 A;  3SAS A;  2QP9 X;  4YHH M;  3FTF A;  2KDL A;  4KT0 F;  1VEG A;  1NY5 A;  3TWK A;  3U60 A;  4I4L A;  2QHO B;  5KQD A;  3F92 A;  3I51 A;  1PJT A;  2CHG A;  1GVN A;  4L6V 6;  4LJ9 A;  5H37 D;  3U6P A;  4OVZ B;  1QUS A;  3U6S A;  3GLG B;  3J7B A;  4GRI A;  2CEA A;  4DBG B;  3K92 A;  2RGO A;  1IXZ A;  1HQY E;  2HAK A;  1NJG A;  1R6B X;  1XWI A;  1YLA A;  4JV5 M;  3HJS A;  3HJQ A;  3I04 M;  3W68 A;  4PDG A;  1UM8 A;  2ZAM A;  3M7G A;  4IBC A;  4IBE A;  2X4A A;  3AOE C;  3SFZ A;  1TF0 B;  3UK6 A;  3L28 A;  5ITX A;  4LY6 A;  1H6U A;  4JI2 M;  1P3Q Q;  3KOY E;  4IBG A;  4DUZ M;  1G3I A;  1IM2 A;  5EXS A;  3HZJ A;  3HHX A;  5BPV A;  4IBD A;  4B7H A;  2EKK A;  3LQQ A;  1IQP A;  3KOX E;  1NHG C;  2DZL A;  1QDR A;  1WR1 B;  1SXJ A;  4L16 A;  3J81 S;  3H4J A;  3GQ4 A;  1N36 M;  2W82 A;  2LVA A;  4II7 A;  2DXI A;  4NSO B;  3FTD A;  3C3E A;  2XGN A;  2YQZ A;  2CRU A;  3GQ3 A;  4I81 A;  4BB9 A;  4OVZ A;  2DWM A;  1C1K A;  2DI0 A;  3A45 A;  2Y20 A;  5E26 A;  1IN5 A;  2QPA A;  2CV0 A;  2EJS A;  4Q7J A;  2DKL A;  4MGY E;  2R62 A;  4QHT A;  4GHL A;  1GJT A;  4DR4 M;  3E21 A;  1D0K A;  1Z5C A;  2D7G A;  1J09 A;  3Q8X A;  1MN3 A;  5EP4 A;  1XC8 A;  3IG8 A;  4RNA A;  3R9X B;  3UJN A;  4UN2 B;  4P17 A;  4BBA A;  3GLG A;  2F5O A;  3AL0 C;  2FFJ A;  3GLH B;  3K2L A;  2X8A A;  1DO0 A;  1QAM A;  3FTC A;  4XBO A;  3L25 A;  2CP8 A;  3HHY A;  1VDL A;  2CE7 A;  2MJ5 B;  3KS8 A;  1IY1 A;  4QNR A;  2OOA A;  3CTW B;  3UZU A;  4ANR A;  4PD2 A;  4X64 M;  4LRS A;  1IY2 A;  3HY5 A;  5EXP A;  3U61 B;  4LCB A;  2RRU A;  4M9X A;  1L2C A;  2F5P A;  4JI4 M;  1G41 A;  4XGI A;  4Z8X A;  3DA1 A;  2KZU A;  2P5T A;  1LTM A;  2CHV A;  1Z5A A;  4ZPX A;  5C1B A;  1NY6 A;  1Q02 A;  1HT1 E;  2QSF X;  1NV9 A;  4IJF A;  3SAW A;  4GKJ M;  3HU2 A;  4AKH A;  2LTU A;  3U6D A;  4CHT B;  5IT9 S;  4NOO B;  3GQ5 A;  1SG9 A;  3QWL A;  1OTR A;  3OTO M;  1GL6 A;  2CUZ A;  3L2A A;  4LJ4 A;  2J5Y A;  1IXS A;  2DAE A;  2MGW A;  3RE8 A;  2J7N A;  3NWL A;  5FSW A;  1JR3 A;  2XH9 A;  2QQ8 A;  2CV1 A;  3FUV A;  3L27 A;  5KQ8 A;  4LF6 M;  1VEJ A;  4LF4 M;  2QCU A;  3AOE A;  2VII A;  4YY3 M;  3LCV B;  4JI0 M;  5ITQ A;  4LGM A;  7CAT A;  2Z3X