3HHWA

Complex of a vesicular stomatitis virus empty capsid with the nucleocapsid-binding domain of the phosphoprotein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
AVSDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGNGRMSHKEAILLGLRYKKLYNQARVKYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Phosphoprotein
publication title Structure of the vesicular stomatitis virus nucleocapsid in complex with the nucleocapsid-binding domain of the small polymerase cofactor, P.
pubmed doi rcsb
source organism Vesicular stomatitis indiana virus
total genus 10
structure length 73
sequence length 73
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.440 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhwA00
3HHZA 3HHWA 2K47A
chains in the Genus database with same CATH superfamily
1N36M 2ZANA 3LQQA 3U6CA 1D0KA 2R4EA 4B3SM 4QNMA 4JI8M 2H5XA 3GLHB 3VK7A 4G4NA 4LG2A 3BBZA 2UXCM 2M5ZA 4DUYM 2FOIC 4DR7M 2Z4SA 3U5ZB 2XFSA 3IG8A 1PM5A 4L6V6 2F5QA 4B3TM 3AOGA 4HEOA 3FE3A 2BWBA 2D7EA 1PJSA 1IXSB 3CF2A 1XHBA 2DWLA 1R6BX 3SAWA 3DFZA 2DWZB 2Z3XA 1WR1B 3MJ5A 2XZFA 2VIIA 4ZPXA 1HQYE 4MGKE 4R71A 2HHHM 2CUZA 1WJ7A 4LJ7A 5E26A 2F5PA 1V34A 4P16A 2F5NA 2ZBKB 4AW4A 2DVWB 1G71A 3DOAA 2WSCF 2C96A 1IFYA 4M9SA 1HR0M 3T1YM 3T1HM 2O25A 1G8PA 3HZJA 3NBIA 1Z5CA 1ORYB 1Z6TA 3THGA 4LJ8A 3C58A 2OO9A 2DAGA 1QZEA 2G3QA 3PXGA 1IY0A 3PVSA 2LNHC 2CV2A 1FNNA 1Q3BA 2LHGA 3E21A 1NVMA 3WHLA 1SXJA 1BVSA 3C3EA 3SMPA 4DR4M 3T6PA 2CHQA 2H1RA 3HU1A 3J7AS 3CGWA 1MJGM 3UGJA 2YNMD 1I4WA 3GLHE 4NRWA 4EIWA 1NHWC 5EXSA 3L2AA 3V76A 4FD2A 1PJQA 3FTDA 4HL4A 4IBDA 4B7GA 4DV5M 3SYKA 1T6OA 2L6OA 5FSWA 2DAEA 4JYAM 5EXXA 4Q7JA 5EQTA 3SFZA 4MGYE 1TTEA 3H4JA 3JAMS 2BJVA 2QZ4A 1Q39A 4GC5A 2RKOA 1HT1E 3LCVB 3CF6E 5DYGA 4DV4M 4RF0A 3AJIB 1ZV1A 2R45A 3KW6A 4LF4M 1G4AE 4QOZC 1E9SA 2QNJA 4LF8M 4JI1M 2M60A 4RNAA 1NNJA 1NJGA 1D0LA 1XXHE 3B7NA 2R65A 4I81A 3W68A 1VQ1A 2XSZD 1TF0B 1WGLA 2OQ4A 1RU3A 3FRHA 3QWLA 1R5LA 3U61B 1NV8A 4IBCA 1HT2E 4II7A 4HLQA 4LFBM 2LVOC 3GP1A 1PJIA 2X8AA 4IBKA 1D2NA 2E5LM 4NC6A 3UMMA 4ITQA 4NL4H 4LY6A 5ITYA 4B3RM 2HCBA 4CJ6A 1N33M 5IZ7D 3VKGA 4L15A 1WXQA 2JXNA 2LVNC 2KRKA 3PNVA 3MHVC 1WGNA 3GQ5A 2HAKA 2CV0A 1AUAA 4MGIE 3GLGA 1SXJB 4XBOA 4JI5M 2VDBB 1C7YA 2CFOA 4CISA 4REZA 3SASA 4W5WA 3C9PA 4JXJA 1IN7A 2MR9A 4FWGA 4Z6YA 3GQ4A 2R62A 4LJAA 3TWKA 2ZAOA 1J09A 2QSFX 3RE8A 4LFCM 3GRRA 3FTCA 1VEGA 3B89A 3A46A 3M0EA 2R44A 2NQ8C 2EUCA 4QHTA 2JY6B 4LJ9A 2MH8A 1AIPC 2K6BA 1Z59A 2AHMA 4QNRA 1XXHA 4NRVA 2B3TA 1LTMA 4B08A 5FTMA 3U6QA 4L8RC 1GJTA 2KHHA 2EKFA 2QBYA 2FE8A 4FVMA 5DFLA 2XLJA 1IBKM 3F92A 1PJTA 3E46A 2Z7JA 5JI2E 2CWBA 1A5TA 3HHZA 1R2ZA 1IBMM 1R7RA 3TWLA 2DENA 5ITXE 4LZZA 3K9PA 1F4IA 3NWLA 1PRBA 2C5RA 5BR8M 3GPPA 2JNHA 4X64M 3SC3A 4Y28F 1YUBA 4XK8F 2QQ8A 5A2QS 3GRVA 4K0KM 5FTKA 4OVZA 4AG5A 2UU9M 5EJCA 4S12A 4PD2A 3NBXX 2JY5A 1MN3A 2ZAMA 1SG9A 1VEKA 3AOEC 5IREB 2XF3A 1ZMWA 1TDHA 3PFIA 4IBFA 4LGYA 3SYLA 3GLGB 3TE6A 3SAVA 4M9ZA 3KS4A 1V33A 4FCVA 1XMOM 2W82A 3SBJA 1TH4A 4UN2B 2GQFA 4MB7A 2BWEA 2KRUA 1NV9A 4I8OA 2V1UA 2G5GX 1OIPA 2V1CA 1HNWM 2OOBA 4FWHA 4L4UA 4LFAM 3U6DA 3K1JA 3U61A 2LVQD 1K3XA 1L2DA 2DKLA 4JI2M 1NY5A 5DYIA 3FD9A 1N32M 1JQJC 1XXHB 2KW0A 3BOSA 5ITXA 5C18A 3CTWB 4TUWA 4NSOB 2JA2A 2BJWA 3M7GA 4IBEA 3R8FA 2CP8A 2ZTDA 1K82A 2UUCM 2DAIA 4IBBA 2QBYB 4AKGA 2K9DA 4WURA 5EXPA 2YQZA 2I7NA 1XB2B 5F3WA 1R2YA 1Q3CA 2DWNA 3W0LB 1PGYA 3FUXA 4DV2M 3AFHA 1UM8A 2HL7A 1L2CA 3TL4X 2HKJA 2LXEA 3FYCA 3FUWA 4X62M 4G3OA 4R3DA 3HU2A 4KLNA 3A98B 3FUUA 5IWAM 4FCWA 3OTOM 4DV0M 1GVNA 1OAIA 4LJ4A 1E94E 3FRIA 3GPUA 