1VG5A

Solution structure of rsgi ruh-014, a uba domain from arabidopsis cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
GSSGSSGSRQAPIANAAVLPQSQGRVAASEEQIQKLVAMGFDRTQVEVALAAADDDLTVAVEILMSQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords rhomboid family protein
publication title Solution Structure of RSGI RUH-014, a UBA domain from Arabidopsis thaliana cDNA
rcsb
source organism Arabidopsis thaliana
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vg5A00
2JY6B 2DAEA 1UFZA 1OAIA 1T43A 2JP7A 1R4GA 1TTEA 1MN3A 1PGYA 4HEOA 2EJSA 3IECA 2OO9A 2DNAA 1SG9A 2L4FA 1IXSA 3GLFE 1HT1E 2EKKA 4F1IA 2BWEA 2G3QA 1DO2A 2JNHA 1GO5A 2LVNC 3FE3A 1CUKA 3LCUA 1XB2B 1ZMWA 3E46A 1T6OA 4UN2B 5JI2E 2DAGA 2L2DA 1Q02A 1XXHE 1BVSA 3E21A 3K9PA 2DZLA 3H4JA 4F2LA 3K9OA 1IM2A 1E94E 1NV8A 1VEKA 2KHHA 2LVPC 2CWBA 3LCVB 1JR3E 1OKSA 2OOBA 3B89A 1ZV1A 1G3IA 1NV9A 2HAKA 2HWJA 2QHOB 1WIVA 2QSFX 1WGNA 1ZMUA 1VDLA 1WR1B 3F92A 2H5XA 1ZMVA 4R71A 2EKFA 1KYIA 2BWBA 1WJ7A 1F4IA 3BBZA 2DENA 2JZ1A 2R0IA 3GLIE 3FRIA 1AIPC 1VG5A 4Q7JA 2K9DA 3IHPA 1OQYA 2DI0A 2B3TA 1VEJA 2KNVA 1V92A 1WGLA 2QNJA 3GLGE 2DAMA 2LVOC 4DBGB 2LTUA 4GEWA 1TR8A 2MGWA 1EFUB 2WZJA 1WHCA 1IFYA 2DKLA 2JZ0A 2JY8A 3GLHE 2LVQD 3MMPA 3FRHA 4WP2A 2JUJA 2MJ5B 2ZTDA 2L4EA 2O25A 2DAKA 1HQYE 5DFLA 1DV0A 1DO0A 2JY7A 1A5TA 1G41A 2LBCA 2DAIA 2K0BX 2RRUA 2LVAA 1C7YA 1HJPA 1OTRA 2ZTCA 1YLAA 3T6PA 2MR9A 1Y8GA 1HT2E 2DHYA 2MROB 2JY5A 1VEGA 1G4AE 2KNAA 2OOAA 2KNZA 1VQ1A 1QZEA 2CP8A 4G3OA 1P3QQ
chains in the Genus database with same CATH superfamily
1UFZA 1T43A 1TTEA 1MN3A 1IN5A 1L1ZA 2RGHA 3FUVA 1SG9A 3MK6A 2VF8A 4LGMA 5ITYA 4GKKM 1TDHA 2L4FA 2L6OA 2KW0A 3LVVA 3GLFE 4F1IA 1JQJC 2BWEA 1HQCA 4L8RC 2FH0A 3LCUA 2L09A 1GJSA 4P17A 4NL4H 2XFTA 3E9SA 3SHGB 2O01F 1T6OA 4XGIA 1G71A 1I4WA 5JI2E 5ITTA 1PM5A 2DAGA 4XK8F 4FWGA 4B3MM 2L2DA 4FCVA 1DGHB 3J80S 1BVSA 4PDGA 1IN7A 1R6BX 3E21A 4W5WA 4CIZA 4FCTA 3H4JA 4L15A 