A;  4NXM M;  1HNW M;  3GPX A;  3SYL A;  3GLG E;  1OIP A;  3C9P A;  2ERC A;  4F1I A;  3U61 A;  3FUT A;  3IEC A;  2I7P A;  2XLJ A;  3HKP A;  1LV7 A;  2L09 A;  2L4F A;  4GIP A;  2LVO C;  4W5W A;  4DV6 M;  4LG2 A;  2OOB A;  1YUB A;  4S12 A;  4WUR A;  1XNQ M;  1PJI A;  2UUC M;  3MHV C;  2LVN C;  4KOD A;  4NC6 A;  3W0F A;  3U60 B;  3GLF B;  2C5R A;  4NRW A;  4X62 M;  1PJS A;  1QAQ A;  4EIW A;  3GLI B;  5LMU M;  4HEO A;  3SC3 A;  2LWX A;  3K9O A;  3KSX A;  3J80 S;  3KXE C;  3VFD A;  1XB2 B;  4L15 A;  4D82 A;  4LF5 M;  3HHW A;  5KPT A;  1TGU A;  1VEK A;  2RKO A;  2VQF M;  2V1C A;  4WP2 A;  1SXJ B;  2O25 A;  5FTN A;  3RGP A;  2MH8 A;  2M60 A;  3T1Y M;  2DHR A;  4CJ6 A;  2JY7 A;  2X49 A;  1EIJ A;  2VQE M;  2L2D A;  2FOI C;  1G4A E;  3CF2 A;  3ZH9 B;  3J7A S;  2DAM A;  1MU5 A;  1QZM A;  1L2D A;  3R8F A;  1MJG M;  2XSZ D;  3CF6 E;  3BBZ A;  3THG A;  2LVQ D;  1AIP C;  1ZQ9 A;  3D8L A;  4DUY M;  1WIV A;  2XFT A;  2E5L M;  1VDD A;  1T43 A;  1QUT A;  3E4R A;  2LBC A;  3K1J A;  1F4I A;  4QNM A;  4FCW A;  4AQY M;  3I4V A;  5DYI A;  1TDZ A;  1OFI A;  5L8R F;  3ZC7 B;  1L1T A;  3HGI A;  3UGJ A;  4L4U A;  3B7Q A;  5BR8 M;  2LHG A;  2JY5 A;  3AV0 A;  2JZ1 A;  4GMQ A;  1HR0 M;  2MR9 A;  3GLF A;  2UXD M;  1A5T A;  1VQ1 A;  2QBY B;  2JUJ A;  2F5S A;  2BNK A;  2FNA A;  1GJS A;  4P16 A;  1NSF A;  3DFZ A;  3GPU A;  2D7E A;  1QQW A;  4B3M M;  1L8Q A;  3RGS A;  4GC5 A;  3BOS A;  3AJI B;  4LF9 M;  8CAT A;  3PNV A;  4R3D A;  3SBJ A;  4RF0 A;  2GQF A;  4MGH A;  4JI3 M;  4LJA A;  2JWS A;  3FD9 A;  4JI5 M;  4KO8 A; 
#chains in the Genus database with same CATH homology
 5F3W A;  1T3T A;  2YR0 A;  4IBI A;  5ITX E;  4DR3 M;  2C9C A;  2Y0Q A;  5FLX S;  1IXS B;  5JI2 E;  3FYD A;  3HU3 A;  3J27 B;  4G6Z A;  4FVM A;  2DWN A;  4DV3 M;  3L26 A;  4LFB M;  3KS4 A;  4AI6 A;  1MX0 A;  2LH0 A;  5DYG A;  2UXC M;  2HCB A;  4L78 A;  1YSY A;  4IBB A;  1FNN A;  4CIS A;  2H1R A;  2C96 A;  2Y21 A;  4AKG A;  1IBL M;  3KP1 E;  4B7F A;  1L2B A;  2KA6 B;  4QOS A;  4D80 A;  4DV5 M;  3T1H M;  4IJE A;  5JI3 E;  3WHL A;  1DGB A;  1N34 M;  1KFV A;  4FCV A;  4K0K M;  1L1Z A;  4LFA M;  2I7N A;  2A5Y B;  5FTL A;  2QBY A;  4DR7 M;  