2VDBB

Structure of human serum albumin with s-naproxen and the ga module
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
55
structure length
55
Chain Sequence
HMTIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERUM ALBUMIN
publication title Structural Basis for the Binding of Naproxen to Human Serum Albumin in the Presence of Fatty Acids and the Ga Module.
pubmed doi rcsb
source organism Peptostreptococcus magnus
molecule tags Protein binding
total genus 21
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2vdbB00
2VDBB 1GJTA 2KDLA 1GJSA 2LHCA 2JWSA 2MH8A 1GABA 1PRBA 2J5YA 2FS1A 2N35A 1TF0B 2LHGA
chains in the Genus database with same CATH superfamily
4Y28F 1I94M 2CFOA 1ZQ9A 4LRSA 1UFZA 2LNHC 2Y0TA 4D81A 1XC8A 3R9XB 4DR5M 3KXEC 5DYGA 4G3OA 3UGJA 4BB9A 1NO1A 2CP8A 3GQ4A 3U61A 1G71A 4X65M 2C9OA 1QUSA 4KODA 4AI6A 5EXSA 4L4UA 3AOEA 3LQQA 3GQ5A 3SAUA 4B3RM 1QQWA 4JI6M 1HQYE 2HWJA 4FWHA 4LJ4A 4HLQA 2EUCA 3L2AA 2WZJA 2UUBM 1WHCA 4WP2A 4IBCA 1T43A 2HL7A 1EFUB 5C18A 4IBGA 2UXCM 2GQFA 2DNAA 4DUZM 2LXEA 5LMUM 1E9SA 4MGKE 1XWIA 2G5GX 3SATA 2G3QA 4LF8M 1IM2A 5IZ7D 2KA6B 4JI0M 2UUAM 3CF6E 2FOIC 1N32M 2MJ5B 4DV6M 1GVNA 1YSYA 2CE7A 3A45A 3B7QA 5JI3E 3J2PB 1IQPA 2CUZA 1NY6A 1OIPA 4JI3M 2JA2A 1VEKA 1Z5CA 1VG5A 2XZUA 4GH9A 1J7KA 4DV3M 4GHLA 2XEPA 3FD9A 3HU3A 4RF0A 3T6PA 2FS1A 4G4NA 1MU5A 4IBKA 3E46A 1Q3CA 4KT0F 4LRTA 3GLFA 1DGGA 4B7FA 4X66M 3FRHA 3GP1A 4B3MM 4M0WA 3I4VA 4JI1M 2FH0A 3MHVC 3LMMA 3T1YM 4IBDA 4QOSA 3DFZA 3J7BA 2I7PA 1PJIA 3KOZE 4QNRA 2G8LA 2RGOA 1NNJA 1GJSA 2QBYB 1GO5A 2V1UA 1IBKM 1NNUC 1GL7A 2KW0A 2APLA 4M9XA 1WGNA 1HNXM 3AKZA 2YQZA 3PNVA 4LGYA 4DBGB 2QPAA 1W5SA 2EKKA 1IN5A 2UXBM 1X37A 3KVWA 3VFDA 2O5RA 1TH2A 4LCBA 2H5XA 2Q2EB 3E4RA 4L6V6 4NRVA 2BJVA 2X8AA 4FCTA 1KYIA 1OIZA 1PJSA 2DKLA 2P5TA 2RRUA 1TTEA 4CIZA 2CHQA 3R8FA 2DWZB 1D0MA 3FRIA 3AV0A 3H4MA 4M0DA 2L09A 3U6OA 1N77A 4LF9M 4GHAA 2R62A 1YUBA 2XGNA 2ZM6M 2DENA 4IIWA 7CATA 1PJQA 3U60B 2FFJA 1SXJC 5KO3A 4XGIA 1I4WA 4FWDA 1IFYA 4M9ZA 3M0EA 3FTFA 1SXJE 1J09A 2C98A 2Y20A 1XB2B 2L4EA 2QSFX 2DWLA 4RF1A 2BNKA 3TWKA 1IXZA 4CGYB 