1VG5A

Solution structure of rsgi ruh-014, a uba domain from arabidopsis cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
GSSGSSGSRQAPIANAAVLPQSQGRVAASEEQIQKLVAMGFDRTQVEVALAAADDDLTVAVEILMSQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rhomboid family protein
publication title Solution Structure of RSGI RUH-014, a UBA domain from Arabidopsis thaliana cDNA
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vg5A00
3IHPA 2L4EA 1UFZA 1KYIA 2JZ0A 2QNJA 3GLGE 2K9DA 1XXHE 1V92A 2DAMA 2JZ1A 1WHCA 2CP8A 1G41A 1HT2E 2O25A 4F1IA 4UN2B 4F2LA 1VG5A 2OO9A 1G3IA 1VEJA 2R0IA 2KNAA 1E94E 2KHHA 3GLHE 1P3QQ 1WGNA 1VDLA 1DO0A 1DV0A 3LCVB 1T6OA 1WR1B 2EKFA 1WIVA 1HQYE 1EFUB 1NV9A 1T43A 2JUJA 1NV8A 2K0BX 2DZLA 1IXSA 1G4AE 1F4IA 2DHYA 1A5TA 1WGLA 2JY7A 2MGWA 2BWEA 3MMPA 2DAGA 3K9OA 1YLAA 1IFYA 2DENA 1ZMUA 2LTUA 2LBCA 4Q7JA 2B3TA 1JR3E 2JY8A 1AIPC 1R4GA 3H4JA 1VEKA 2MJ5B 2LVPC 1C7YA 2MR9A 2QHOB 1DO2A 4G3OA 4R71A 1Y8GA 1OTRA 2G3QA 1XB2B 2WZJA 1ZMWA 1IM2A 1OKSA 4DBGB 1HJPA 2DKLA 2H5XA 1VQ1A 2JP7A 2L4FA 2EJSA 4WP2A 3GLIE 1VEGA 5JI2E 3LCUA 3FRIA 3FRHA 2MROB 1GO5A 1CUKA 2EKKA 3IECA 2ZTDA 1QZEA 3K9PA 3F92A 1TTEA 2LVQD 1OAIA 1TR8A 1ZMVA 2DAKA 2JY5A 3B89A 3E21A 2HAKA 3E46A 2LVNC 2CWBA 2DAEA 2OOAA 3T6PA 1MN3A 2JY6B 2LVOC 2BWBA 2DI0A 4GEWA 1PGYA 2DNAA 2KNVA 2KNZA 3GLFE 2RRUA 3FE3A 2DAIA 1SG9A 4HEOA 2QSFX 1OQYA 1ZV1A 2OOBA 5DFLA 1HT1E 1Q02A 2LVAA 2L2DA 2HWJA 2ZTCA 3BBZA 2JNHA 1BVSA 1WJ7A
chains in the Genus database with same CATH superfamily
3C3EA 4A3VB 1IBLM 4LGMA 3PVSA 4IBIA 5IT9S 2JZ1A 5KO3A 2KRUA 1QUTA 1GLNA 3SC3A 4JYAM 4DR4M 3GLHB 3I01M 4I8OA 4QNRA 1NSFA 5FTMA 4F1IA 1FJGM 4B3RM 4DR1M 1PRBA 2OO9A 4BLCA 1IY2A 4DUZM 1L1ZA 5E26A 1G3IA 5EXPA 2R0IA 3GLHE 3QWLA 4MGKE 1W5TA 4R7GA 1WGNA 4LZJA 1XMQM 3T38A 1N36M 1MX0A 4JI4M 3SMPA 1XNRM 2DWNA 1Z6TA 4IBCA 1WR1B 3IG5A 4WW0A 2EKFA 3SHGB 3HJQA 2KDLA 1HQYE 3U61A 4JI2M 2DXIA 3NBXX 1NV8A 2F5NA 2WSEF 2O5RA 3K2LA 3GQ4A 1C1KA 3CTWB 2YFQA 4OVZB 4B3SM 4JI7M 2EUCA 2FFJA 1Z59A 2MGWA 3HWSA 2OQ4A 3LMMA 2F5SA 4AKIA 4B7FA 3J27B 4NXNM 2D7EA 3GLGB 2LTUA 3SYKA 3UJNA 1NNJA 1QDRA 2X49A 1L2CA 2FNAA 1SXJB 1N78A 2UXCM 4RKUF 2MR9A 1J09A 3W0LB 1YUBA 5E6JA 3VKHA 1IQPA 1G59A 3WHLA 1QZMA 1SXJE 1ZMWA 4EIWA 3KSJA 1OIPA 4Z6YA 4DBGB 1GL6A 3U6LA 3TL4X 1LV7A 1TH2A 2JP7A 2LH0A 2CEAA 1DGBA 3LCUA 3FRIA 3TWMA 4FCTA 5KQDA 3GPYA 1GL7A 3W67A 3QAUA 4KLNA 3B9PA 4HL4A 1QAQA 2JXNA 3GLHA 3ZQJA 3SAWA 2J5YA 4M9XA 2R4EA 2ZTDA 2UUAM 2J7OA 3H4MA 3TWLA 5F3WA 3B74A 1H6UA 3F92A 4FW9A 1IY0A 3VLFB 1G8PA 1IN8A 3GPXA 3GQ3A 2Z8YM 1TTEA 4L6V6 4NSOB 2D7HA 4L78A 4DUYM 1IXSB 1L8QA 3KP1E 3CF2A 2C98A 2DAKA 3B89A 3KS4A 1QANA 3E21A 3KOZE 2R46A 3B7NA 1PM5A 