2VDBB

Structure of human serum albumin with s-naproxen and the ga module
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
55
structure length
55
Chain Sequence
HMTIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Binding of Naproxen to Human Serum Albumin in the Presence of Fatty Acids and the Ga Module.
pubmed doi rcsb
source organism Peptostreptococcus magnus
molecule tags Protein binding
molecule keywords SERUM ALBUMIN
total genus 21
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2vdbB00
2LHCA 2FS1A 1GJTA 1GJSA 2MH8A 2VDBB 2JWSA 1PRBA 2J5YA 2LHGA 2N35A 1GABA 2KDLA 1TF0B
chains in the Genus database with same CATH superfamily
1MU5A 2YQZA 4LJ6A 4AW4A 4B7GA 4WURA 2LH0A 4CHTB 1OJLA 4MGIE 2O5RA 3PFIA 2C9CA 1JR3D 4CJ6A 1C1KA 2JUJA 4AZFA 3GLFE 3M6AA 3FTEA 2CV2A 1KYIA 2R6FA 4LF8M 3Q8GA 2ERCA 4LRTA 2CV0A 4GH9A 3AV0A 2KNZA 3NWLA 2Z8YM 3CF6E 2EJSA 2GQFA 2ZAMA 2I7NA 3IHPA 4LFAM 4R71A 4DV6M 4G4NA 2P5TA 3SHFA 1QZMA 1SXJC 2L4EA 2G8LA 1VDLA 2XSZD 5EP3A 4B3TM 2GNOA 3KDSE 3GLGA 1VDDA 1E32A 2BJWA 3UK6A 3C3DA 4IJEA 4PD2A 4LF7M 2OOBA 3GLHB 2XF3A 4IBCA 3GLFA 1VG5A 1NHGC 2M60A 5E26A 5GKNA 3SBJA 5EXPA 1IQPA 2R62A 2ZBKB 3A45A 1DGHB 2LVQD 4MGZE 1SXJB 3LVWA 2QBYA 2DNAA 2FE8A 3KP1E 4CISA 4GITA 4W5WA 1FJGM 4I4LA 4FVMA 3SARA 1IXZA 3B7NA 4LZJA 4CIZA 4AQYM 4QOZC 4B3SM 1OAIA 3KVWA 1AUAA 1HQYE 3KSJA 3BBZA 1VEGA 5FLXS 1FNNA 1EIJA 5ITTA 2H5XA 2CHVA 2L4FA 3HU1A 2HHHM 4LF9M 4D82A 4Q7JA 1Z5CA 2C96A 2O25A 3JR4A 3EIEA 1TTEA 2FNAA 4IBKA 2DXIA 1WJ7A 5BPVA 4JI0M 5IREB 2R4JA 1ZV1A 2KDLA 2DAKA 3W67A 4B08A 3T1YM 4G4OA 2CHQA 3FYCA 1PJIA 1L1TA 1G8PA 1GLNA 1IY1A 4L78A 3GLIE 1GJTA 4FCWA 1IN6A 4JI7M 1VQ1A 2QHOB 1K82A 2V1UA 1VEKA 2DHYA 2CP8A 5ITXE 1LV7A 2UU9M 3W0LB 3FUTA 3I4YA 3MMPA 3SYKA 1N34M 4B7FA 3GPPA 4NSRA 1T6OA 1YLAA 2L7HA 3C3EA 1IY0A 1NSFA 1C7YA 3R8FA 1TH3A 2KNAA 2K0BX 3J2PB 4DR6M 1N33M 1HNWM 4FWDA 3B7ZA 2ZANA 3K92A 4I5SA 3GLIA 2X49A 1G41A 3FUUA 4NXMM 1QAQA 3FE3A 4HEOA 3EIHA 5ITXA 4YY3M 3NBIA 2MGWA 3FTFA 2F5SA 4F2LA 1YSYA 2H1RA 3HJSA 2XZUA 1XXHB 2CEAA 3FD9A 3V76A 1XNRM 3AOEC 1IN4A 3SHGB 2OO9A 1J09A 1IN7A 2RGOA 