1TDZA 2XSZD 1JR3A 4L15A 2CHGA 2R46A 3GPYA 1IN8A 3TPZA 4S12A 4X64M 4PDGA 1Q39A 2I7NA 1ZAEA 5FTJA 3ZC7B 4XBOA 4CHTB 1FNNA 4DR7M 4LJ8A 3JR5A 1TH4A 5ITTA 3W67A 1Z5BA 3GLHE 1TF0B 2YR0A 3I4YA 1N75A 3HJSA 2KDLA 4LG2A 4AW4A 4PT5A 2N35A 3TWLA 5E26A 2H1RA 1UM8A 3LQRA 3L25A 4IBFA 5EXTA 1IY1A 1T6OA 1SXJB 2XZFA 3HU1A 4OVZA 4XK8F 3DOAA 3LVWA 3GRYA 4JI5M 1WJ7A 1R2YA 1IXSB 4MGYE 4R3DA 3C58A 1IY2A 4KO8A 2CV2A 4MH0E 4NSOB 2Z4SA 2JP7A 1OFHA 1VQ1A 3I04M 2XH9A 2QQ8A 1QYRA 1LV7A 5KPZA 4DR1M 3TQSA 4P17A 3SAVA 2ZAOA 2F5PA 2JWSA 2EA0A 3GLHB 5EP1A 4B3TM 3PVSA 3J80S 3Q8XA 3SC3A 4DV2M 5E6JA 2DHRA 4DR2M 2QENA 1ORYB 3MK6A 1XMQM 1R7RA 1D0KA 1NJGA 2KRUA 2VF7A 4M9SA 4ANRA 1NSFA 2XLJA 3FE3A 4P16A 4L8RC 3GLIA 5ITXE 2DWNA 3WHKA 3HHZA 2L7IA 1HNWM 2DXIA 4AQYM 3IHPA 2OQ4A 4QOZC 3U6MA 4X62M 1FJGM 1NJFA 4W5WA 1K82A 4JV5M 5FTLA 5DFLA 4G4OA 3CGWA 2J7NA 3W68A 1WR1B 2JY5A 4IJEA 3CTWB 1OFIA 3IG8A 3RGPA 1QAOA 1R2ZA 1TDHA 2Z8YM 4AKIA 2RGHA 3K9PA 2O01F 2QNJA 1ZMVA 1HNZM 4ZPXA 2LHCA 1PJJA 1QVRA 1XXHA 2MH8A 1JQJC 4GC9A 3FTCA 2C9CA 2E5LM 5EP4A 4LJ5A 2JY8A 2A5YB 3NWLA 3W0FA 1C7YA 4LJ6A 4GIPA 2L7HA 2LVAA 1L2BA 3T38A 1N36M 1L8QA 2UXDM 2L6OA 1DGHB 1G59A 3U6CA 3SHFA 4BBAA 4QHSA 3BXWA 4LZZA 3K8ZA 4R7GA 3KOWE 4YY3M 2RKOA 1L1TA 1HJPA 1CUKA 4HEOA 4HL4A 4DR3M 2XFSA 3W0LB 3SYLA 1N33M 3ZQJA 1DGFA 1ZV1A 5A2QS 3M6AA 2CHVA 3I01M 2CV0A 3FTDA 4OX9M 1GKIA 1HT1E 4L16A 2JY6B 4JI8M 1KSFX 3AFHA 3H4JA 4NL4H 4NXMM 3FUVA 2X49A 4D82A 4JN6A 4AG6A 1E9RA 2JUJA 4YHHM 3LCUA 2F5QA 3BBZA 2JY7A 4AZFA 1MN3A 4FCVA 2F5OA 4JI4M 2ZTDA 4LFBM 3SHGB 3L26A 2LWXA 1F4IA 1QZEA 3C3DA 1PM5A 3B9PA 2BWBA 1JB0F 2FNAA 3D8LA 3GLGE 3LVVA 3J27B 3BOSA 3FUWA 1BVSA 1TGUA 2KNZA 4LY6A 4TUWA 1EE8A 4LF6M 3TE6A 2M5ZA 2BWEA 2DWMA 3HJQA 1IBLM 2QBYA 3IECA 4LFCM 1DV0A 1QAMA 3CF0A 1T3TA 1L2CA 2HKJA 2DAKA 3KW6A 3KOYE 3HKPA 4A3VB 2C96A 4CJ6A 4F1IA 3K92A 3ZH9B 1GJTA 2D7GA 5KQ8A 2AHMA 1JR3D 1QDTA 2ZTCA 4IBIA 1HQCA 2LTUA 4LJ7A 1MJGM 2F4VM 1D2NA 3M7GA 3U6SA 3K2LA 2K9DA 3GLGB 1MX0A 2LH0A 4RNAA 4MGIE 3EIHA 3KP1E 2UU9M 3UMMA 5BR8M 2UUCM 3U6LA 2KRKA 1V92A 3A46A 2VQFM 2EJSA 3THGA 2XF3A 3J7AS 4LGMA 4GITA 4B7GA 3TWMA 