2VDBB

Structure of human serum albumin with s-naproxen and the ga module
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
55
structure length
55
Chain Sequence
b'HMTIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERUM ALBUMIN
molecule tags Protein binding
source organism Peptostreptococcus magnus
publication title Structural Basis for the Binding of Naproxen to Human Serum Albumin in the Presence of Fatty Acids and the Ga Module.
pubmed doi rcsb
total genus 21
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2vdbB00
2MH8A 1PRBA 1GABA 2FS1A 1GJTA 2JWSA 1GJSA 2J5YA 2KDLA 1TF0B 2VDBB 2LHCA 2LHGA 2N35A
chains in the Genus database with same CATH superfamily
3GRUA 1PJTA 2GNOA 2V1CA 2J5YA 1E32A 3U5ZB 2UUCM 1QZEA 1IFYA 2LNHC 2H1RA 3GRRA 4GHAA 5FTMA 3GRVA 3FUXA 4YY3M 1TTEA 3LCUA 4Z6YA 2Z3XA 2LBCA 2F5OA 4LFBM 4F2LA 2ZM6M 3PNVA 5GKNA 5IZ7D 1NY6A 1IY2A 2FOIC 3GLFA 3ILKA 3J80S 2XZFA 2D7GA 3U6MA 1T3TA 1GO5A 2XZUA 3B7ZA 1XMOM 3GLGE 2QBYB 2DKLA 2I7NA 1G3IA 3FUUA 1V92A 2DZNB 5EXTA 1N33M 1QDTA 2C9OA 4LF8M 3JAMS 2CRUA 3ZC7B 4B7FA 3HGIA 3RGPA 3GQ5A 1YLAA 3KDSE 1TR8A 2Y21A 3U5ZA 3PNYA 5KPZA 2F5SA 3SMSA 2LHCA 5E26A 3SYKA 1DV0A 2CWBA 4G3OA 2L7HA 2EUCA 1Z5BA 3D8BA 2R0IA 4HLQA 2OO9A 8CATA 2WSCF 4I81A 4DV3M 2OOBA 4AQYM 2FE8A 4IBIA 3J81S 3HZJA 3U6OA 1N78A 1IN5A 3WHLA 1ZMVA 4LZJA 3UGJA 2J7NA 3VLFB 2ZAMA 2CFOA 4MGYE 4CJ6A 1NHWC 3HJSA 2EA0A 4NRVA 4YHHM 4IJFA 1Z5AA 2QZ4A 1MN3A 1C1KA 2XLJA 1G59A 2DWLA 4IBDA 2RGOA 2P5TA 3W67A 2HL7A 1N75A 2QSFX 3TL4X 4FW9A 2K9DA 3L26A 1QUTA 3MK6A 4W5WA 1WXQA 4KHPM 3B9PA 1PJIA 4MH0E 1HNXM 4DR4M 1OKSA 3GLHA 3F92A 3GLIE 1ZAEA 1Y8GA 4LFAM 4P17A 2JXNA 4LGMA 5FTLA 1QAQA 3TWKA 3FYDA 2APLA 3R8FA 2UUAM 1XB2B 2C98A 2DWNA 5ITUA 2VDBB 1QYRA 4FWGA 3B89A 1SXJA 3HJQA 3UJNA 1OQYA 5EP4A 1R4GA 5ITXA 3TWMA 3SAWA 3AKZA 1QQWA 3UZUA 4LJ8A 2UXBM 1L1ZA 3FE3A 4GC9A 4JV5M 5EP2A 5FSWA 5BR8M 5FLXS 4REZA 3CF2A 2RGHA 1R5LA 3GP1A 1JR3E 1DGHB 4LJAA 1IBMM 2ZAOA 3GPPA 1MJGM 2XFTA 3HHXA 5H37D 1WIVA 1XC8A 1L1TA 2DXIA 1DGBA 1NSFA 1Z6TA 2MGWA 4DR5M 1SXJC 3A46A 4B3MM 1PJSA 1UM8A 4RF0A 4LFCM 2ZANA 4G4RA 2UXDM 