1DGBA 4G4QA 3FYDA 2G5GX 4RKUF 3E46A 5DYIA 3KSXA 4LJ7A 2FFJA 2RKOA 3C58A 2HL7A 2JY8A 2KW0A 1NY6A 1SG9A 3IECA 3GPXA 5F3WA 3ZQJA 3U60A 2KHHA 3MK6A 3L28A 4ANRA 3J80S 3TL4X 1NNUC 2QSFX 3HU3A 4FCVA 7CATA 1TR8A 3GQ3A 5EP4A 3RE8A 5EXSA 1WGLA 2XLJA 1N32M 2DAMA 4D81A 4IBGA 1R4GA 4IIWA 4GRIA 4JV5M 3K1JA 2QQ8A 4NRWA 2EKFA 2WSCF 5LMUM 3GRUA 3M7GA 3DFZA 4AKHA 1IBMM 3GO8A 1XB2B 3K8ZA 5ITYA 4DV2M 4NL4H 3TQSA 3I4VA 1XWIA 3FKEA 4K0KM 2MROB 3VDPA 3DOAA 1V33A 2I7PA 4LF6M 1ZQ9A 2JY7A 2LBCA 3T38A 2BWBA 2UXDM 3GLGB 4AKIA 4M9ZA 4D80A 3RGSA 3J81S 3U61A 5KQDA 3VKGA 3DZDA 1Q3CA 4NSOB 4JI5M 3FTDA 2R45A 1PJQA 2LVNC 1YUBA 1QDRA 4AG6A 4F1IA 2DVWB 4LFCM 1DO0A 1ZMUA 3BOSA 1HJPA 3T6PA 2JZ1A 2KA6B 2JWSA 2DZNB 4QNRA 4LGMA 2A5YB 2BWEA 4QHTA 3HHYA 5FTMA 1HNZM 1D0MA 5ITUA 2QP9X 1L2CA 4LZZA 2EUCA 3K2LA 3VFDA 2FS1A 3SFZA 4PDIA 4DV3M 4JI6M 1N78A 4AKGA 3RGPA 1T3TA 4JI4M 2F5QA 3L26A 1DV0A 2UUAM 3NBXX 2ZTDA 4G4RA 3U6PA 2VQFM 1TH2A 1OTRA 4NOOB 1DO2A 4M9XA 4P17A 4YHHM 3UZUA 2DWMA 2KNVA 1V92A 1K3XA 1TDHA 2KRUA 4CGYB 5FTLA 1TH4A 5EP2A 4HLQA 4DV5M 4KLNA 2L2DA 1IXSA 1OIPA 1T43A 1E94E 1W5SA 4Z8XA 2XZFA 2HAKA 2HCBA 2VIIA 4JN6A 5EP1A 1OIZA 3KOXE 3ILKA 3GRYA 1ZAEA 2L6OA 3B89A 1HR0M 3UGJA 2QENA 2KXEA 1HT2E 2Y0TA 3U6EA 1NHWC 1PRBA 3GPUA 2V6ZM 3PVSA 1I4WA 3AKZA 1GO5A 1IM2A 2AHMA 4NC6A 1GL7A 2L7IA 4LG2A 2XSZA 1R7RA 2K9DA 3CF2A 3MJ5A 1JQJC 3IG8A 1IBLM 4WP2A 1TDZA 2F5OA 3FUVA 2CFOA 4DV1M 4GHLA 3ZC7B 3GRRA 4JI3M 2C9OA 3GP1A 3PNVA 2Y0QA 5KPRA 5FTJA 2R4EA 4GIPA 2LWXA 4B7HA 3I51A 4AG5A 4DV0M 4KHPM 3BXWA 2VF7A 3H4MA 2APLA 3L2AA 4HL4A 3TWLA 3L29A 1WGNA 3VLFB 3HHZA 3B9PA 2DAEA 3K9PA 1ZMVA 2R44A 3F92A 1OFHA 2Y21A 4QOSA 4BLCA 1HQCA 2D7GA 3IG5A 4G6ZA 4DR7M 2HKJA 5L8RF 2KZSA 3VDUA 5E6JA 2LVPC 4JI1M 1D2NA 1PJJA 1QUTA 3AL0C 2UXCM 1EFUB 2Z3XA 2KRKA 3ZCBB 3U60B 1G3IA 4S12A 4DR2M 3HJQA 1E9RA 1HT1E 4RF0A 2L09A 3E9SA 2B3TA 1XMOM 1OAOC 5ITQA 4NXNM 1IN8A 5C18A 1QUSA 2X4AA 3HKPA 1KFVA 4DR3M 1R2ZA 3DA1A 3LQQA 4QNMA 2FH0A 4IBBA 3U5ZB 3L27A 4MB7A 1PGYA 4WW0A 2DWNA 1G71A 3GLIB 4LF5M 1GL6A 3UJNA 3FRIA 3VKHA 1OKSA 2R18A 4IBFA 3SAWA 4I81A 1MX0A 3D8BA 4BB9A 2UUCM 1E9SA 