3FUUA 5F3WA 5KQDA 3DZDA 3L29A 4MGZE 2LVOC 1Q02A 5IT9S 2L4FA 3U60A 1DGBA 1P3QQ 1PJTA 5L8RF 2QP9X 1EIJA 2JZ0A 3HZJA 1N34M 2F5NA 1Z5AA 5JI2E 3QYBA 4Z8XA 5EQTA 3ILKA 1XNQM 3DA1A 3FYDA 2C5RA 4Q7JA 3JAMS 4G4QA 1XMOM 2DHYA 2Y21A 3QWLA 2DVWB 2QZ4A 2C99A 3AOEC 1RU3A 3L28A 2CEAA 3HY5A 4FCWA 2KEBA 3TL4X 3NBXX 3U5ZB 4B3SM 4JYAM 3RGSA 2R44A 3HHWA 4LJ9A 2DAGA 4DV0M 1L1ZA 4II7A 5IREB 1WXQA 5EP3A 5DNYA 2M60A 1SXJA 2R4EA 2BJWA 4UN2B 3VDUA 3SARA 3KS8A 3KSXA 2CRUA 3V76A 2CV1A 1NV9A 2J5YA 4MB7A 2OOBA 3I51A 1IXSA 2ZAMA 2DAEA 1NV8A 4AG5A 4KLNA 1D0LA 1VDDA 1QAQA 2LBCA 5ITRA 2KXEA 4G6ZA 1G41A 8CATA 3U61B 3SMSA 4I81A 4QNMA 3U6DA 4PD2A 2YNMD 4B08A 1WIVA 5IWAM 3GLHA 1VEJA 2JXNA 1IN4A 4LJAA 4BLCA 4DV1M 1WGLA 2ZBKB 3GLFE 5FLXS 3PFIA 4AKGA 4DV7M 1AUAA 3LW5F 3AOGA 2OO9A 1ZMWA 3A98B 3LCVB 1XXHB 2CWBA 4JI7M 1QZMA 4NOOB 3NBIA 5ITUA 2KZUA 4REZA 3VLFB 3GPPA 3QYEA 2J7OA 3C9PA 3Q8GA 2VF8A 4L78A 2DZLA 2R0IA 3GRVA 5KPTA 2Y0QA 4GMQA 3GO8A 3AL0C 1Q3BA 2KNVA 2HCBA 3KS4A 3MJ5A 4MGHA 1K3XA 2EKFA 3GQ3A 1K3WA 1XHBA 3MMPA 2F5SA 3SMPA 4K0KM 3FTEA 4FWGA 1J5EM 3KOXE 3GLFB 2Z7JA 2K6BA 3A42A 2D7EA 3FUXA 2KNAA 3B7NA 4WURA 1TH3A 2K0BX 3J81S 4AKHA 1OAIA 2XFTA 2LVPC 3HX3A 1E94E 2WSCF 3C3EA 2D7HA 3E9SA 5EJCA 4PDIA 4LF4M 1GABA 5ITXA 4NSRA 4R71A 2V6ZM 1V34A 2DZNB 4FD2A 4JXJA 1V33A 1GL6A 4G4RA 3VKGA 4IBEA 2JNHA 1DO2A 3OTOM 1E32A 3T15A 3B74A 3SFZA 5FSWA 5FTKA 1OJLA 4FW9A 1DGHA 5DYIA 1S3SA 5FTNA 1IY0A 1H6UA 2EO2A 2MR9A 1KFVA 1JR3E 3VK7A 2HHHM 1IN6A 2VDBB 2Z3XA 3FUTA 3GRUA 1QDRA 2V1CA 2K47A 2QCUA 2ZANA 3ZCBB 3PXGA 4OU7A 1IN7A 4LFAM 4B7HA 2LVNC 3GPXA 4F2LA 3WHLA 4I4LA 1R6BX 3SAWA 1OTRA 3K9OA 2R18A 2DZOB 3UK6A 3L27A 4LF7M 2WSFF 3PNYA 3UZUA 1PGYA 3E21A 4FVMA 3U6QA 4GKKM 2NQ8C 4WW0A 2DAMA 2DAIA 3K1JA 5BPVA 1W5TA 2ERCA 1C1KA 4JI2M 1G8PA 1L2DA 4IBBA 1QANA 4DR4M 2KZSA 4D80A 3B7ZA 5EXPA 2Z4RA 5C1BA 1OAOC 1HT2E 1YLAA 3SASA 1GLNA 3UJNA 5KPRA 1Z6TA 1PRBA 2L2DA 1TR8A 2R65A 1DO0A 1G4AE 3KDSE 4DUYM 4IJFA 4DV5M 3HJ8A 2DI0A 2WSEF 4DV4M 4CISA 2LVQD 2R6FA 5ITYA 5ITQA 2FE8A 4IBJA 2OOAA 4NXNM 2YFQA 3HHYA 4OVZB 4GRIA 4GKJM 1Y8GA 3HU2A 4GEWA 3GLIE 3VKHA 1NHGC 2JZ1A 2QHOB 