3GLHE 3GLIA 5EJCA 4K0KM 1V33A 1VDLA 3MMPA 3HHYA 2VF8A 2R45A 4LRTA 4QNRA 1PJJA 1GABA 1CUKA 4MGHA 5ITXE 4M0WA 5E6JA 2JUJA 3W0FA 1L2CA 3PVSA 4LJ6A 4L15A 1JR3D 2DAMA 2VQEM 2M5ZA 3EIEA 1N34M 2Y20A 3PFIA 3I4VA 3IG8A 2MJ5B 3M7GA 1IQPA 4BB9A 3JR4A 2NQ8C 2EO2A 3VFDA 1OFIA 1WGNA 1FJGM 2MROB 2R4JA 1Z59A 1I94M 2X49A 3UK6A 2R46A 2L2DA 1R2ZA 2CHGA 4GKKM 2CE7A 4FCWA 2XGNA 4FCVA 3GPYA 3GPUA 4LF6M 4JI6M 1IN7A 1E9SA 5IT9S 3I01M 4GMQA 4Q7JA 3A45A 1KSFX 2QPAA 1XXHA 1XNQM 3U60A 3FTDA 2R65A 3DZDA 3J2PB 1XWIA 2KDLA 3FRHA 3BXWA 2EKKA 2KNVA 7CATA 3Q8GA 5KPRA 2DVWB 5DFLA 3CF0A 1VDDA 2KZSA 4LGYA 1NNJA 2WSFF 3I04M 1HJPA 2LHGA 2BJVA 4NRWA 3HU2A 1JR3A 4DR2M 2X8AA 4CGYB 2YR0A 1W5SA 2LVNC 3U6PA 3HWSA 3AFHA 1K3XA 1T43A 3FUTA 4I4LA 2BWBA 1NVMA 3KSJA 4DV5M 2JP7A 1QVRA 3LW5F 2C96A 1IM2A 2QNJA 2JZ1A 3CTWB 3VK7A 1P3QQ 2KNZA 3B7NA 3GLFB 2L6OA 1QANA 4M9SA 2HHHM 3KOYE 2L4FA 3KXEC 2Z7JA 4RF1A 1PRBA 2K0BX 3U61B 2KXEA 4PDGA 1SXJD 4NXMM 3R9XB 2Z4SA 1K82A 1IN8A 2CHQA 3FUVA 5DYIA 3NBXX 4G4NA 4OX9M 1R7RA 3SAUA 1OJLA 4JYAM 2FS1A 2ERCA 1GLNA 3L2AA 4XK8F 3KW6A 3U6LA 1HT2E 2CEAA 1NY5A 2HKJA 2VQFM 2RRUA 4X64M 2XEPA 1HT1E 4HL4A 1T6OA 4IBCA 3TWLA 1QAMA 4JI2M 1QAOA 4WP2A 4JI3M 2FFJA 2Y0QA 2QCUA 4B7HA 4DUZM 4IIWA 3GO8A 2L4EA 2FNAA 2Z4RA 2UXCM 3NWLA 3K2LA 3GLHB 3V76A 3SHGB 3C3EA 2HAKA 3KFUG 1V34A 5EXSA 1D0LA 4ANRA 3L25A 1Q3CA 1RU3A 2CHVA 2HWJA 1PM5A 1N36M 4MM3B 2OPFA 4LF5M 3DA1A 1D0KA 4TUWA 3M0EA 1HQCA 1Q02A 3U6CA 4L8RC 3QAUA 3MJ5A 3SMPA 1H6UA 1NJFA 2JZ0A 4AW4A 4DV0M 3M6AA 4GC5A 3SBJA 4DR7M 2OOAA 3U6DA 1WR1B 3FRIA 3VK8A 4AG6A 1VG5A 1ZMUA 3B74A 3HHWA 5LMNM 3U6QA 3TQSA 2LWXA 1XNRM 3FUWA 2HCBA 3UMMA 2FH0A 1DO0A 1E94E 3GLGA 1NV8A 4IBEA 2G8LA 2X4AA 1G4AE 1OIZA 3FTFA 2KA6B 4CHTB 4LJ5A 4M9XA 4QOSA 2DNAA 2K6BA 1IXSA 3KSXA 4JI7M 1TDZA 4MB7A 3T1YM 3A42A 4AKGA 5JI3E 1PGYA 4FWHA 1JQJC 3L28A 4D80A 2C99A 1XXHE 4R71A 3TPZA 5A2QS 4GITA 5C1BA 1IY0A 2BJWA 5LMUM 1F4IA 4R7GA 2JWSA 4OW0A 3AL0C 4LF4M 1NNUC 1L8QA 2DAKA 1Q3BA 1XHBA 3K1JA 3LQRA 2L7IA 3AOGA 3SYLA 2UU9M 1KYIA 4JI1M 2R4EA 4KLNA 4AKHA 2O25A 4Y28F 4G6ZA 3GLFE 1WGLA 2AHMA 2DAIA 3THGA 4FD2A 4LF7M 1WJ7A 5ITYA 