3HHWA

Complex of a vesicular stomatitis virus empty capsid with the nucleocapsid-binding domain of the phosphoprotein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
AVSDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGNGRMSHKEAILLGLRYKKLYNQARVKYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphoprotein
publication title Structure of the vesicular stomatitis virus nucleocapsid in complex with the nucleocapsid-binding domain of the small polymerase cofactor, P.
pubmed doi rcsb
source organism Vesicular stomatitis indiana virus
molecule tags Viral protein
total genus 10
structure length 73
sequence length 73
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.440 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhwA00
2K47A 3HHZA 3HHWA
chains in the Genus database with same CATH superfamily
1SXJB 4F2LA 1ZV1A 1IY0A 3PXGA 4G6ZA 3T1HM 4QHTA 2KEBA 4NXNM 5L8RF 3FTEA 1GL6A 2R62A 3FUVA 2H1RA 3I4YA 1D0MA 5EP1A 5DNYA 3SASA 2MJ5B 1HQCA 3HHWA 3TWLA 1N34M 2DNAA 2O01F 2DHRA 2QP9X 1HT2E 2ZTCA 4JI3M 5ITUA 2UXBM 5FTKA 2VF8A 4LF7M 3DA1A 2KNVA 4LJAA 1OJLA 1Y8GA 3SYLA 1L2DA 3OTOM 1VG5A 4FWGA 4JI7M 2C9CA 1F4IA 3UMMA 3U6PA 1QZEA 1VDDA 3NBXX 1PJJA 2DWLA 1EE8A 2CV2A 4LY6A 3B9PA 2D7GA 4GKJM 3GLGE 1GJSA 2RGHA 1PJSA 2R46A 1NSFA 3K92A 4DV3M 4LJ9A 5IT9S 1E32A 1IY2A 4II7A 1LV7A 2X49A 3PNYA 1NHGC 2VF7A 1YE9A 2K0BX 3ZQJA 3KOZE 2F5PA 1RU3A 4M0DA 4M9SA 3KS8A 2CHGA 4IBDA 4AQYM 1UM8A 1LTMA 3LW5F 1QANA 3UZUA 5E26A 4WP2A 4D80A 4YY3M 4GHAA 1BVSA 5KPRA 3VKGA 3KSXA 4PT5A 3H4MA 4QOZC 4FCWA 2LVPC 1NHWC 3FUWA 2G8LA 4LF4M 2BJWA 1XXHE 1AUAA 4RF0A 4HLQA 2UXCM 1TDZA 3GRVA 3KP0E 2ZM6M 1YLAA 2LHCA 4MGKE 4RF1A 2C99A 3KOXE 2R4EA 3A98B 2VDBB 4BB9A 4G4QA 2JUJA 3C3DA 1JR3D 4B7HA 2JZ0A 2W82A 2RGOA 3CTWB 1IY1A 4LF6M 1SG9A 1Q02A 4MGIE 3LCUA 2DAKA 3IECA 4KT0F 3I51A 4QHSA 3SHFA 4DR2M 2CEAA 1XMOM 2F5QA 1N32M 1NV8A 1IQPA 2G3QA 2L2DA 3GLHE 2UXDM 3R8FA 1PRBA 1QDTA 2QSFX 4R3DA 4Q7JA 4PDIA 5EP3A 3VK8A 2Y0TA 1W5TA 3FYDA 3JR4A 4KO8A 5JI3E 3E21A 1IBMM 4LFCM 2LNHC 3K9PA 1IBLM 2DZNB 2LH0A 1C1KA 2EKFA 3GLIE 2APLA 4QNRA 3KSJA 4GEWA 4GITA 5IWAM 3A42A 3FTCA 5C1BA 3U6DA 1QAOA 4DR7M 2V1CA 3QAUA 2Q2EB 4AI6A 3HY5A 5ITXA 3JR5A 1A5TA 2BWBA 5C18A 4ANRA 2F4VM 3FE3A 2D7HA 4FCVA 1OAOC 2JY5A 2G5GX 3DFZA 3AKZA 4JI2M 2Z4SA 3L2AA 4DBGB 1Z5CA 4IIWA 1WHCA 2FOIC 4I5SA 5F3WA 3SARA 1TF0B 1GJTA 3AOGA 4IJEA 1K82A 5FLXS 4GKKM 4LF9M 1MU5A 1CUKA 5FTLA 5JI2E 3BOSA 1HNXM 1JR3A 1ZMVA 4FW9A 3H4JA 5EXSA 4RKUF 3HU1A 2ZTDA 4REZA 2R0IA 4P16A 4GC9A 4LJ4A 3L27A 1NJGA 3E46A 5ITYA 2EO2A 1V34A 2CV1A 1N78A 3V76A 4NSRA 3W68A 3GLFE 1NNJA 2R4JA 2XFTA 5KPTA 4CISA 4A3VB 4IJFA 2QHOB 1Q3BA 1MX0A 3KVWA 4LZJA 1IBKM 4DR4M 4DV6M 4NOOB 4G4NA 4GHLA 2DZLA 2DENA 3PVSA 5LMNM 1KYIA 2JY8A 2EUCA 2LXEA 4IBKA 4G3OA 1N77A 2DAIA 3HHYA 1DV0A 2L7IA 4LG2A 3C3EA 1XB2B 4JXJA 1VQ1A 2KNZA 5KO3A 3NWLA 2QZ4A 3QWLA 1TTEA 2OOAA 2CWBA 2OQ4A 1NV9A 1DO2A 1GVNA 2DAGA 4DR1M 3WHLA 2LVAA 3FRHA 3T15A 1UFZA 1Q39A 4WURA 1VEJA 2DWZB 3AOEC 2EKKA 4EIWA 4I81A 3L26A 3B74A 2VQEM 1IXRC 1IN5A 1OFHA 1D0LA 2J7OA 4LZZA 5EP4A 1WGNA 2RRUA 1I4WA 1XHBA 5EXPA 4JI4M 3ZC7B 3GP1A 1DGGA 1SXJE 3I01M 3FUXA 3HHXA 3NBIA 3GQ5A 1TGUA 4M0WA 2FFJA 1ORYB 3MHVC 4LRSA 1MJGM 3HZJA 2DHYA 3MMPA 3THGA 1ZQ9A 3K2LA 3PFIA 2JXNA 1X37A 3B89A 4B7FA 2P5TA 3HGIA 3GRYA 4LJ7A 4P17A 3WHKA 1TH4A 2MH8A 2Z4RA 5LMUM 3LQRA 4B08A 4DV4M 1R2ZA 2R44A 5DFLA 3VK7A 4B3TM 3W0FA 2L4FA 2O25A 3HWSA 4MH0E 3ZH9B 2FNAA 2KA6B 3GLGB 4IBCA 4DV1M 1L2BA 4FD2A 1EIJA 3LVVA 5FSWA 3K8ZA 3L25A 2WSCF 3IG8A 4GC5A 5EP2A 2DWNA 2UU9M 4MM3B 2KW0A 3RFWA 2E5LM 2C96A 1WIVA 