4EIWA 2MGWA 3IG5A 1OKSA 3GLGA 1SG9A 1HR0M 2VQEM 4OW0A 5EXXA 4RKUF 3JR4A 3HGIA 2XSZA 2B3TA 3GRRA 3SBJA 4NC6A 1AIPC 1YE9A 4QHTA 5GKNA 3T1HM 1IBMM 2HAKA 3CF2A 5H37D 3FYCA 4I5SA 3HWSA 4PCZA 1N78A 1SXJD 1VEGA 4NRWA 3KP0E 1IXRC 1R4GA 3B89A 1XNRM 1VDLA 2X4AA 1ZMUA 4I8OA 4MM3B 1OQYA 1QUTA 3QAUA 1XXHE 2GNOA 3GLIB 4KHPM 3KFUG 3AJIB 3VK8A 3FKEA 2LHGA 5FTMA 2MROB 4GC5A 5LMNM 1R5LA 3U6PA 2R45A 2KHHA 3GPUA 3F92A 3HHXA 2VIIA 2O25A 4LZJA 3VDPA 3D8BA 4Z6YA 3U5ZA 4DR6M 4LF5M 3RE8A 1NHWC 1A5TA 3SYKA 2R4JA 3KSJA 1NY5A 3RFWA 3EIEA 1NVMA 2W82A 2OPFA 4ITQA 5EP2A 3U6EA 1Z59A 1LTMA 1G3IA
chains in the Genus database with same CATH topology
2VDBB 1GJTA 2KDLA 1GJSA 2LHCA 2JWSA 2MH8A 1GABA 1PRBA 2J5YA 2FS1A 2N35A 1TF0B 2LHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDB B;  1GJT A;  2KDL A;  1GJS A;  2LHC A;  2JWS A;  2MH8 A;  1GAB A;  1PRB A;  2J5Y A;  2FS1 A;  2N35 A;  1TF0 B;  2LHG A; 
#chains in the Genus database with same CATH topology
 4Y28 F;  1I94 M;  2CFO A;  1ZQ9 A;  4LRS A;  1UFZ A;  2LNH C;  2Y0T A;  4D81 A;  1XC8 A;  3R9X B;  4DR5 M;  3KXE C;  5DYG A;  4G3O A;  3UGJ A;  4BB9 A;  1NO1 A;  2CP8 A;  3GQ4 A;  3U61 A;  1G71 A;  4X65 M;  2C9O A;  1QUS A;  4KOD A;  4AI6 A;  5EXS A;  4L4U A;  3AOE A;  3LQQ A;  3GQ5 A;  3SAU A;  4B3R M;  1QQW A;  4JI6 M;  1HQY E;  2HWJ A;  4FWH A;  4LJ4 A;  4HLQ A;  2EUC A;  3L2A A;  2WZJ A;  2UUB M;  1WHC A;  4WP2 A;  4IBC A;  1T43 A;  2HL7 A;  1EFU B;  5C18 A;  4IBG A;  2UXC M;  2GQF A;  2DNA A;  4DUZ M;  2LXE A;  5LMU M;  1E9S A;  4MGK E;  1XWI A;  2G5G X;  3SAT A;  2G3Q A;  4LF8 M;  1IM2 A;  5IZ7 D;  2KA6 B;  4JI0 M;  2UUA M;  3CF6 E;  2FOI C;  1N32 M;  2MJ5 B;  4DV6 M;  1GVN A;  1YSY A;  2CE7 A;  3A45 A;  3B7Q A;  5JI3 E;  3J2P B;  1IQP A;  2CUZ A;  1NY6 A;  1OIP A;  4JI3 M;  2JA2 A;  1VEK A;  1Z5C A;  1VG5 A;  2XZU A;  4GH9 A;  1J7K A;  4DV3 M;  4GHL A;  2XEP A;  3FD9 A;  3HU3 A;  4RF0 A;  3T6P A;  2FS1 A;  4G4N A;  1MU5 A;  4IBK A;  3E46 A;  1Q3C A;  4KT0 F;  4LRT A;  3GLF A;  1DGG A;  4B7F A;  4X66 M;  3FRH A;  3GP1 A;  4B3M M;  4M0W A;  3I4V A;  4JI1 M;  2FH0 