2G8LA 1SXJD 4OVZB 4NXNM 2DNAA 3GLGE 2R46A 5FTJA 3HHWA 5JI3E 3I51A 2F5OA 3D8BA 4AQYM 3LVVA 2RGOA 1Q02A 4QOSA 1OJLA 1IN5A 3CF0A 4I4LA 4YY3M 4CIZA 5FTNA 2DZLA 2FNAA 2LTUA 3I4YA 3GLFA 3UJNA 3LQRA 4RF1A 3E9SA 4GHLA 1TDZA 2WSEF 2KNAA 5KQ8A 1JB0F 1VEJA 1XWIA 1QUTA 3J2PB 4L78A 2VF8A 4JV5M 2QPAA 1L2BA 5IT9S 5EP4A 4XGIA 4AI6A 1QYRA 5H37D 2XH9A 3E4RA 4MH0E 2UUBM 2A5YB 3QYBA 2D7GA 3VFDA 3GLIE 3VKHA 4LF6M 3U6PA 4FCTA 4MGHA 1DGBA 1L1TA 5FLXS 3KS8A 3C3DA 2OPFA 3D8LA 3QYEA 5KPRA 3AOEA 1NHGC 3HWSA 5LMUM 4D80A 4DR5M 4LF9M 2C98A 2L7HA 3U6OA 3DA1A 1QZMA 1KYIA 3L26A 3ZCBB 1NNUC 3LW5F 2KZUA 3LVWA 3GRYA 3SHFA 4NOOB 4PDGA 1IXZA 2LBCA 2OOAA 1Y8GA 1IY2A 3KOWE 1TGUA 2L7IA 4IIWA 2Q2EB 4LJ5A 5EP1A 4DR1M 2CHGA 3TWMA 1V92A 2WZJA 4F1IA 1XNQM 2MGWA 4DV3M 3B7ZA 4OW0A 5KPZA 2KEBA 8CATA 3A42A 1ZAEA 3GRUA 2JZ0A 2YFQA 3KP1E 2VQEM 1GJSA 1IQPA 4GKJM 2CEAA 4G4QA 1NSFA 3FKEA 1G41A 5ITUA 3J81S 1VDDA 5FTLA 4WW0A 3GLFB 3GLIA 4JI4M 1QVRA 1R4GA 1WHCA 2ERCA 5C1BA 2EKKA 4X66M 3B9PA 3IECA 3WHKA 3U6EA 3DZDA 2C9CA 2JY7A 3HJ8A 1W5TA 4YHHM 3FYDA 1HQCA 3LMMA 3SMSA 1DGHA 3KSJA 3SARA 1N75A 2O5RA 2JY8A 3L29A 4LF5M 3ILKA 2BNKA 2FH0A 5GKNA 3GPYA 4AZFA 4F2LA 2VF7A 3H4MA 4DR2M 1XMQM 2UXDM 2QHOB 1JR3A 3VDPA 2DZOB 4MGZE 3W0FA 3BXWA 3J7BA 2ZTCA 1GL6A 1N78A 3FTFA 4JI0M 2LHCA 4KODA 3GQ3A 5ITTA 3AKZA 3L28A 4IBGA 1EE8A 3KP0E 1GKIA 4JI3M 2XFTA 1QANA 3RFWA 1ZMUA 3L27A 1E9RA 1KSFX 4KO8A 3FUVA 1IN6A 3SHGB 3T38A 3U6LA 3EIEA 3HKPA 3LCUA 1QAQA 4GH9A 1OIZA 2J7OA 4CGYB 3KXEC 3HHYA 1MU5A 1NJFA 4IBJA 3M6AA 1OFHA 4IJFA 4B3MM 3I04M 3PNYA 1L1ZA 4AKIA 1HNZM 3GLFE 5KO3A 1FJGM 3AV0A 1C1KA 4GRIA 4QHSA 3J27B 3VLFB 4DV7M 1EIJA 2QENA 2F4VM 2LVAA 2L2DA 2KNZA 1LV7A 1YLAA 3I01M 5ITQA 1IBLM 4M0DA 2APLA 2JUJA 3JR4A 3GLIB 4JI6M 1OQYA 1GO5A 3HY5A 2UXBM 3VDUA 2L4EA 2MROB 1GLNA 1DGGA 2DXIA 1NY6A 1N34M 2DHRA 2Z4RA 4D82A 4CHTB 1DGHB 2R0IA 2DAKA 2KDLA 3FUTA 1N77A 3TPZA 2O01F 1MX0A 2L09A 3SAUA 3UK6A 1YE9A 1VDLA 1DO2A 4LCBA 4RKUF 1TH3A 3IG5A 1WIVA 1YSYA 1QQWA 4NSRA 2XEPA 1X37A 2XGNA 4BB9A 3KSXA 3MMPA 1TR8A 3HHXA 1J5EM 2EA0A 2C99A 3HJQA 1K3WA 1IN4A 5DNYA 3KOZE 3VK8A 4NXMM 3Q8XA 3U6SA 4GIPA 1QDTA 4FWDA 3HGIA 4OU7A 1DO0A 3U60A 3FTEA 4X65M 4LJ6A 4B7FA 3KVWA 5KPTA 4DV1M 1OKSA 3A45A 4IJEA 4KT0F 4M0WA 2Y21A 3ZQJA 1GABA 4AKHA 4JN6A 4G4OA 3R9XB 1T43A 1IY1A 2ZM6M 2RGHA 1XNRM 4LZJA 2LVPC 2CHVA 4BLCA 2DAMA 2GNOA 1IXRC 1QUSA 2HWJA 3B7QA 2CV1A 2FFJA 3K2LA 2KNVA 4JI7M 4G6ZA 3J80S 5EXTA 4GMQA 4FW9A 3SATA 1Z5BA 2LWXA 2Y0TA 3TQSA 2XSZA 3EIHA 1PJJA 2CRUA 2QCUA 2XZUA 1P3QQ 2X4AA 4Z8XA 1JR3E 3KDSE 4B7HA 1GL7A 2I7PA 2V6ZM 3T15A 4A3VB 1HNXM 2R4JA 2UUAM 3HU3A 4GEWA 2Y20A 3K8ZA 3U6MA 1I94M 4MM3B 4PT5A 1HJPA 2KZSA 4GC9A 2J7NA 2L4FA 2QP9X 4M9XA 3KOXE 4LGMA 2DI0A 2DWMA 4PCZA 5EP3A 2YR0A 2RRUA 4WP2A 5EP2A 2MJ5B 3ZH9B 2J5YA 1IN8A 3QAUA 4AG6A 3L25A 2R18A 3K9OA 1D0MA 4D81A 1T3TA 5KQDA 3GO8A 2EO2A 4GITA 1EFUB 2JZ1A 3GLHA 4LRSA 1DV0A 1TH2A 2N35A 2WSFF 3U60B 4DR6M 3U5ZA 4I5SA 1E32A 3JR5A 2DZNB 4DUZM 5LMNM 1ZQ9A 1XC8A 4GKKM 2LH0A 4DV6M 1IXSA 2R6FA 1SXJC 2JWSA 1VG5A 5BPVA 2P5TA 2X49A 1H6UA 4OX9M 2FS1A 3K92A 1Z5AA 2VQFM 2KXEA 1QDRA 1OFIA 3HJSA 1OTRA 3GPXA 1ZMVA 4L16A 4ANRA 4LF7M 1IM2A 2K0BX 3ZC7B 4IBIA 3I4VA 3IHPA 1J7KA 4G4RA 2F5SA 2C9OA 2CE7A 1QAMA 4DBGB 1OAOC 4R7GA 2Z8YM 3KOYE 4GHAA 1DGFA 2Y0QA 1JR3D 1QAOA 4DR3M 5E6JA 2JP7A 2DHYA 2KA6B 3Q8GA 3RGPA 5ITRA 1NO1A 3UZUA 3B74A 3W67A 2K47A 3RGSA 2EJSA 1W5SA 2D7HA 3MK6A 5L8RF 7CATA 4LRTA 1G59A 4KHPM 1KFVA 1UFZA 1S3SA 4BBAA 3AL0C 1G3IA 4P17A 3KFUG 3HX3A 1SXJE 1CUKA 1L8QA 4PDIA
chains in the Genus database with same CATH topology