4FWDA 3U6SA 5DYGA 4AKIA 4GIPA 4JI0M 3SARA 4B3TM 3KP0E 4IBGA 4OVZA 2JA2A 4D81A 3H4MA 4WURA 4DR1M 1L2BA 2XF3A 4LJ9A 4CISA 4AI6A 1MU5A 1DO2A 4IBKA 3KOXE 4JI4M 4CIZA 2BWEA 3SHFA 1TGUA 2XH9A 2F5PA 3DFZA 1NV9A 4RNAA 4X65M 1R6BX 5IREB 1QZMA 3RGSA 2EKFA 2QP9X 2YFQA 3JR5A 3HY5A 1IXRC 4L16A 1EE8A 1GL6A 4LZZA 5EP3A 3K8ZA 4KO8A 3L27A 3D8LA 4G4QA 3TE6A 3VKHA 1OIPA 2LVPC 1GL7A 2R62A 2VF7A 4IJEA 3AV0A 4L78A 4GHLA 1W5TA 2LTUA 3KOWE 4GH9A 4XBOA 2MR9A 5C18A 3EIHA 3FKEA 2DI0A 3KOZE 2WZJA 3AOEA 5ITRA 3K9OA 4MGIE 4A3VB 2R44A 2DZLA 2JY6B 1TH4A 2KEBA 2QHOB 4BBAA 4DV1M 2Y0TA 2KRKA 1I4WA 2I7PA 4GEWA 4JI5M 3T1HM 3HU3A 1JB0F 2UUBM 2VIIA 3U6EA 1YE9A 1GKIA 1Z5CA 4B3SM 1NHGC 5EXXA 2QBYA 4PDIA 3E9SA 5EXPA 1NO1A 5KQDA 3FTEA 1G41A 3C3DA 3RE8A 4KODA 5KO3A 1QDRA 1E9RA 4PD2A 2O5RA 4B3RM 5EQTA 2KHHA 4EIWA 2E5LM 3HHZA 1G8PA 2KW0A 1D2NA 2G5GX 1IY1A 1GJTA 2CP8A 2R18A 4ITQA 4LG2A 2C9CA 4NXNM 2CUZA 3SC3A 2CV2A 4LF9M 1XXHB 3J7AS 5BPVA 3H4JA 4I5SA 3QYEA 4D82A 2OQ4A 5F3WA 4JN6A 4OVZB 1PJQA 1TDHA 1SXJB 2DAEA 3J7BA 3E21A 4AZFA 2N35A 2Z8YM 2DHRA 1J09A 1DGGA 1ZQ9A 2DWZB 3LVWA 5ITQA 3QYBA 3A98B 4DBGB 3K92A 3IHPA 2EJSA 2YNMD 2WSEF 2DAGA 4S12A 4QOZC 1R2YA 4NL4H 4DV6M 1GJSA 2J7OA 2V1UA 1OAIA 1IN6A 3I4YA 4LY6A 3MHVC 3BOSA 3VDPA 4PCZA 4AG5A 1L2DA 1LTMA 1VEKA 2W82A 4NSRA 3T15A 2RKOA 4RKUF 3W68A 3LQQA 2D7HA 1HNWM 2KRUA 3VKGA 3BBZA 4F1IA 2LH0A 2ZBKB 5KQ8A 1QUSA 4DV7M 1Q39A 4DV4M 4NOOB 1KFVA 3Q8XA 4P16A 3KP1E 2LVOC 1EFUB 3GPXA 1LV7A 4ZPXA 1OTRA 2GQFA 2CV1A 1NJGA 3GRYA 2LVAA 3IECA 3K9PA 4I8OA 4MGZE 3SAVA 4DR3M 1FNNA 4DR6M 2F4VM 1EIJA 1IN4A 1DGFA 3L29A 1VQ1A 1YUBA 2ZTCA 3KS8A 1HQYE 2JY7A 1ZV1A 4M9ZA 2YQZA 2H5XA 2L09A 2ZTDA 3U61A 2KNAA 3OTOM 4B08A 4GRIA 4Z8XA 2JY5A 1AUAA 5JI2E 4FVMA 3CF6E 3ZQJA 3DOAA 2JY8A 1X37A 2BNKA 1J7KA 3SASA 2B3TA 3FTCA 2LXEA 4HEOA 3B7QA 1MX0A 1VEGA 3PXGA 3KS4A 1N32M 3AOEC 1TH2A 2DZOB 3GLGB 1WHCA 4II7A 3RFWA 1TH3A 4IBJA 4B7GA 3E4RA 1SG9A 1HR0M 2QQ8A 2JNHA 1C7YA 5EP1A 4M0DA 5FTNA 3VDUA 3CGWA 4BLCA 4DV2M 2DWMA 3I51A 1ORYB 2XSZD 3QWLA 2XFSA 1A5TA 4PT5A 2F5NA 2F5QA 1OAOC 4WW0A 3LVVA 3AJIB 2D7EA 3SATA 1IXSB 2XSZA 2CV0A 3WHKA 1VEJA 