A;  3MHV C;  3LMM A;  3T1Y M;  4IBD A;  4QOS A;  3DFZ A;  3J7B A;  2I7P A;  1PJI A;  3KOZ E;  4QNR A;  2G8L A;  2RGO A;  1NNJ A;  1GJS A;  2QBY B;  1GO5 A;  2V1U A;  1IBK M;  1NNU C;  1GL7 A;  2KW0 A;  2APL A;  4M9X A;  1WGN A;  1HNX M;  3AKZ A;  2YQZ A;  3PNV A;  4LGY A;  4DBG B;  2QPA A;  1W5S A;  2EKK A;  1IN5 A;  2UXB M;  1X37 A;  3KVW A;  3VFD A;  2O5R A;  1TH2 A;  4LCB A;  2H5X A;  2Q2E B;  3E4R A;  4L6V 6;  4NRV A;  2BJV A;  2X8A A;  4FCT A;  1KYI A;  1OIZ A;  1PJS A;  2DKL A;  2P5T A;  2RRU A;  1TTE A;  4CIZ A;  2CHQ A;  3R8F A;  2DWZ B;  1D0M A;  3FRI A;  3AV0 A;  3H4M A;  4M0D A;  2L09 A;  3U6O A;  1N77 A;  4LF9 M;  4GHA A;  2R62 A;  1YUB A;  2XGN A;  2ZM6 M;  2DEN A;  4IIW A;  7CAT A;  1PJQ A;  3U60 B;  2FFJ A;  1SXJ C;  5KO3 A;  4XGI A;  1I4W A;  4FWD A;  1IFY A;  4M9Z A;  3M0E A;  3FTF A;  1SXJ E;  1J09 A;  2C98 A;  2Y20 A;  1XB2 B;  2L4E A;  2QSF X;  2DWL A;  4RF1 A;  2BNK A;  3TWK A;  1IXZ A;  4CGY B;  1TDZ A;  2XSZ D;  1JR3 A;  4L15 A;  2CHG A;  2R46 A;  3GPY A;  1IN8 A;  3TPZ A;  4S12 A;  4X64 M;  4PDG A;  1Q39 A;  2I7N A;  1ZAE A;  5FTJ A;  3ZC7 B;  4XBO A;  4CHT B;  1FNN A;  4DR7 M;  4LJ8 A;  3JR5 A;  1TH4 A;  5ITT A;  3W67 A;  1Z5B A;  3GLH E;  1TF0 B;  2YR0 A;  3I4Y A;  1N75 A;  3HJS A;  2KDL A;  4LG2 A;  4AW4 A;  4PT5 A;  2N35 A;  3TWL A;  5E26 A;  2H1R A;  1UM8 A;  3LQR A;  3L25 A;  4IBF A;  5EXT A;  1IY1 A;  1T6O A;  1SXJ B;  2XZF A;  3HU1 A;  4OVZ A;  4XK8 F;  3DOA A;  3LVW A;  3GRY A;  4JI5 M;  1WJ7 A;  1R2Y A;  1IXS B;  4MGY E;  4R3D A;  3C58 A;  1IY2 A;  4KO8 A;  2CV2 A;  4MH0 E;  4NSO B;  2Z4S A;  2JP7 A;  1OFH A;  1VQ1 A;  3I04 M;  2XH9 A;  2QQ8 A;  1QYR A;  1LV7 A;  5KPZ A;  4DR1 M;  3TQS A;  4P17 A;  3SAV A;  2ZAO A;  2F5P A;  2JWS A;  2EA0 A;  3GLH B;  5EP1 A;  4B3T M;  3PVS A;  3J80 S;  3Q8X A;  3SC3 A;  4DV2 M;  5E6J A;  2DHR A;  4DR2 M;  2QEN A;  1ORY B;  3MK6 A;  1XMQ M;  1R7R A;  1D0K A;  1NJG A;  2KRU A;  2VF7 A;  4M9S A;  4ANR A;  1NSF A;  2XLJ A;  3FE3 A;  4P16 A;  4L8R C;  3GLI A;  5ITX E;  2DWN A;  3WHK A;  3HHZ A;  2L7I A;  1HNW M;  2DXI A;  