1EE8A 1MJGM 2JA2A 2W82A 4LJ4A 3GLHA 4X65M 5BR8M 3GLFB 2F5PA 2DWZB 3ZH9B 3A98B 3HU2A 5JI2E 3LMMA 5FTKA 4A3VB 4PCZA 4X64M 3AOEA 2DAIA 3SAVA 1DGHA 5KO3A 1TGUA 2ZTCA 1NVMA 2CV1A 2LVAA 2D7EA 2R46A 2YNMD 3TE6A 4JYAM 2Y20A 1UM8A 4L16A 1Z59A 1VEJA 2DZOB 3WHLA 4R7GA 2WSFF 5KQ8A 2JXNA 2JY5A 1L2DA 3HJ8A 5C1BA 1V34A 3GLHE 1NO1A 4LJ8A 2LNHC 5EQTA 3KXEC 1A5TA 2Z7JA 4XGIA 3SYLA 3JAMS 2QBYB 2LHGA 3HGIA 1XXHE 3LCVB 1IY2A 4MGKE 3A42A 3CTWB 4FWGA 3LW5F 1SXJE 1NJGA 3KOYE 4GKKM 1R5LA 2EA0A 3VK7A 1UFZA 1H6UA 2CWBA 3T1HM 2ZAOA 4ZPXA 3SC3A 4XBOA 3U61B 3C9PA 1IXSB 4LJAA 2KEBA 3HWSA 1AIPC 3Q8XA 3SMSA 3AOGA 1N77A 4M0WA 4LY6A 3LCUA 2OQ4A 1OQYA 2K6BA 4DR1M 2DWLA 4AI6A 3GQ4A 1F4IA 1L2BA 3KOWE 4DV4M 1S3SA 3B74A 4OU7A 1QYRA 1XNQM 1CUKA 4P16A 4DV7M 2Z4RA 4MGHA 4KO8A 1D0KA 4GEWA 2VF8A 2QNJA 3GPYA 1K3WA 3SATA 3K9OA 1WXQA 5FSWA 1L8QA 4PT5A 1IBKM 4RNAA 3U6CA 2O01F 4OW0A 3VK8A 4DR5M 1R6BX 2N35A 1HNXM 2JZ0A 3H4JA 4MM3B 4TUWA 1NV9A 3HY5A 1G4AE 2BJVA 4FWHA 5DYGA 1PM5A 3L25A 1Q3BA 5LMNM 1QDTA 3PXGA 4L4UA 3RFWA 5FTNA 2R65A 3U6SA 3CF0A 3FUXA 4M9SA 3M0EA 2F5NA 4JI8M 1XHBA 3QYEA 4X62M 4L8RC 5IT9S 2MR9A 2ZM6M 1MN3A 4DR4M 2MJ5B 4IBEA 5JI3E 3AJIB 3I01M 5DFLA 3I04M 4LFBM 2LXEA 1PJTA 2JNHA 3SAUA 1XC8A 3SASA 1QAMA 2MH8A 2M5ZA 2V1CA 1Y8GA 3A46A 4OX9M 4R3DA 1NY5A 2K47A 1XMQM 4IJFA 1N36M 3KFUG 3FUWA 1XXHA 2WZJA 3LVVA 2XFSA 2VQEM 4DBGB 3MHVC 2LHCA 3THGA 1ZMWA 3E4RA 1SXJA 3KW6A 3TWMA 1GJSA 5EXXA 2VDBB 1QAOA 1J7KA 2J5YA 4REZA 1DGGA 3U6QA 4JI2M 1L1ZA 3QWLA 3U5ZA 2DKLA 2QCUA 2FOIC 2NQ8C 4KT0F 4EIWA 4L6V6 2KZUA 4JXJA 3U6OA 3HHWA 2F4VM 1QANA 1WHCA 2LTUA 5IZ7D 1IXRC 3QYBA 1N75A 2J7OA 3WHKA 1GVNA 1YE9A 4G3OA 2RGHA 2LVOC 1JB0F 2QZ4A 2WSEF 2XEPA 3HHXA 1NNJA 8CATA 2X8AA 2CE7A 2C99A 3JR5A 1SXJD 1Z5AA 4I8OA 4XK8F 1IN5A 4FD2A 2XGNA 3OTOM 3KS4A 2G3QA 3FRHA 3TPZA 1P3QQ 4B3MM 2OOAA 3FTCA 4DUYM 1RU3A 2DHRA 1OFIA 1W5TA 2DENA 4LGYA 3U6LA 3D8LA 2J7NA 1I94M 3R9XB 4LJ9A 3LQRA 4IBJA 2DAGA 4LJ5A 1Z6TA 4LF4M 3J7AS 2XH9A 4FW9A 1TF0B 4OVZA 5KPTA 2R0IA 1JR3E 1NV8A 5A2QS 2DI0A 2UXBM 1PJSA 3J7BA 4Y28F 3W68A 1QVRA 4GMQA 2CRUA 4II7A 1Q39A 2XFTA 3KS8A 5IWAM 3CGWA 2QPAA 