3HHZA 3HKPA 4DV3M 4FWDA 4LF8M 3GPXA 2BJWA 1JR3A 1PJSA 1MJGM 4I8OA 1SXJB 2A5YB 2LVPC 4IJEA 4RNAA 3LCVB 4X66M 5L8RF 5FLXS 5JI3E 2XGNA 1YUBA 4IBCA 3UZUA 3K8ZA 1D0KA 1D0LA 2XFSA 3D8BA 3GLHA 4G4QA 2X8AA 1PJTA 2N35A 3HY5A 3AOGA 1WIVA 3DZDA 1WGNA 1ZMUA 2P5TA 3F92A 1WR1B 2H5XA 2FFJA 5IWAM 3AOEA 1J7KA 1IXZA 4JI0M 2UUBM 2R46A 2KDLA 4X62M 2OPFA 4LJ4A 3GLFB 2DENA 1KSFX 1GLNA 5EP2A 3FYDA 3SMPA 4G4RA 3JAMS 2KA6B 3CF2A 4NC6A 4BB9A 1QQWA 3M7GA 3U6CA 3VDUA 3B7QA 3IHPA 3SAWA 5EJCA 2B3TA 2KNVA 3DOAA 2CUZA 3SYKA 4YY3M 2QNJA 1PJJA 3JR5A 5KPZA 2EUCA 1FNNA 1TR8A 5C18A 1W5SA 2KEBA 3VFDA 4LJ5A 2JZ0A 1IBMM 3C3DA 3CGWA 3GLHE 2CHVA 3GRVA 3PNYA 3SAUA 3KP0E 4AI6A 1C1KA 4II7A 4GH9A 4LZJA 3U6SA 3VK8A 2ZTDA 2O25A 3ILKA 1GJTA 4DV2M 2LHGA 1OIZA 2O5RA 4LJ8A 4NRWA 1L2DA 4K0KM 4KODA 1A5TA 3AJIB 2K0BX 1N36M 2RRUA 5DYGA 4FCWA 3GO8A 1C7YA 3UK6A 1XMQM 1V33A 3CF0A 4JI2M 1YE9A 3U6EA 3J7BA 5LMUM 2KXEA 3AKZA 4AQYM 1TH3A 2XZUA 4I4LA 1NO1A 2DWMA 1E9SA 4B3SM 4HL4A 4GKJM 3CTWB 4Y28F 1G4AE 2XEPA 3HU3A 4GIPA 3AFHA 1P3QQ 2ZAMA 3UJNA 2JY6B 2DAEA 3HU1A 3B74A 1LTMA 4HEOA 4PT5A 3GQ5A 1QZMA 2UUAM 4L6V6 4RKUF 3LQRA 2J7OA 1G59A 2QP9X 4NXMM 2X49A 2Z3XA 3L25A 4JN6A 5ITQA 1NNUC 2EKKA 3GLHB 4TUWA 3T1YM 1GO5A 2L7HA 4KT0F 3TPZA 3KP1E 3VLFB 1CUKA 1XB2B 3TQSA 4YHHM 3E46A 4AW4A 2QBYB 1L1TA 2YR0A 4L16A 5ITRA 1K3XA 3QWLA 5KQDA 5EXPA 2APLA 2VDBB 4DV6M 4B3TM 3GQ4A 2HKJA 1NJFA 1Z6TA 4M9ZA 2YNMD 1EE8A 7CATA 4DR3M 1NY5A 3L28A 3SYLA 3KOYE 4NXNM 3RE8A 3WHLA 4LJ7A 3JR4A 2J7NA 1UM8A 2YFQA 3I4VA 3K9OA 1E94E 1XNQM 1NV8A 3Q8XA 2KHHA 3C58A 1H6UA 2C99A 3L29A 2OOBA 3K92A 2Z4RA 4FW9A 5EP1A 2LWXA 3TWKA 4IBFA 1ZV1A 1G3IA 1N34M 4JI1M 4JV5M 3M0EA 4IBJA 1NV9A 2CEAA 2HAKA 2DWLA 1Z59A 4LY6A 4FVMA 4CGYB 2QSFX 3C3EA 4FWHA 3THGA 4LFCM 1ZMVA 3H4MA 2GQFA 2EKFA 1KYIA 2C9CA 1Z5CA 3KS8A 2EA0A 3HGIA 1IY0A 3FTDA 3FUUA 1QANA 2R62A 2R0IA 1AIPC 1VG5A 4PDIA 3ZCBB 4R7GA 4LG2A 2J5YA 2K9DA 4GC9A 1NY6A 3HU2A 3PNVA 1E32A 1Q3CA 1ZQ9A 1V92A 