4AQY M;  3IHP A;  2OQ4 A;  4QOZ C;  3U6M A;  4X62 M;  1FJG M;  1NJF A;  4W5W A;  1K82 A;  4JV5 M;  5FTL A;  5DFL A;  4G4O A;  3CGW A;  2J7N A;  3W68 A;  1WR1 B;  2JY5 A;  4IJE A;  3CTW B;  1OFI A;  3IG8 A;  3RGP A;  1QAO A;  1R2Z A;  1TDH A;  2Z8Y M;  4AKI A;  2RGH A;  3K9P A;  2O01 F;  2QNJ A;  1ZMV A;  1HNZ M;  4ZPX A;  2LHC A;  1PJJ A;  1QVR A;  1XXH A;  2MH8 A;  1JQJ C;  4GC9 A;  3FTC A;  2C9C A;  2E5L M;  5EP4 A;  4LJ5 A;  2JY8 A;  2A5Y B;  3NWL A;  3W0F A;  1C7Y A;  4LJ6 A;  4GIP A;  2L7H A;  2LVA A;  1L2B A;  3T38 A;  1N36 M;  1L8Q A;  2UXD M;  2L6O A;  1DGH B;  1G59 A;  3U6C A;  3SHF A;  4BBA A;  4QHS A;  3BXW A;  4LZZ A;  3K8Z A;  4R7G A;  3KOW E;  4YY3 M;  2RKO A;  1L1T A;  1HJP A;  1CUK A;  4HEO A;  4HL4 A;  4DR3 M;  2XFS A;  3W0L B;  3SYL A;  1N33 M;  3ZQJ A;  1DGF A;  1ZV1 A;  5A2Q S;  3M6A A;  2CHV A;  3I01 M;  2CV0 A;  3FTD A;  4OX9 M;  1GKI A;  1HT1 E;  4L16 A;  2JY6 B;  4JI8 M;  1KSF X;  3AFH A;  3H4J A;  4NL4 H;  4NXM M;  3FUV A;  2X49 A;  4D82 A;  4JN6 A;  4AG6 A;  1E9R A;  2JUJ A;  4YHH M;  3LCU A;  2F5Q A;  3BBZ A;  2JY7 A;  4AZF A;  1MN3 A;  4FCV A;  2F5O A;  4JI4 M;  2ZTD A;  4LFB M;  3SHG B;  3L26 A;  2LWX A;  1F4I A;  1QZE A;  3C3D A;  1PM5 A;  3B9P A;  2BWB A;  1JB0 F;  2FNA A;  3D8L A;  3GLG E;  3LVV A;  3J27 B;  3BOS A;  3FUW A;  1BVS A;  1TGU A;  2KNZ A;  4LY6 A;  4TUW A;  1EE8 A;  4LF6 M;  3TE6 A;  2M5Z A;  2BWE A;  2DWM A;  3HJQ A;  1IBL M;  2QBY A;  3IEC A;  4LFC M;  1DV0 A;  1QAM A;  3CF0 A;  1T3T A;  1L2C A;  2HKJ A;  2DAK A;  3KW6 A;  3KOY E;  3HKP A;  4A3V B;  2C96 A;  4CJ6 A;  4F1I A;  3K92 A;  3ZH9 B;  1GJT A;  2D7G A;  5KQ8 A;  2AHM A;  1JR3 D;  1QDT A;  2ZTC A;  4IBI A;  1HQC A;  2LTU A;  4LJ7 A;  1MJG M;  2F4V M;  1D2N A;  3M7G A;  3U6S A;  3K2L A;  2K9D A;  3GLG B;  1MX0 A;  2LH0 A;  4RNA A;  4MGI E;  3EIH A;  3KP1 E;  2UU9 M;  3UMM A;  5BR8 M;  2UUC M;  3U6L A;  2KRK A;  1V92 A;  3A46 A;  2VQF M;  2EJS A;  3THG A;  2XF3 A;  3J7A S;  4LGM A;  4GIT A;  4B7G A;  3TWM A;  3FUU A;  5F3W A;  5KQD A;  3DZD A;  3L29 A;  4MGZ E;  2LVO C;  1Q02 A;  5IT9 