3H4M A;  1Q3C A;  3VKG A;  1DGH A;  2EUC A;  2EO2 A;  4KLN A;  4B3R M;  3LVW A;  4IBK A;  5ITT A;  3KW6 A;  4IIW A;  5IZ7 D;  2J7O A;  3HWS A;  4A3V B;  4G4Q A;  2DZN B;  3B9P A;  1Z6T A;  4R7G A;  2YFQ A;  3GP1 A;  4AZF A;  2R4E A;  2O5R A;  3D8B A;  4DV0 M;  2XZU A;  5GKN A;  4FWH A;  4IBJ A;  3TWM A;  4TUW A;  1JR3 D;  3GRV A;  1GLN A;  2V6Z M;  4NRV A;  3KVW A;  4QOZ C;  2Z7J A;  1DGF A;  1EE8 A;  2CHQ A;  1PJJ A;  1IN7 A;  3SMP A;  4B3T M;  3T38 A;  3GLH A;  5A2Q S;  3AKZ A;  3L29 A;  4MH0 E;  3A98 B;  2QZ4 A;  1PM5 A;  1XHB A;  1NNU C;  2KXE A;  4JI8 M;  1DGH B;  4LFC M;  2DZO B;  1TDH A;  2CV2 A;  4I5S A;  1XNR M;  4X66 M;  3DZD A;  2XF3 A;  4Z6Y A;  5E6J A;  4CGY B;  2L7I A;  2RGH A;  3JR5 A;  2KRU A;  3PVS A;  5FTJ A;  1HT2 E;  1HNZ M;  2DVW B;  2C9O A;  1QAO A;  1E9R A;  3UMM A;  3HHZ A;  1Z5B A;  4AG5 A;  4LJ8 A;  1IN6 A;  5EXT A;  4JI1 M;  1OJL A;  4G4O A;  3U6C A;  2NQ8 C;  3TE6 A;  2C98 A;  2AHM A;  1SXJ E;  2Q2E B;  1K3W A;  3U6Q A;  3T15 A;  3MK6 A;  3LQR A;  4GH9 A;  1YE9 A;  2D7H A;  2HKJ A;  3FTE A;  2KRK A;  1IBM M;  1TH2 A;  2UU9 M;  1IXR C;  2F4V M;  3VDP A;  2OQ4 A;  4PCZ A;  1R2Z A;  5ITU A;  3AOG A;  4MM3 B;  2OPF A;  1SXJ D;  5KO3 A;  2K47 A;  3EIE A;  3KSJ A;  4FD2 A;  3WHK A;  1E32 A;  1IN4 A;  1GKI A;  3RFW A;  4DR6 M;  3C58 A;  1Q3B A;  3CF0 A;  2R65 A;  3ILK A;  4DR5 M;  3FKE A;  1KYI A;  3GRR A;  3PXG A;  3HU1 A;  4M0D A;  2ZBK B;  5C18 A;  1OFH A;  4M0W A;  3SAV A;  3SAT A;  4OW0 A;  1QAN A;  3J2P B;  3LVV A;  1FJG M;  2UXB M;  1ZAE A;  2ZM6 M;  3SHF A;  3A42 A;  2EA0 A;  3SHG B;  1ORY B;  5EP1 A;  2XFS A;  3GRU A;  4FW9 A;  1N77 A;  4NL4 H;  3U6E A;  3A46 A;  1KSF X;  2ZAN A;  4LRT A;  1K3X A;  2F5Q A;  1HNX M;  4ITQ A;  1W5T A;  2FE8 A;  4FCT A;  5DNY A;  4X65 M;  2LNH C;  2BJV A;  2Z4S A;  3VK7 A;  3VK8 A;  5EP2 A;  1NVM A;  3FUU A;  4G4N A;  1Q39 A;  1IBK M;  4MB7 A;  2L6O A;  4G4R A;  5IRE B;  1N78 A;  2R46 A;  2R18 A;  3VKH A;  4JN6 A;  1XMQ M;  1NHW C;  4GKK M;  4LZJ A;  3K8Z A;  4B08 A;  1NJF A;  1DGG A;  2M5Z A;  5ITR A;  3NBI A;  2HHH M;  2DWL A;  2CFO A;  3AFH A;  2Y0T A;  3U6O A;  3KOW E;  4RF1 A;  1R2Y A;  3KFU G;  1IN8 A;  