4X66M 4FCTA 3U60B 2Q2EB 4L4UA 3FD9A 4R3DA 4XGIA 1HNZM 4GKJM 4DUYM 5FTKA 4OU7A 3E46A 1SXJE 1IXZA 1OFHA 2DENA 4X62M 2M60A 5KPTA 1K3WA 1BVSA 3HJ8A 4QHSA 3NBIA 2V6ZM 3HKPA 3J27B 4G4OA 1IBKM 3ZH9B 1IBLM 3T6PA 3ZCBB 3W0LB 3FYCA 4IBBA 4LJ4A 1D0MA 1XMQM 4KT0F 3HU1A 3SFZA 5L8RF 5IWAM 1N77A 2A5YB 2G3QA 4NSOB 2O01F 3T38A 1UFZA 3GQ3A 1GVNA 4QHTA 2KZUA 3HX3A 2LVQD 5ITTA 1ZMWA 4MGKE 3GLIB 5DNYA 4L6V6 2DHYA 3C9PA 1AIPC 4JI8M 4QNMA 2C5RA 3LMMA 4LJ7A 3LCVB 4LCBA 4LRSA 3GQ4A 1G71A 1J5EM 2MH8A 1DGHA 3IG5A 1S3SA 2QENA 1YSYA 3KVWA 4JXJA 4NC6A 3C58A 2R6FA 4UN2B 1TF0B 4IBFA 5FTJA 2K47A
chains in the Genus database with same CATH topology
2MH8A 1PRBA 1GABA 2FS1A 1GJTA 2JWSA 1GJSA 2J5YA 2KDLA 1TF0B 2VDBB 2LHCA 2LHGA 2N35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MH8 A;  1PRB A;  1GAB A;  2FS1 A;  1GJT A;  2JWS A;  1GJS A;  2J5Y A;  2KDL A;  1TF0 B;  2VDB B;  2LHC A;  2LHG A;  2N35 A; 
#chains in the Genus database with same CATH topology
 3GRU A;  1PJT A;  2GNO A;  2V1C A;  2J5Y A;  1E32 A;  3U5Z B;  2UUC M;  1QZE A;  1IFY A;  2LNH C;  2H1R A;  3GRR A;  4GHA A;  5FTM A;  3GRV A;  3FUX A;  4YY3 M;  1TTE A;  3LCU A;  4Z6Y A;  2Z3X A;  2LBC A;  2F5O A;  4LFB M;  4F2L A;  2ZM6 M;  3PNV A;  5GKN A;  5IZ7 D;  1NY6 A;  1IY2 A;  2FOI C;  3GLF A;  3ILK A;  3J80 S;  2XZF A;  2D7G A;  3U6M A;  1T3T A;  1GO5 A;  2XZU A;  3B7Z A;  1XMO M;  3GLG E;  2QBY B;  2DKL A;  2I7N A;  1G3I A;  3FUU A;  1V92 A;  2DZN B;  5EXT A;  1N33 M;  1QDT A;  2C9O A;  4LF8 M;  3JAM S;  2CRU A;  3ZC7 B;  4B7F A;  3HGI A;  3RGP A;  3GQ5 A;  1YLA A;  3KDS E;  1TR8 A;  2Y21 A;  3U5Z A;  3PNY A;  5KPZ A;  2F5S A;  3SMS A;  2LHC A;  5E26 A;  3SYK A;  1DV0 A;  2CWB A;  4G3O A;  2L7H A;  2EUC A;  1Z5B A;  3D8B A;  2R0I A;  4HLQ A;  2OO9 A;  8CAT A;  2WSC F;  4I81 A;  4DV3 M;  2OOB A;  4AQY M;  2FE8 A;  4IBI A;  3J81 S;  3HZJ A;  3U6O A;  1N78 A;  1IN5 A;  3WHL A;  1ZMV A;  4LZJ A;  3UGJ A;  2J7N A;  3VLF B;  2ZAM A;  2CFO A;  4MGY E;  4CJ6 A;  1NHW C;  3HJS A;  2EA0 A;  4NRV A;  4YHH M;  4IJF A;  1Z5A A;  2QZ4 A;  1MN3 A;  1C1K A;  2XLJ A;  