2VDBB

Structure of human serum albumin with s-naproxen and the ga module
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
55
structure length
55
Chain Sequence
HMTIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Binding of Naproxen to Human Serum Albumin in the Presence of Fatty Acids and the Ga Module.
pubmed doi rcsb
source organism Peptostreptococcus magnus
molecule tags Protein binding
molecule keywords SERUM ALBUMIN
total genus 21
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2vdbB00
2VDBB 2J5YA 1GABA 2KDLA 1GJSA 1TF0B 1PRBA 2LHGA 1GJTA 2LHCA 2N35A 2JWSA 2FS1A 2MH8A
chains in the Genus database with same CATH superfamily
3B89A 4LF5M 1D0KA 4JXJA 3MHVC 3U61B 1JB0F 3HWSA 3SATA 3UZUA 3FD9A 4AI6A 1VQ1A 2HL7A 2WSCF 4JI8M 1HQCA 2FFJA 4LFBM 2Z4SA 2LHCA 3AL0C 4MGHA 4KLNA 4PDIA 3D8BA 3U60A 4LGYA 2ZBKB 2XFTA 4GMQA 4LF6M 3K1JA 3QWLA 3I04M 3RGPA 3GLIB 4TUWA 5E6JA 4LGMA 4X66M 3OTOM 3LW5F 3GLIA 3K9PA 4DR2M 1QVRA 1G41A 3THGA 4GC5A 4Z6YA 2R65A 5JI3E 4ITQA 1EIJA 2DZLA 1TGUA 2Z8YM 2L7HA 4I4LA 2C98A 2HHHM 3GRYA 5C18A 3U6DA 2WSFF 3KW6A 1IXSB 2KXEA 2ZTCA 1V34A 2DHYA 3HJQA 1IY0A 3AKZA 3E9SA 2EUCA 3KP0E 1VEJA 3UK6A 3U6OA 1DV0A 2FE8A 3K8ZA 4QHSA 2XSZA 3HY5A 4LG2A 2J7OA 2R44A 3BXWA 1LTMA 4JI4M 2F5PA 3DA1A 1L2DA 2LH0A 4B3RM 2BNKA 4LFCM 1NY5A 7CATA 3H4JA 2QENA 1TH3A 4FCTA 4DV0M 1ZMWA 4FW9A 3R9XB 1NV9A 1YUBA 4KODA 1VDDA 3GPXA 4MB7A 2K47A 3FUUA 2JNHA 1QDRA 2QCUA 1YSYA 3L26A 3M7GA 4LJ6A 4CGYB 2JA2A 3ILKA 3AOEA 4I81A 5IREB 1E9SA 3HKPA 2OO9A 1XNRM 3B7ZA 2QZ4A 5EP2A 3J7AS 3U6PA 1PGYA 1PM5A 1LV7A 4A3VB 2LBCA 1MU5A 4DUYM 3SASA 4Y28F 1VDLA 3KXEC 4PCZA 3VK7A 4G4RA 3HHYA 1IM2A 1IN6A 4R3DA 3RE8A 4B08A 4NRVA 4JI6M 1SXJB 1S3SA 1YLAA 3E4RA 1L2BA 5ITXE 2XLJA 2QNJA 2YFQA 3C3EA 3GLGE 2D7EA 3TQSA 3TL4X 4M0DA 4B7HA 1SXJA 3IG8A 5KQDA 4BB9A 3HGIA 1JQJC 3HHXA 3SHFA 5KQ8A 2KRUA 5EJCA 1QZEA 1MX0A 3U6LA 2BWBA 3UGJA 1IN5A 1DO0A 2DAEA 2I7PA 3FTCA 1K82A 3LVWA 4MGKE 3HX3A 2UXCM 1G3IA 3A98B 4M9SA 3SMPA 2RKOA 3SAUA 5FTLA 4FWGA 2VIIA 4IBEA 2C5RA 3NWLA 4MM3B 1J7KA 2LVAA 2RGHA 3SAWA 4LRTA 1KSFX 4L8RC 2DXIA 3A46A 2LVPC 1QAMA 