3FYC A;  3KP0 E;  4LGY A;  5EXX A;  3QAU A;  4AW4 A;  4B3S M;  3SMS A;  3U6L A;  3U5Z B;  3SAU A;  5ITY A;  4D81 A;  1XXH B;  4DR2 M;  4HLQ A;  5LMN M;  4FWG A;  3E9S A;  5KPR A;  2KZS A;  4M9S A;  1Z59 A;  1QYR A;  2G8L A;  3PNY A;  3LMM A;  3TL4 X;  4OU7 A;  3PFI A;  5EP3 A;  1TH3 A;  2KEB A;  3DOA A;  1JQJ C;  2XEP A;  1SXJ C;  3VDU A;  4AKI A;  1HQC A;  2QEN A;  4DV1 M;  4JI7 M;  1I94 M;  5EJC A;  5IWA M;  3FUX A;  4L8R C;  1D2N A;  4LF8 M;  1I4W A;  3KOZ E;  1E9S A;  2R45 A;  3U6M A;  3FUW A;  3M6A A;  3TWL A;  1N32 M;  4LJ6 A;  1DO2 A;  1GL7 A;  3ZCB B;  4DR1 M;  2R4J A;  1J5E M;  1QVR A;  3GRY A;  3I4Y A;  5FTM A;  3W0L B;  1J7K A;  1XXH A;  3TPZ A;  3TQS A;  3U5Z A;  2XZF A;  4IBF A;  4PT5 A;  2L7H A;  2DWZ B;  4I8O A;  4NXN M;  2ZAO A;  3GLI A;  1NNJ A;  2F5N A;  1G59 A;  4JI6 M;  4QHS A;  4BLC A;  4JXJ A;  4DV2 M;  1N75 A;  1WXQ A;  1R7R A;  4KHP M;  1XMO M;  1X37 A;  3EIH A;  4M9Z A;  1S3S A;  4LJ5 A;  1K82 A;  4GIT A;  3M0E A;  1N33 M;  4FWD A;  4WW0 A;  3KDS E;  4NSR A;  4GHA A;  4AG6 A;  4JYA M;  4HL4 A;  3HJ8 A;  1E94 E;  1W5S A;  2V1U A;  4MGK E;  3GO8 A;  2Z4R A;  4GC9 A;  4LJ7 A;  2XSZ A;  3JR4 A;  4DV7 M;  3SYK A;  4B7G A;  5FTK A;  2UUB M;  4PDI A;  2G5G X;  3MJ5 A;  5KPZ A;  3GPY A;  4DV4 M;  4LF7 M;  3VLF B;  2JA2 A;  3JAM S;  2BJW A;  4MGI E;  1TH4 A;  2YNM D;  3GPP A;  2UUA M;  2HL7 A;  3IG5 A;  4REZ A;  2KW0 A;  4OX9 M;  4MGZ E;  3SAR A;  5EQT A;  1IY0 A;  2C99 A;  2LXE A;  4LZZ A;  3SAS A;  2QP9 X;  4YHH M;  3FTF A;  3U60 A;  1NY5 A;  3TWK A;  4I4L A;  5KQD A;  3I51 A;  4LJ9 A;  2CHG A;  1GVN A;  5H37 D;  3U6P A;  4OVZ B;  3U6S A;  3GLG B;  3J7B A;  4GRI A;  2CEA A;  3K92 A;  2RGO A;  1IXZ A;  1HQY E;  1NJG A;  1R6B X;  1XWI A;  4JV5 M;  3HJS A;  3HJQ A;  4PDG A;  1UM8 A;  2ZAM A;  3M7G A;  4IBC A;  4IBE A;  2X4A A;  3AOE C;  3SFZ A;  3UK6 A;  3L28 A;  5ITX A;  4LY6 A;  1H6U A;  4JI2 M;  3KOY E;  4IBG A;  4DUZ M;  1G3I A;  1IM2 A;  5EXS A;  3HHX A;  5BPV A;  4IBD A;  4B7H A;  3LQQ A;  1IQP A;  3KOX E;  1NHG C;  4L16 A;  3J81 S;  1SXJ A;  1N36 M;  3GQ4 A;  2W82 A;  4II7 A;  2DXI A;  4NSO B;  3FTD A;  2XGN A;  2YQZ A;  3GQ3 A;  4I81 A;  4BB9 