1G59 A;  2DWL A;  4IBD A;  2RGO A;  2P5T A;  3W67 A;  2HL7 A;  1N75 A;  2QSF X;  3TL4 X;  4FW9 A;  2K9D A;  3L26 A;  1QUT A;  3MK6 A;  4W5W A;  1WXQ A;  4KHP M;  3B9P A;  1PJI A;  4MH0 E;  1HNX M;  4DR4 M;  1OKS A;  3GLH A;  3F92 A;  3GLI E;  1ZAE A;  1Y8G A;  4LFA M;  4P17 A;  2JXN A;  4LGM A;  5FTL A;  1QAQ A;  3TWK A;  3FYD A;  2APL A;  3R8F A;  2UUA M;  1XB2 B;  2C98 A;  2DWN A;  5ITU A;  2VDB B;  1QYR A;  4FWG A;  3B89 A;  1SXJ A;  3HJQ A;  3UJN A;  1OQY A;  5EP4 A;  1R4G A;  5ITX A;  3TWM A;  3SAW A;  3AKZ A;  1QQW A;  3UZU A;  4LJ8 A;  2UXB M;  1L1Z A;  3FE3 A;  4GC9 A;  4JV5 M;  5EP2 A;  5FSW A;  5BR8 M;  5FLX S;  4REZ A;  3CF2 A;  2RGH A;  1R5L A;  3GP1 A;  1JR3 E;  1DGH B;  4LJA A;  1IBM M;  2ZAO A;  3GPP A;  1MJG M;  2XFT A;  3HHX A;  5H37 D;  1WIV A;  1XC8 A;  1L1T A;  2DXI A;  1DGB A;  1NSF A;  1Z6T A;  2MGW A;  4DR5 M;  1SXJ C;  3A46 A;  4B3M M;  1PJS A;  1UM8 A;  4RF0 A;  4LFC M;  2ZAN A;  4G4R A;  2UXD M;  3GLH E;  3GLI A;  5EJC A;  4K0K M;  1V33 A;  1VDL A;  3MMP A;  3HHY A;  2VF8 A;  2R45 A;  4LRT A;  4QNR A;  1PJJ A;  1GAB A;  1CUK A;  4MGH A;  5ITX E;  4M0W A;  5E6J A;  2JUJ A;  3W0F A;  1L2C A;  3PVS A;  4LJ6 A;  4L15 A;  1JR3 D;  2DAM A;  2VQE M;  2M5Z A;  3EIE A;  1N34 M;  2Y20 A;  3PFI A;  3I4V A;  3IG8 A;  2MJ5 B;  3M7G A;  1IQP A;  4BB9 A;  3JR4 A;  2NQ8 C;  2EO2 A;  3VFD A;  1OFI A;  1WGN A;  1FJG M;  2MRO B;  2R4J A;  1Z59 A;  1I94 M;  2X49 A;  3UK6 A;  2R46 A;  2L2D A;  1R2Z A;  2CHG A;  4GKK M;  2CE7 A;  4FCW A;  2XGN A;  4FCV A;  3GPY A;  3GPU A;  4LF6 M;  4JI6 M;  1IN7 A;  1E9S A;  5IT9 S;  3I01 M;  4GMQ A;  4Q7J A;  3A45 A;  1KSF X;  2QPA A;  1XXH A;  1XNQ M;  3U60 A;  3FTD A;  2R65 A;  3DZD A;  3J2P B;  1XWI A;  2KDL A;  3FRH A;  3BXW A;  2EKK A;  2KNV A;  7CAT A;  3Q8G A;  5KPR A;  2DVW B;  5DFL A;  3CF0 A;  1VDD A;  2KZS A;  4LGY A;  1NNJ A;  2WSF F;  3I04 M;  1HJP A;  2LHG A;  2BJV A;  4NRW A;  3HU2 A;  1JR3 A;  4DR2 M;  2X8A A;  4CGY B;  2YR0 A;  1W5S A;  2LVN C;  3U6P A;  3HWS A;  3AFH A;  1K3X A;  1T43 A;  3FUT A;  4I4L A;  2BWB A;  1NVM A;  3KSJ A;  