2HWJA 3FKEA 2M5ZA 5FTNA 2QNJA 1TH2A 4Z6YA 1PJIA 3SAVA 3K9OA 1EFUB 3CGWA 2EJSA 3KOWE 5BR8M 2WSFF 1N33M 3A46A 1JB0F 3QYEA 2I7NA 1L1TA 2HHHM 2F5SA 1FNNA 4JI5M 1NY5A 2K47A 3W0LB 5BPVA 1R6BX 1VEGA 3I4VA 4IBJA 5EJCA 3RGSA 2V6ZM 2Y20A 1GO5A 1KSFX 1SXJC 1NO1A 4WW0A 4RNAA 2QPAA 2Z7JA 1E94E 2JY6B 2C5RA 1S3SA 2X4AA 3DZDA 3TPZA 2XF3A 1Z6TA 2JWSA 1IFYA 1VDLA 4NC6A 4K0KM 2LVQD 1PJTA 3M7GA 4B7GA 2DZOB 1HNWM 3FYCA 3LVWA 5DYGA 5ITQA 3UJNA 3KFUG 1YSYA 3HU2A 4MGYE 3AV0A 2XSZD 2WSEF 3B7QA 2Z8YM 1IN8A 2YNMD 4ZPXA 1XMQM 4CJ6A 1ZMWA 2KNAA 4D81A 3EIEA 3FTDA 1OIPA 2D7EA 1WXQA 2DKLA 3TE6A 2CUZA 1XWIA 3J80S 3GRUA 4OVZA 2X8AA 4BBAA 5ITRA 3GPXA 2CP8A 3SBJA 3T1YM 2OO9A 3SATA 1N75A 4GH9A 4DUZM 3E4RA 2KRUA 2ZAOA 2BJVA 3U6CA 3AL0C 1L8QA 3LMMA 4HL4A 4YHHM 4Y28F 1AIPC 4AW4A 2KZUA 3M6AA 4CIZA 1PJQA 1SXJD 3VDPA 5FTMA 1DGBA 3KDSE 1H6UA 4DR6M 2LVNC 3HJQA 3UK6A 1G4AE 1Z5BA 2KDLA 4NRVA 1KFVA 3Q8GA 1L1ZA 3TQSA 3SYKA 4KODA 4OVZB 2UUAM 4NSOB 4MGZE 3SMPA 4L78A 1OIZA 2JA2A 1TH3A 2OOBA 2Y21A 5H37D 1DGHB 1OKSA 2J7NA 3J2PB 2K9DA 2CHVA 1HT1E 3U6QA 4CGYB 4JV5M 2ZBKB 2XSZA 2KRKA 3T6PA 4JYAM 3U6SA 3GLFB 2NQ8C 3EIHA 3KOYE 4LJ8A 3KP1E 2MGWA 2DAMA 3U61B 1V92A 1J5EM 2DAEA 3U6MA 2XGNA 1N36M 3SHGB 2VIIA 1IN7A 4W5WA 1G41A 5ITXE 3SFZA 2J5YA 4AZFA 1HQYE 3L29A 4FVMA 5FTJA 3FUUA 3J7AS 4S12A 2ZAMA 2BWEA 1QYRA 3PNVA 3U6OA 1E9RA 1TR8A 5KPZA 1GABA 2BNKA 3IG5A 3RE8A 2YQZA 3HJ8A 3J81S 5E6JA 1Z5AA 1OFIA 3VLFB 1JR3E 2VQFM 4IBIA 4M9ZA 2CE7A 4NRWA 4LGYA 4JI8M 3CF2A 3GLGA 1G3IA 2XZUA 4CHTB 2OPFA 2L4EA 1JQJC 2R18A 4I8OA 1GL7A 3GPPA 2JZ1A 2QQ8A 3UGJA 2FE8A 8CATA 4LFBM 4DV2M 1IN4A 1XNQM 1OAIA 1PM5A 1R4GA 2LHGA 1HNZM 2JNHA 4PD2A 4NXMM 3TWKA 1HJPA 4L8RC 2FH0A 3BXWA 4X62M 3FUTA 1IXSA 3DOAA 1QUTA 2L09A 4OX9M 2H5XA 1XXHA 5KQ8A 4DV5M 1FJGM 1I94M 1G8PA 5IREB 3ZCBB 1DGFA 3T38A 2YFQA 3HJSA 2KZSA 4IBEA 2LBCA 3M0EA 1L2CA 4R7GA 1QAMA 2F5OA 4Z8XA 3HU3A 1TDHA 1G71A 1Z59A 2UUCM 2B3TA 3A45A 4PDGA 2LWXA 3U6LA 1T43A 3AFHA 3J7BA 2KXEA 3F92A 4FWHA 1YUBA 1W5SA 1IXSB 2CRUA 3MJ5A 3BBZA 2C98A 2WZJA 1XXHB 3GLHA 4KHPM 3QYBA 3KS4A 1K3WA 4XGIA 5ITTA 2MROB 1OTRA 1IM2A 4GMQA 2YR0A 2Z3XA 3C58A 2I7PA 2Y0QA 3GLIA 2LTUA 4LRTA 1NY6A 3ILKA 4IBGA 1P3QQ 4LCBA 1XNRM 2R6FA 4L6V6 2K6BA 1Q3CA 3VDUA 2DWMA 3R9XB 7CATA 4L16A 1R2YA 2R45A 4KLNA 4PCZA 1R7RA 1NNUC 1QDRA 4HEOA 3GLHB 4M9XA 2HKJA 4B3SM 4GRIA 1T6OA 5GKNA 4DR5M 1V33A 3B7ZA 3K1JA 4R71A 3CF6E 4I4LA 5KQDA 3TWMA 3AOEA 3GLIB 5DYIA 3FD9A 4G4OA 4L15A 4B3MM 1DGHA 2QBYA 2QENA 3U5ZA 1WJ7A 3CF0A 3KW6A 1WR1B 4LJ6A 4MB7A 4AKGA 4OW0A 5A2QS 3GLFA 2A5YB 1HR0M 1D0KA 3SAUA 3GQ4A 2LVOC 1GLNA 1NVMA 2F5NA 4IBBA 2CHQA 3U61A 4LF5M 4F1IA 4FCTA 1ZAEA 1J09A 1ZMUA 4G4RA 2L7HA 4QNMA 4LGMA 4X66M 2XLJA 1IXZA 4DV0M 2XZFA 2ZANA 1QVRA 2DI0A 2KHHA 3HX3A 3J27B 3MK6A 2QBYB 2DVWB 3U5ZB 5IZ7D 4L4UA 3U6EA 4LJ5A 2XH9A 1GKIA 4X64M 2DXIA 1T3TA 3I04M 4LFAM 2RKOA 1G59A 2C9OA 3D8LA 3Q8XA 2FS1A 4AKIA 4MGHA 4JI6M 1QAQA 4X65M 3D8BA 4GIPA 4OU7A 3E9SA 2XFSA 2V1UA 2ERCA 3B7NA 2L6OA 3GRRA 1XC8A 3JAMS 2HL7A 3IHPA 1QUSA 3L28A 4D82A 4LF8M 5EXTA 4JI0M 2R65A 3GPUA 3FTFA 2O5RA 2M60A 4QOSA 2UUBM 4NL4H 3U60A 4B3RM 5EXXA 1VEKA 3TL4X 3HHZA 1IN6A 1QZMA 1MN3A 3VFDA 3W67A 4AKHA 2JP7A 1DO0A 2JY7A 2HCBA 3C9PA 2HAKA 3FRIA 1SXJA 1E9SA 3AJIB 4DR3M 3GQ3A 3LQQA 4BLCA 2GNOA 1OQYA 2CFOA 2N35A 4UN2B 4ITQA 3LCVB 4JI1M 4TUWA 4IBFA 5EQTA 4AG6A 1D2NA 3SAWA 3KXEC 3SMSA 1PGYA 4DUYM 2CV0A 2XEPA 1QQWA 1C7YA 1NJFA 3HKPA 4AG5A 3RGPA 3GPYA 1WGLA 3U60B 4JN6A 2GQFA 4XBOA 3SC3A 3VKHA 4XK8F 4DV7M 1K3XA 2MR9A 1R5LA 2AHMA 3GO8A 2QCUA 2EA0A 4FWDA 1J7KA
chains in the Genus database with same CATH topology