4LCBA 3B7QA 3J27B 2D7HA 1IFYA 5EJCA 3GLGE 1Z5BA 5ITRA 5DNYA 5KPZA 3T15A 4BBAA 2CHGA 2EO2A 3PNYA 4NRVA 4GHAA 4QHSA 5H37D 2JY6B 4MGYE 1G59A 2JP7A 3E21A 1R2YA 4UN2B 1J5EM 3U6DA 4FCTA 4GC9A 1NJFA 2DZLA 3QAUA 1X37A 3W0FA 2OPFA 1JR3A 2Q2EB 2YFQA 3KOZE 4OVZB 1DGFA 2HWJA 4PDGA 2CUZA 4X66M 2C98A 2UUBM 3UMMA 3HZJA 1LTMA 1GABA 4DUZM 2BNKA 4M0DA 2E5LM 4B3RM 1GKIA 3KP0E 4LRSA 5EXTA 2EKKA 3HX3A 4IBDA 3U6MA 3TWKA 4ITQA 4IBIA 1D0LA 2YR0A 1WIVA 4MH0E 1Q02A 2Z4SA 4GC5A 4L15A 1WR1B 1KSFX 4KODA 1BVSA 3GQ5A 4Z6YA 2C5RA 1QZEA 4RF1A 3SMPA 4GKJM 1QQWA 3AFHA 3GRVA 1ORYB 2RRUA
chains in the Genus database with same CATH topology
2LHCA 2FS1A 1GJTA 1GJSA 2MH8A 2VDBB 2JWSA 1PRBA 2J5YA 2LHGA 2N35A 1GABA 2KDLA 1TF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHC A;  2FS1 A;  1GJT A;  1GJS A;  2MH8 A;  2VDB B;  2JWS A;  1PRB A;  2J5Y A;  2LHG A;  2N35 A;  1GAB A;  2KDL A;  1TF0 B; 
#chains in the Genus database with same CATH topology
 1MU5 A;  2YQZ A;  4LJ6 A;  4AW4 A;  4B7G A;  4WUR A;  2LH0 A;  4CHT B;  1OJL A;  4MGI E;  2O5R A;  3PFI A;  2C9C A;  1JR3 D;  4CJ6 A;  1C1K A;  2JUJ A;  4AZF A;  3GLF E;  3M6A A;  3FTE A;  2CV2 A;  1KYI A;  2R6F A;  4LF8 M;  3Q8G A;  2ERC A;  4LRT A;  2CV0 A;  4GH9 A;  3AV0 A;  2KNZ A;  3NWL A;  2Z8Y M;  3CF6 E;  2EJS A;  2GQF A;  2ZAM A;  2I7N A;  3IHP A;  4LFA M;  4R71 A;  4DV6 M;  4G4N A;  2P5T A;  3SHF A;  1QZM A;  1SXJ C;  2L4E A;  2G8L A;  1VDL A;  2XSZ D;  5EP3 A;  4B3T M;  2GNO A;  3KDS E;  3GLG A;  1VDD A;  1E32 A;  2BJW A;  3UK6 A;  3C3D A;  4IJE A;  4PD2 A;  4LF7 M;  2OOB A;  3GLH B;  2XF3 A;  4IBC A;  3GLF A;  1VG5 A;  1NHG C;  2M60 A;  5E26 A;  5GKN A;  3SBJ A;  5EXP A;  1IQP A;  2R62 A;  2ZBK B;  3A45 A;  1DGH B;  2LVQ D;  4MGZ E;  1SXJ B;  3LVW A;  2QBY A;  2DNA A;  2FE8 A;  3KP1 E;  4CIS A;  4GIT A;  4W5W A;  1FJG M;  4I4L A;  4FVM A;  3SAR A;  1IXZ A;  3B7N A;  4LZJ A;  4CIZ A;  4AQY M;  4QOZ C;  4B3S M;  1OAI A;  3KVW A;  1AUA A;  1HQY E;  3KSJ A;  3BBZ A;  1VEG A;  5FLX S;  1FNN A;  1EIJ A;  5ITT A;  2H5X A;  2CHV A;  2L4F A;  3HU1 A;  2HHH M;  4LF9 M;  4D82 