4DV5 M;  2JP7 A;  1QVR A;  3LW5 F;  2C96 A;  1IM2 A;  2QNJ A;  2JZ1 A;  3CTW B;  3VK7 A;  1P3Q Q;  2KNZ A;  3B7N A;  3GLF B;  2L6O A;  1QAN A;  4M9S A;  2HHH M;  3KOY E;  2L4F A;  3KXE C;  2Z7J A;  4RF1 A;  1PRB A;  2K0B X;  3U61 B;  2KXE A;  4PDG A;  1SXJ D;  4NXM M;  3R9X B;  2Z4S A;  1K82 A;  1IN8 A;  2CHQ A;  3FUV A;  5DYI A;  3NBX X;  4G4N A;  4OX9 M;  1R7R A;  3SAU A;  1OJL A;  4JYA M;  2FS1 A;  2ERC A;  1GLN A;  3L2A A;  4XK8 F;  3KW6 A;  3U6L A;  1HT2 E;  2CEA A;  1NY5 A;  2HKJ A;  2VQF M;  2RRU A;  4X64 M;  2XEP A;  1HT1 E;  4HL4 A;  1T6O A;  4IBC A;  3TWL A;  1QAM A;  4JI2 M;  1QAO A;  4WP2 A;  4JI3 M;  2FFJ A;  2Y0Q A;  2QCU A;  4B7H A;  4DUZ M;  4IIW A;  3GO8 A;  2L4E A;  2FNA A;  2Z4R A;  2UXC M;  3NWL A;  3K2L A;  3GLH B;  3V76 A;  3SHG B;  3C3E A;  2HAK A;  3KFU G;  1V34 A;  5EXS A;  1D0L A;  4ANR A;  3L25 A;  1Q3C A;  1RU3 A;  2CHV A;  2HWJ A;  1PM5 A;  1N36 M;  4MM3 B;  2OPF A;  4LF5 M;  3DA1 A;  1D0K A;  4TUW A;  3M0E A;  1HQC A;  1Q02 A;  3U6C A;  4L8R C;  3QAU A;  3MJ5 A;  3SMP A;  1H6U A;  1NJF A;  2JZ0 A;  4AW4 A;  4DV0 M;  3M6A A;  4GC5 A;  3SBJ A;  4DR7 M;  2OOA A;  3U6D A;  1WR1 B;  3FRI A;  3VK8 A;  4AG6 A;  1VG5 A;  1ZMU A;  3B74 A;  3HHW A;  5LMN M;  3U6Q A;  3TQS A;  2LWX A;  1XNR M;  3FUW A;  2HCB A;  3UMM A;  2FH0 A;  1DO0 A;  1E94 E;  3GLG A;  1NV8 A;  4IBE A;  2G8L A;  2X4A A;  1G4A E;  1OIZ A;  3FTF A;  2KA6 B;  4CHT B;  4LJ5 A;  4M9X A;  4QOS A;  2DNA A;  2K6B A;  1IXS A;  3KSX A;  4JI7 M;  1TDZ A;  4MB7 A;  3T1Y M;  3A42 A;  4AKG A;  5JI3 E;  1PGY A;  4FWH A;  1JQJ C;  3L28 A;  4D80 A;  2C99 A;  1XXH E;  4R71 A;  3TPZ A;  5A2Q S;  4GIT A;  5C1B A;  1IY0 A;  2BJW A;  5LMU M;  1F4I A;  4R7G A;  2JWS A;  4OW0 A;  3AL0 C;  4LF4 M;  1NNU C;  1L8Q A;  2DAK A;  1Q3B A;  1XHB A;  3K1J A;  3LQR A;  2L7I A;  3AOG A;  3SYL A;  2UU9 M;  1KYI A;  4JI1 M;  2R4E A;  4KLN A;  4AKH A;  2O25 A;  4Y28 F;  4G6Z A;  3GLF E;  1WGL A;  2AHM A;  2DAI A;  3THG A;  4FD2 A;  4LF7 M;  1WJ7 A;  5ITY A;  4FWD A;  3U6S A;  5DYG A;  4AKI A;  4GIP A;  4JI0 M;  3SAR A;  4B3T M;  3KP0 