3FUTA 2Y0TA 4B3TM 1G71A 4Z8XA 4W5WA 3M0EA 4JI3M 4LRTA 4CGYB 2BJWA 3D8BA 5FTKA 2QCUA 3FYDA 1KSFX 2LNHC 2EO2A 3HJ8A 4OVZA 4DV6M 4NOOB 4QOZC 3FE3A 2DAIA 1OIZA 4LF5M 3AJIB 4AG5A 1ZV1A 4B7HA 2OOBA 4TUWA 1KFVA 4LF7M 4QOSA 4LJ9A 4DV2M 4LFCM 2HWJA 4QHTA 1WXQA 2JWSA 2R4JA 2DWMA 4DR6M 1JQJC 3HHXA 4R3DA 2L4EA 2KXEA 1SXJA 4FD2A 4K0KM 2JZ0A 1IN6A 2K9DA 5DYIA 4PD2A 1YE9A 1TDHA 1WHCA 3RE8A 2Q2EB 4DR7M 3GRRA 4LGYA 4II7A 1HT2E 3U60B 3RGSA 4D82A 4OU7A 4L15A 4IBDA 1IY1A 3B7ZA 3AOEA 2K6BA 1NY5A 3HHYA 1VG5A 1Z5CA 4ANRA 2XFSA 1K3WA 4IBEA 2O01F 4GKJM 3J7AS 3ZC7B 5LMNM 4CIZA 3JAMS 3A98B 1UM8A 3A46A 3IG8A 4M0WA 4IJFA 5DNYA 3BOSA 5EXXA 1DV0A 1N32M 1SXJC 1T6OA 4IBFA 1V34A 3KVWA 3GLIB 3I4YA 3U6MA 3GRVA 3SARA 2AHMA 2E5LM 1E9SA 2JUJA 3VDPA 2K0BX 3HHZA 3KOYE 2DZLA 5FLXS 1IXSA 2BJVA 3OTOM 1F4IA 3AOEC 4RNAA 2VDBB 3PNYA 3MK6A 1L1TA 3HGIA 3HHWA 2UXDM 1A5TA 3JR5A 3RGPA 2MH8A 4GRIA 5EXTA 2X4AA 3J7BA 3L26A 2DAGA 3JR4A 3LQQA 2M5ZA 4DR5M 4Y28F 4IBBA 2Z4RA 3L27A 1R5LA 2FE8A 4AKGA 2LHGA 3KSXA 3UMMA 4Q7JA 3U6OA 2B3TA 3HU1A 1PJIA 1JR3E 2A5YB 1AIPC 1D2NA 1R4GA 2FOIC 2JY8A 3UK6A 4JV5M 1NJFA 3NBIA 5H37D 3U5ZB 1VEKA 5GKNA 3UGJA 1YSYA 2Y20A 2LVPC 2VIIA 1HR0M 4JI8M 4NRVA 1IXZA 2G8LA 1E32A 5A2QS 2QZ4A 1Y8GA 2KZUA 4DV3M 1HNXM 2VQFM 1Z5BA 1D0LA 1XB2B 3BXWA 4LCBA 5EQTA 3L2AA 3GLFB 4DV1M 1IM2A 1OKSA 1HJPA 3I51A 2APLA 3I4VA 2L4FA 1JB0F 2CV0A 2GQFA 3CF6E 3TPZA 5JI2E 3KXEC 4LRSA 4KT0F 1CUKA 4FWGA 2ZAOA 5FTLA 5BR8M 3U60A 4PDIA 2EKKA 2YQZA 1IN7A 7CATA 1W5SA 4REZA 4PDGA 5ITQA 3HKPA 1EE8A 2J7NA 2XH9A 4BB9A 3R8FA 4CJ6A 4AZFA 4DR2M 2Z4SA 4LJ6A 2JY5A 1TR8A 1ZMVA 2KRKA 2LHCA 2XSZD 4IBJA 2CHQA 5IZ7D 3LW5F 3VFDA 2HHHM 4GH9A 3E46A 4LF9M 2CWBA 2DAEA 3KS8A 4L16A 3HY5A 2QPAA 3M6AA 1GKIA 4IBGA 3T6PA 2LVOC 3J80S 3FUXA 3C3DA 4JI0M 4GEWA 4QNMA 2NQ8C 3FTCA 4I5SA 3U6QA 3LQRA 1R7RA 3FTEA 8CATA 1NO1A 2DVWB 1ORYB 3LVWA 4IJEA 1JR3A 1XHBA 3GPPA 3THGA 1OQYA 2F5OA 4NSRA 2YR0A 3U6CA 2LVAA 3W0FA 4G4QA 3VK7A 2ZTCA 1X37A 1XXHB 1QYRA 1BVSA 4IIWA 4GC5A 4DV4M 1UFZA 1KYIA 2L6OA 2V1UA 1PJJA 4LG2A 1FNNA 4AKHA 3GLGE 2R62A 1XXHE 1K3XA 1V92A 3KP0E 2DAMA 4NL4H 4YHHM 4G4OA 5ITTA 2CP8A 2C9OA 3SAVA 1ZAEA 2R6FA 4UN2B 4AQYM 4KHPM 1HQCA 5EXSA 4GMQA 5LMUM 3VK8A 5EP4A 1IN5A 2EA0A 1RU3A 2RGOA 1VEJA 4X62M 3EIHA 2C9CA 1IXRC 1N75A 1OFIA 2H1RA 2KHHA 3PNVA 4LJ4A 3HZJA 1P3QQ 4WURA 5KPRA 3U6SA 1PJQA 4MB7A 2KZSA 1DO0A 4LFBM 5ITRA 1MU5A 4LJAA 4XBOA 2UUBM 3LCVB 4G4NA 4MGHA 2QQ8A 1QDTA 1GVNA 3U6PA 1NJGA 1OFHA 2Y0QA 3SBJA 2RGHA 3FD9A 1EIJA 4X66M 3GRYA 1G4AE 1R2YA 2QENA 3KDSE 2RKOA 3L29A 2JY7A 3MMPA 2BWEA 4JI6M 2I7NA 2M60A 1R6BX 2DENA 2KW0A 1ZMUA 3E4RA 3M7GA 3D8LA 2D7GA 3ZCBB 4L8RC 5ITUA 1J5EM 3GRUA 3PXGA 2UU9M 3H4JA 3GO8A 1OJLA 