2C9OA 4AKHA 2HKJA 5EP3A 2GNOA 3E21A 2MGWA 5EP4A 5ITXA 1HNXM 2LVQD 5BR8M 4OVZA 4IBFA 1ORYB 3FTDA 2Y21A 4QOZC 2XZUA 4EIWA 2O25A 2JY6B 2M5ZA 4QHTA 4LF8M 3FKEA 1GJTA 1OKSA 4G6ZA 5EXPA 4D82A 2JY7A 1P3QQ 3KS8A 1PJJA 1SXJC 4B3SM 3JR5A 2L6OA 1DGHA 4KHPM 2LXEA 2ZAOA 5EXTA 4DR7M 1F4IA 3W68A 2EO2A 2JWSA 3AOGA 4DV3M 1QANA 2L7IA 3T38A 1TTEA 4DV5M 3L29A 3SBJA 2KW0A 4MGIE 2WZJA 2Y0QA 3GLHE 4DR4M 3FUWA 4PDGA 1QAQA 1VEGA 3IECA 2XGNA 3NBXX 3K92A 3FYDA 4IBGA 3T1YM 3SFZA 4HEOA 1HR0M 3ZH9B 1HQYE 4JV5M 2C99A 1XNQM 1QZMA 2XSZD 3HU2A 1Q02A 1MJGM 1NNJA 3U6MA 1ZQ9A 3QAUA 2LWXA 3TWKA 4GRIA 2KNAA 2XZFA 4IBJA 3Q8GA 4GC9A 3GLGB 5E26A 4QNRA 1SXJE 1WGNA 2KDLA 1IFYA 1IY2A 4ANRA 3GLGA 4M9ZA 1N77A 5EXXA 1K3XA 1WXQA 2QPAA 5FTKA 2OOBA 1TDHA 3SYLA 4PT5A 1WIVA 3VKHA 2KEBA 1PJTA 3GQ4A 1FJGM 4AW4A 4FCVA 2HCBA 4AKGA 1OQYA 3J7BA 4JI7M 2LVNC 4IBIA 1NO1A 1FNNA 1W5TA 4UN2B 2ZANA 3W67A 1BVSA 1QQWA 2DAKA 2LTUA 2RGOA 5EP1A 5ITRA 3GO8A 4D81A 2C9CA 2H1RA 5ITUA 4FD2A 3TWLA 4IBBA 1VEKA 1N34M 2DAGA 3IHPA 5L8RF 5DYIA 2H5XA 4FWHA 3C3DA 3B74A 1V92A 3KOYE 4D80A 4LZZA 4IBCA 2Z4RA 2R62A 2XFSA 1KYIA 1SXJD 3W0FA 3GPUA 4L4UA 1NJFA 3CF0A 1HT1E 1IQPA 2X49A 3FUXA 4L78A 3B9PA 1QAOA 3KS4A 2DKLA 1XMOM 1NHGC 3A45A 3CF2A 3FRIA 2QP9X 1OTRA 2RRUA 1Q39A 2JY5A 2X4AA 1WJ7A 3FUVA 3BBZA 1UFZA 3M0EA 4MGYE 2B3TA 1NSFA 2R0IA 1JR3E 3NBIA 5IWAM 1IBKM 1L8QA 2QHOB 4GIPA 4WURA 4P17A 1EFUB 4OVZB 3HU3A 4S12A 2EA0A 1Z6TA 1N75A 3CTWB 3FE3A 1XC8A 3WHLA 2CFOA 3RFWA 1XXHB 4LF9M 3JR4A 1ZV1A 3GPPA 2R6FA 5FTMA 4NRWA 3KP1E 4QNMA 1R7RA 4B3TM 1N33M 2FS1A 4B7GA 1XXHA 2O5RA 3KVWA 2CP8A 1CUKA 1R5LA 1SG9A 3HZJA 3U6CA 2EJSA 2VDBB 4NXMM 4LJ9A 3IG5A 2UUBM 2APLA 2BJWA 4NSOB 3AV0A 3GRRA 3GLIE 3GLHB 3Q8XA 1Z5BA 4WW0A 2OPFA 3F92A 3FYCA 2OOAA 1OFHA 2A5YB 1E32A 2HWJA 2N35A 4LJAA 4OX9M 5KO3A 1XHBA 2KNVA 4XGIA 3LQQA 1XMQM 1XXHE 2R46A 4NXNM 3U60B 1IY1A 2L4EA 2VQFM 2LNHC 3HU1A 2BJVA 2X8AA 4IBKA 2R4EA 1C7YA 2QBYB 2FOIC 1IN7A 5IZ7D 3I51A 3KOXE 3L25A 2CUZA 1OAOC 4JI3M 4OU7A 3FTEA 2V1UA 2F5SA 1G71A 3LCUA 3KFUG 3DFZA 3BOSA 1TH2A 4DV1M 2KHHA 3KOZE 5ITTA 2ZAMA 1I4WA 1GABA 2R4JA 2XH9A 1A5TA 1HJPA 1R2YA 