A;  4Q7J A;  1Z5C A;  2C96 A;  2O25 A;  3JR4 A;  3EIE A;  1TTE A;  2FNA A;  4IBK A;  2DXI A;  1WJ7 A;  5BPV A;  4JI0 M;  5IRE B;  2R4J A;  1ZV1 A;  2KDL A;  2DAK A;  3W67 A;  4B08 A;  3T1Y M;  4G4O A;  2CHQ A;  3FYC A;  1PJI A;  1L1T A;  1G8P A;  1GLN A;  1IY1 A;  4L78 A;  3GLI E;  1GJT A;  4FCW A;  1IN6 A;  4JI7 M;  1VQ1 A;  2QHO B;  1K82 A;  2V1U A;  1VEK A;  2DHY A;  2CP8 A;  5ITX E;  1LV7 A;  2UU9 M;  3W0L B;  3FUT A;  3I4Y A;  3MMP A;  3SYK A;  1N34 M;  4B7F A;  3GPP A;  4NSR A;  1T6O A;  1YLA A;  2L7H A;  3C3E A;  1IY0 A;  1NSF A;  1C7Y A;  3R8F A;  1TH3 A;  2KNA A;  2K0B X;  3J2P B;  4DR6 M;  1N33 M;  1HNW M;  4FWD A;  3B7Z A;  2ZAN A;  3K92 A;  4I5S A;  3GLI A;  2X49 A;  1G41 A;  3FUU A;  4NXM M;  1QAQ A;  3FE3 A;  4HEO A;  3EIH A;  5ITX A;  4YY3 M;  3NBI A;  2MGW A;  3FTF A;  2F5S A;  4F2L A;  1YSY A;  2H1R A;  3HJS A;  2XZU A;  1XXH B;  2CEA A;  3FD9 A;  3V76 A;  1XNR M;  3AOE C;  1IN4 A;  3SHG B;  2OO9 A;  1J09 A;  1IN7 A;  2RGO A;  1DGB A;  4G4Q A;  3FYD A;  2G5G X;  4RKU F;  3E46 A;  5DYI A;  3KSX A;  4LJ7 A;  2FFJ A;  2RKO A;  3C58 A;  2HL7 A;  2JY8 A;  2KW0 A;  1NY6 A;  1SG9 A;  3IEC A;  3GPX A;  5F3W A;  3ZQJ A;  3U60 A;  2KHH A;  3MK6 A;  3L28 A;  4ANR A;  3J80 S;  3TL4 X;  1NNU C;  2QSF X;  3HU3 A;  4FCV A;  7CAT A;  1TR8 A;  3GQ3 A;  5EP4 A;  3RE8 A;  5EXS A;  1WGL A;  2XLJ A;  1N32 M;  2DAM A;  4D81 A;  4IBG A;  1R4G A;  4IIW A;  4GRI A;  4JV5 M;  3K1J A;  2QQ8 A;  4NRW A;  2EKF A;  2WSC F;  5LMU M;  3GRU A;  3M7G A;  3DFZ A;  4AKH A;  1IBM M;  3GO8 A;  1XB2 B;  3K8Z A;  5ITY A;  4DV2 M;  4NL4 H;  3TQS A;  3I4V A;  1XWI A;  3FKE A;  4K0K M;  2MRO B;  3VDP A;  3DOA A;  1V33 A;  2I7P A;  4LF6 M;  1ZQ9 A;  2JY7 A;  2LBC A;  3T38 A;  2BWB A;  2UXD M;  3GLG B;  4AKI A;  4M9Z A;  4D80 A;  3RGS A;  3J81 S;  3U61 A;  5KQD A;  3VKG A;  3DZD A;  1Q3C A;  4NSO B;  4JI5 M;  3FTD A;  2R45 A;  1PJQ A;  2LVN C;  1YUB A;  1QDR A;  4AG6 A;  4F1I A;  2DVW B;  4LFC M;  1DO0 A;  1ZMU A;  3BOS A;  1HJP A;  3T6P A;  2JZ1 A;  2KA6 B;  2JWS A;  2DZN B;  4QNR A;  4LGM A;  2A5Y B;  2BWE A;  