1N36M 2ZANA 3LQQA 3U6CA 2R4EA 4B3SM 4QNMA 4JI8M 3GLHB 3VK7A 4G4NA 4LG2A 2UXCM 2M5ZA 4DUYM 2FOIC 4DR7M 2Z4SA 3U5ZB 2XFSA 3IG8A 1PM5A 2F5QA 4B3TM 3AOGA 2D7EA 1IXSB 3CF2A 1XHBA 2DWLA 1R6BX 3SAWA 3DFZA 2DWZB 2Z3XA 3MJ5A 2XZFA 2VIIA 4ZPXA 1HQYE 4MGKE 2HHHM 2CUZA 4LJ7A 5E26A 2F5PA 2F5NA 4P16A 2ZBKB 4AW4A 2DVWB 3DOAA 2C96A 4M9SA 1HR0M 3T1YM 3T1HM 3NBIA 1G8PA 1Z5CA 1ORYB 1Z6TA 3THGA 4LJ8A 3C58A 3PXGA 1IY0A 3PVSA 2LNHC 2CV2A 1FNNA 1Q3BA 3WHLA 1NVMA 1SXJA 3SMPA 4DR4M 2CHQA 2H1RA 3HU1A 3J7AS 3UGJA 2YNMD 1I4WA 4NRWA 4EIWA 1NHWC 5EXSA 3L2AA 4FD2A 3FTDA 4HL4A 4IBDA 4B7GA 4DV5M 3SYKA 2L6OA 5FSWA 4JYAM 5EXXA 5EQTA 3SFZA 4MGYE 3JAMS 2BJVA 2QZ4A 1Q39A 4GC5A 2RKOA 1HT1E 3CF6E 5DYGA 4DV4M 4RF0A 3AJIB 2R45A 3KW6A 4LF4M 1G4AE 4QOZC 1E9SA 4LF8M 4JI1M 2M60A 4RNAA 1NNJA 1NJGA 2R65A 4I81A 2XSZD 2OQ4A 3QWLA 3U61B 4IBCA 1HT2E 4II7A 4HLQA 4LFBM 3GP1A 1PJIA 2X8AA 4IBKA 1D2NA 2E5LM 3UMMA 4ITQA 4NL4H 4LY6A 5ITYA 4B3RM 2HCBA 1N33M 5IZ7D 3VKGA 4L15A 1WXQA 2KRKA 3PNVA 3MHVC 3GQ5A 2CV0A 4MGIE 3GLGA 1SXJB 4XBOA 4JI5M 2CFOA 4CISA 4REZA 3SASA 4W5WA 4JXJA 1IN7A 4Z6YA 4FWGA 3GQ4A 2R62A 4LJAA 3TWKA 2ZAOA 1J09A 3RE8A 4LFCM 3GRRA 3FTCA 3A46A 3M0EA 2NQ8C 2EUCA 4QHTA 4LJ9A 4QNRA 1Z59A 2AHMA 1XXHA 4NRVA 4B08A 5FTMA 3U6QA 4L8RC 2QBYA 2FE8A 4FVMA 2XLJA 1IBKM 2Z7JA 5JI2E 3HHZA 1R2ZA 1IBMM 1R7RA 3TWLA 5ITXE 4LZZA 3NWLA 2C5RA 5BR8M 3GPPA 4X64M 3SC3A 1YUBA 5A2QS 3GRVA 4K0KM 5FTKA 4OVZA 4AG5A 2UU9M 5EJCA 4S12A 4PD2A 2ZAMA 3AOEC 5IREB 2XF3A 1TDHA 3PFIA 4IBFA 4LGYA 3SYLA 3GLGB 3TE6A 3SAVA 4M9ZA 3KS4A 4FCVA 1XMOM 2W82A 3SBJA 1TH4A 4MB7A 2KRUA 4I8OA 2V1UA 2G5GX 2V1CA 1HNWM 4FWHA 4L4UA 4LFAM 3U6DA 3K1JA 3U61A 1L2DA 1K3XA 4JI2M 1NY5A 5DYIA 3FD9A 1N32M 1JQJC 1XXHB 2KW0A 3BOSA 5ITXA 5C18A 3CTWB 4TUWA 4NSOB 2JA2A 2BJWA 3M7GA 4IBEA 3R8FA 1K82A 2UUCM 4AKGA 2QBYB 4IBBA 4WURA 5EXPA 2YQZA 2I7NA 5F3WA 1R2YA 1Q3CA 2DWNA 3W0LB 3FUXA 4DV2M 3AFHA 1UM8A 2HL7A 1L2CA 3TL4X 2HKJA 2LXEA 3FYCA 3FUWA 4X62M 4R3DA 3HU2A 4KLNA 3A98B 3FUUA 5IWAM 4FCWA 3OTOM 4DV0M 1GVNA 4LJ4A 1E94E 3GPUA 2G8LA 1SXJD 4OVZB 4NXNM 2R46A 5FTJA 3HHWA 5JI3E 3I51A 2F5OA 3D8BA 4AQYM 3LVVA 2RGOA 4QOSA 1OJLA 1IN5A 3CF0A 4I4LA 4YY3M 5FTNA 2FNAA 3I4YA 3GLFA 3UJNA 3LQRA 4RF1A 3E9SA 4GHLA 1TDZA 5KQ8A 1XWIA 3J2PB 4L78A 4JV5M 2QPAA 1L2BA 5IT9S 5EP4A 4XGIA 4AI6A 1QYRA 5H37D 2XH9A 3E4RA 4MH0E 2UUBM 2A5YB 2D7GA 3VFDA 3VKHA 4LF6M 3U6PA 4FCTA 4MGHA 1DGBA 1L1TA 5FLXS 3KS8A 2OPFA 3D8LA 5KPRA 3AOEA 1NHGC 3HWSA 5LMUM 4D80A 4DR5M 4LF9M 2C98A 2L7HA 3U6OA 3DA1A 1QZMA 1KYIA 3L26A 3ZCBB 1NNUC 2KZUA 3LVWA 3GRYA 3SHFA 4NOOB 4PDGA 1IXZA 3KOWE 1IY2A 4LJ5A 1TGUA 2L7IA 4IIWA 2Q2EB 5EP1A 4DR1M 2CHGA 3TWMA 1XNQM 4DV3M 4OW0A 5KPZA 2KEBA 8CATA 3A42A 1ZAEA 3GRUA 2VQEM 2YFQA 3KP1E 1IQPA 4GKJM 2CEAA 4G4QA 1NSFA 3FKEA 1G41A 5ITUA 3J81S 1VDDA 5FTLA 4WW0A 3GLFB 3GLIA 4JI4M 1QVRA 2ERCA 5C1BA 4X66M 3B9PA 3WHKA 3U6EA 3DZDA 2C9CA 3HJ8A 1W5TA 4YHHM 3FYDA 1HQCA 3LMMA 3SMSA 1DGHA 3KSJA 3SARA 1N75A 2O5RA 4LF5M 3L29A 3ILKA 2BNKA 5GKNA 3GPYA 4AZFA 3H4MA 4DR2M 1XMQM 2UXDM 1JR3A 3VDPA 2DZOB 4MGZE 3W0FA 3J7BA 1GL6A 1N78A 3FTFA 4JI0M 4KODA 3GQ3A 5ITTA 3AKZA 3L28A 4IBGA 1EE8A 3KP0E 1GKIA 4JI3M 2XFTA 1QANA 3RFWA 3L27A 1E9RA 1KSFX 4KO8A 3FUVA 1IN6A 3SHGB 3T38A 3U6LA 3EIEA 3HKPA 1QAQA 4GH9A 2J7OA 4CGYB 3KXEC 3HHYA 1MU5A 1NJFA 4IBJA 3M6AA 1OFHA 4IJFA 4B3MM 3PNYA 1L1ZA 4AKIA 1HNZM 5KO3A 1FJGM 3AV0A 1C1KA 4GRIA 4QHSA 3J27B 3VLFB 4DV7M 2QENA 2F4VM 1LV7A 1IBLM 5ITQA 4M0DA 3GLIB 3JR4A 4JI6M 2UXBM 3VDUA 1GLNA 1DGGA 2DXIA 1NY6A 1N34M 2DHRA 2Z4RA 4D82A 4CHTB 1DGHB 3FUTA 1N77A 3TPZA 1MX0A 2L09A 3SAUA 3UK6A 1YE9A 1DO2A 4LCBA 1TH3A 3IG5A 1YSYA 1QQWA 