2UXBM 2Q2EB 3ZC7B 1GVNA 2ZTDA 3B7NA 2CRUA 4HL4A 2EKKA 3GLHA 3SHGB 3T15A 3UMMA 1K3WA 1HNZM 1GL6A 2JY8A 2Z7JA 4NSRA 4FCWA 4NL4H 2UUAM 1DGHB 4FVMA 1WGLA 5JI2E 4LFAM 3VLFB 3TWMA 1WHCA 2JP7A 3DOAA 4GH9A 5EQTA 1DGBA 3TPZA 2CEAA 2QSFX 1NNUC 4KO8A 3C9PA 2CHQA 1NY6A 4IBDA 1Y8GA 4DV2M 4L15A 5IT9S 3ZCBB 2VF7A 5KPZA 4DUZM 5KPTA 3V76A 2F5OA 1GO5A 3CF6E 4GEWA 2G5GX 2D7HA 3RGSA 1AIPC 5FSWA 4L6V6 3FUTA 1W5SA 1XWIA 4LJ4A 4WP2A 3KDSE 1D2NA 1T3TA 3WHKA 3EIHA 3K9OA 4Z8XA 1HT2E 1OIZA 4DR3M 3PNYA 3QYBA 1N78A 1Q3CA 4MH0E 1IXZA 3J80S 2DENA 2MJ5B 4G4OA 5FLXS 1GLNA 2BWEA 2DHRA 5FTNA 3GRUA 5F3WA 5ITYA 3SMSA 3W0LB 2LVOC 4JI2M 5EXSA 4RF0A 4QOSA 1TH4A 5C1BA 2XEPA 2GQFA 5DFLA 4R7GA 2J7NA 1PJSA 2G8LA 1J5EM 4X64M 1G59A 2CV1A 8CATA 2YNMD 3R8FA 3GP1A 1R2ZA 4CIZA 4CHTB 2UUCM 3I4VA 4F2LA 4LF4M 1EE8A 1JR3D 1QDTA 4RKUF 4W5WA 1DGGA 3C58A 3PNVA 1TF0B 3QYEA 1IN4A 4L16A 4JI0M 3PXGA 3LMMA 3MJ5A 1N36M 2F5QA 2M60A 4FWDA 3T6PA 1T6OA 2CV0A 3KOWE 1HNWM 5DYGA 3U6QA 4MGZE 3AJIB 4NC6A 4REZA 2I7NA 2MROB 4BBAA 4XBOA 2QBYA 4JI5M 1PJQA 3GQ3A 2CV2A 3U6EA 3LQRA 4LJ7A 3U6SA 1NJGA 3ZQJA 2UXDM 2KZUA 4YHHM 4II7A 3VK8A 3VDPA 4K0KM 2DVWB 4M9XA 4X65M 5LMNM 1IBLM 4I5SA 4XK8F 4DV4M 1UM8A 3FRHA 3MMPA 5GKNA 3A42A 2Z3XA 1ZAEA 4RF1A 2O01F 3VFDA 1DGFA 1GKIA 4BLCA 4AG5A 4HLQA 1IXSA 1R6BX 2DI0A 2DNAA 2DWZB 1KFVA 3SARA 2JUJA 1C1KA 3K2LA 2XF3A 4IIWA 2G3QA 4LCBA 2L4FA 4JI1M 4LZJA 4I8OA 2KNZA 1ZMUA 2Y20A 4AZFA 5LMUM 1OFIA 5FTJA 2V1CA 2MH8A 2R18A 1GL7A 3JAMS 2DZOB 2ERCA 3PFIA 1MN3A 3GPYA 2D7GA 4B7FA 4IJFA 1QUSA 2UU9M 5KPRA 4GHLA 1D0LA 2JZ1A 2KA6B 3L28A 2YQZA 3H4MA 4DR6M 2CWBA 1D0MA 4F1IA 4Q7JA 3L2AA 1G8PA 4R71A 1YE9A 3HJSA 1IN8A 2KRKA 3UJNA 4DR1M 1I94M 2L2DA 3KSJA 4X62M 1VG5A 1Z5CA 4G3OA 3EIEA 3M6AA 2F4VM 3E46A 1GJSA 2FH0A 2K6BA 2CHGA 4G4QA 2CE7A 3SYKA 2VF8A 1Z5AA 3L27A 2DZNB 2JZ0A 4LRSA 1NHWC 2ZM6M 1IBMM 4DBGB 2HAKA 2AHMA 2WSEF 4DV7M 2P5TA 1N32M 3J2PB 5BPVA 5A2QS 1E94E 3LVVA 3VDUA 2DWNA 1L2CA 3J81S 1Q3BA 4LJ8A 1H6UA 1NV8A 1ZMVA 4CJ6A 1V33A 3GLFE 1T43A 1TDZA 3D8LA 1WR1B 2L09A 2V6ZM 1AUAA 1J09A 3MK6A 5ITQA 3U5ZA 2J5YA 2NQ8C 4GKJM 4KT0F 3SAVA 2K0BX 5DNYA 4GKKM 