2MJ5B 1V33A 2LWXA 1C7YA 1E9RA 1IN4A 4G3OA 4LFAM 4LJ8A 4P16A 1J7KA 3UZUA 3ZH9B 3GLGA 2LXEA 1XXHA 2HCBA 2JA2A 4DV0M 2VF8A 5FSWA 2XLJA 1VQ1A 5JI3E 3MJ5A 4ZPXA 3GLIE 4WP2A 3GPUA 3FYCA 3TE6A 3VDUA 4I81A 1QUSA 3FRHA 4YY3M 2DHRA 2MROB 3SMSA 2XGNA 3I04M 2Y21A 3K92A 3DOAA 1IBKM 1PJSA 3AKZA 4LY6A 1QZEA 4LF8M 1XC8A 2XF3A 2X8AA 3CGWA 2WSCF 2W82A 5ITXE 2LVQD 1TH4A 2R65A 3HX3A 2P5TA 4FWDA 1OAIA 2F4VM 2CHVA 5BPVA 1XWIA 2HAKA 2CV2A 3AOGA 2XFTA 2CUZA 2OPFA 2OOAA 5KPZA 2KA6B 5EP2A 3TWKA 4LF4M 4GITA 3R9XB 1I94M 2ZAMA 4RF0A 2N35A 1N34M 4GHLA 3LVVA 1DGHB 2DI0A 4AI6A 4XGIA 2KNVA 4XK8F 5ITYA 4CISA 4GIPA 1Q3BA 3SFZA 2KNZA 3GLFE 1L2DA 4HEOA 1SG9A 4X64M 2QSFX 5KPTA 5DFLA 3FUWA 1HT1E 1L2BA 5EP3A 1NHWC 3HJSA 2GNOA 2L2DA 3A45A 1AUAA 3ILKA 4B3MM 5L8RF 2JNHA 3L28A 2HL7A 1WJ7A 4M9SA 4G4RA 3IHPA 2XZUA 4D80A 3SATA 3AL0C 2QBYB 2I7PA 2QNJA 1MJGM 2FH0A 5FTJA 4M0DA 3GLIA 3SASA 1G41A 2O25A 3V76A 3PFIA 1HNWM 1LTMA 4JN6A 4F2LA 5KQ8A 2ZM6M 4ITQA 3J2PB 2Z3XA 4AG6A 3AV0A 2V1CA 2KNAA 4RF1A 1JR3D 3HU2A 1E94E 4L4UA 3FKEA 2VQEM 3U6EA 4AW4A 2F5QA 1TGUA 1VDLA 4IBKA 2QP9X 2R18A 2VF7A 1GJTA 3AFHA 1N33M 5ITXA 2CRUA 4LJ7A 4B08A 4DV5M 2XSZA 3Q8XA 1QQWA 2C5RA 4D81A 1WIVA 2DWLA 1EFUB 1NV9A 2K47A 4LJ5A 4NXMM 1T43A 3KW6A 3T15A 3U5ZA 2V6ZM 2L09A 2YNMD 2CE7A 4HLQA 1QAMA 2G5GX 3VKGA 2DHYA 1QAOA 1D0MA 4CHTB 1T3TA 1WGLA 4P17A 4PCZA 3DFZA 3K9OA 1YLAA 4DR3M 3GLFA 1IFYA 1VDDA 3J81S 4OW0A 2LBCA 2Z7JA 2CV1A 1DGHA 2DZNB 4MGIE 2UUCM 1Z5AA 2FS1A 2UXBM 2ZANA 4JXJA 3SHFA 3KFUG 5IWAM 3NWLA 2DZOB 2C96A 5C18A 2QHOB 1Q3CA 1DO2A 1DGFA 3HU3A 3WHKA 4R71A 3SYLA 4FCWA 4DV7M 5EJCA 4FVMA 1OTRA 1K82A 4LF6M 1GJSA 2G3QA 1N77A 1ZQ9A 2WSFF 2WZJA 2ZBKB 5IREB 2F5PA 2ERCA 1SXJD 3GQ5A 1PJTA 1TH3A 2DKLA 1TF0B 1QVRA 2H5XA 1NNUC 3KOWE 4NC6A 4QHSA 4S12A 2EJSA 3CF0A 4KODA 1VEGA 5EP1A 3W68A 2QBYA 4JI5M 1NHGC 4MH0E 1XNQM 3GP1A 2XZFA 1GO5A 3DZDA 2L7HA 2R44A 2C99A 1OAOC 3FUUA 1Q39A 2DWZB 2L7IA 3IECA 3KOXE 4MGZE 2XEPA 1IBMM 3QYEA 3K8ZA 4GHAA 3L25A 4GC9A 3U61B 3K9PA 1GABA 3FTFA 5FTNA 4M9ZA 2KEBA 1R2ZA 3RFWA 3TQSA 2R45A 1NVMA 3QYBA 4PT5A 4B7GA 3U6DA 1HNZM 4FCVA 3T1YM 3FUVA 4BBAA 2LVNC 3B7QA 3Q8GA 4X65M 4G6ZA 1MN3A 1NY6A 2CHGA 2JY6B 3K1JA 4OX9M 2BWBA 3T1HM 3MHVC 4LZZA 1PGYA 4KO8A 2DNAA 4MGYE 1I4WA 3C58A 4GKKM 5DYGA 3C9PA 2RRUA 2BNKA 4JI1M 1D0KA 3A42A 2HKJA 4FWHA 2CFOA 3EIEA 4I4LA 4NRWA 4MM3B 1Q02A 3SAUA 5C1BA 1XMOM 3E9SA 3BBZA 1DGGA 1S3SA 1TDZA 3FTDA 3DA1A
chains in the Genus database with same CATH topology