1SXJB 1IY0A 3PXGA 4G6ZA 3T1HM 4QHTA 2KEBA 4NXNM 3FTEA 1GL6A 2R62A 3FUVA 2H1RA 3I4YA 5EP1A 5DNYA 3SASA 1HQCA 3HHWA 3TWLA 1N34M 2QP9X 2DHRA 4JI3M 1HT2E 5ITUA 2UXBM 5FTKA 4LF7M 3DA1A 4LJAA 1OJLA 3SYLA 1L2DA 3OTOM 4FWGA 4JI7M 2C9CA 3UMMA 3U6PA 1VDDA 1PJJA 2DWLA 1EE8A 2CV2A 4LY6A 3B9PA 2D7GA 4GKJM 2RGHA 4DV3M 2R46A 1NSFA 3K92A 4LJ9A 5IT9S 1E32A 1IY2A 4II7A 1LV7A 2X49A 3PNYA 1NHGC 1YE9A 2F5PA 3KOZE 4M0DA 4M9SA 3KS8A 2CHGA 4IBDA 4AQYM 1UM8A 1QANA 3UZUA 5E26A 4D80A 4YY3M 4GHAA 3VKGA 5KPRA 3KSXA 4PT5A 3H4MA 4QOZC 4FCWA 1NHWC 3FUWA 2G8LA 4LF4M 2BJWA 4RF0A 4HLQA 2UXCM 1TDZA 3GRVA 3KP0E 2ZM6M 4MGKE 4RF1A 2C99A 3KOXE 2R4EA 3A98B 4BB9A 4G4QA 1JR3D 4B7HA 2W82A 2RGOA 3CTWB 1IY1A 4LF6M 4MGIE 4QHSA 2F5QA 3SHFA 3I51A 1XMOM 4DR2M 2CEAA 1N32M 1IQPA 2UXDM 3R8FA 4PDIA 4R3DA 5EP3A 3VK8A 2Y0TA 1W5TA 3FYDA 3JR4A 4KO8A 5JI3E 1IBMM 4LFCM 2LNHC 1IBLM 2DZNB 2LH0A 1C1KA 4QNRA 3KSJA 4GITA 5IWAM 3A42A 3FTCA 5C1BA 3U6DA 1QAOA 4DR7M 2V1CA 3QAUA 2Q2EB 4AI6A 5ITXA 3JR5A 5C18A 2F4VM 2D7HA 4FCVA 3DFZA 3AKZA 2G5GX 4JI2M 2Z4SA 3L2AA 1Z5CA 4IIWA 2FOIC 4I5SA 5F3WA 3SARA 3AOGA 4IJEA 1K82A 5FLXS 4GKKM 4LF9M 1MU5A 5FTLA 5JI2E 3BOSA 1HNXM 1JR3A 4FW9A 5EXSA 3HU1A 4REZA 4P16A 4GC9A 4LJ4A 3L27A 1NJGA 5ITYA 2CV1A 2EO2A 1N78A 4NSRA 1NNJA 2R4JA 2XFTA 5KPTA 4CISA 4A3VB 4IJFA 4LZJA 3KVWA 1MX0A 1Q3BA 4DR4M 1IBKM 4DV6M 4NOOB 4G4NA 4GHLA 3PVSA 5LMNM 1KYIA 4IBKA 2EUCA 2LXEA 1N77A 3HHYA 2L7IA 4LG2A 4JXJA 5KO3A 3NWLA 2QZ4A 3QWLA 2OQ4A 1DO2A 1GVNA 4DR1M 3WHLA 3T15A 1Q39A 4WURA 2DWZB 4EIWA 3AOEC 4I81A 3L26A 2VQEM 1IXRC 1IN5A 1OFHA 2J7OA 4LZZA 5EP4A 1I4WA 1XHBA 5EXPA 4JI4M 3ZC7B 3GP1A 1DGGA 1SXJE 3FUXA 3HHXA 3NBIA 3GQ5A 1TGUA 4M0WA 2FFJA 1ORYB 3MHVC 4LRSA 3THGA 1ZQ9A 3K2LA 3PFIA 1X37A 4B7FA 2P5TA 3HGIA 3GRYA 4LJ7A 3WHKA 1TH4A 2Z4RA 5LMUM 3LQRA 4B08A 4DV4M 1R2ZA 3VK7A 4B3TM 3W0FA 3HWSA 4MH0E 3ZH9B 2FNAA 2KA6B 3GLGB 4IBCA 4DV1M 1L2BA 4FD2A 3LVVA 5FSWA 3K8ZA 3L25A 2UU9M 3IG8A 4GC5A 5EP2A 2DWNA 4MM3B 2KW0A 3RFWA 2E5LM 2C96A 3FKEA 2M5ZA 5FTNA 1TH2A 4Z6YA 1PJIA 3SAVA 3KOWE 5BR8M 1N33M 3A46A 2I7NA 1L1TA 2HHHM 2F5SA 1FNNA 4JI5M 1NY5A 2K47A 3W0LB 5BPVA 1R6BX 3I4VA 4IBJA 5EJCA 3RGSA 2V6ZM 2Y20A 1KSFX 1SXJC 4WW0A 4RNAA 2QPAA 2Z7JA 1E94E 2C5RA 1S3SA 2X4AA 3DZDA 3TPZA 2XF3A 1Z6TA 4K0KM 4B7GA 3M7GA 2DZOB 1HNWM 3FYCA 3LVWA 5DYGA 5ITQA 3UJNA 3KFUG 1YSYA 3HU2A 4MGYE 3AV0A 2XSZD 1IN8A 2YNMD 4ZPXA 1XMQM 4D81A 3EIEA 3FTDA 2D7EA 1WXQA 3TE6A 2CUZA 1XWIA 3J80S 3GRUA 4OVZA 2X8AA 4BBAA 5ITRA 3GPXA 3SBJA 3T1YM 3SATA 1N75A 4GH9A 4DUZM 3E4RA 2KRUA 2ZAOA 2BJVA 3U6CA 3AL0C 1L8QA 3LMMA 4HL4A 4YHHM 4AW4A 2KZUA 3M6AA 1SXJD 3VDPA 5FTMA 1DGBA 3KDSE 1H6UA 4DR6M 3HJQA 3UK6A 1G4AE 1Z5BA 4NRVA 1KFVA 1L1ZA 3TQSA 3SYKA 4KODA 4OVZB 2UUAM 4NSOB 4MGZE 3SMPA 4L78A 2JA2A 1TH3A 2Y21A 5H37D 1DGHB 2J7NA 3J2PB 3U6QA 2CHVA 1HT1E 4JV5M 4CGYB 2ZBKB 2XSZA 2KRKA 4JYAM 3U6SA 3GLFB 2NQ8C 3EIHA 3KOYE 4LJ8A 3KP1E 3U61B 1J5EM 3U6MA 2XGNA 1N36M 3SHGB 2VIIA 1IN7A 4W5WA 1G41A 5ITXE 3SFZA 4AZFA 1HQYE 3L29A 4FVMA 5FTJA 3FUUA 3J7AS 4S12A 2ZAMA 3PNVA 1QYRA 3U6OA 1E9RA 5KPZA 2BNKA 3IG5A 3RE8A 2YQZA 3HJ8A 3J81S 5E6JA 1Z5AA 1OFIA 3VLFB 2VQFM 4IBIA 4M9ZA 2CE7A 4NRWA 4LGYA 4JI8M 3CF2A 3GLGA 1G3IA 2XZUA 4CHTB 2OPFA 1JQJC 2R18A 4I8OA 1GL7A 3GPPA 3UGJA 2FE8A 8CATA 4LFBM 4DV2M 1IN4A 1XNQM 1PM5A 1HNZM 4PD2A 4NXMM 3TWKA 4L8RC 4X62M 3FUTA 3DOAA 2L09A 4OX9M 1XXHA 5KQ8A 4DV5M 1FJGM 1I94M 1G8PA 5IREB 3ZCBB 1DGFA 3T38A 2YFQA 3HJSA 2KZSA 4IBEA 3M0EA 1L2CA 4R7GA 1QAMA 2F5OA 4Z8XA 3HU3A 1TDHA 2UUCM 1Z59A 3A45A 4PDGA 2LWXA 3U6LA 3AFHA 3J7BA 2KXEA 4FWHA 1YUBA 1W5SA 1IXSB 3MJ5A 4KHPM 2C98A 1XXHB 3GLHA 3KS4A 