2K9DA 3B7QA 3U5ZB 3HHWA 4ZPXA 5H37D 3J27B 2DAMA 2CHVA 4YY3M 1IXRC 1L1ZA 3FTFA 1L1TA 3GLFA 2Y0TA 1PJIA 3U61A 1OAIA 2DWMA 4DR5M 2KZSA 3PVSA 1QUTA 3GLFB 2LHGA 4G4NA 3AOEC 1JR3A 2C96A 3HJ8A 2VQEM 2JXNA 3GRVA 2DWLA 2E5LM 3I01M 1XB2B 1OJLA 2FNAA 4JN6A 4PD2A 1PRBA 4GITA 1E9RA 1G4AE 3I4YA 3T1HM 4DV6M 2YR0A 4M0WA 2QQ8A 3SC3A 4AKIA 4RNAA 4LY6A 1NVMA 3GQ5A 4LF7M 4P16A 4AG6A 2W82A 2EKFA 3LCVB 4IJEA 1OIPA 4OW0A 4AQYM 2DAIA 2F5NA 2MR9A 3VKGA 1Z59A 4CISA 1R4GA 3HHZA 1QYRA 4NOOB 1DO2A 4B3MM 2R45A 3CGWA 4LJ5A 3KSXA 3AFHA 1RU3A 3DZDA 1X37A 4GHAA 4JYAM 3TE6A 1TR8A 2OQ4A
chains in the Genus database with same CATH topology
2VDBB 2J5YA 1GABA 2KDLA 1GJSA 1TF0B 1PRBA 2LHGA 1GJTA 2LHCA 2N35A 2JWSA 2FS1A 2MH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDB B;  2J5Y A;  1GAB A;  2KDL A;  1GJS A;  1TF0 B;  1PRB A;  2LHG A;  1GJT A;  2LHC A;  2N35 A;  2JWS A;  2FS1 A;  2MH8 A; 
#chains in the Genus database with same CATH topology
 3B89 A;  4LF5 M;  1D0K A;  4JXJ A;  3MHV C;  3U61 B;  1JB0 F;  3HWS A;  3SAT A;  3UZU A;  3FD9 A;  4AI6 A;  1VQ1 A;  2HL7 A;  2WSC F;  4JI8 M;  1HQC A;  2FFJ A;  4LFB M;  2Z4S A;  2LHC A;  3AL0 C;  4MGH A;  4KLN A;  4PDI A;  3D8B A;  3U60 A;  4LGY A;  2ZBK B;  2XFT A;  4GMQ A;  4LF6 M;  3K1J A;  3QWL A;  3I04 M;  3RGP A;  3GLI B;  4TUW A;  5E6J A;  4LGM A;  4X66 M;  3OTO M;  3LW5 F;  3GLI A;  3K9P A;  4DR2 M;  1QVR A;  1G41 A;  3THG A;  4GC5 A;  4Z6Y A;  2R65 A;  5JI3 E;  4ITQ A;  1EIJ A;  2DZL A;  1TGU A;  2Z8Y M;  2L7H A;  4I4L A;  2C98 A;  2HHH M;  3GRY A;  5C18 A;  3U6D A;  2WSF F;  3KW6 A;  1IXS B;  2KXE A;  2ZTC A;  1V34 A;  2DHY A;  3HJQ A;  1IY0 A;  3AKZ A;  3E9S A;  2EUC A;  3KP0 E;  1VEJ A;  3UK6 A;  3U6O A;  1DV0 A;  2FE8 A;  3K8Z A;  4QHS A;  2XSZ A;  3HY5 A;  4LG2 A;  2J7O A;  2R44 A;  3BXW A;  1LTM A;  4JI4 M;  2F5P A;  3DA1 A;  1L2D A;  2LH0 A;  4B3R M;  2BNK A;  4LFC M;  1NY5 A;  7CAT A;  3H4J A;  2QEN A;  1TH3 A;  4FCT A;  4DV0 M;  1ZMW A;  4FW9 A;  3R9X B;  1NV9 A;  1YUB A;  4KOD A;  1VDD A;  3GPX A;  4MB7 A;  2K47 A;  3FUU A;  2JNH A;  1QDR A;  2QCU A;  1YSY