3IHPA 2L4EA 1UFZA 1KYIA 2JZ0A 2QNJA 3GLGE 2K9DA 1XXHE 1V92A 2DAMA 2JZ1A 1WHCA 2CP8A 1G41A 1HT2E 2O25A 4F1IA 4UN2B 4F2LA 1VG5A 2OO9A 1G3IA 1VEJA 2R0IA 2KNAA 1E94E 2KHHA 3GLHE 1P3QQ 1WGNA 1VDLA 1DO0A 1DV0A 3LCVB 1T6OA 1WR1B 2EKFA 1WIVA 1HQYE 1EFUB 1NV9A 1T43A 2JUJA 1NV8A 2K0BX 2DZLA 1IXSA 1G4AE 1F4IA 2DHYA 1A5TA 1WGLA 2JY7A 2MGWA 2BWEA 3MMPA 2DAGA 3K9OA 1YLAA 1IFYA 2DENA 1ZMUA 2LTUA 2LBCA 4Q7JA 2B3TA 1JR3E 2JY8A 1AIPC 1R4GA 3H4JA 1VEKA 2MJ5B 2LVPC 1C7YA 2MR9A 2QHOB 1DO2A 4G3OA 4R71A 1Y8GA 1OTRA 2G3QA 1XB2B 2WZJA 1ZMWA 1IM2A 1OKSA 4DBGB 1HJPA 2DKLA 2H5XA 1VQ1A 2JP7A 2L4FA 2EJSA 4WP2A 3GLIE 1VEGA 5JI2E 3LCUA 3FRIA 3FRHA 2MROB 1GO5A 1CUKA 2EKKA 3IECA 2ZTDA 1QZEA 3K9PA 3F92A 1TTEA 2LVQD 1OAIA 1TR8A 1ZMVA 2DAKA 2JY5A 3B89A 3E21A 2HAKA 3E46A 2LVNC 2CWBA 2DAEA 2OOAA 3T6PA 1MN3A 2JY6B 2LVOC 2BWBA 2DI0A 4GEWA 1PGYA 2DNAA 2KNVA 2KNZA 3GLFE 2RRUA 3FE3A 2DAIA 1SG9A 4HEOA 2QSFX 1OQYA 1ZV1A 2OOBA 5DFLA 1HT1E 1Q02A 2LVAA 2L2DA 2HWJA 2ZTCA 3BBZA 2JNHA 1BVSA 1WJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHP A;  2L4E A;  1UFZ A;  1KYI A;  2JZ0 A;  2QNJ A;  3GLG E;  2K9D A;  1XXH E;  1V92 A;  2DAM A;  2JZ1 A;  1WHC A;  2CP8 A;  1G41 A;  1HT2 E;  2O25 A;  4F1I A;  4UN2 B;  4F2L A;  1VG5 A;  2OO9 A;  1G3I A;  1VEJ A;  2R0I A;  2KNA A;  1E94 E;  2KHH A;  3GLH E;  1P3Q Q;  1WGN A;  1VDL A;  1DO0 A;  1DV0 A;  3LCV B;  1T6O A;  1WR1 B;  2EKF A;  1WIV A;  1HQY E;  1EFU B;  1NV9 A;  1T43 A;  2JUJ A;  1NV8 A;  2K0B X;  2DZL A;  1IXS A;  1G4A E;  1F4I A;  2DHY A;  1A5T A;  1WGL A;  2JY7 A;  2MGW A;  2BWE A;  3MMP A;  2DAG A;  3K9O A;  1YLA A;  1IFY A;  2DEN A;  1ZMU A;  2LTU A;  2LBC A;  4Q7J A;  2B3T A;  1JR3 E;  2JY8 A;  1AIP C;  1R4G A;  3H4J A;  1VEK A;  2MJ5 B;  2LVP C;  1C7Y A;  2MR9 A;  2QHO B;  1DO2 A;  4G3O A;  4R71 A;  1Y8G A;  1OTR A;  2G3Q A;  1XB2 B;  2WZJ A;  1ZMW A;  1IM2 A;  1OKS A;  4DBG B;  1HJP A;  2DKL A;  2H5X A;  1VQ1 A;  2JP7 A;  2L4F A;  2EJS A;  4WP2 A;  3GLI E;  1VEG A;  5JI2 E;  3LCU A;  3FRI A;  3FRH A;  2MRO B;  1GO5 A;  1CUK A;  2EKK A;  3IEC A;  2ZTD A;  1QZE A;  3K9P A;  3F92 A;  1TTE A;  2LVQ D;  1OAI A;  1TR8 A;  1ZMV A;  2DAK A;  2JY5 A;  3B89 A;  3E21 A;  2HAK A;  3E46 A;  2LVN C;  2CWB A;  2DAE A;  2OOA A;  3T6P A;  1MN3 A;  2JY6 B;  2LVO C;  2BWB A;  2DI0 A;  4GEW A;  1PGY A;  2DNA A;  2KNV A;  2KNZ A;  3GLF E;  2RRU A;  3FE3 A;  2DAI A;  1SG9 A;  4HEO A;  2QSF X;  1OQY A;  1ZV1 A;  2OOB A;  5DFL A;  1HT1 E;  1Q02 A;  2LVA A;  2L2D A;  2HWJ A;  2ZTC A;  3BBZ A;  2JNH A;  1BVS A;  1WJ7 A; 
#chains in the Genus database with same CATH topology