1K3WA 4XGIA 5ITTA 1IM2A 4GMQA 2YR0A 2Z3XA 3C58A 2I7PA 2Y0QA 3GLIA 4LRTA 1NY6A 3ILKA 4IBGA 4LCBA 1XNRM 3VDUA 1Q3CA 2DWMA 3R9XB 7CATA 4L16A 1R2YA 2R45A 4KLNA 4PCZA 1R7RA 1NNUC 3GLHB 4M9XA 2HKJA 4B3SM 4GRIA 5GKNA 4DR5M 3K1JA 3CF6E 4I4LA 5KQDA 3TWMA 3AOEA 3GLIB 5DYIA 3FD9A 4G4OA 4L15A 4B3MM 1DGHA 2QBYA 2QENA 3U5ZA 3CF0A 3KW6A 4LJ6A 4AKGA 4MB7A 4OW0A 5A2QS 3GLFA 2A5YB 1HR0M 3SAUA 3GQ4A 1GLNA 1NVMA 2F5NA 4IBBA 2CHQA 3U61A 4LF5M 4FCTA 1ZAEA 1J09A 4G4RA 2L7HA 4QNMA 4LGMA 4X66M 2XLJA 1IXZA 4DV0M 2XZFA 2ZANA 1QVRA 3J27B 3MK6A 2QBYB 2DVWB 3U5ZB 5IZ7D 4L4UA 3U6EA 4LJ5A 2XH9A 1GKIA 4X64M 2DXIA 1T3TA 4LFAM 2RKOA 1G59A 2C9OA 3D8LA 3Q8XA 4AKIA 4MGHA 4JI6M 1QAQA 4X65M 3D8BA 4GIPA 4OU7A 3E9SA 2XFSA 2V1UA 2ERCA 2L6OA 3GRRA 1XC8A 3JAMS 2HL7A 4D82A 3L28A 4LF8M 5EXTA 4JI0M 2R65A 3GPUA 3FTFA 2O5RA 2M60A 4QOSA 2UUBM 4NL4H 3U60A 4B3RM 5EXXA 3TL4X 3HHZA 1IN6A 1QZMA 3VFDA 4AKHA 1DO0A 2HCBA 1SXJA 1E9SA 3AJIB 4DR3M 3GQ3A 3LQQA 4BLCA 4JI1M 2CFOA 4ITQA 4TUWA 4IBFA 5EQTA 4AG6A 1D2NA 3SAWA 3KXEC 3SMSA 4DUYM 2CV0A 2XEPA 1QQWA 1NJFA 3HKPA 4AG5A 3RGPA 3GPYA 3U60B 4JN6A 4XBOA 3SC3A 3VKHA 4DV7M 1K3XA 2AHMA 3GO8A 2QCUA 2EA0A 4FWDA 1J7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K47 A;  3HHZ A;  3HHW A; 
#chains in the Genus database with same CATH topology
 1SXJ B;  4F2L A;  1ZV1 A;  1IY0 A;  3PXG A;  4G6Z A;  3T1H M;  4QHT A;  2KEB A;  4NXN M;  5L8R F;  3FTE A;  1GL6 A;  2R62 A;  3FUV A;  2H1R A;  3I4Y A;  1D0M A;  5EP1 A;  5DNY A;  3SAS A;  2MJ5 B;  1HQC A;  3HHW A;  3TWL A;  1N34 M;  2DNA A;  2O01 F;  2DHR A;  2QP9 X;  1HT2 E;  2ZTC A;  4JI3 M;  5ITU A;  2UXB M;  5FTK A;  2VF8 A;  4LF7 M;  3DA1 A;  2KNV A;  4LJA A;  1OJL A;  1Y8G A;  3SYL A;  1L2D A;  3OTO M;  1VG5 A;  4FWG A;  4JI7 M;  2C9C A;  1F4I A;  3UMM A;  3U6P A;  1QZE A;  1VDD A;  3NBX X;  1PJJ A;  2DWL A;  1EE8 A;  2CV2 A;  4LY6 A;  3B9P A;  2D7G A;  4GKJ M;  3GLG E;  1GJS A;  2RGH A;  1PJS A;  2R46 A;  1NSF A;  3K92 A;  4DV3 M;  4LJ9 A;  5IT9 S;  1E32 A;  1IY2 A;  4II7 A;  1LV7 A;  2X49 A;  3PNY A;  1NHG C;  2VF7 A;  1YE9 A;  2K0B X;  3ZQJ A;  3KOZ E;  2F5P A;  1RU3 A;  4M0D A;  4M9S A;  3KS8 A;  2CHG A;  4IBD A;  4AQY M;  1UM8 A;  1LTM A;  3LW5 F;  1QAN A;  3UZU A;  5E26 A;  4WP2 A;  4D80 A;  4YY3 M;  4GHA A;  1BVS A;  5KPR A;  3VKG A;  3KSX A;  4PT5 A;  3H4M A;  4QOZ C;  4FCW A;  2LVP C;  1NHW C;  3FUW A;  2G8L A;  4LF4 M;  2BJW A;  1XXH E;  1AUA A;  4RF0 A;  4HLQ A;  2UXC M;  1TDZ A;  3GRV A;  3KP0 E;  2ZM6 M;  1YLA A;  2LHC A;  4MGK E;  4RF1 A;  2C99 A;  3KOX E;  2R4E A;  3A98 B;  2VDB B;  4BB9 A;  4G4Q A;  2JUJ A;  3C3D A;  1JR3 D;  4B7H A;  2JZ0 A;  2W82 A;  2RGO A;  3CTW B;  1IY1 A;  4LF6 M;  1SG9 A;  1Q02 A;  4MGI E;  3LCU A;  2DAK A;  3IEC A;  4KT0 F;  3I51 A;  4QHS A;  3SHF A;  4DR2 M;  2CEA A;  1XMO M;  2F5Q A;  1N32 M;  1NV8 A;  1IQP A;  2G3Q A;  2L2D A;  3GLH E;  2UXD M;  3R8F A;  1PRB A;  1QDT A;  2QSF X;  4R3D A;  4Q7J A;  4PDI A;  5EP3 A;  3VK8 A;  2Y0T A;  1W5T A;  3FYD A;  3JR4 A;  4KO8 A;  5JI3 E;  3E21 A;  1IBM M;  4LFC M;  2LNH C;  3K9P A;  1IBL M;  2DZN B;  2LH0 A;  1C1K A;  2EKF A;  3GLI E;  2APL A;  4QNR A;  3KSJ A;  4GEW A;  4GIT A;  5IWA M;  3A42 A;  3FTC A;  5C1B A;  3U6D A;  1QAO A;  4DR7 M;  2V1C A;  3QAU A;  2Q2E B;  4AI6 A;  3HY5 A;  5ITX A;  3JR5 A;  1A5T A;  2BWB A;  5C18 A;  4ANR A;  2F4V M;  3FE3 A;  2D7H A;  4FCV A;  1OAO C;  2JY5 A;  2G5G X;  3DFZ A;  3AKZ A;  4JI2 M;  2Z4S A;  3L2A A;  4DBG B;  1Z5C A;  4IIW A;  1WHC A;  2FOI C;  4I5S A;  5F3W A;  3SAR A;  1TF0 B;  1GJT A;  3AOG A;  4IJE