A;  3L26 A;  3M7G A;  4LJ6 A;  4CGY B;  2JA2 A;  3ILK A;  3AOE A;  4I81 A;  5IRE B;  1E9S A;  3HKP A;  2OO9 A;  1XNR M;  3B7Z A;  2QZ4 A;  5EP2 A;  3J7A S;  3U6P A;  1PGY A;  1PM5 A;  1LV7 A;  4A3V B;  2LBC A;  1MU5 A;  4DUY M;  3SAS A;  4Y28 F;  1VDL A;  3KXE C;  4PCZ A;  3VK7 A;  4G4R A;  3HHY A;  1IM2 A;  1IN6 A;  4R3D A;  3RE8 A;  4B08 A;  4NRV A;  4JI6 M;  1SXJ B;  1S3S A;  1YLA A;  3E4R A;  1L2B A;  5ITX E;  2XLJ A;  2QNJ A;  2YFQ A;  3C3E A;  3GLG E;  2D7E A;  3TQS A;  3TL4 X;  4M0D A;  4B7H A;  1SXJ A;  3IG8 A;  5KQD A;  4BB9 A;  3HGI A;  1JQJ C;  3HHX A;  3SHF A;  5KQ8 A;  2KRU A;  5EJC A;  1QZE A;  1MX0 A;  3U6L A;  2BWB A;  3UGJ A;  1IN5 A;  1DO0 A;  2DAE A;  2I7P A;  3FTC A;  1K82 A;  3LVW A;  4MGK E;  3HX3 A;  2UXC M;  1G3I A;  3A98 B;  4M9S A;  3SMP A;  2RKO A;  3SAU A;  5FTL A;  4FWG A;  2VII A;  4IBE A;  2C5R A;  3NWL A;  4MM3 B;  1J7K A;  2LVA A;  2RGH A;  3SAW A;  4LRT A;  1KSF X;  4L8R C;  2DXI A;  3A46 A;  2LVP C;  1QAM A;  2C9O A;  4AKH A;  2HKJ A;  5EP3 A;  2GNO A;  3E21 A;  2MGW A;  5EP4 A;  5ITX A;  1HNX M;  2LVQ D;  5BR8 M;  4OVZ A;  4IBF A;  1ORY B;  3FTD A;  2Y21 A;  4QOZ C;  2XZU A;  4EIW A;  2O25 A;  2JY6 B;  2M5Z A;  4QHT A;  4LF8 M;  3FKE A;  1GJT A;  1OKS A;  4G6Z A;  5EXP A;  4D82 A;  2JY7 A;  1P3Q Q;  3KS8 A;  1PJJ A;  1SXJ C;  4B3S M;  3JR5 A;  2L6O A;  1DGH A;  4KHP M;  2LXE A;  2ZAO A;  5EXT A;  4DR7 M;  1F4I A;  3W68 A;  2EO2 A;  2JWS A;  3AOG A;  4DV3 M;  1QAN A;  2L7I A;  3T38 A;  1TTE A;  4DV5 M;  3L29 A;  3SBJ A;  2KW0 A;  4MGI E;  2WZJ A;  2Y0Q A;  3GLH E;  4DR4 M;  3FUW A;  4PDG A;  1QAQ A;  1VEG A;  3IEC A;  2XGN A;  3NBX X;  3K92 A;  3FYD A;  4IBG A;  3T1Y M;  3SFZ A;  4HEO A;  1HR0 M;  3ZH9 B;  1HQY E;  4JV5 M;  2C99 A;  1XNQ M;  1QZM A;  2XSZ D;  3HU2 A;  1Q02 A;  1MJG M;  1NNJ A;  3U6M A;  1ZQ9 A;  3QAU A;  2LWX A;  3TWK A;  4GRI A;  2KNA A;  2XZF A;  4IBJ A;  3Q8G A;  4GC9 A;  3GLG B;  5E26 A;  4QNR A;  1SXJ E;  1WGN A;  2KDL A;  1IFY A;  1IY2 A;  4ANR A;  3GLG A;  4M9Z A;  1N77 A;  5EXX A;  1K3X A;  1WXQ A;  2QPA A;  5FTK A;  2OOB A;  