E;  4IBG A;  4OVZ A;  2JA2 A;  4D81 A;  3H4M A;  4WUR A;  4DR1 M;  1L2B A;  2XF3 A;  4LJ9 A;  4CIS A;  4AI6 A;  1MU5 A;  1DO2 A;  4IBK A;  3KOX E;  4JI4 M;  4CIZ A;  2BWE A;  3SHF A;  1TGU A;  2XH9 A;  2F5P A;  3DFZ A;  1NV9 A;  4RNA A;  4X65 M;  1R6B X;  5IRE B;  1QZM A;  3RGS A;  2EKF A;  2QP9 X;  2YFQ A;  3JR5 A;  3HY5 A;  1IXR C;  4L16 A;  1EE8 A;  1GL6 A;  4LZZ A;  5EP3 A;  3K8Z A;  4KO8 A;  3L27 A;  3D8L A;  4G4Q A;  3TE6 A;  3VKH A;  1OIP A;  2LVP C;  1GL7 A;  2R62 A;  2VF7 A;  4IJE A;  3AV0 A;  4L78 A;  4GHL A;  1W5T A;  2LTU A;  3KOW E;  4GH9 A;  4XBO A;  2MR9 A;  5C18 A;  3EIH A;  3FKE A;  2DI0 A;  3KOZ E;  2WZJ A;  3AOE A;  5ITR A;  3K9O A;  4MGI E;  4A3V B;  2R44 A;  2DZL A;  2JY6 B;  1TH4 A;  2KEB A;  2QHO B;  4BBA A;  4DV1 M;  2Y0T A;  2KRK A;  1I4W A;  2I7P A;  4GEW A;  4JI5 M;  3T1H M;  3HU3 A;  1JB0 F;  2UUB M;  2VII A;  3U6E A;  1YE9 A;  1GKI A;  1Z5C A;  4B3S M;  1NHG C;  5EXX A;  2QBY A;  4PDI A;  3E9S A;  5EXP A;  1NO1 A;  5KQD A;  3FTE A;  1G41 A;  3C3D A;  3RE8 A;  4KOD A;  5KO3 A;  1QDR A;  1E9R A;  4PD2 A;  2O5R A;  4B3R M;  5EQT A;  2KHH A;  4EIW A;  2E5L M;  3HHZ A;  1G8P A;  2KW0 A;  1D2N A;  2G5G X;  1IY1 A;  1GJT A;  2CP8 A;  2R18 A;  4ITQ A;  4LG2 A;  2C9C A;  4NXN M;  2CUZ A;  3SC3 A;  2CV2 A;  4LF9 M;  1XXH B;  3J7A S;  5BPV A;  3H4J A;  4I5S A;  3QYE A;  4D82 A;  2OQ4 A;  5F3W A;  4JN6 A;  4OVZ B;  1PJQ A;  1TDH A;  1SXJ B;  2DAE A;  3J7B A;  3E21 A;  4AZF A;  2N35 A;  2Z8Y M;  2DHR A;  1J09 A;  1DGG A;  1ZQ9 A;  2DWZ B;  3LVW A;  5ITQ A;  3QYB A;  3A98 B;  4DBG B;  3K92 A;  3IHP A;  2EJS A;  2YNM D;  2WSE F;  2DAG A;  4S12 A;  4QOZ C;  1R2Y A;  4NL4 H;  4DV6 M;  1GJS A;  2J7O A;  2V1U A;  1OAI A;  1IN6 A;  3I4Y A;  4LY6 A;  3MHV C;  3BOS A;  3VDP A;  4PCZ A;  4AG5 A;  1L2D A;  1LTM A;  1VEK A;  2W82 A;  4NSR A;  3T15 A;  2RKO A;  4RKU F;  3W68 A;  3LQQ A;  2D7H A;  1HNW M;  2KRU A;  3VKG A;  3BBZ A;  4F1I A;  2LH0 A;  2ZBK B;  5KQ8 A;  1QUS A;  4DV7 M;  1Q39 A;  4DV4 M;  4NOO B;  1KFV A;  3Q8X A;  4P16 A;  3KP1 E;  2LVO C;  1EFU B;  3GPX A;  1LV7 A;  