4NSRA 2XEPA 1X37A 2XGNA 4BB9A 3KSXA 3HHXA 1J5EM 2EA0A 2C99A 3HJQA 1K3WA 1IN4A 5DNYA 3KOZE 3VK8A 4NXMM 3Q8XA 3U6SA 4GIPA 4FWDA 3HGIA 4OU7A 1DO0A 3U60A 3FTEA 4X65M 4LJ6A 4B7FA 3KVWA 5KPTA 4DV1M 3A45A 4IJEA 4M0WA 2Y21A 4AKHA 4JN6A 4G4OA 3R9XB 1IY1A 2ZM6M 2RGHA 1XNRM 4LZJA 2CHVA 4BLCA 1IXRC 2CV1A 2FFJA 3K2LA 4JI7M 4G6ZA 3J80S 5EXTA 4GMQA 4FW9A 3SATA 1Z5BA 2LWXA 2Y0TA 3TQSA 2XSZA 3EIHA 1PJJA 2QCUA 2XZUA 2X4AA 4Z8XA 3KDSE 4B7HA 1GL7A 2I7PA 2V6ZM 3T15A 4A3VB 1HNXM 2R4JA 2UUAM 3HU3A 2Y20A 3K8ZA 3U6MA 1I94M 4MM3B 4PT5A 2KZSA 4GC9A 2J7NA 2QP9X 4M9XA 3KOXE 4LGMA 2DWMA 4PCZA 5EP3A 2YR0A 5EP2A 3ZH9B 3QAUA 1IN8A 4AG6A 3L25A 2R18A 4D81A 1T3TA 5KQDA 3GO8A 2EO2A 4GITA 3GLHA 4LRSA 1TH2A 3U60B 4DR6M 3U5ZA 4I5SA 1E32A 3JR5A 2DZNB 4DUZM 5LMNM 1ZQ9A 1XC8A 4GKKM 2LH0A 4DV6M 1SXJC 5BPVA 2P5TA 2X49A 1H6UA 4OX9M 3K92A 1Z5AA 2VQFM 2KXEA 1OFIA 3HJSA 3GPXA 4LF7M 4L16A 1IM2A 3ZC7B 4IBIA 3I4VA 4G4RA 1J7KA 2F5SA 2C9OA 2CE7A 1QAMA 4R7GA 3KOYE 4GHAA 1DGFA 2Y0QA 1JR3D 1QAOA 4DR3M 5E6JA 2KA6B 3RGPA 5ITRA 3UZUA 2K47A 3RGSA 1W5SA 2D7HA 3MK6A 4KHPM 7CATA 4LRTA 1G59A 1KFVA 3AL0C 1S3SA 4BBAA 1G3IA 3KFUG 1SXJE 1L8QA 4PDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHZ A;  3HHW A;  2K47 A; 
#chains in the Genus database with same CATH topology
 1N36 M;  2ZAN A;  3LQQ A;  3U6C A;  1D0K A;  2R4E A;  4B3S M;  4QNM A;  4JI8 M;  2H5X A;  3GLH B;  3VK7 A;  4G4N A;  4LG2 A;  3BBZ A;  2UXC M;  2M5Z A;  4DUY M;  2FOI C;  4DR7 M;  2Z4S A;  3U5Z B;  2XFS A;  3IG8 A;  1PM5 A;  4L6V 6;  2F5Q A;  4B3T M;  3AOG A;  4HEO A;  3FE3 A;  2BWB A;  2D7E A;  1PJS A;  1IXS B;  3CF2 A;  1XHB A;  2DWL A;  1R6B X;  3SAW A;  3DFZ A;  2DWZ B;  2Z3X A;  1WR1 B;  3MJ5 A;  2XZF A;  2VII A;  4ZPX A;  1HQY E;  4MGK E;  4R71 A;  2HHH M;  2CUZ A;  1WJ7 A;  4LJ7 A;  5E26 A;  2F5P A;  1V34 A;  4P16 A;  2F5N A;  2ZBK B;  4AW4 A;  2DVW B;  1G71 A;  3DOA A;  2WSC F;  2C96 A;  1IFY A;  4M9S A;  1HR0 M;  3T1Y M;  3T1H M;  2O25 A;  1G8P A;  3HZJ A;  3NBI A;  1Z5C A;  1ORY B;  1Z6T A;  3THG A;  4LJ8 A;  3C58 A;  2OO9 A;  2DAG A;  1QZE A;  2G3Q A;  3PXG A;  1IY0 A;  3PVS A;  2LNH C;  2CV2 A;  1FNN A;  1Q3B A;  2LHG A;  3E21 A;  1NVM A;  3WHL A;  1SXJ A;  1BVS A;  3C3E A;  3SMP A;  4DR4 M;  3T6P A;  2CHQ A;  2H1R A;  3HU1 A;  3J7A S;  3CGW A;  1MJG M;  3UGJ A;  2YNM D;  1I4W A;  3GLH E;  4NRW A;  4EIW A;  1NHW C;  5EXS A;  3L2A A;  3V76 A;  4FD2 A;  1PJQ A;  3FTD A;  4HL4 A;  4IBD A;  4B7G A;  4DV5 M;  3SYK A;  1T6O A;  2L6O A;  5FSW A;  2DAE A;  4JYA M;  5EXX A;  4Q7J A;  5EQT A;  3SFZ A;  4MGY E;  1TTE A;  3H4J A;  3JAM S;  2BJV A;  2QZ4 A;  1Q39 A;  4GC5 A;  2RKO A;  1HT1 E;  3LCV B;  3CF6 E;  5DYG A;  4DV4 M;  4RF0 A;  3AJI B;  1ZV1 A;  2R45 A;  3KW6 A;  4LF4 M;  1G4A E;  4QOZ C;  1E9S A;  2QNJ A;  4LF8 M;  4JI1 M;  2M60 A;  4RNA A;  1NNJ A;  1NJG A;  1D0L A;  1XXH E;  3B7N A;  2R65 A;  4I81 A;  3W68 A;  1VQ1 A;  2XSZ D;  1TF0 B;  1WGL A;  2OQ4 A;  1RU3 A;  3FRH A;  3QWL A;  1R5L A;  3U61 B;  1NV8 A;  4IBC A;  1HT2 E;  4II7 A;  4HLQ A;  4LFB M;  2LVO C;  3GP1 A;  1PJI A;  2X8A A;  4IBK A;  1D2N A;  2E5L M;  4NC6 A;  3UMM A;  4ITQ A;  4NL4 H;  4LY6 A;  5ITY A;  4B3R M;  2HCB A;  4CJ6 A;  1N33 M;  5IZ7 D;  3VKG A;  4L15 A;  1WXQ A;  2JXN A;  2LVN C;  2KRK A;  3PNV A;  3MHV C;  1WGN A;  3GQ5 A;  2HAK A;  2CV0 A;  1AUA A;  4MGI E;  3GLG A;  1SXJ B;  4XBO A;  4JI5 M;  2VDB B;  1C7Y A;  2CFO A;  4CIS A;  4REZ A;  3SAS A;  4W5W A;  3C9P A;  4JXJ A;  1IN7 A;  2MR9 A;  4FWG A;  4Z6Y A;  3GQ4 A;  2R62 A;  4LJA A;  3TWK A;  2ZAO A;  1J09 A;  