A;  1K82 A;  5FLX S;  4GKK M;  4LF9 M;  1MU5 A;  1CUK A;  5FTL A;  5JI2 E;  3BOS A;  1HNX M;  1JR3 A;  1ZMV A;  4FW9 A;  3H4J A;  5EXS A;  4RKU F;  3HU1 A;  2ZTD A;  4REZ A;  2R0I A;  4P16 A;  4GC9 A;  4LJ4 A;  3L27 A;  1NJG A;  3E46 A;  5ITY A;  2EO2 A;  1V34 A;  2CV1 A;  1N78 A;  3V76 A;  4NSR A;  3W68 A;  3GLF E;  1NNJ A;  2R4J A;  2XFT A;  5KPT A;  4CIS A;  4A3V B;  4IJF A;  2QHO B;  1Q3B A;  1MX0 A;  3KVW A;  4LZJ A;  1IBK M;  4DR4 M;  4DV6 M;  4NOO B;  4G4N A;  4GHL A;  2DZL A;  2DEN A;  3PVS A;  5LMN M;  1KYI A;  2JY8 A;  2EUC A;  2LXE A;  4IBK A;  4G3O A;  1N77 A;  2DAI A;  3HHY A;  1DV0 A;  2L7I A;  4LG2 A;  3C3E A;  1XB2 B;  4JXJ A;  1VQ1 A;  2KNZ A;  5KO3 A;  3NWL A;  2QZ4 A;  3QWL A;  1TTE A;  2OOA A;  2CWB A;  2OQ4 A;  1NV9 A;  1DO2 A;  1GVN A;  2DAG A;  4DR1 M;  3WHL A;  2LVA A;  3FRH A;  3T15 A;  1UFZ A;  1Q39 A;  4WUR A;  1VEJ A;  2DWZ B;  3AOE C;  2EKK A;  4EIW A;  4I81 A;  3L26 A;  3B74 A;  2VQE M;  1IXR C;  1IN5 A;  1OFH A;  1D0L A;  2J7O A;  4LZZ A;  5EP4 A;  1WGN A;  2RRU A;  1I4W A;  1XHB A;  5EXP A;  4JI4 M;  3ZC7 B;  3GP1 A;  1DGG A;  1SXJ E;  3I01 M;  3FUX A;  3HHX A;  3NBI A;  3GQ5 A;  1TGU A;  4M0W A;  2FFJ A;  1ORY B;  3MHV C;  4LRS A;  1MJG M;  3HZJ A;  2DHY A;  3MMP A;  3THG A;  1ZQ9 A;  3K2L A;  3PFI A;  2JXN A;  1X37 A;  3B89 A;  4B7F A;  2P5T A;  3HGI A;  3GRY A;  4LJ7 A;  4P17 A;  3WHK A;  1TH4 A;  2MH8 A;  2Z4R A;  5LMU M;  3LQR A;  4B08 A;  4DV4 M;  1R2Z A;  2R44 A;  5DFL A;  3VK7 A;  4B3T M;  3W0F A;  2L4F A;  2O25 A;  3HWS A;  4MH0 E;  3ZH9 B;  2FNA A;  2KA6 B;  3GLG B;  4IBC A;  4DV1 M;  1L2B A;  4FD2 A;  1EIJ A;  3LVV A;  5FSW A;  3K8Z A;  3L25 A;  2WSC F;  3IG8 A;  4GC5 A;  5EP2 A;  2DWN A;  2UU9 M;  4MM3 B;  2KW0 A;  3RFW A;  2E5L M;  2C96 A;  1WIV A;  2HWJ A;  3FKE A;  2M5Z A;  5FTN A;  2QNJ A;  1TH2 A;  4Z6Y A;  1PJI A;  3SAV A;  3K9O A;  1EFU B;  3CGW A;  2EJS A;  3KOW E;  5BR8 M;  2WSF F;  1N33 M;  3A46 A;  1JB0 F;  3QYE A;  2I7N A;  1L1T A;  2HHH M;  2F5S A;  1FNN A;  4JI5 M;  1NY5 A;  2K47 A;  3W0L B;  5BPV A;  1R6B X;  1VEG A;  3I4V A;  4IBJ A;  5EJC A;  3RGS A;  2V6Z M;  2Y20 A;  1GO5 A;  1KSF X;  1SXJ C;  1NO1 A;  4WW0 A;  4RNA A;  2QPA A;  2Z7J A;  1E94 E;  2JY6 B;  2C5R A;  1S3S A;  2X4A A;  3DZD A;  3TPZ A;  2XF3 A;  1Z6T A;  2JWS A;  1IFY A;  1VDL A;  4NC6 A;  4K0K M;  2LVQ D;  1PJT A;  3M7G A;  4B7G A;  2DZO B;  1HNW M;  3FYC A;  3LVW A;  5DYG A;  5ITQ A;  3UJN A;  3KFU G;  1YSY A;  3HU2 A;  4MGY E;  3AV0 A;  2XSZ D;  2WSE F;  3B7Q A;  2Z8Y M;  1IN8 A;  2YNM D;  4ZPX A;  1XMQ M;  4CJ6 A;  1ZMW A;  2KNA A;  4D81 A;  3EIE A;  3FTD A;  1OIP A;  2D7E A;  1WXQ A;  2DKL A;  3TE6 A;  2CUZ A;  1XWI A;  3J80 S;  3GRU A;  4OVZ A;  2X8A A;  4BBA A;  5ITR A;  3GPX A;  2CP8 A;  3SBJ A;  3T1Y M;  2OO9 A;  3SAT A;  1N75 A;  4GH9 A;  4DUZ M;  3E4R A;  2KRU A;  2ZAO A;  2BJV A;  3U6C A;  3AL0 C;  1L8Q A;  3LMM A;  4HL4 A;  4YHH M;  4Y28 F;  1AIP C;  4AW4 A;  2KZU A;  3M6A A;  4CIZ A;  1PJQ A;  1SXJ D;  3VDP A;  5FTM A;  1DGB A;  3KDS E;  1H6U A;  4DR6 M;  2LVN C;  3HJQ A;  3UK6 A;  1G4A E;  1Z5B A;  2KDL A;  4NRV A;  1KFV A;  3Q8G A;  1L1Z A;  3TQS A;  3SYK A;  4KOD A;  4OVZ B;  2UUA M;  4NSO B;  4MGZ E;  3SMP A;  4L78 A;  1OIZ A;  2JA2 A;  1TH3 A;  2OOB A;  2Y21 A;  5H37 D;  1DGH B;  1OKS A;  2J7N A;  3J2P B;  2K9D A;  2CHV A;  1HT1 E;  3U6Q A;  4CGY B;  4JV5 M;  2ZBK B;  2XSZ A;  2KRK A;  3T6P A;  4JYA M;  3U6S A;  3GLF B;  2NQ8 C;  3EIH A;  3KOY E;  4LJ8 A;  3KP1 E;  2MGW A;  2DAM A;  3U61 B;  1V92 A;  1J5E M;  2DAE