 3C3E A;  4A3V B;  1IBL M;  4LGM A;  3PVS A;  4IBI A;  5IT9 S;  2JZ1 A;  5KO3 A;  2KRU A;  1QUT A;  1GLN A;  3SC3 A;  4JYA M;  4DR4 M;  3GLH B;  3I01 M;  4I8O A;  4QNR A;  1NSF A;  5FTM A;  4F1I A;  1FJG M;  4B3R M;  4DR1 M;  1PRB A;  2OO9 A;  4BLC A;  1IY2 A;  4DUZ M;  1L1Z A;  5E26 A;  1G3I A;  5EXP A;  2R0I A;  3GLH E;  3QWL A;  4MGK E;  1W5T A;  4R7G A;  1WGN A;  4LZJ A;  1XMQ M;  3T38 A;  1N36 M;  1MX0 A;  4JI4 M;  3SMP A;  1XNR M;  2DWN A;  1Z6T A;  4IBC A;  1WR1 B;  3IG5 A;  4WW0 A;  2EKF A;  3SHG B;  3HJQ A;  2KDL A;  1HQY E;  3U61 A;  4JI2 M;  2DXI A;  3NBX X;  1NV8 A;  2F5N A;  2WSE F;  2O5R A;  3K2L A;  3GQ4 A;  1C1K A;  3CTW B;  2YFQ A;  4OVZ B;  4B3S M;  4JI7 M;  2EUC A;  2FFJ A;  1Z59 A;  2MGW A;  3HWS A;  2OQ4 A;  3LMM A;  2F5S A;  4AKI A;  4B7F A;  3J27 B;  4NXN M;  2D7E A;  3GLG B;  2LTU A;  3SYK A;  3UJN A;  1NNJ A;  1QDR A;  2X49 A;  1L2C A;  2FNA A;  1SXJ B;  1N78 A;  2UXC M;  4RKU F;  2MR9 A;  1J09 A;  3W0L B;  1YUB A;  5E6J A;  3VKH A;  1IQP A;  1G59 A;  3WHL A;  1QZM A;  1SXJ E;  1ZMW A;  4EIW A;  3KSJ A;  1OIP A;  4Z6Y A;  4DBG B;  1GL6 A;  3U6L A;  3TL4 X;  1LV7 A;  1TH2 A;  2JP7 A;  2LH0 A;  2CEA A;  1DGB A;  3LCU A;  3FRI A;  3TWM A;  4FCT A;  5KQD A;  3GPY A;  1GL7 A;  3W67 A;  3QAU A;  4KLN A;  3B9P A;  4HL4 A;  1QAQ A;  2JXN A;  3GLH A;  3ZQJ A;  3SAW A;  2J5Y A;  4M9X A;  2R4E A;  2ZTD A;  2UUA M;  2J7O A;  3H4M A;  3TWL A;  5F3W A;  3B74 A;  1H6U A;  3F92 A;  4FW9 A;  1IY0 A;  3VLF B;  1G8P A;  1IN8 A;  3GPX A;  3GQ3 A;  2Z8Y M;  1TTE A;  4L6V 6;  4NSO B;  2D7H A;  4L78 A;  4DUY M;  1IXS B;  1L8Q A;  3KP1 E;  3CF2 A;  2C98 A;  2DAK A;  3B89 A;  3KS4 A;  1QAN A;  3E21 A;  3KOZ E;  2R46 A;  3B7N A;  1PM5 A;  3FUT A;  2Y0T A;  4B3T M;  1G71 A;  4Z8X A;  4W5W A;  3M0E A;  4JI3 M;  4LRT A;  4CGY B;  2BJW A;  3D8B A;  5FTK A;  2QCU A;  3FYD A;  1KSF X;  2LNH C;  2EO2 A;  3HJ8 A;  4OVZ A;  4DV6 M;  4NOO B;  4QOZ C;  3FE3 A;  2DAI A;  1OIZ A;  4LF5 M;  3AJI B;  4AG5 A;  1ZV1 A;  4B7H A;  2OOB A;  4TUW A;  1KFV A;  4LF7 M;  4QOS A;  4LJ9 A;  4DV2 M;  4LFC M;  2HWJ A;  4QHT A;  1WXQ A;  2JWS A;  2R4J A;  2DWM A;  4DR6 M;  1JQJ C;  3HHX A;  4R3D A;  2L4E A;  2KXE A;  1SXJ A;  4FD2 A;  4K0K M;  2JZ0 A;  1IN6 A;  2K9D A;  5DYI A;  4PD2 A;  1YE9 A;  1TDH A;  1WHC A;  3RE8 A;  2Q2E B;  4DR7 M;  3GRR A;  4LGY A;  4II7 A;  1HT2 E;  3U60 B;  3RGS A;  4D82 A;  4OU7 A;  4L15 A;  4IBD A;  1IY1 A;  3B7Z A;  3AOE A;  2K6B A;  1NY5 A;  3HHY A;  1VG5 A;  1Z5C A;  4ANR A;  2XFS A;  1K3W A;  4IBE A;  2O01 F;  4GKJ M;  3J7A S;  3ZC7 B;  5LMN M;  4CIZ A;  3JAM S;  3A98 B;  1UM8 A;  3A46 A;  3IG8 A;  4M0W A;  4IJF A;  5DNY A;  3BOS A;  5EXX A;  1DV0 A;  1N32 M;  1SXJ C;  1T6O A;  4IBF A;  1V34 A;  3KVW A;  3GLI B;  3I4Y A;  3U6M A;  3GRV A;  3SAR A;  2AHM A;  2E5L M;  1E9S A;  2JUJ A;  3VDP A;  2K0B X;  3HHZ A;  3KOY E;  2DZL A;  5FLX S;  1IXS A;  2BJV A;  3OTO M;  