2QSF X;  3RE8 A;  4LFC M;  3GRR A;  3FTC A;  1VEG A;  3B89 A;  3A46 A;  3M0E A;  2R44 A;  2NQ8 C;  2EUC A;  4QHT A;  2JY6 B;  4LJ9 A;  2MH8 A;  1AIP C;  2K6B A;  1Z59 A;  2AHM A;  4QNR A;  1XXH A;  4NRV A;  2B3T A;  1LTM A;  4B08 A;  5FTM A;  3U6Q A;  4L8R C;  1GJT A;  2KHH A;  2EKF A;  2QBY A;  2FE8 A;  4FVM A;  5DFL A;  2XLJ A;  1IBK M;  3F92 A;  1PJT A;  3E46 A;  2Z7J A;  5JI2 E;  2CWB A;  1A5T A;  3HHZ A;  1R2Z A;  1IBM M;  1R7R A;  3TWL A;  2DEN A;  5ITX E;  4LZZ A;  3K9P A;  1F4I A;  3NWL A;  1PRB A;  2C5R A;  5BR8 M;  3GPP A;  2JNH A;  4X64 M;  3SC3 A;  4Y28 F;  1YUB A;  4XK8 F;  2QQ8 A;  5A2Q S;  3GRV A;  4K0K M;  5FTK A;  4OVZ A;  4AG5 A;  2UU9 M;  5EJC A;  4S12 A;  4PD2 A;  3NBX X;  2JY5 A;  1MN3 A;  2ZAM A;  1SG9 A;  1VEK A;  3AOE C;  5IRE B;  2XF3 A;  1ZMW A;  1TDH A;  3PFI A;  4IBF A;  4LGY A;  3SYL A;  3GLG B;  3TE6 A;  3SAV A;  4M9Z A;  3KS4 A;  1V33 A;  4FCV A;  1XMO M;  2W82 A;  3SBJ A;  1TH4 A;  4UN2 B;  2GQF A;  4MB7 A;  2BWE A;  2KRU A;  1NV9 A;  4I8O A;  2V1U A;  2G5G X;  1OIP A;  2V1C A;  1HNW M;  2OOB A;  4FWH A;  4L4U A;  4LFA M;  3U6D A;  3K1J A;  3U61 A;  2LVQ D;  1K3X A;  1L2D A;  2DKL A;  4JI2 M;  1NY5 A;  5DYI A;  3FD9 A;  1N32 M;  1JQJ C;  1XXH B;  2KW0 A;  3BOS A;  5ITX A;  5C18 A;  3CTW B;  4TUW A;  4NSO B;  2JA2 A;  2BJW A;  3M7G A;  4IBE A;  3R8F A;  2CP8 A;  2ZTD A;  1K82 A;  2UUC M;  2DAI A;  4IBB A;  2QBY B;  4AKG A;  2K9D A;  4WUR A;  5EXP A;  2YQZ A;  2I7N A;  1XB2 B;  5F3W A;  1R2Y A;  1Q3C A;  2DWN A;  3W0L B;  1PGY A;  3FUX A;  4DV2 M;  3AFH A;  1UM8 A;  2HL7 A;  1L2C A;  3TL4 X;  2HKJ A;  2LXE A;  3FYC A;  3FUW A;  4X62 M;  4G3O A;  4R3D A;  3HU2 A;  4KLN A;  3A98 B;  3FUU A;  5IWA M;  4FCW A;  3OTO M;  4DV0 M;  1GVN A;  1OAI A;  4LJ4 A;  1E94 E;  3FRI A;  3GPU A;  2G8L A;  1SXJ D;  4OVZ B;  4NXN M;  2DNA A;  3GLG E;  2R46 A;  5FTJ A;  3HHW A;  5JI3 E;  3I51 A;  2F5O A;  3D8B A;  4AQY M;  3LVV A;  2RGO A;  1Q02 A;  4QOS A;  1OJL A;  1IN5 A;  3CF0 A;  4I4L A;  4YY3 M;  4CIZ A;  5FTN A;  2DZL A;  2FNA A;  2LTU A;  3I4Y A;  3GLF A;  3UJN A;  3LQR A;  4RF1 A;  3E9S A;  4GHL A;  1TDZ A;  2WSE F;  2KNA A;  5KQ8 A;  1JB0 F;  1VEJ A;  1XWI A;  1QUT A;  3J2P B;  4L78 A;  2VF8 A;  4JV5 M;  2QPA A;  1L2B A;  5IT9 S;  5EP4 A;  4XGI A;  4AI6 A;  1QYR A;  5H37 D;  2XH9 A;  3E4R A;  4MH0 E;  2UUB M;  2A5Y B;  3QYB A;  2D7G A;  3VFD A;  3GLI E;  3VKH A;  4LF6 M;  3U6P A;  4FCT A;  4MGH A;  1DGB A;  1L1T A;  5FLX S;  3KS8 A;  3C3D A;  2OPF A;  3D8L A;  3QYE A;  5KPR A;  3AOE A;  1NHG C;  3HWS A;  5LMU M;  4D80 A;  4DR5 M;  4LF9 M;  2C98 A;  2L7H A;  3U6O A;  3DA1 A;  1QZM A;  1KYI A;  3L26 A;  3ZCB B;  1NNU C;  3LW5 F;  2KZU A;  3LVW A;  3GRY A;  3SHF A;  4NOO B;  4PDG A;  1IXZ A;  2LBC A;  2OOA A;  1Y8G A;  1IY2 A;  3KOW E;  1TGU A;  2L7I A;  4IIW A;  2Q2E B;  4LJ5 A;  5EP1 A;  4DR1 M;  2CHG A;  3TWM A;  1V92 A;  2WZJ A;  4F1I A;  1XNQ M;  2MGW A;  4DV3 M;  3B7Z A;  4OW0 A;  5KPZ A;  2KEB A;  8CAT A;  3A42 A;  1ZAE A;  3GRU A;  2JZ0 A;  2YFQ A;  3KP1 E;  2VQE M;  1GJS A;  1IQP A;  4GKJ M;  2CEA A;  4G4Q A;  1NSF A;  3FKE A;  1G41 A;  5ITU A;  3J81 S;  1VDD A;  5FTL A;  4WW0 A;  3GLF B;  3GLI A;  4JI4 M;  1QVR A;  1R4G A;  1WHC A;  2ERC A;  5C1B A;  2EKK A;  4X66 M;  3B9P A;  3IEC A;  3WHK A;  3U6E A;  3DZD A;  2C9C A;  2JY7 A;  3HJ8 A;  1W5T A;  4YHH M;  3FYD A;  1HQC A;  3LMM A;  3SMS A;  1DGH A;  3KSJ A;  3SAR A;  1N75 A;  2O5R A;  2JY8 A;  3L29 A;  4LF5 M;  3ILK A;  2BNK A;  2FH0 A;  5GKN A;  3GPY A;  4AZF A;  4F2L A;  2VF7 