A;  3U6M A;  2XGN A;  1N36 M;  3SHG B;  2VII A;  1IN7 A;  4W5W A;  1G41 A;  5ITX E;  3SFZ A;  2J5Y A;  4AZF A;  1HQY E;  3L29 A;  4FVM A;  5FTJ A;  3FUU A;  3J7A S;  4S12 A;  2ZAM A;  2BWE A;  1QYR A;  3PNV A;  3U6O A;  1E9R A;  1TR8 A;  5KPZ A;  1GAB A;  2BNK A;  3IG5 A;  3RE8 A;  2YQZ A;  3HJ8 A;  3J81 S;  5E6J A;  1Z5A A;  1OFI A;  3VLF B;  1JR3 E;  2VQF M;  4IBI A;  4M9Z A;  2CE7 A;  4NRW A;  4LGY A;  4JI8 M;  3CF2 A;  3GLG A;  1G3I A;  2XZU A;  4CHT B;  2OPF A;  2L4E A;  1JQJ C;  2R18 A;  4I8O A;  1GL7 A;  3GPP A;  2JZ1 A;  2QQ8 A;  3UGJ A;  2FE8 A;  8CAT A;  4LFB M;  4DV2 M;  1IN4 A;  1XNQ M;  1OAI A;  1PM5 A;  1R4G A;  2LHG A;  1HNZ M;  2JNH A;  4PD2 A;  4NXM M;  3TWK A;  1HJP A;  4L8R C;  2FH0 A;  3BXW A;  4X62 M;  3FUT A;  1IXS A;  3DOA A;  1QUT A;  2L09 A;  4OX9 M;  2H5X A;  1XXH A;  5KQ8 A;  4DV5 M;  1FJG M;  1I94 M;  1G8P A;  5IRE B;  3ZCB B;  1DGF A;  3T38 A;  2YFQ A;  3HJS A;  2KZS A;  4IBE A;  2LBC A;  3M0E A;  1L2C A;  4R7G A;  1QAM A;  2F5O A;  4Z8X A;  3HU3 A;  1TDH A;  1G71 A;  1Z59 A;  2UUC M;  2B3T A;  3A45 A;  4PDG A;  2LWX A;  3U6L A;  1T43 A;  3AFH A;  3J7B A;  2KXE A;  3F92 A;  4FWH A;  1YUB A;  1W5S A;  1IXS B;  2CRU A;  3MJ5 A;  3BBZ A;  2C98 A;  2WZJ A;  1XXH B;  3GLH A;  4KHP M;  3QYB A;  3KS4 A;  1K3W A;  4XGI A;  5ITT A;  2MRO B;  1OTR A;  1IM2 A;  4GMQ A;  2YR0 A;  2Z3X A;  3C58 A;  2I7P A;  2Y0Q A;  3GLI A;  2LTU A;  4LRT A;  1NY6 A;  3ILK A;  4IBG A;  1P3Q Q;  4LCB A;  1XNR M;  2R6F A;  4L6V 6;  2K6B A;  1Q3C A;  3VDU A;  2DWM A;  3R9X B;  7CAT A;  4L16 A;  1R2Y A;  2R45 A;  4KLN A;  4PCZ A;  1R7R A;  1NNU C;  1QDR A;  4HEO A;  3GLH B;  4M9X A;  2HKJ A;  4B3S M;  4GRI A;  1T6O A;  5GKN A;  4DR5 M;  1V33 A;  3B7Z A;  3K1J A;  4R71 A;  3CF6 E;  4I4L A;  5KQD A;  3TWM A;  3AOE A;  3GLI B;  5DYI A;  3FD9 A;  4G4O A;  4L15 A;  4B3M M;  1DGH A;  2QBY A;  2QEN A;  3U5Z A;  1WJ7 A;  3CF0 A;  3KW6 A;  1WR1 B;  4LJ6 A;  4MB7 A;  4AKG A;  4OW0 A;  5A2Q S;  3GLF A;  2A5Y B;  1HR0 M;  1D0K A;  3SAU A;  3GQ4 A;  2LVO C;  1GLN A;  1NVM A;  2F5N A;  4IBB A;  2CHQ A;  3U61 A;  4LF5 M;  4F1I A;  4FCT A;  1ZAE A;  1J09 A;  1ZMU A;  4G4R A;  2L7H A;  4QNM A;  4LGM A;  4X66 M;  2XLJ A;  1IXZ A;  4DV0 M;  2XZF A;  2ZAN A;  1QVR A;  2DI0 A;  2KHH A;  3HX3 A;  3J27 B;  3MK6 A;  2QBY B;  2DVW B;  3U5Z B;  5IZ7 D;  4L4U A;  3U6E A;  4LJ5 A;  2XH9 A;  1GKI A;  4X64 M;  2DXI A;  1T3T A;  3I04 M;  4LFA M;  2RKO A;  1G59 A;  2C9O A;  3D8L A;  3Q8X A;  2FS1 A;  4AKI A;  4MGH A;  4JI6 M;  1QAQ A;  4X65 M;  3D8B A;  4GIP A;  4OU7 A;  3E9S A;  2XFS A;  2V1U A;  2ERC A;  3B7N A;  2L6O A;  3GRR A;  1XC8 A;  3JAM S;  2HL7 A;  3IHP A;  1QUS A;  3L28 A;  4D82 A;  4LF8 M;  5EXT A;  4JI0 M;  2R65 A;  3GPU A;  3FTF A;  2O5R A;  2M60 A;  4QOS A;  2UUB M;  4NL4 H;  3U60 A;  4B3R M;  5EXX A;  1VEK A;  3TL4 X;  3HHZ A;  1IN6 A;  1QZM A;  1MN3 A;  3VFD A;  3W67 A;  4AKH A;  2JP7 A;  1DO0 A;  2JY7 A;  2HCB A;  3C9P A;  2HAK A;  3FRI A;  1SXJ A;  1E9S A;  3AJI B;  4DR3 M;  3GQ3 A;  3LQQ A;  4BLC A;  2GNO A;  1OQY A;  2CFO A;  2N35 A;  4UN2 B;  4ITQ A;  3LCV B;  4JI1 M;  4TUW A;  4IBF A;  5EQT A;  4AG6 A;  1D2N A;  3SAW A;  3KXE C;  3SMS A;  1PGY A;  4DUY M;  2CV0 A;  2XEP A;  1QQW A;  1C7Y A;  1NJF A;  3HKP A;  4AG5 A;  3RGP A;  3GPY A;  1WGL A;  3U60 B;  4JN6 A;  2GQF A;  4XBO A;  3SC3 A;  3VKH A;  4XK8 F;  4DV7 M;  1K3X A;  2MR9 A;  1R5L A;  2AHM A;  3GO8 A;  2QCU A;  2EA0 A;  4FWD A;  1J7K A; 
#chains in the Genus database with same CATH homology