1F4I A;  3AOE C;  4RNA A;  2VDB B;  3PNY A;  3MK6 A;  1L1T A;  3HGI A;  3HHW A;  2UXD M;  1A5T A;  3JR5 A;  3RGP A;  2MH8 A;  4GRI A;  5EXT A;  2X4A A;  3J7B A;  3L26 A;  2DAG A;  3JR4 A;  3LQQ A;  2M5Z A;  4DR5 M;  4Y28 F;  4IBB A;  2Z4R A;  3L27 A;  1R5L A;  2FE8 A;  4AKG A;  2LHG A;  3KSX A;  3UMM A;  4Q7J A;  3U6O A;  2B3T A;  3HU1 A;  1PJI A;  1JR3 E;  2A5Y B;  1AIP C;  1D2N A;  1R4G A;  2FOI C;  2JY8 A;  3UK6 A;  4JV5 M;  1NJF A;  3NBI A;  5H37 D;  3U5Z B;  1VEK A;  5GKN A;  3UGJ A;  1YSY A;  2Y20 A;  2LVP C;  2VII A;  1HR0 M;  4JI8 M;  4NRV A;  1IXZ A;  2G8L A;  1E32 A;  5A2Q S;  2QZ4 A;  1Y8G A;  2KZU A;  4DV3 M;  1HNX M;  2VQF M;  1Z5B A;  1D0L A;  1XB2 B;  3BXW A;  4LCB A;  5EQT A;  3L2A A;  3GLF B;  4DV1 M;  1IM2 A;  1OKS A;  1HJP A;  3I51 A;  2APL A;  3I4V A;  2L4F A;  1JB0 F;  2CV0 A;  2GQF A;  3CF6 E;  3TPZ A;  5JI2 E;  3KXE C;  4LRS A;  4KT0 F;  1CUK A;  4FWG A;  2ZAO A;  5FTL A;  5BR8 M;  3U60 A;  4PDI A;  2EKK A;  2YQZ A;  1IN7 A;  7CAT A;  1W5S A;  4REZ A;  4PDG A;  5ITQ A;  3HKP A;  1EE8 A;  2J7N A;  2XH9 A;  4BB9 A;  3R8F A;  4CJ6 A;  4AZF A;  4DR2 M;  2Z4S A;  4LJ6 A;  2JY5 A;  1TR8 A;  1ZMV A;  2KRK A;  2LHC A;  2XSZ D;  4IBJ A;  2CHQ A;  5IZ7 D;  3LW5 F;  3VFD A;  2HHH M;  4GH9 A;  3E46 A;  4LF9 M;  2CWB A;  2DAE A;  3KS8 A;  4L16 A;  3HY5 A;  2QPA A;  3M6A A;  1GKI A;  4IBG A;  3T6P A;  2LVO C;  3J80 S;  3FUX A;  3C3D A;  4JI0 M;  4GEW A;  4QNM A;  2NQ8 C;  3FTC A;  4I5S A;  3U6Q A;  3LQR A;  1R7R A;  3FTE A;  8CAT A;  1NO1 A;  2DVW B;  1ORY B;  3LVW A;  4IJE A;  1JR3 A;  1XHB A;  3GPP A;  3THG A;  1OQY A;  2F5O A;  4NSR A;  2YR0 A;  3U6C A;  2LVA A;  3W0F A;  4G4Q A;  3VK7 A;  2ZTC A;  1X37 A;  1XXH B;  1QYR A;  1BVS A;  4IIW A;  4GC5 A;  4DV4 M;  1UFZ A;  1KYI A;  2L6O A;  2V1U A;  1PJJ A;  4LG2 A;  1FNN A;  4AKH A;  3GLG E;  2R62 A;  1XXH E;  1K3X A;  1V92 A;  3KP0 E;  2DAM A;  4NL4 H;  4YHH M;  4G4O A;  5ITT A;  2CP8 A;  2C9O A;  3SAV A;  1ZAE A;  2R6F A;  4UN2 B;  4AQY M;  4KHP M;  1HQC A;  5EXS A;  4GMQ A;  5LMU M;  3VK8 A;  5EP4 A;  1IN5 A;  2EA0 A;  1RU3 A;  2RGO A;  1VEJ A;  4X62 M;  3EIH A;  2C9C A;  1IXR C;  1N75 A;  1OFI A;  2H1R A;  2KHH A;  3PNV A;  4LJ4 A;  3HZJ A;  1P3Q Q;  4WUR A;  5KPR A;  3U6S A;  1PJQ A;  4MB7 A;  2KZS A;  1DO0 A;  4LFB M;  5ITR A;  1MU5 A;  4LJA A;  4XBO A;  2UUB M;  3LCV B;  4G4N A;  4MGH A;  2QQ8 A;  1QDT A;  1GVN A;  3U6P A;  1NJG A;  1OFH A;  2Y0Q A;  3SBJ A;  2RGH A;  3FD9 A;  1EIJ A;  4X66 M;  3GRY A;  1G4A E;  1R2Y A;  2QEN A;  3KDS E;  2RKO A;  3L29 A;  2JY7 A;  3MMP A;  2BWE A;  4JI6 M;  2I7N A;  2M60 A;  1R6B X;  2DEN A;  2KW0 A;  1ZMU A;  