A;  3H4M A;  4DR2 M;  1XMQ M;  2UXD M;  2QHO B;  1JR3 A;  3VDP A;  2DZO B;  4MGZ E;  3W0F A;  3BXW A;  3J7B A;  2ZTC A;  1GL6 A;  1N78 A;  3FTF A;  4JI0 M;  2LHC A;  4KOD A;  3GQ3 A;  5ITT A;  3AKZ A;  3L28 A;  4IBG A;  1EE8 A;  3KP0 E;  1GKI A;  4JI3 M;  2XFT A;  1QAN A;  3RFW A;  1ZMU A;  3L27 A;  1E9R A;  1KSF X;  4KO8 A;  3FUV A;  1IN6 A;  3SHG B;  3T38 A;  3U6L A;  3EIE A;  3HKP A;  3LCU A;  1QAQ A;  4GH9 A;  1OIZ A;  2J7O A;  4CGY B;  3KXE C;  3HHY A;  1MU5 A;  1NJF A;  4IBJ A;  3M6A A;  1OFH A;  4IJF A;  4B3M M;  3I04 M;  3PNY A;  1L1Z A;  4AKI A;  1HNZ M;  3GLF E;  5KO3 A;  1FJG M;  3AV0 A;  1C1K A;  4GRI A;  4QHS A;  3J27 B;  3VLF B;  4DV7 M;  1EIJ A;  2QEN A;  2F4V M;  2LVA A;  2L2D A;  2KNZ A;  1LV7 A;  1YLA A;  3I01 M;  5ITQ A;  1IBL M;  4M0D A;  2APL A;  2JUJ A;  3JR4 A;  3GLI B;  4JI6 M;  1OQY A;  1GO5 A;  3HY5 A;  2UXB M;  3VDU A;  2L4E A;  2MRO B;  1GLN A;  1DGG A;  2DXI A;  1NY6 A;  1N34 M;  2DHR A;  2Z4R A;  4D82 A;  4CHT B;  1DGH B;  2R0I A;  2DAK A;  2KDL A;  3FUT A;  1N77 A;  3TPZ A;  2O01 F;  1MX0 A;  2L09 A;  3SAU A;  3UK6 A;  1YE9 A;  1VDL A;  1DO2 A;  4LCB A;  4RKU F;  1TH3 A;  3IG5 A;  1WIV A;  1YSY A;  1QQW A;  4NSR A;  2XEP A;  1X37 A;  2XGN A;  4BB9 A;  3KSX A;  3MMP A;  1TR8 A;  3HHX A;  1J5E M;  2EA0 A;  2C99 A;  3HJQ A;  1K3W A;  1IN4 A;  5DNY A;  3KOZ E;  3VK8 A;  4NXM M;  3Q8X A;  3U6S A;  4GIP A;  1QDT A;  4FWD A;  3HGI A;  4OU7 A;  1DO0 A;  3U60 A;  3FTE A;  4X65 M;  4LJ6 A;  4B7F A;  3KVW A;  5KPT A;  4DV1 M;  1OKS A;  3A45 A;  4IJE A;  4KT0 F;  4M0W A;  2Y21 A;  3ZQJ A;  1GAB A;  4AKH A;  4JN6 A;  4G4O A;  3R9X B;  1T43 A;  1IY1 A;  2ZM6 M;  2RGH A;  1XNR M;  4LZJ A;  2LVP C;  2CHV A;  4BLC A;  2DAM A;  2GNO A;  1IXR C;  1QUS A;  2HWJ A;  3B7Q A;  2CV1 A;  2FFJ A;  3K2L A;  2KNV A;  4JI7 M;  4G6Z A;  3J80 S;  5EXT A;  4GMQ A;  4FW9 A;  3SAT A;  1Z5B A;  2LWX A;  2Y0T A;  3TQS A;  2XSZ A;  3EIH A;  1PJJ A;  2CRU A;  2QCU A;  2XZU A;  1P3Q Q;  2X4A A;  4Z8X A;  1JR3 E;  3KDS E;  4B7H A;  1GL7 A;  2I7P A;  2V6Z M;  3T15 A;  4A3V B;  1HNX M;  2R4J A;  2UUA M;  3HU3 A;  4GEW A;  2Y20 A;  3K8Z A;  3U6M A;  1I94 M;  4MM3 B;  4PT5 A;  1HJP A;  2KZS A;  4GC9 A;  2J7N A;  2L4F A;  2QP9 X;  4M9X A;  3KOX E;  4LGM A;  2DI0 A;  2DWM A;  4PCZ A;  5EP3 A;  2YR0 A;  2RRU A;  4WP2 A;  5EP2 A;  2MJ5 B;  3ZH9 B;  2J5Y A;  1IN8 A;  3QAU A;  4AG6 A;  3L25 A;  2R18 A;  3K9O A;  1D0M A;  4D81 A;  1T3T A;  5KQD A;  3GO8 A;  2EO2 A;  4GIT A;  1EFU B;  2JZ1 A;  3GLH A;  4LRS A;  1DV0 A;  1TH2 A;  2N35 A;  2WSF F;  3U60 B;  4DR6 M;  3U5Z A;  4I5S A;  1E32 A;  3JR5 A;  2DZN B;  4DUZ M;  5LMN M;  1ZQ9 A;  1XC8 A;  4GKK M;  2LH0 A;  4DV6 M;  1IXS A;  2R6F A;  1SXJ C;  2JWS A;  1VG5 A;  5BPV A;  2P5T A;  2X49 A;  1H6U A;  4OX9 M;  2FS1 A;  3K92 A;  1Z5A A;  2VQF M;  2KXE A;  1QDR A;  1OFI A;  3HJS A;  1OTR A;  3GPX A;  1ZMV A;  4L16 A;  4ANR A;  4LF7 M;  1IM2 A;  2K0B X;  3ZC7 B;  4IBI A;  3I4V A;  3IHP A;  1J7K A;  4G4R A;  2F5S A;  2C9O A;  2CE7 A;  1QAM A;  4DBG B;  1OAO C;  4R7G A;  2Z8Y M;  3KOY E;  4GHA A;  1DGF A;  2Y0Q A;  1JR3 D;  1QAO A;  4DR3 M;  5E6J A;  2JP7 A;  2DHY A;  2KA6 B;  3Q8G A;  3RGP A;  5ITR A;  1NO1 A;  3UZU A;  3B74 A;  3W67 A;  2K47 A;  3RGS A;  2EJS A;  1W5S A;  2D7H A;  3MK6 A;  5L8R F;  7CAT A;  4LRT A;  1G59 A;  4KHP M;  1KFV A;  1UFZ A;  1S3S A;  4BBA A;  3AL0 C;  1G3I A;  4P17 A;  3KFU G;  3HX3 A;  1SXJ E;  1CUK A;  1L8Q A;  4PDI A; 
#chains in the Genus database with same CATH homology