4MH0E 1WGLA 3RFWA 4JI6M 4GHLA 2DAMA 4DBGB 4EIWA 1PRBA 2F4VM 3R9XB 5FTLA 1TF0B 2MH8A 2FOIC 3A45A 1SXJD 1EFUB 2XSZA 1NHGC 3KOZE 1IFYA 3BXWA 2R6FA 2DKLA 2JA2A 5EXXA 4GMQA 4AKIA 2JY8A 1IN4A 1X37A 1QVRA 2JWSA 2XZFA 4LJ9A 2LVQD 3D8LA 2Y0QA 2QBYA 3VDPA 3SMSA 4CJ6A 4DV1M 4KO8A 2JUJA 2R65A 5KQ8A 4LF4M 3FTCA 4B08A 1HR0M 2F5SA 2WSFF 1N78A 1GL7A 2I7PA 4XBOA 2HL7A 3T1HM 1NHWC 5E6JA 3W0FA 5DFLA 3VK7A 1DV0A 1DO0A 2KZSA 3FTEA 3LQQA 2LHCA 3U6PA 3QYEA 1NJGA 2DAIA 2FNAA 2VIIA 1XWIA 1J5EM 4LF7M 2CE7A 4X65M 3TWMA 3SBJA 3C9PA 1R7RA 2Z4SA 3NWLA 3QYBA 4LF5M 3U6LA 1R5LA 2C96A 1D0MA 3T6PA 1N75A 4KHPM 3ZC7B 3FUTA 3TE6A 4NSRA 3KOXE 3SAVA 2EO2A 1OFHA 2KNAA 1VEGA 2DWNA 3L26A 2HCBA 3DA1A 4IBIA 4AG5A 4PD2A 1QDRA 4QNMA 3EIHA 1LV7A 4G4NA 3UMMA 3IG5A 1OAIA 4NSOB 2UXBM 2V1UA 1PGYA 2CRUA 2RKOA 3GRYA 2F5OA 2EJSA 1EIJA 3W67A 3VKHA 4DV4M 2D7GA 1IXSA 4G4OA 1DGBA 3I01M 3KSXA 2C98A 5ITXA 4OVZA 4ZPXA 2JNHA 1IBKM 3LMMA 2DHRA 1ZMWA 3J2PB 2KZUA 3GPYA 4S12A 5EXSA 4LFAM 3A42A 2VQFM 2K47A 2R18A 2W82A 1XC8A 4UN2B 3PFIA 2DVWB 5IZ7D 4MM3B 3U6OA 2UU9M 1N77A 3FYCA 2R44A 1Q02A 1XXHE 2R45A 2WSCF 3E4RA 3GRRA 3NBXX 5GKNA 3ZH9B 3GLIA 2V6ZM 3GP1A 3K9PA 1Q39A 2Y21A 2HHHM 3ZQJA 2DZLA 1DGGA 2BNKA 1YSYA 3M6AA 4LCBA 2ZAOA 4NRVA 1OJLA 2UXCM 1IM2A 4PCZA 4DR6M 1ORYB 2BJVA 4WURA 1AUAA 2CWBA 4P16A 2VF7A 5BR8M 1QYRA 4DR5M 2Z8YM 1OKSA 1JR3D 3B89A 4NOOB 3OTOM 4QOZC 4GITA 2LXEA 3SFZA 1Z5AA 4QNRA 5ITXE 4JI5M 1OIPA 2AHMA 2HWJA 3HJSA 1PJQA 4IBBA 4M0DA 1T3TA 4DV0M 1VDLA 1TH2A 2Q2EB 4R71A 1XMOM 4X64M 2XLJA 5EXTA 2BWBA 1WJ7A 5E26A 1L2CA 3WHKA 4ANRA 3GLIE 1W5TA 4OW0A 4Q7JA 5FTKA 2OQ4A 2V1CA 4LJAA 4MGHA 4DR1M 3FUXA 3HJ8A 2WSEF 4M9XA 3HZJA 1L8QA 2DI0A 2LNHC 1OQYA 3A46A 1VEJA 2JXNA 1KFVA 4IBEA 1J09A 3PVSA 3GLGE 4IJFA 4L78A 2RGOA 2LTUA 1XXHB 3DFZA 3K1JA 5IREB 2MGWA 2M5ZA 5ITUA 2WZJA 1WHCA 2XH9A 2KRKA 1Q3BA 3J7AS 3FTFA 1ZAEA 2G8LA 4Z8XA 1L2BA 1K82A 4A3VB 3MMPA 4IBDA 4WP2A 3U6DA 4D80A 2MJ5B 3J27B 1N33M 3KVWA 