3E4R A;  3M7G A;  3D8L A;  2D7G A;  3ZCB B;  4L8R C;  5ITU A;  1J5E M;  3GRU A;  3PXG A;  2UU9 M;  3H4J A;  3GO8 A;  1OJL A;  2MJ5 B;  1V33 A;  2LWX A;  1C7Y A;  1E9R A;  1IN4 A;  4G3O A;  4LFA M;  4LJ8 A;  4P16 A;  1J7K A;  3UZU A;  3ZH9 B;  3GLG A;  2LXE A;  1XXH A;  2HCB A;  2JA2 A;  4DV0 M;  2VF8 A;  5FSW A;  2XLJ A;  1VQ1 A;  5JI3 E;  3MJ5 A;  4ZPX A;  3GLI E;  4WP2 A;  3GPU A;  3FYC A;  3TE6 A;  3VDU A;  4I81 A;  1QUS A;  3FRH A;  4YY3 M;  2DHR A;  2MRO B;  3SMS A;  2XGN A;  3I04 M;  2Y21 A;  3K92 A;  3DOA A;  1IBK M;  1PJS A;  3AKZ A;  4LY6 A;  1QZE A;  4LF8 M;  1XC8 A;  2XF3 A;  2X8A A;  3CGW A;  2WSC F;  2W82 A;  5ITX E;  2LVQ D;  1TH4 A;  2R65 A;  3HX3 A;  2P5T A;  4FWD A;  1OAI A;  2F4V M;  2CHV A;  5BPV A;  1XWI A;  2HAK A;  2CV2 A;  3AOG A;  2XFT A;  2CUZ A;  2OPF A;  2OOA A;  5KPZ A;  2KA6 B;  5EP2 A;  3TWK A;  4LF4 M;  4GIT A;  3R9X B;  1I94 M;  2ZAM A;  4RF0 A;  2N35 A;  1N34 M;  4GHL A;  3LVV A;  1DGH B;  2DI0 A;  4AI6 A;  4XGI A;  2KNV A;  4XK8 F;  5ITY A;  4CIS A;  4GIP A;  1Q3B A;  3SFZ A;  2KNZ A;  3GLF E;  1L2D A;  4HEO A;  1SG9 A;  4X64 M;  2QSF X;  5KPT A;  5DFL A;  3FUW A;  1HT1 E;  1L2B A;  5EP3 A;  1NHW C;  3HJS A;  2GNO A;  2L2D A;  3A45 A;  1AUA A;  3ILK A;  4B3M M;  5L8R F;  2JNH A;  3L28 A;  2HL7 A;  1WJ7 A;  4M9S A;  4G4R A;  3IHP A;  2XZU A;  4D80 A;  3SAT A;  3AL0 C;  2QBY B;  2I7P A;  2QNJ A;  1MJG M;  2FH0 A;  5FTJ A;  4M0D A;  3GLI A;  3SAS A;  1G41 A;  2O25 A;  3V76 A;  3PFI A;  1HNW M;  1LTM A;  4JN6 A;  4F2L A;  5KQ8 A;  2ZM6 M;  4ITQ A;  3J2P B;  2Z3X A;  4AG6 A;  3AV0 A;  2V1C A;  2KNA A;  4RF1 A;  1JR3 D;  3HU2 A;  1E94 E;  4L4U A;  3FKE A;  2VQE M;  3U6E A;  4AW4 A;  2F5Q A;  1TGU A;  1VDL A;  4IBK A;  2QP9 X;  2R18 A;  2VF7 A;  1GJT A;  3AFH A;  1N33 M;  5ITX A;  2CRU A;  4LJ7 A;  4B08 A;  4DV5 M;  2XSZ A;  3Q8X A;  1QQW A;  2C5R A;  4D81 A;  1WIV A;  2DWL A;  1EFU B;  1NV9 A;  2K47 A;  4LJ5 A;  4NXM M;  1T43 A;  3KW6 A;  3T15 A;  3U5Z A;  2V6Z M;  2L09 A;  2YNM D;  2CE7 A;  4HLQ A;  1QAM A;  2G5G X;  3VKG A;  2DHY A;  1QAO A;  1D0M A;  4CHT B;  1T3T A;  1WGL A;  4P17 A;  4PCZ A;  3DFZ A;  3K9O A;  1YLA A;  4DR3 M;  3GLF A;  1IFY A;  1VDD A;  3J81 S;  4OW0 A;  2LBC A;  2Z7J A;  2CV1 A;  1DGH A;  2DZN B;  4MGI E;  2UUC M;  1Z5A A;  2FS1 A;  2UXB M;  2ZAN A;  4JXJ A;  3SHF A;  3KFU G;  5IWA M;  3NWL A;  2DZO B;  2C96 A;  5C18 A;  2QHO B;  1Q3C A;  1DO2 A;  1DGF A;  3HU3 A;  3WHK A;  4R71 A;  3SYL A;  4FCW A;  4DV7 M;  5EJC A;  4FVM A;  1OTR A;  1K82 A;  4LF6 M;  1GJS A;  2G3Q A;  1N77 A;  1ZQ9 A;  2WSF F;  2WZJ A;  2ZBK B;  5IRE B;  2F5P A;  2ERC A;  1SXJ D;  3GQ5 