 1N36 M;  2ZAN A;  3LQQ A;  3U6C A;  2R4E A;  4B3S M;  4QNM A;  4JI8 M;  3GLH B;  3VK7 A;  4G4N A;  4LG2 A;  2UXC M;  2M5Z A;  4DUY M;  2FOI C;  4DR7 M;  2Z4S A;  3U5Z B;  2XFS A;  3IG8 A;  1PM5 A;  2F5Q A;  4B3T M;  3AOG A;  2D7E A;  1IXS B;  3CF2 A;  1XHB A;  2DWL A;  1R6B X;  3SAW A;  3DFZ A;  2DWZ B;  2Z3X A;  3MJ5 A;  2XZF A;  2VII A;  4ZPX A;  1HQY E;  4MGK E;  2HHH M;  2CUZ A;  4LJ7 A;  5E26 A;  2F5P A;  2F5N A;  4P16 A;  2ZBK B;  4AW4 A;  2DVW B;  3DOA A;  2C96 A;  4M9S A;  1HR0 M;  3T1Y M;  3T1H M;  3NBI A;  1G8P A;  1Z5C A;  1ORY B;  1Z6T A;  3THG A;  4LJ8 A;  3C58 A;  3PXG A;  1IY0 A;  3PVS A;  2LNH C;  2CV2 A;  1FNN A;  1Q3B A;  3WHL A;  1NVM A;  1SXJ A;  3SMP A;  4DR4 M;  2CHQ A;  2H1R A;  3HU1 A;  3J7A S;  3UGJ A;  2YNM D;  1I4W A;  4NRW A;  4EIW A;  1NHW C;  5EXS A;  3L2A A;  4FD2 A;  3FTD A;  4HL4 A;  4IBD A;  4B7G A;  4DV5 M;  3SYK A;  2L6O A;  5FSW A;  4JYA M;  5EXX A;  5EQT A;  3SFZ A;  4MGY E;  3JAM S;  2BJV A;  2QZ4 A;  1Q39 A;  4GC5 A;  2RKO A;  1HT1 E;  3CF6 E;  5DYG A;  4DV4 M;  4RF0 A;  3AJI B;  2R45 A;  3KW6 A;  4LF4 M;  1G4A E;  4QOZ C;  1E9S A;  4LF8 M;  4JI1 M;  2M60 A;  4RNA A;  1NNJ A;  1NJG A;  2R65 A;  4I81 A;  2XSZ D;  2OQ4 A;  3QWL A;  3U61 B;  4IBC A;  1HT2 E;  4II7 A;  4HLQ A;  4LFB M;  3GP1 A;  1PJI A;  2X8A A;  4IBK A;  1D2N A;  2E5L M;  3UMM A;  4ITQ A;  4NL4 H;  4LY6 A;  5ITY A;  4B3R M;  2HCB A;  1N33 M;  5IZ7 D;  3VKG A;  4L15 A;  1WXQ A;  2KRK A;  3PNV A;  3MHV C;  3GQ5 A;  2CV0 A;  4MGI E;  3GLG A;  1SXJ B;  4XBO A;  4JI5 M;  2CFO A;  4CIS A;  4REZ A;  3SAS A;  4W5W A;  4JXJ A;  1IN7 A;  4Z6Y A;  4FWG A;  3GQ4 A;  2R62 A;  4LJA A;  3TWK A;  2ZAO A;  1J09 A;  3RE8 A;  4LFC M;  3GRR A;  3FTC A;  3A46 A;  3M0E A;  2NQ8 C;  2EUC A;  4QHT A;  4LJ9 A;  4QNR A;  1Z59 A;  2AHM A;  1XXH A;  4NRV A;  4B08 A;  5FTM A;  3U6Q A;  4L8R C;  2QBY A;  2FE8 A;  4FVM A;  2XLJ A;  1IBK M;  2Z7J A;  5JI2 E;  3HHZ A;  1R2Z A;  1IBM M;  1R7R A;  3TWL A;  5ITX E;  4LZZ A;  3NWL A;  2C5R A;  5BR8 M;  3GPP A;  4X64 M;  3SC3 A;  1YUB A;  5A2Q S;  3GRV A;  4K0K M;  5FTK A;  4OVZ A;  4AG5 A;  2UU9 M;  5EJC A;  4S12 A;  4PD2 A;  2ZAM A;  3AOE C;  5IRE B;  2XF3 A;  1TDH A;  3PFI A;  4IBF A;  4LGY A;  3SYL A;  3GLG B;  3TE6 A;  3SAV A;  4M9Z A;  3KS4 A;  4FCV A;  1XMO M;  2W82 A;  3SBJ A;  1TH4 A;  4MB7 A;  2KRU A;  4I8O A;  2V1U A;  2G5G X;  2V1C A;  1HNW M;  4FWH A;  4L4U A;  4LFA M;  3U6D A;  3K1J A;  3U61 A;  1L2D A;  1K3X A;  4JI2 M;  1NY5 A;  5DYI A;  3FD9 A;  1N32 M;  1JQJ C;  1XXH B;  2KW0 A;  3BOS A;  5ITX A;  5C18 A;  3CTW B;  4TUW A;  4NSO B;  2JA2 A;  2BJW A;  3M7G A;  4IBE A;  3R8F A;  1K82 A;  2UUC M;  4AKG A;  2QBY B;  4IBB A;  4WUR A;  5EXP A;  2YQZ A;  2I7N A;  5F3W A;  1R2Y A;  1Q3C A;  2DWN A;  3W0L B;  3FUX A;  4DV2 M;  3AFH A;  1UM8 A;  2HL7 A;  1L2C A;  3TL4 X;  2HKJ A;  2LXE A;  3FYC A;  3FUW A;  4X62 M;  4R3D A;  3HU2 A;  4KLN A;  3A98 B;  3FUU A;  5IWA M;  4FCW A;  3OTO M;  4DV0 M;  1GVN A;  4LJ4 A;  1E94 E;  3GPU A;  2G8L A;  1SXJ D;  4OVZ B;  4NXN M;  2R46 A;  5FTJ A;  3HHW A;  5JI3 E;  3I51 A;  2F5O A;  3D8B A;  4AQY M;  3LVV A;  2RGO A;  4QOS A;  1OJL A;  1IN5 A;  3CF0 A;  4I4L A;  4YY3 M;  5FTN A;  2FNA A;  3I4Y A;  3GLF A;  3UJN A;  3LQR A;  4RF1 A;  3E9S A;  4GHL A;  1TDZ A;  5KQ8 A;  1XWI A;  3J2P B;  4L78 A;  4JV5 M;  2QPA A;  1L2B A;  5IT9 S;  5EP4 A;  4XGI A;  4AI6 A;  1QYR A;  5H37 D;  2XH9 A;  3E4R A;  4MH0 E;  2UUB M;  2A5Y B;  2D7G A;  3VFD A;  3VKH A;  4LF6 M;  3U6P A;  4FCT A;  4MGH A;  1DGB A;  1L1T A;  5FLX S;  3KS8 A;  