S;  2L4F A;  3U60 A;  1DGB A;  1P3Q Q;  1PJT A;  5L8R F;  2QP9 X;  1EIJ A;  2JZ0 A;  3HZJ A;  1N34 M;  2F5N A;  1Z5A A;  5JI2 E;  3QYB A;  4Z8X A;  5EQT A;  3ILK A;  1XNQ M;  3DA1 A;  3FYD A;  2C5R A;  4Q7J A;  3JAM S;  4G4Q A;  1XMO M;  2DHY A;  2Y21 A;  3QWL A;  2DVW B;  2QZ4 A;  2C99 A;  3AOE C;  1RU3 A;  3L28 A;  2CEA A;  3HY5 A;  4FCW A;  2KEB A;  3TL4 X;  3NBX X;  3U5Z B;  4B3S M;  4JYA M;  3RGS A;  2R44 A;  3HHW A;  4LJ9 A;  2DAG A;  4DV0 M;  1L1Z A;  4II7 A;  5IRE B;  1WXQ A;  5EP3 A;  5DNY A;  2M60 A;  1SXJ A;  2R4E A;  2BJW A;  4UN2 B;  3VDU A;  3SAR A;  3KS8 A;  3KSX A;  2CRU A;  3V76 A;  2CV1 A;  1NV9 A;  2J5Y A;  4MB7 A;  2OOB A;  3I51 A;  1IXS A;  2ZAM A;  2DAE A;  1NV8 A;  4AG5 A;  4KLN A;  1D0L A;  1VDD A;  1QAQ A;  2LBC A;  5ITR A;  2KXE A;  4G6Z A;  1G41 A;  8CAT A;  3U61 B;  3SMS A;  4I81 A;  4QNM A;  3U6D A;  4PD2 A;  2YNM D;  4B08 A;  1WIV A;  5IWA M;  3GLH A;  1VEJ A;  2JXN A;  1IN4 A;  4LJA A;  4BLC A;  4DV1 M;  1WGL A;  2ZBK B;  3GLF E;  5FLX S;  3PFI A;  4AKG A;  4DV7 M;  1AUA A;  3LW5 F;  3AOG A;  2OO9 A;  1ZMW A;  3A98 B;  3LCV B;  1XXH B;  2CWB A;  4JI7 M;  1QZM A;  4NOO B;  3NBI A;  5ITU A;  2KZU A;  4REZ A;  3VLF B;  3GPP A;  3QYE A;  2J7O A;  3C9P A;  3Q8G A;  2VF8 A;  4L78 A;  2DZL A;  2R0I A;  3GRV A;  5KPT A;  2Y0Q A;  4GMQ A;  3GO8 A;  3AL0 C;  1Q3B A;  2KNV A;  2HCB A;  3KS4 A;  3MJ5 A;  4MGH A;  1K3X A;  2EKF A;  3GQ3 A;  1K3W A;  1XHB A;  3MMP A;  2F5S A;  3SMP A;  4K0K M;  3FTE A;  4FWG A;  1J5E M;  3KOX E;  3GLF B;  2Z7J A;  2K6B A;  3A42 A;  2D7E A;  3FUX A;  2KNA A;  3B7N A;  4WUR A;  1TH3 A;  2K0B X;  3J81 S;  4AKH A;  1OAI A;  2XFT A;  2LVP C;  3HX3 A;  1E94 E;  2WSC F;  3C3E A;  2D7H A;  3E9S A;  5EJC A;  4PDI A;  4LF4 M;  1GAB A;  5ITX A;  4NSR A;  4R71 A;  2V6Z M;  1V34 A;  2DZN B;  4FD2 A;  4JXJ A;  1V33 A;  1GL6 A;  4G4R A;  3VKG A;  4IBE A;  2JNH A;  1DO2 A;  3OTO M;  1E32 A;  3T15 A;  3B74 A;  3SFZ A;  5FSW A;  5FTK A;  1OJL A;  4FW9 A;  1DGH A;  5DYI A;  1S3S A;  5FTN A;  1IY0 A;  1H6U A;  2EO2 A;  2MR9 A;  1KFV A;  1JR3 E;  3VK7 A;  