1TDH A;  3SYL A;  4PT5 A;  1WIV A;  3VKH A;  2KEB A;  1PJT A;  3GQ4 A;  1FJG M;  4AW4 A;  4FCV A;  2HCB A;  4AKG A;  1OQY A;  3J7B A;  4JI7 M;  2LVN C;  4IBI A;  1NO1 A;  1FNN A;  1W5T A;  4UN2 B;  2ZAN A;  3W67 A;  1BVS A;  1QQW A;  2DAK A;  2LTU A;  2RGO A;  5EP1 A;  5ITR A;  3GO8 A;  4D81 A;  2C9C A;  2H1R A;  5ITU A;  4FD2 A;  3TWL A;  4IBB A;  1VEK A;  1N34 M;  2DAG A;  3IHP A;  5L8R F;  5DYI A;  2H5X A;  4FWH A;  3C3D A;  3B74 A;  1V92 A;  3KOY E;  4D80 A;  4LZZ A;  4IBC A;  2Z4R A;  2R62 A;  2XFS A;  1KYI A;  1SXJ D;  3W0F A;  3GPU A;  4L4U A;  1NJF A;  3CF0 A;  1HT1 E;  1IQP A;  2X49 A;  3FUX A;  4L78 A;  3B9P A;  1QAO A;  3KS4 A;  2DKL A;  1XMO M;  1NHG C;  3A45 A;  3CF2 A;  3FRI A;  2QP9 X;  1OTR A;  2RRU A;  1Q39 A;  2JY5 A;  2X4A A;  1WJ7 A;  3FUV A;  3BBZ A;  1UFZ A;  3M0E A;  4MGY E;  2B3T A;  1NSF A;  2R0I A;  1JR3 E;  3NBI A;  5IWA M;  1IBK M;  1L8Q A;  2QHO B;  4GIP A;  4WUR A;  4P17 A;  1EFU B;  4OVZ B;  3HU3 A;  4S12 A;  2EA0 A;  1Z6T A;  1N75 A;  3CTW B;  3FE3 A;  1XC8 A;  3WHL A;  2CFO A;  3RFW A;  1XXH B;  4LF9 M;  3JR4 A;  1ZV1 A;  3GPP A;  2R6F A;  5FTM A;  4NRW A;  3KP1 E;  4QNM A;  1R7R A;  4B3T M;  1N33 M;  2FS1 A;  4B7G A;  1XXH A;  2O5R A;  3KVW A;  2CP8 A;  1CUK A;  1R5L A;  1SG9 A;  3HZJ A;  3U6C A;  2EJS A;  2VDB B;  4NXM M;  4LJ9 A;  3IG5 A;  2UUB M;  2APL A;  2BJW A;  4NSO B;  3AV0 A;  3GRR A;  3GLI E;  3GLH B;  3Q8X A;  1Z5B A;  4WW0 A;  2OPF A;  3F92 A;  3FYC A;  2OOA A;  1OFH A;  2A5Y B;  1E32 A;  2HWJ A;  2N35 A;  4LJA A;  4OX9 M;  5KO3 A;  1XHB A;  2KNV A;  4XGI A;  3LQQ A;  1XMQ M;  1XXH E;  2R46 A;  4NXN M;  3U60 B;  1IY1 A;  2L4E A;  2VQF M;  2LNH C;  3HU1 A;  2BJV A;  2X8A A;  4IBK A;  2R4E A;  1C7Y A;  2QBY B;  2FOI C;  1IN7 A;  5IZ7 D;  3I51 A;  3KOX E;  3L25 A;  2CUZ A;  1OAO C;  4JI3 M;  4OU7 A;  3FTE A;  2V1U A;  2F5S A;  1G71 A;  3LCU A;  3KFU G;  3DFZ A;  3BOS A;  1TH2 A;  4DV1 M;  2KHH A;  3KOZ E;  5ITT A;  2ZAM A;  1I4W A;  1GAB A;  2R4J A;  2XH9 A;  1A5T A;  1HJP A;  1R2Y A;  2UXB M;  2Q2E B;  3ZC7 B;  1GVN A;  2ZTD A;  3B7N A;  