2Z7JA 4B3RM 1TH4A 3T38A 4DR4M 1QUTA 2X4AA 4GRIA 1HQYE 2ERCA 1VDDA 3W0LB 1IXSB 3SC3A 1WXQA 5FTMA 2K6BA 4OVZB 1IXRC 3HHXA 1G41A 4MGKE 5C1BA 2LBCA 1IN8A 4MGZE 3AV0A 1QAMA 3LVWA 1GABA 2LVAA 1OAOC 3EIEA 3FUWA 4GHAA 4LFBM 4BBAA 1HJPA 1JB0F 2FS1A 1FJGM 1OTRA 1XHBA 2ZTCA 1YLAA 3U5ZB 5FSWA 1GKIA 4R3DA 4LRTA 4AKGA 1E9RA 2I7NA 4Z6YA 3GLIB 4OU7A 2OOAA 3HWSA 1GL6A 4BLCA 2CP8A 4G3OA 5EP4A 8CATA 4CISA 3HHWA 1XNRM 4L4UA 1NNJA 1MU5A 4G6ZA 4LF9M 3VKGA 2JP7A 3GLGB 1R4GA 5FTJA 4DUZM 3I51A 3KFUG 1S3SA 3IECA 2OO9A 1IQPA 2DNAA 4MGIE 3A98B 3KDSE 1I94M 4JI7M 2DZOB 1OFIA 4MGYE 2CV1A 1HNZM 3J81S 1HT1E 1NSFA 2G3QA 1DO2A 3RGPA 2R4JA 2LVNC 3FE3A 4B7FA 5KPTA 2CHQA 4JI4M 2UUCM 5IT9S 3KOWE 3IG8A 4IBKA 4RF1A 2DWZB 4GC5A 1XXHA 2GNOA 3B7ZA 4RF0A 3CF6E 4DV5M 3L27A 3T15A 2NQ8C 3FKEA 3HHYA 2Y0TA 3QAUA 3U61B 4IBGA 5F3WA 2QPAA 4I81A 3SHFA 2CV2A 1V34A 4B7GA 4F2LA 2ZM6M 2CFOA 4IIWA 5H37D 5KPRA 3U6QA 1VEKA 4AG6A 5BPVA 4DR2M 3BOSA 2F5QA 2QCUA 1JR3E 2Y20A 3HX3A 4KLNA 5DNYA 2KRUA 4DUYM 4AZFA 3U60B 2M60A 3R8FA 2QHOB 1TDZA 4D82A 3MJ5A 4JI8M 1G8PA 3AOEC 3U5ZA 4LF6M 5EP3A 4JXJA 3AL0C 2FE8A 2QENA 2F5NA 2VQEM 4LRSA 1N32M 2CV0A 1F4IA 3BBZA 5DYIA 3V76A 2UXDM 1D2NA 1DGHA 1Z5BA 2JZ1A 3KXEC 3I4YA 3FRIA 2G5GX 2D7EA 3KW6A 4QOSA 3GPPA 3HJQA 5FTNA 1IN6A 1IY1A 4OX9M 3GLGA 4DV7M 4LZZA 1TGUA 3L2AA 3LW5F 2LVOC 3PXGA 3TL4X 3GPUA 1QAOA 1SXJA 2H1RA 1QAQA 2C5RA 4GEWA 1K3WA 1IY2A 3B9PA 4I5SA 1QDTA 4LJ6A 2DXIA 1HNWM 4REZA 3TWLA 2XSZD 2LH0A 3GRUA 4D81A 4FD2A 4CHTB 5LMNM 4M9SA 3MHVC 2QZ4A 3FRHA 3W68A 4DR7M 1IBLM 3SASA 2YQZA 3B7NA 1QUSA 2QQ8A 4LGYA 3FD9A 1NVMA 2ZANA 3Q8GA 1R2YA 2L4EA 3I04M 2DAKA 3KSJA 4AKHA 3GLFA 2C9OA 3GQ3A 2JY7A 1MX0A 3U61A 1HNXM 2E5LM 3SARA 1GVNA 5EQTA 3NBIA 2D7HA 3SATA 3K2LA 5A2QS 4B7HA 1SXJC 2L7IA 5KO3A 4ITQA 2R4EA 1R2ZA 2DZNB 2MR9A 2XF3A 1SXJE 4QHSA 1PJIA 4WW0A 4JYAM 1Y8GA 1HT2E 4JI3M 1RU3A 2DHYA 4HLQA 2MROB 3RGSA 2JY5A 3U60A 2KNZA 1VQ1A 1QZEA 4MB7A 4QHTA 3U6MA 2F5PA 4M0WA 3UGJA 3KS4A 1DGFA 2CHGA 2ZBKB