2HHH M;  1IN6 A;  2VDB B;  2Z3X A;  3FUT A;  3GRU A;  1QDR A;  2V1C A;  2K47 A;  2QCU A;  2ZAN A;  3ZCB B;  3PXG A;  4OU7 A;  1IN7 A;  4LFA M;  4B7H A;  2LVN C;  3GPX A;  4F2L A;  3WHL A;  4I4L A;  1R6B X;  3SAW A;  1OTR A;  3K9O A;  2R18 A;  2DZO B;  3UK6 A;  3L27 A;  4LF7 M;  2WSF F;  3PNY A;  3UZU A;  1PGY A;  3E21 A;  4FVM A;  3U6Q A;  4GKK M;  2NQ8 C;  4WW0 A;  2DAM A;  2DAI A;  3K1J A;  5BPV A;  1W5T A;  2ERC A;  1C1K A;  4JI2 M;  1G8P A;  1L2D A;  4IBB A;  1QAN A;  4DR4 M;  2KZS A;  4D80 A;  3B7Z A;  5EXP A;  2Z4R A;  5C1B A;  1OAO C;  1HT2 E;  1YLA A;  3SAS A;  1GLN A;  3UJN A;  5KPR A;  1Z6T A;  1PRB A;  2L2D A;  1TR8 A;  2R65 A;  1DO0 A;  1G4A E;  3KDS E;  4DUY M;  4IJF A;  4DV5 M;  3HJ8 A;  2DI0 A;  2WSE F;  4DV4 M;  4CIS A;  2LVQ D;  2R6F A;  5ITY A;  5ITQ A;  2FE8 A;  4IBJ A;  2OOA A;  4NXN M;  2YFQ A;  3HHY A;  4OVZ B;  4GRI A;  4GKJ M;  1Y8G A;  3HU2 A;  4GEW A;  3GLI E;  3VKH A;  1NHG C;  2JZ1 A;  2QHO B;  4EIW A;  2MGW A;  3IG5 A;  1OKS A;  3GLG A;  1SG9 A;  1HR0 M;  2VQE M;  4OW0 A;  5EXX A;  4RKU F;  3JR4 A;  3HGI A;  2XSZ A;  2B3T A;  3GRR A;  3SBJ A;  4NC6 A;  1AIP C;  1YE9 A;  4QHT A;  5GKN A;  3T1H M;  1IBM M;  2HAK A;  3CF2 A;  5H37 D;  3FYC A;  4I5S A;  3HWS A;  4PCZ A;  1N78 A;  1SXJ D;  1VEG A;  4NRW A;  3KP0 E;  1IXR C;  1R4G A;  3B89 A;  1XNR M;  1VDL A;  2X4A A;  1ZMU A;  4I8O A;  4MM3 B;  1OQY A;  1QUT A;  3QAU A;  1XXH E;  2GNO A;  3GLI B;  4KHP M;  3KFU G;  3AJI B;  3VK8 A;  3FKE A;  2LHG A;  5FTM A;  2MRO B;  4GC5 A;  5LMN M;  1R5L A;  3U6P A;  2R45 A;  2KHH A;  3GPU A;  3F92 A;  3HHX A;  2VII A;  2O25 A;  4LZJ A;  3VDP A;  3D8B A;  4Z6Y A;  3U5Z A;  4DR6 M;  4LF5 M;  3RE8 A;  1NHW C;  1A5T A;  3SYK A;  2R4J A;  3KSJ A;  1NY5 A;  3RFW A;  3EIE A;  1NVM A;  2W82 A;  2OPF A;  4ITQ A;  5EP2 A;  3U6E A;  1Z59 A;  1LTM A;  1G3I A; 
#chains in the Genus database with same CATH homology
 2VDB B;  1GJT A;  2KDL A;  1GJS A;  2LHC A;  2JWS A;  2MH8 A;  1GAB A;  1PRB A;  2J5Y A;  2FS1 A;  2N35 A;  1TF0 B;  2LHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...