2CRU A;  4HL4 A;  2EKK A;  3GLH A;  3SHG B;  3T15 A;  3UMM A;  1K3W A;  1HNZ M;  1GL6 A;  2JY8 A;  2Z7J A;  4NSR A;  4FCW A;  4NL4 H;  2UUA M;  1DGH B;  4FVM A;  1WGL A;  5JI2 E;  4LFA M;  3VLF B;  3TWM A;  1WHC A;  2JP7 A;  3DOA A;  4GH9 A;  5EQT A;  1DGB A;  3TPZ A;  2CEA A;  2QSF X;  1NNU C;  4KO8 A;  3C9P A;  2CHQ A;  1NY6 A;  4IBD A;  1Y8G A;  4DV2 M;  4L15 A;  5IT9 S;  3ZCB B;  2VF7 A;  5KPZ A;  4DUZ M;  5KPT A;  3V76 A;  2F5O A;  1GO5 A;  3CF6 E;  4GEW A;  2G5G X;  2D7H A;  3RGS A;  1AIP C;  5FSW A;  4L6V 6;  3FUT A;  1W5S A;  1XWI A;  4LJ4 A;  4WP2 A;  3KDS E;  1D2N A;  1T3T A;  3WHK A;  3EIH A;  3K9O A;  4Z8X A;  1HT2 E;  1OIZ A;  4DR3 M;  3PNY A;  3QYB A;  1N78 A;  1Q3C A;  4MH0 E;  1IXZ A;  3J80 S;  2DEN A;  2MJ5 B;  4G4O A;  5FLX S;  1GLN A;  2BWE A;  2DHR A;  5FTN A;  3GRU A;  5F3W A;  5ITY A;  3SMS A;  3W0L B;  2LVO C;  4JI2 M;  5EXS A;  4RF0 A;  4QOS A;  1TH4 A;  5C1B A;  2XEP A;  2GQF A;  5DFL A;  4R7G A;  2J7N A;  1PJS A;  2G8L A;  1J5E M;  4X64 M;  1G59 A;  2CV1 A;  8CAT A;  2YNM D;  3R8F A;  3GP1 A;  1R2Z A;  4CIZ A;  4CHT B;  2UUC M;  3I4V A;  4F2L A;  4LF4 M;  1EE8 A;  1JR3 D;  1QDT A;  4RKU F;  4W5W A;  1DGG A;  3C58 A;  3PNV A;  1TF0 B;  3QYE A;  1IN4 A;  4L16 A;  4JI0 M;  3PXG A;  3LMM A;  3MJ5 A;  1N36 M;  2F5Q A;  2M60 A;  4FWD A;  3T6P A;  1T6O A;  2CV0 A;  3KOW E;  1HNW M;  5DYG A;  3U6Q A;  4MGZ E;  3AJI B;  4NC6 A;  4REZ A;  2I7N A;  2MRO B;  4BBA A;  4XBO A;  2QBY A;  4JI5 M;  1PJQ A;  3GQ3 A;  2CV2 A;  3U6E A;  3LQR A;  4LJ7 A;  3U6S A;  1NJG A;  3ZQJ A;  2UXD M;  2KZU A;  4YHH M;  4II7 A;  3VK8 A;  3VDP A;  4K0K M;  2DVW B;  4M9X A;  4X65 M;  5LMN M;  1IBL M;  4I5S A;  4XK8 F;  4DV4 M;  1UM8 A;  3FRH A;  3MMP A;  5GKN A;  3A42 A;  2Z3X A;  1ZAE A;  4RF1 A;  2O01 F;  3VFD A;  1DGF A;  1GKI A;  4BLC A;  4AG5 A;  4HLQ A;  1IXS A;  1R6B X;  2DI0 A;  2DNA A;  2DWZ B;  1KFV A;  3SAR A;  2JUJ A;  1C1K A;  3K2L A;  2XF3 A;  4IIW A;  2G3Q A;  4LCB A;  2L4F A;  4JI1 M;  4LZJ A;  4I8O A;  2KNZ A;  1ZMU A;  2Y20 A;  4AZF A;  5LMU M;  1OFI A;  5FTJ A;  2V1C A;  2MH8 