A;  1PJT A;  1TH3 A;  2DKL A;  1TF0 B;  1QVR A;  2H5X A;  1NNU C;  3KOW E;  4NC6 A;  4QHS A;  4S12 A;  2EJS A;  3CF0 A;  4KOD A;  1VEG A;  5EP1 A;  3W68 A;  2QBY A;  4JI5 M;  1NHG C;  4MH0 E;  1XNQ M;  3GP1 A;  2XZF A;  1GO5 A;  3DZD A;  2L7H A;  2R44 A;  2C99 A;  1OAO C;  3FUU A;  1Q39 A;  2DWZ B;  2L7I A;  3IEC A;  3KOX E;  4MGZ E;  2XEP A;  1IBM M;  3QYE A;  3K8Z A;  4GHA A;  3L25 A;  4GC9 A;  3U61 B;  3K9P A;  1GAB A;  3FTF A;  5FTN A;  4M9Z A;  2KEB A;  1R2Z A;  3RFW A;  3TQS A;  2R45 A;  1NVM A;  3QYB A;  4PT5 A;  4B7G A;  3U6D A;  1HNZ M;  4FCV A;  3T1Y M;  3FUV A;  4BBA A;  2LVN C;  3B7Q A;  3Q8G A;  4X65 M;  4G6Z A;  1MN3 A;  1NY6 A;  2CHG A;  2JY6 B;  3K1J A;  4OX9 M;  2BWB A;  3T1H M;  3MHV C;  4LZZ A;  1PGY A;  4KO8 A;  2DNA A;  4MGY E;  1I4W A;  3C58 A;  4GKK M;  5DYG A;  3C9P A;  2RRU A;  2BNK A;  4JI1 M;  1D0K A;  3A42 A;  2HKJ A;  4FWH A;  2CFO A;  3EIE A;  4I4L A;  4NRW A;  4MM3 B;  1Q02 A;  3SAU A;  5C1B A;  1XMO M;  3E9S A;  3BBZ A;  1DGG A;  1S3S A;  1TDZ A;  3FTD A;  3DA1 A; 
#chains in the Genus database with same CATH homology
 3IHP A;  2L4E A;  1UFZ A;  1KYI A;  2JZ0 A;  2QNJ A;  3GLG E;  2K9D A;  1XXH E;  1V92 A;  2DAM A;  2JZ1 A;  1WHC A;  2CP8 A;  1G41 A;  1HT2 E;  2O25 A;  4F1I A;  4UN2 B;  4F2L A;  1VG5 A;  2OO9 A;  1G3I A;  1VEJ A;  2R0I A;  2KNA A;  1E94 E;  2KHH A;  3GLH E;  1P3Q Q;  1WGN A;  1VDL A;  1DO0 A;  1DV0 A;  3LCV B;  1T6O A;  1WR1 B;  2EKF A;  1WIV A;  1HQY E;  1EFU B;  1NV9 A;  1T43 A;  2JUJ A;  1NV8 A;  2K0B X;  2DZL A;  1IXS A;  1G4A E;  1F4I A;  2DHY A;  1A5T A;  1WGL A;  2JY7 A;  2MGW A;  2BWE A;  3MMP A;  2DAG A;  3K9O A;  1YLA A;  1IFY A;  2DEN A;  1ZMU A;  2LTU A;  2LBC A;  4Q7J A;  2B3T A;  1JR3 E;  2JY8 A;  1AIP C;  1R4G A;  3H4J A;  1VEK A;  2MJ5 B;  2LVP C;  1C7Y A;  2MR9 A;  2QHO B;  1DO2 A;  4G3O A;  4R71 A;  1Y8G A;  1OTR A;  2G3Q A;  1XB2 B;  2WZJ A;  1ZMW A;  1IM2 A;  1OKS A;  4DBG B;  1HJP A;  2DKL A;  2H5X A;  1VQ1 A;  2JP7 A;  2L4F A;  2EJS A;  4WP2 A;  3GLI E;  1VEG A;  5JI2 E;  3LCU A;  3FRI A;  3FRH A;  2MRO B;  1GO5 A;  1CUK A;  2EKK A;  3IEC A;  2ZTD A;  1QZE A;  3K9P A;  3F92 A;  1TTE A;  2LVQ D;  1OAI A;  1TR8 A;  1ZMV A;  2DAK A;  2JY5 A;  3B89 A;  3E21 A;  2HAK A;  3E46 A;  2LVN C;  2CWB A;  2DAE A;  2OOA A;  3T6P A;  1MN3 A;  2JY6 B;  2LVO C;  2BWB A;  2DI0 A;  4GEW A;  1PGY A;  2DNA A;  2KNV A;  2KNZ A;  3GLF E;  2RRU A;  3FE3 A;  2DAI A;  1SG9 A;  4HEO A;  2QSF X;  1OQY A;  1ZV1 A;  2OOB A;  5DFL A;  1HT1 E;  1Q02 A;  2LVA A;  2L2D A;  2HWJ A;  2ZTC A;  3BBZ A;  2JNH A;  1BVS A;  1WJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...