 1SXJ B;  1IY0 A;  3PXG A;  4G6Z A;  3T1H M;  4QHT A;  2KEB A;  4NXN M;  3FTE A;  1GL6 A;  2R62 A;  3FUV A;  2H1R A;  3I4Y A;  5EP1 A;  5DNY A;  3SAS A;  1HQC A;  3HHW A;  3TWL A;  1N34 M;  2QP9 X;  2DHR A;  4JI3 M;  1HT2 E;  5ITU A;  2UXB M;  5FTK A;  4LF7 M;  3DA1 A;  4LJA A;  1OJL A;  3SYL A;  1L2D A;  3OTO M;  4FWG A;  4JI7 M;  2C9C A;  3UMM A;  3U6P A;  1VDD A;  1PJJ A;  2DWL A;  1EE8 A;  2CV2 A;  4LY6 A;  3B9P A;  2D7G A;  4GKJ M;  2RGH A;  4DV3 M;  2R46 A;  1NSF A;  3K92 A;  4LJ9 A;  5IT9 S;  1E32 A;  1IY2 A;  4II7 A;  1LV7 A;  2X49 A;  3PNY A;  1NHG C;  1YE9 A;  2F5P A;  3KOZ E;  4M0D A;  4M9S A;  3KS8 A;  2CHG A;  4IBD A;  4AQY M;  1UM8 A;  1QAN A;  3UZU A;  5E26 A;  4D80 A;  4YY3 M;  4GHA A;  3VKG A;  5KPR A;  3KSX A;  4PT5 A;  3H4M A;  4QOZ C;  4FCW A;  1NHW C;  3FUW A;  2G8L A;  4LF4 M;  2BJW A;  4RF0 A;  4HLQ A;  2UXC M;  1TDZ A;  3GRV A;  3KP0 E;  2ZM6 M;  4MGK E;  4RF1 A;  2C99 A;  3KOX E;  2R4E A;  3A98 B;  4BB9 A;  4G4Q A;  1JR3 D;  4B7H A;  2W82 A;  2RGO A;  3CTW B;  1IY1 A;  4LF6 M;  4MGI E;  4QHS A;  2F5Q A;  3SHF A;  3I51 A;  1XMO M;  4DR2 M;  2CEA A;  1N32 M;  1IQP A;  2UXD M;  3R8F A;  4PDI A;  4R3D A;  5EP3 A;  3VK8 A;  2Y0T A;  1W5T A;  3FYD A;  3JR4 A;  4KO8 A;  5JI3 E;  1IBM M;  4LFC M;  2LNH C;  1IBL M;  2DZN B;  2LH0 A;  1C1K A;  4QNR A;  3KSJ A;  4GIT A;  5IWA M;  3A42 A;  3FTC A;  5C1B A;  3U6D A;  1QAO A;  4DR7 M;  2V1C A;  3QAU A;  2Q2E B;  4AI6 A;  5ITX A;  3JR5 A;  5C18 A;  2F4V M;  2D7H A;  4FCV A;  3DFZ A;  3AKZ A;  2G5G X;  4JI2 M;  2Z4S A;  3L2A A;  1Z5C A;  4IIW A;  2FOI C;  4I5S A;  5F3W A;  3SAR A;  3AOG A;  4IJE A;  1K82 A;  5FLX S;  4GKK M;  4LF9 M;  1MU5 A;  5FTL A;  5JI2 E;  3BOS A;  1HNX M;  1JR3 A;  4FW9 A;  5EXS A;  3HU1 A;  4REZ A;  4P16 A;  4GC9 A;  4LJ4 A;  3L27 A;  1NJG A;  5ITY A;  2CV1 A;  2EO2 A;  1N78 A;  4NSR A;  1NNJ A;  2R4J A;  2XFT A;  5KPT A;  4CIS A;  4A3V B;  4IJF A;  4LZJ A;  3KVW A;  1MX0 A;  1Q3B A;  4DR4 M;  1IBK M;  4DV6 M;  4NOO B;  4G4N A;  4GHL A;  3PVS A;  5LMN M;  1KYI A;  4IBK A;  2EUC A;  2LXE A;  1N77 A;  3HHY A;  2L7I A;  4LG2 A;  4JXJ A;  5KO3 A;  3NWL A;  2QZ4 A;  3QWL A;  2OQ4 A;  1DO2 A;  1GVN A;  4DR1 M;  3WHL A;  3T15 A;  1Q39 A;  4WUR A;  2DWZ B;  4EIW A;  3AOE C;  4I81 A;  3L26 A;  2VQE M;  1IXR C;  1IN5 A;  1OFH A;  2J7O A;  4LZZ A;  5EP4 A;  1I4W A;  1XHB A;  5EXP A;  4JI4 M;  3ZC7 B;  3GP1 A;  1DGG A;  1SXJ E;  3FUX A;  3HHX A;  3NBI A;  3GQ5 A;  1TGU A;  4M0W A;  2FFJ A;  1ORY B;  3MHV C;  4LRS A;  3THG A;  1ZQ9 A;  3K2L A;  3PFI A;  1X37 A;  4B7F A;  2P5T A;  3HGI A;  3GRY A;  4LJ7 A;  3WHK A;  1TH4 A;  2Z4R A;  5LMU M;  3LQR A;  4B08 A;  4DV4 M;  1R2Z A;  3VK7 A;  4B3T M;  3W0F A;  3HWS A;  4MH0 E;  3ZH9 B;  2FNA A;  2KA6 B;  3GLG B;  4IBC A;  4DV1 M;  1L2B A;  4FD2 A;  3LVV A;  5FSW A;  3K8Z A;  3L25 A;  2UU9 M;  3IG8 A;  4GC5 A;  5EP2 A;  2DWN A;  4MM3 B;  2KW0 A;  3RFW A;  2E5L M;  2C96 A;  3FKE A;  2M5Z A;  5FTN A;  1TH2 A;  4Z6Y A;  1PJI A;  3SAV A;  3KOW E;  5BR8 M;  1N33 M;  3A46 A;  2I7N A;  1L1T A;  2HHH M;  2F5S A;  1FNN A;  4JI5 M;  1NY5 A;  2K47 A;  3W0L B;  5BPV A;  1R6B X;  3I4V A;  4IBJ A;  5EJC A;  3RGS A;  2V6Z M;  2Y20 A;  1KSF X;  1SXJ C;  4WW0 A;  4RNA A;  2QPA A;  2Z7J A;  1E94 E;  2C5R A;  1S3S A;  2X4A A;  3DZD A;  3TPZ A;  2XF3 A;  1Z6T A;  4K0K M;  4B7G A;  3M7G A;  2DZO B;  1HNW M;  3FYC A;  3LVW A;  5DYG A;  5ITQ A;  3UJN A;  3KFU G;  1YSY A;  3HU2 A;  4MGY E;  3AV0 A;  2XSZ D;  1IN8 A;  2YNM D;  4ZPX A;  1XMQ M;  4D81 A;  3EIE A;  3FTD A;  2D7E A;  1WXQ A;  3TE6 A;  2CUZ A;  1XWI A;  3J80 S;  3GRU A;  4OVZ A;  2X8A A;  4BBA A;  5ITR A;  3GPX A;  3SBJ A;  3T1Y M;  3SAT A;  1N75 A;  4GH9 A;  4DUZ M;  3E4R A;  2KRU A;  2ZAO A;  2BJV A;  3U6C A;  3AL0 C;  1L8Q A;  3LMM A;  4HL4 A;  4YHH M;  4AW4 A;  2KZU A;  3M6A A;  1SXJ D;  3VDP A;  5FTM A;  1DGB A;  3KDS E;  1H6U A;  4DR6 M;  3HJQ A;  3UK6 A;  1G4A E;  1Z5B A;  4NRV A;  1KFV A;  1L1Z A;  3TQS A;  3SYK A;  4KOD A;  4OVZ B;  2UUA M;  4NSO B;  4MGZ E;  3SMP A;  4L78 A;  2JA2 A;  1TH3 A;  2Y21 A;  5H37 D;  1DGH B;  2J7N A;  3J2P B;  3U6Q A;  2CHV A;  1HT1 E;  4JV5 M;  4CGY B;  2ZBK B;  2XSZ A;  2KRK A;  4JYA M;  3U6S A;  3GLF B;  2NQ8 C;  3EIH A;  3KOY E;  4LJ8 A;  3KP1 E;  3U61 B;  1J5E M;  3U6M A;  2XGN A;  1N36 M;  3SHG B;  2VII A;  1IN7 A;  4W5W A;  1G41 A;  5ITX E;  3SFZ A;  4AZF A;  1HQY E;  3L29 A;  4FVM A;  5FTJ A;  3FUU A;  3J7A S;  4S12 A;  2ZAM A;  3PNV A;  1QYR A;  3U6O A;  1E9R A;  5KPZ A;  2BNK A;  3IG5 A;  3RE8 A;  2YQZ A;  3HJ8 A;  3J81 S;  5E6J A;  1Z5A A;  1OFI A;  3VLF B;  2VQF M;  4IBI A;  4M9Z A;  2CE7 A;  4NRW A;  4LGY A;  4JI8 M;  3CF2 A;  3GLG A;  1G3I A;  2XZU A;  4CHT B;  2OPF A;  1JQJ C;  2R18 A;  4I8O A;  1GL7 A;  3GPP A;  3UGJ A;  2FE8 A;  8CAT A;  4LFB M;  4DV2 M;  1IN4 A;  1XNQ M;  1PM5 A;  1HNZ M;  4PD2 A;  4NXM M;  3TWK A;  4L8R C;  4X62 M;  3FUT A;  3DOA A;  2L09 A;  4OX9 M;  1XXH A;  5KQ8 A;  4DV5 M;  1FJG M;  1I94 M;  1G8P A;  5IRE B;  3ZCB B;  1DGF A;  3T38 A;  2YFQ A;  3HJS A;  2KZS A;  4IBE A;  3M0E A;  1L2C A;  4R7G A;  1QAM A;  2F5O A;  4Z8X A;  3HU3 A;  1TDH A;  2UUC M;  1Z59 A;  3A45 A;  4PDG A;  2LWX A;  3U6L A;  3AFH A;  3J7B A;  2KXE A;  4FWH A;  1YUB A;  1W5S A;  1IXS B;  3MJ5 A;  4KHP M;  2C98 A;  1XXH B;  3GLH A;  3KS4 A;  1K3W A;  4XGI A;  5ITT A;  1IM2 A;  4GMQ A;  2YR0 A;  2Z3X A;  3C58 A;  2I7P A;  2Y0Q A;  3GLI A;  4LRT A;  1NY6 A;  3ILK A;  4IBG A;  4LCB A;  1XNR M;  3VDU A;  1Q3C A;  2DWM A;  3R9X B;  7CAT A;  4L16 A;  1R2Y A;  2R45 A;  4KLN A;  4PCZ A;  1R7R A;  1NNU C;  3GLH B;  4M9X A;  2HKJ A;  4B3S M;  4GRI A;  5GKN A;  4DR5 M;  3K1J A;  3CF6 E;  4I4L A;  5KQD A;  3TWM A;  3AOE A;  3GLI B;  5DYI A;  3FD9 A;  4G4O A;  4L15 A;  4B3M M;  1DGH A;  2QBY A;  2QEN A;  3U5Z A;  3CF0 A;  3KW6 A;  4LJ6 A;  4AKG A;  4MB7 A;  4OW0 A;  5A2Q S;  3GLF A;  2A5Y B;  1HR0 M;  3SAU A;  3GQ4 A;  1GLN A;  1NVM A;  2F5N A;  4IBB A;  2CHQ A;  3U61 A;  4LF5 M;  4FCT A;  1ZAE A;  1J09 A;  4G4R A;  2L7H A;  4QNM A;  4LGM A;  4X66 M;  2XLJ A;  1IXZ A;  4DV0 M;  2XZF A;  2ZAN A;  1QVR A;  3J27 B;  3MK6 A;  2QBY B;  2DVW B;  3U5Z B;  5IZ7 D;  4L4U A;  3U6E A;  4LJ5 A;  2XH9 A;  1GKI A;  4X64 M;  2DXI A;  1T3T A;  4LFA M;  2RKO A;  1G59 A;  2C9O A;  3D8L A;  3Q8X A;  4AKI A;  4MGH A;  4JI6 M;  1QAQ A;  4X65 M;  3D8B A;  4GIP A;  4OU7 A;  3E9S A;  2XFS A;  2V1U A;  2ERC A;  2L6O A;  3GRR A;  1XC8 A;  3JAM S;  2HL7 A;  4D82 A;  3L28 A;  4LF8 M;  5EXT A;  4JI0 M;  2R65 A;  3GPU A;  3FTF A;  2O5R A;  2M60 A;  4QOS A;  2UUB M;  4NL4 H;  3U60 A;  4B3R M;  5EXX A;  3TL4 X;  3HHZ A;  1IN6 A;  1QZM A;  3VFD A;  4AKH A;  1DO0 A;  2HCB A;  1SXJ A;  1E9S A;  3AJI B;  4DR3 M;  3GQ3 A;  3LQQ A;  4BLC A;  4JI1 M;  2CFO A;  4ITQ A;  4TUW A;  4IBF A;  5EQT A;  4AG6 A;  1D2N A;  3SAW A;  3KXE C;  3SMS A;  4DUY M;  2CV0 A;  2XEP A;  1QQW A;  1NJF A;  3HKP A;  4AG5 A;  3RGP A;  3GPY A;  3U60 B;  4JN6 A;  4XBO A;  3SC3 A;  3VKH A;  4DV7 M;  1K3X A;  2AHM A;  3GO8 A;  2QCU A;  2EA0 A;  4FWD A;  1J7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...