4QHT A;  3HHY A;  5FTM A;  1HNZ M;  1D0M A;  5ITU A;  2QP9 X;  1L2C A;  4LZZ A;  2EUC A;  3K2L A;  3VFD A;  2FS1 A;  3SFZ A;  4PDI A;  4DV3 M;  4JI6 M;  1N78 A;  4AKG A;  3RGP A;  1T3T A;  4JI4 M;  2F5Q A;  3L26 A;  1DV0 A;  2UUA M;  3NBX X;  2ZTD A;  4G4R A;  3U6P A;  2VQF M;  1TH2 A;  1OTR A;  4NOO B;  1DO2 A;  4M9X A;  4P17 A;  4YHH M;  3UZU A;  2DWM A;  2KNV A;  1V92 A;  1K3X A;  1TDH A;  2KRU A;  4CGY B;  5FTL A;  1TH4 A;  5EP2 A;  4HLQ A;  4DV5 M;  4KLN A;  2L2D A;  1IXS A;  1OIP A;  1T43 A;  1E94 E;  1W5S A;  4Z8X A;  2XZF A;  2HAK A;  2HCB A;  2VII A;  4JN6 A;  5EP1 A;  1OIZ A;  3KOX E;  3ILK A;  3GRY A;  1ZAE A;  2L6O A;  3B89 A;  1HR0 M;  3UGJ A;  2QEN A;  2KXE A;  1HT2 E;  2Y0T A;  3U6E A;  1NHW C;  1PRB A;  3GPU A;  2V6Z M;  3PVS A;  1I4W A;  3AKZ A;  1GO5 A;  1IM2 A;  2AHM A;  4NC6 A;  1GL7 A;  2L7I A;  4LG2 A;  2XSZ A;  1R7R A;  2K9D A;  3CF2 A;  3MJ5 A;  1JQJ C;  3IG8 A;  1IBL M;  4WP2 A;  1TDZ A;  2F5O A;  3FUV A;  2CFO A;  4DV1 M;  4GHL A;  3ZC7 B;  3GRR A;  4JI3 M;  2C9O A;  3GP1 A;  3PNV A;  2Y0Q A;  5KPR A;  5FTJ A;  2R4E A;  4GIP A;  2LWX A;  4B7H A;  3I51 A;  4AG5 A;  4DV0 M;  4KHP M;  3BXW A;  2VF7 A;  3H4M A;  2APL A;  3L2A A;  4HL4 A;  3TWL A;  3L29 A;  1WGN A;  3VLF B;  3HHZ A;  3B9P A;  2DAE A;  3K9P A;  1ZMV A;  2R44 A;  3F92 A;  1OFH A;  2Y21 A;  4QOS A;  4BLC A;  1HQC A;  2D7G A;  3IG5 A;  4G6Z A;  4DR7 M;  2HKJ A;  5L8R F;  2KZS A;  3VDU A;  5E6J A;  2LVP C;  4JI1 M;  1D2N A;  1PJJ A;  1QUT A;  3AL0 C;  2UXC M;  1EFU B;  2Z3X A;  2KRK A;  3ZCB B;  3U60 B;  1G3I A;  4S12 A;  4DR2 M;  3HJQ A;  1E9R A;  1HT1 E;  4RF0 A;  2L09 A;  3E9S A;  2B3T A;  1XMO M;  1OAO C;  5ITQ A;  4NXN M;  1IN8 A;  5C18 A;  1QUS A;  2X4A A;  3HKP A;  1KFV A;  4DR3 M;  1R2Z A;  3DA1 A;  3LQQ A;  4QNM A;  2FH0 A;  4IBB A;  3U5Z B;  3L27 A;  4MB7 A;  1PGY A;  4WW0 A;  2DWN A;  1G71 A;  3GLI B;  4LF5 M;  1GL6 A;  3UJN A;  3FRI A;  3VKH A;  1OKS A;  2R18 A;  4IBF A;  3SAW A;  4I81 A;  1MX0 A;  3D8B A;  4BB9 A;  2UUC M;  1E9S A;  1EE8 A;  1MJG M;  2JA2 A;  2W82 A;  4LJ4 A;  3GLH A;  4X65 M;  5BR8 M;  3GLF B;  2F5P A;  2DWZ B;  3ZH9 B;  3A98 B;  3HU2 A;  5JI2 E;  3LMM A;  5FTK A;  4A3V B;  4PCZ A;  4X64 M;  3AOE A;  2DAI A;  3SAV A;  1DGH A;  5KO3 A;  1TGU A;  2ZTC A;  1NVM A;  2CV1 A;  2LVA A;  2D7E A;  2R46 A;  2YNM D;  3TE6 A;  4JYA M;  2Y20 A;  1UM8 A;  4L16 A;  1Z59 A;  1VEJ A;  2DZO B;  3WHL A;  4R7G A;  2WSF F;  5KQ8 A;  2JXN A;  2JY5 A;  1L2D A;  3HJ8 A;  5C1B A;  1V34 A;  3GLH E;  1NO1 A;  4LJ8 A;  2LNH C;  5EQT A;  3KXE C;  1A5T A;  2Z7J A;  4XGI A;  3SYL A;  3JAM S;  2QBY B;  2LHG A;  3HGI A;  1XXH E;  3LCV B;  1IY2 A;  4MGK E;  3A42 A;  3CTW B;  4FWG A;  3LW5 F;  1SXJ E;  1NJG A;  3KOY E;  4GKK M;  1R5L A;  2EA0 A;  3VK7 A;  1UFZ A;  1H6U A;  2CWB A;  3T1H M;  2ZAO A;  4ZPX A;  3SC3 A;  4XBO A;  3U61 B;  3C9P A;  1IXS B;  4LJA A;  2KEB A;  3HWS A;  1AIP C;  3Q8X A;  3SMS A;  3AOG A;  1N77 A;  4M0W A;  4LY6 A;  3LCU A;  2OQ4 A;  1OQY A;  2K6B A;  4DR1 M;  2DWL A;  4AI6 A;  3GQ4 A;  1F4I A;  1L2B A;  3KOW E;  4DV4 M;  1S3S A;  3B74 A;  4OU7 A;  1QYR A;  1XNQ M;  1CUK A;  4P16 A;  4DV7 M;  2Z4R A;  4MGH A;  4KO8 A;  1D0K A;  4GEW A;  2VF8 A;  2QNJ A;  3GPY A;  1K3W A;  3SAT A;  3K9O A;  1WXQ A;  5FSW A;  1L8Q A;  4PT5 A;  1IBK M;  4RNA A;  3U6C A;  2O01 F;  4OW0 A;  3VK8 A;  4DR5 M;  1R6B X;  2N35 A;  1HNX M;  2JZ0 A;  3H4J A;  4MM3 B;  4TUW A;  1NV9 A;  3HY5 A;  1G4A E;  2BJV A;  4FWH A;  5DYG A;  1PM5 A;  3L25 A;  1Q3B A;  5LMN M;  1QDT A;  3PXG A;  4L4U A;  3RFW A;  5FTN A;  2R65 A;  3U6S A;  3CF0 A;  3FUX A;  4M9S A;  3M0E A;  2F5N A;  4JI8 M;  1XHB A;  3QYE A;  4X62 M;  4L8R C;  5IT9 S;  2MR9 A;  2ZM6 M;  1MN3 A;  4DR4 M;  2MJ5 B;  4IBE A;  5JI3 E;  3AJI B;  3I01 M;  5DFL A;  3I04 M;  4LFB M;  2LXE A;  1PJT A;  2JNH A;  3SAU A;  1XC8 A;  3SAS A;  1QAM A;  2MH8 A;  2M5Z A;  2V1C A;  1Y8G A;  3A46 A;  4OX9 M;  4R3D A;  1NY5 A;  2K47 A;  1XMQ M;  4IJF A;  1N36 M;  3KFU G;  3FUW A;  1XXH A;  2WZJ A;  3LVV A;  2XFS A;  2VQE M;  4DBG B;  3MHV C;  2LHC A;  3THG A;  1ZMW A;  3E4R A;  1SXJ A;  3KW6 A;  3TWM A;  1GJS A;  5EXX A;  2VDB B;  1QAO A;  1J7K A;  2J5Y