2OPF A;  3D8L A;  5KPR A;  3AOE A;  1NHG C;  3HWS A;  5LMU M;  4D80 A;  4DR5 M;  4LF9 M;  2C98 A;  2L7H A;  3U6O A;  3DA1 A;  1QZM A;  1KYI A;  3L26 A;  3ZCB B;  1NNU C;  2KZU A;  3LVW A;  3GRY A;  3SHF A;  4NOO B;  4PDG A;  1IXZ A;  3KOW E;  1IY2 A;  4LJ5 A;  1TGU A;  2L7I A;  4IIW A;  2Q2E B;  5EP1 A;  4DR1 M;  2CHG A;  3TWM A;  1XNQ M;  4DV3 M;  4OW0 A;  5KPZ A;  2KEB A;  8CAT A;  3A42 A;  1ZAE A;  3GRU A;  2VQE M;  2YFQ A;  3KP1 E;  1IQP A;  4GKJ M;  2CEA A;  4G4Q A;  1NSF A;  3FKE A;  1G41 A;  5ITU A;  3J81 S;  1VDD A;  5FTL A;  4WW0 A;  3GLF B;  3GLI A;  4JI4 M;  1QVR A;  2ERC A;  5C1B A;  4X66 M;  3B9P A;  3WHK A;  3U6E A;  3DZD A;  2C9C A;  3HJ8 A;  1W5T A;  4YHH M;  3FYD A;  1HQC A;  3LMM A;  3SMS A;  1DGH A;  3KSJ A;  3SAR A;  1N75 A;  2O5R A;  4LF5 M;  3L29 A;  3ILK A;  2BNK A;  5GKN A;  3GPY A;  4AZF A;  3H4M A;  4DR2 M;  1XMQ M;  2UXD M;  1JR3 A;  3VDP A;  2DZO B;  4MGZ E;  3W0F A;  3J7B A;  1GL6 A;  1N78 A;  3FTF A;  4JI0 M;  4KOD A;  3GQ3 A;  5ITT A;  3AKZ A;  3L28 A;  4IBG A;  1EE8 A;  3KP0 E;  1GKI A;  4JI3 M;  2XFT A;  1QAN A;  3RFW A;  3L27 A;  1E9R A;  1KSF X;  4KO8 A;  3FUV A;  1IN6 A;  3SHG B;  3T38 A;  3U6L A;  3EIE A;  3HKP A;  1QAQ A;  4GH9 A;  2J7O A;  4CGY B;  3KXE C;  3HHY A;  1MU5 A;  1NJF A;  4IBJ A;  3M6A A;  1OFH A;  4IJF A;  4B3M M;  3PNY A;  1L1Z A;  4AKI A;  1HNZ M;  5KO3 A;  1FJG M;  3AV0 A;  1C1K A;  4GRI A;  4QHS A;  3J27 B;  3VLF B;  4DV7 M;  2QEN A;  2F4V M;  1LV7 A;  1IBL M;  5ITQ A;  4M0D A;  3GLI B;  3JR4 A;  4JI6 M;  2UXB M;  3VDU A;  1GLN A;  1DGG A;  2DXI A;  1NY6 A;  1N34 M;  2DHR A;  2Z4R A;  4D82 A;  4CHT B;  1DGH B;  3FUT A;  1N77 A;  3TPZ A;  1MX0 A;  2L09 A;  3SAU A;  3UK6 A;  1YE9 A;  1DO2 A;  4LCB A;  1TH3 A;  3IG5 A;  1YSY A;  1QQW A;  4NSR A;  2XEP A;  1X37 A;  2XGN A;  4BB9 A;  3KSX A;  3HHX A;  1J5E M;  2EA0 A;  2C99 A;  3HJQ A;  1K3W A;  1IN4 A;  5DNY A;  3KOZ E;  3VK8 A;  4NXM M;  3Q8X A;  3U6S A;  4GIP A;  4FWD A;  3HGI A;  4OU7 A;  1DO0 A;  3U60 A;  3FTE A;  4X65 M;  4LJ6 A;  4B7F A;  3KVW A;  5KPT A;  4DV1 M;  3A45 A;  4IJE A;  4M0W A;  2Y21 A;  4AKH A;  4JN6 A;  4G4O A;  3R9X B;  1IY1 A;  2ZM6 M;  2RGH A;  1XNR M;  4LZJ A;  2CHV A;  4BLC A;  1IXR C;  2CV1 A;  2FFJ A;  3K2L A;  4JI7 M;  4G6Z A;  3J80 S;  5EXT A;  4GMQ A;  4FW9 A;  3SAT A;  1Z5B A;  2LWX A;  2Y0T A;  3TQS A;  2XSZ A;  3EIH A;  1PJJ A;  2QCU A;  2XZU A;  2X4A A;  4Z8X A;  3KDS E;  4B7H A;  1GL7 A;  2I7P A;  2V6Z M;  3T15 A;  4A3V B;  1HNX M;  2R4J A;  2UUA M;  3HU3 A;  2Y20 A;  3K8Z A;  3U6M A;  1I94 M;  4MM3 B;  4PT5 A;  2KZS A;  4GC9 A;  2J7N A;  2QP9 X;  4M9X A;  3KOX E;  4LGM A;  2DWM A;  4PCZ A;  5EP3 A;  2YR0 A;  5EP2 A;  3ZH9 B;  3QAU A;  1IN8 A;  4AG6 A;  3L25 A;  2R18 A;  4D81 A;  1T3T A;  5KQD A;  3GO8 A;  2EO2 A;  4GIT A;  3GLH A;  4LRS A;  1TH2 A;  3U60 B;  4DR6 M;  3U5Z A;  4I5S A;  1E32 A;  3JR5 A;  2DZN B;  4DUZ M;  5LMN M;  1ZQ9 A;  1XC8 A;  4GKK M;  2LH0 A;  4DV6 M;  1SXJ C;  5BPV A;  2P5T A;  2X49 A;  1H6U A;  4OX9 M;  3K92 A;  1Z5A A;  2VQF M;  2KXE A;  1OFI A;  3HJS A;  3GPX A;  4LF7 M;  4L16 A;  1IM2 A;  3ZC7 B;  4IBI A;  3I4V A;  4G4R A;  1J7K A;  2F5S A;  2C9O A;  2CE7 A;  1QAM A;  4R7G A;  3KOY E;  4GHA A;  1DGF A;  2Y0Q A;  1JR3 D;  1QAO A;  4DR3 M;  5E6J A;  2KA6 B;  3RGP A;  5ITR A;  3UZU A;  2K47 A;  3RGS A;  1W5S A;  2D7H A;  3MK6 A;  4KHP M;  7CAT A;  4LRT A;  1G59 A;  1KFV A;  3AL0 C;  1S3S A;  4BBA A;  1G3I A;  3KFU G;  1SXJ E;  1L8Q A;  4PDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...