A;  2R18 A;  1GL7 A;  3JAM S;  2DZO B;  2ERC A;  3PFI A;  1MN3 A;  3GPY A;  2D7G A;  4B7F A;  4IJF A;  1QUS A;  2UU9 M;  5KPR A;  4GHL A;  1D0L A;  2JZ1 A;  2KA6 B;  3L28 A;  2YQZ A;  3H4M A;  4DR6 M;  2CWB A;  1D0M A;  4F1I A;  4Q7J A;  3L2A A;  1G8P A;  4R71 A;  1YE9 A;  3HJS A;  1IN8 A;  2KRK A;  3UJN A;  4DR1 M;  1I94 M;  2L2D A;  3KSJ A;  4X62 M;  1VG5 A;  1Z5C A;  4G3O A;  3EIE A;  3M6A A;  2F4V M;  3E46 A;  1GJS A;  2FH0 A;  2K6B A;  2CHG A;  4G4Q A;  2CE7 A;  3SYK A;  2VF8 A;  1Z5A A;  3L27 A;  2DZN B;  2JZ0 A;  4LRS A;  1NHW C;  2ZM6 M;  1IBM M;  4DBG B;  2HAK A;  2AHM A;  2WSE F;  4DV7 M;  2P5T A;  1N32 M;  3J2P B;  5BPV A;  5A2Q S;  1E94 E;  3LVV A;  3VDU A;  2DWN A;  1L2C A;  3J81 S;  1Q3B A;  4LJ8 A;  1H6U A;  1NV8 A;  1ZMV A;  4CJ6 A;  1V33 A;  3GLF E;  1T43 A;  1TDZ A;  3D8L A;  1WR1 B;  2L09 A;  2V6Z M;  1AUA A;  1J09 A;  3MK6 A;  5ITQ A;  3U5Z A;  2J5Y A;  2NQ8 C;  4GKJ M;  4KT0 F;  3SAV A;  2K0B X;  5DNY A;  4GKK M;  2K9D A;  3B7Q A;  3U5Z B;  3HHW A;  4ZPX A;  5H37 D;  3J27 B;  2DAM A;  2CHV A;  4YY3 M;  1IXR C;  1L1Z A;  3FTF A;  1L1T A;  3GLF A;  2Y0T A;  1PJI A;  3U61 A;  1OAI A;  2DWM A;  4DR5 M;  2KZS A;  3PVS A;  1QUT A;  3GLF B;  2LHG A;  4G4N A;  3AOE C;  1JR3 A;  2C96 A;  3HJ8 A;  2VQE M;  2JXN A;  3GRV A;  2DWL A;  2E5L M;  3I01 M;  1XB2 B;  1OJL A;  2FNA A;  4JN6 A;  4PD2 A;  1PRB A;  4GIT A;  1E9R A;  1G4A E;  3I4Y A;  3T1H M;  4DV6 M;  2YR0 A;  4M0W A;  2QQ8 A;  3SC3 A;  4AKI A;  4RNA A;  4LY6 A;  1NVM A;  3GQ5 A;  4LF7 M;  4P16 A;  4AG6 A;  2W82 A;  2EKF A;  3LCV B;  4IJE A;  1OIP A;  4OW0 A;  4AQY M;  2DAI A;  2F5N A;  2MR9 A;  3VKG A;  1Z59 A;  4CIS A;  1R4G A;  3HHZ A;  1QYR A;  4NOO B;  1DO2 A;  4B3M M;  2R45 A;  3CGW A;  4LJ5 A;  3KSX A;  3AFH A;  1RU3 A;  3DZD A;  1X37 A;  4GHA A;  4JYA M;  3TE6 A;  1TR8 A;  2OQ4 A; 
#chains in the Genus database with same CATH homology
 2VDB B;  2J5Y A;  1GAB A;  2KDL A;  1GJS A;  1TF0 B;  1PRB A;  2LHG A;  1GJT A;  2LHC A;  2N35 A;  2JWS A;  2FS1 A;  2MH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...