4ZPX A;  1OTR A;  2GQF A;  2CV1 A;  1NJG A;  3GRY A;  2LVA A;  3IEC A;  3K9P A;  4I8O A;  4MGZ E;  3SAV A;  4DR3 M;  1FNN A;  4DR6 M;  2F4V M;  1EIJ A;  1IN4 A;  1DGF A;  3L29 A;  1VQ1 A;  1YUB A;  2ZTC A;  3KS8 A;  1HQY E;  2JY7 A;  1ZV1 A;  4M9Z A;  2YQZ A;  2H5X A;  2L09 A;  2ZTD A;  3U61 A;  2KNA A;  3OTO M;  4B08 A;  4GRI A;  4Z8X A;  2JY5 A;  1AUA A;  5JI2 E;  4FVM A;  3CF6 E;  3ZQJ A;  3DOA A;  2JY8 A;  1X37 A;  2BNK A;  1J7K A;  3SAS A;  2B3T A;  3FTC A;  2LXE A;  4HEO A;  3B7Q A;  1MX0 A;  1VEG A;  3PXG A;  3KS4 A;  1N32 M;  3AOE C;  1TH2 A;  2DZO B;  3GLG B;  1WHC A;  4II7 A;  3RFW A;  1TH3 A;  4IBJ A;  4B7G A;  3E4R A;  1SG9 A;  1HR0 M;  2QQ8 A;  2JNH A;  1C7Y A;  5EP1 A;  4M0D A;  5FTN A;  3VDU A;  3CGW A;  4BLC A;  4DV2 M;  2DWM A;  3I51 A;  1ORY B;  2XSZ D;  3QWL A;  2XFS A;  1A5T A;  4PT5 A;  2F5N A;  2F5Q A;  1OAO C;  4WW0 A;  3LVV A;  3AJI B;  2D7E A;  3SAT A;  1IXS B;  2XSZ A;  2CV0 A;  3WHK A;  1VEJ A;  4X66 M;  4FCT A;  3U60 B;  2Q2E B;  4L4U A;  3FD9 A;  4R3D A;  4XGI A;  1HNZ M;  4GKJ M;  4DUY M;  5FTK A;  4OU7 A;  3E46 A;  1SXJ E;  1IXZ A;  1OFH A;  2DEN A;  4X62 M;  2M60 A;  5KPT A;  1K3W A;  1BVS A;  3HJ8 A;  4QHS A;  3NBI A;  2V6Z M;  3HKP A;  3J27 B;  4G4O A;  1IBK M;  3ZH9 B;  1IBL M;  3T6P A;  3ZCB B;  3W0L B;  3FYC A;  4IBB A;  4LJ4 A;  1D0M A;  1XMQ M;  4KT0 F;  3HU1 A;  3SFZ A;  5L8R F;  5IWA M;  1N77 A;  2A5Y B;  2G3Q A;  4NSO B;  2O01 F;  3T38 A;  1UFZ A;  3GQ3 A;  1GVN A;  4QHT A;  2KZU A;  3HX3 A;  2LVQ D;  5ITT A;  1ZMW A;  4MGK E;  3GLI B;  5DNY A;  4L6V 6;  2DHY A;  3C9P A;  1AIP C;  4JI8 M;  4QNM A;  2C5R A;  3LMM A;  4LJ7 A;  3LCV B;  4LCB A;  4LRS A;  3GQ4 A;  1G71 A;  1J5E M;  2MH8 A;  1DGH A;  3IG5 A;  1S3S A;  2QEN A;  1YSY A;  3KVW A;  4JXJ A;  4NC6 A;  3C58 A;  2R6F A;  4UN2 B;  1TF0 B;  4IBF A;  5FTJ A;  2K47 A; 
#chains in the Genus database with same CATH homology
 2MH8 A;  1PRB A;  1GAB A;  2FS1 A;  1GJT A;  2JWS A;  1GJS A;  2J5Y A;  2KDL A;  1TF0 B;  2VDB B;  2LHC A;  2LHG A;  2N35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...