A;  4OVZ A;  2DWM A;  1C1K A;  3A45 A;  2Y20 A;  5E26 A;  1IN5 A;  2QPA A;  2CV0 A;  4MGY E;  2R62 A;  4QHT A;  4GHL A;  4DR4 M;  5EP4 A;  1Z5C A;  3Q8X A;  2D7G A;  1J09 A;  1XC8 A;  3IG8 A;  4RNA A;  3R9X B;  3UJN A;  4BBA A;  3GLG A;  2F5O A;  3AL0 C;  2FFJ A;  3GLH B;  3K2L A;  2X8A A;  1DO0 A;  1QAM A;  3FTC A;  4XBO A;  3L25 A;  3HHY A;  3KS8 A;  2CE7 A;  1IY1 A;  4QNR A;  3CTW B;  3UZU A;  4PD2 A;  4X64 M;  4LRS A;  1IY2 A;  3U61 B;  5EXP A;  4LCB A;  4M9X A;  1L2C A;  2F5P A;  4JI4 M;  1G41 A;  4XGI A;  4Z8X A;  3DA1 A;  2KZU A;  2P5T A;  5C1B A;  2CHV A;  1Z5A A;  4ZPX A;  3SAW A;  1NY6 A;  1HT1 E;  4IJF A;  4GKJ M;  4AKH A;  3HU2 A;  3U6D A;  4CHT B;  5IT9 S;  4NOO B;  3GQ5 A;  3QWL A;  3OTO M;  1GL6 A;  2CUZ A;  3L2A A;  4LJ4 A;  3RE8 A;  2J7N A;  3NWL A;  5FSW A;  1JR3 A;  2XH9 A;  2CV1 A;  3FUV A;  3L27 A;  5KQ8 A;  4LF6 M;  4LF4 M;  2QCU A;  3AOE A;  2VII A;  4YY3 M;  4JI0 M;  5ITQ A;  4LGM A;  7CAT A;  2Z3X A;  4NXM M;  1HNW M;  3GPX A;  3SYL A;  2ERC A;  3U61 A;  3FUT A;  2I7P A;  2XLJ A;  3HKP A;  1LV7 A;  2L09 A;  4GIP A;  4W5W A;  4DV6 M;  4LG2 A;  1YUB A;  4S12 A;  4WUR A;  1XNQ M;  1PJI A;  2UUC M;  3MHV C;  4KOD A;  3W0F A;  3U60 B;  2C5R A;  3GLF B;  4NRW A;  4X62 M;  1QAQ A;  4EIW A;  3GLI B;  5LMU M;  3SC3 A;  2LWX A;  3KSX A;  3J80 S;  3KXE C;  3VFD A;  4L15 A;  4D82 A;  4LF5 M;  3HHW A;  5KPT A;  1TGU A;  2RKO A;  2VQF M;  2V1C A;  1SXJ B;  5FTN A;  3RGP A;  2M60 A;  3T1Y M;  2DHR A;  2X49 A;  2VQE M;  2FOI C;  1G4A E;  3CF2 A;  3ZH9 B;  3J7A S;  1MU5 A;  1QZM A;  1L2D A;  3R8F A;  2XSZ D;  3CF6 E;  3THG A;  1ZQ9 A;  3D8L A;  4DUY M;  2XFT A;  2E5L M;  1VDD A;  3E4R A;  3K1J A;  4QNM A;  4FCW A;  4AQY M;  3I4V A;  5DYI A;  1TDZ A;  1OFI A;  3ZC7 B;  1L1T A;  3HGI A;  3UGJ A;  4L4U A;  5BR8 M;  3AV0 A;  4GMQ A;  1HR0 M;  3GLF A;  2UXD M;  2QBY B;  2F5S A;  2BNK A;  2FNA A;  4P16 A;  1NSF A;  3DFZ A;  3GPU A;  2D7E A;  1QQW A;  4B3M M;  1L8Q A;  3RGS A;  4GC5 A;  3BOS A;  3AJI B;  4LF9 M;  8CAT A;  3PNV A;  4R3D A;  3SBJ A;  4RF0 A;  4MGH A;  4JI3 M;  4LJA A;  1G8P A;  3FD9 A;  4JI5 M;  4KO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...