A;  4REZ A;  1DGG A;  3U6Q A;  4JI2 M;  1L1Z A;  3QWL A;  3U5Z A;  2DKL A;  2QCU A;  2FOI C;  2NQ8 C;  4KT0 F;  4EIW A;  4L6V 6;  2KZU A;  4JXJ A;  3U6O A;  3HHW A;  2F4V M;  1QAN A;  1WHC A;  2LTU A;  5IZ7 D;  1IXR C;  3QYB A;  1N75 A;  2J7O A;  3WHK A;  1GVN A;  1YE9 A;  4G3O A;  2RGH A;  2LVO C;  1JB0 F;  2QZ4 A;  2WSE F;  2XEP A;  3HHX A;  1NNJ A;  8CAT A;  2X8A A;  2CE7 A;  2C99 A;  3JR5 A;  1SXJ D;  1Z5A A;  4I8O A;  4XK8 F;  1IN5 A;  4FD2 A;  2XGN A;  3OTO M;  3KS4 A;  2G3Q A;  3FRH A;  3TPZ A;  1P3Q Q;  4B3M M;  2OOA A;  3FTC A;  4DUY M;  1RU3 A;  2DHR A;  1OFI A;  1W5T A;  2DEN A;  4LGY A;  3U6L A;  3D8L A;  2J7N A;  1I94 M;  3R9X B;  4LJ9 A;  3LQR A;  4IBJ A;  2DAG A;  4LJ5 A;  1Z6T A;  4LF4 M;  3J7A S;  2XH9 A;  4FW9 A;  1TF0 B;  4OVZ A;  5KPT A;  2R0I A;  1JR3 E;  1NV8 A;  5A2Q S;  2DI0 A;  2UXB M;  1PJS A;  3J7B A;  4Y28 F;  3W68 A;  1QVR A;  4GMQ A;  2CRU A;  4II7 A;  1Q39 A;  2XFT A;  3KS8 A;  5IWA M;  3CGW A;  2QPA A;  4LCB A;  3B7Q A;  3J27 B;  2D7H A;  1IFY A;  5EJC A;  3GLG E;  1Z5B A;  5ITR A;  5DNY A;  5KPZ A;  3T15 A;  4BBA A;  2CHG A;  2EO2 A;  3PNY A;  4NRV A;  4GHA A;  4QHS A;  5H37 D;  2JY6 B;  4MGY E;  1G59 A;  2JP7 A;  3E21 A;  1R2Y A;  4UN2 B;  1J5E M;  3U6D A;  4FCT A;  4GC9 A;  1NJF A;  2DZL A;  3QAU A;  1X37 A;  3W0F A;  2OPF A;  1JR3 A;  2Q2E B;  2YFQ A;  3KOZ E;  4OVZ B;  1DGF A;  2HWJ A;  4PDG A;  2CUZ A;  4X66 M;  2C98 A;  2UUB M;  3UMM A;  3HZJ A;  1LTM A;  1GAB A;  4DUZ M;  2BNK A;  4M0D A;  2E5L M;  4B3R M;  1GKI A;  3KP0 E;  4LRS A;  5EXT A;  2EKK A;  3HX3 A;  4IBD A;  3U6M A;  3TWK A;  4ITQ A;  4IBI A;  1D0L A;  2YR0 A;  1WIV A;  4MH0 E;  1Q02 A;  2Z4S A;  4GC5 A;  4L15 A;  1WR1 B;  1KSF X;  4KOD A;  1BVS A;  3GQ5 A;  4Z6Y A;  2C5R A;  1QZE A;  4RF1 A;  3SMP A;  4GKJ M;  1QQW A;  3AFH A;  3GRV A;  1ORY B;  2RRU A; 
#chains in the Genus database with same CATH homology
 2LHC A;  2FS1 A;  1GJT A;  1GJS A;  2MH8 A;  2VDB B;  2JWS A;  1PRB A;  2J5Y A;  2LHG A;  2N35 A;  1GAB A;  2KDL A;  1TF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...