chains in the Genus database with same CATH topology
2JY6B 2DAEA 1UFZA 1OAIA 1T43A 2JP7A 1R4GA 1TTEA 1MN3A 1PGYA 4HEOA 2EJSA 3IECA 2OO9A 2DNAA 1SG9A 2L4FA 1IXSA 3GLFE 1HT1E 2EKKA 4F1IA 2BWEA 2G3QA 1DO2A 2JNHA 1GO5A 2LVNC 3FE3A 1CUKA 3LCUA 1XB2B 1ZMWA 3E46A 1T6OA 4UN2B 5JI2E 2DAGA 2L2DA 1Q02A 1XXHE 1BVSA 3E21A 3K9PA 2DZLA 3H4JA 4F2LA 3K9OA 1IM2A 1E94E 1NV8A 1VEKA 2KHHA 2LVPC 2CWBA 3LCVB 1JR3E 1OKSA 2OOBA 3B89A 1ZV1A 1G3IA 1NV9A 2HAKA 2HWJA 2QHOB 1WIVA 2QSFX 1WGNA 1ZMUA 1VDLA 1WR1B 3F92A 2H5XA 1ZMVA 4R71A 2EKFA 1KYIA 2BWBA 1WJ7A 1F4IA 3BBZA 2DENA 2JZ1A 2R0IA 3GLIE 3FRIA 1AIPC 1VG5A 4Q7JA 2K9DA 3IHPA 1OQYA 2DI0A 2B3TA 1VEJA 2KNVA 1V92A 1WGLA 2QNJA 3GLGE 2DAMA 2LVOC 4DBGB 2LTUA 4GEWA 1TR8A 2MGWA 1EFUB 2WZJA 1WHCA 1IFYA 2DKLA 2JZ0A 2JY8A 3GLHE 2LVQD 3MMPA 3FRHA 4WP2A 2JUJA 2MJ5B 2ZTDA 2L4EA 2O25A 2DAKA 1HQYE 5DFLA 1DV0A 1DO0A 2JY7A 1A5TA 1G41A 2LBCA 2DAIA 2K0BX 2RRUA 2LVAA 1C7YA 1HJPA 1OTRA 2ZTCA 1YLAA 3T6PA 2MR9A 1Y8GA 1HT2E 2DHYA 2MROB 2JY5A 1VEGA 1G4AE 2KNAA 2OOAA 2KNZA 1VQ1A 1QZEA 2CP8A 4G3OA 1P3QQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY6 B;  2DAE A;  1UFZ A;  1OAI A;  1T43 A;  2JP7 A;  1R4G A;  1TTE A;  1MN3 A;  1PGY A;  4HEO A;  2EJS A;  3IEC A;  2OO9 A;  2DNA A;  1SG9 A;  2L4F A;  1IXS A;  3GLF E;  1HT1 E;  2EKK A;  4F1I A;  2BWE A;  2G3Q A;  1DO2 A;  2JNH A;  1GO5 A;  2LVN C;  3FE3 A;  1CUK A;  3LCU A;  1XB2 B;  1ZMW A;  3E46 A;  1T6O A;  4UN2 B;  5JI2 E;  2DAG A;  2L2D A;  1Q02 A;  1XXH E;  1BVS A;  3E21 A;  3K9P A;  2DZL A;  3H4J A;  4F2L A;  3K9O A;  1IM2 A;  1E94 E;  1NV8 A;  1VEK A;  2KHH A;  2LVP C;  2CWB A;  3LCV B;  1JR3 E;  1OKS A;  2OOB A;  3B89 A;  1ZV1 A;  1G3I A;  1NV9 A;  2HAK A;  2HWJ A;  2QHO B;  1WIV A;  2QSF X;  1WGN A;  1ZMU A;  1VDL A;  1WR1 B;  3F92 A;  2H5X A;  1ZMV A;  4R71 A;  2EKF A;  1KYI A;  2BWB A;  1WJ7 A;  1F4I A;  3BBZ A;  2DEN A;  2JZ1 A;  2R0I A;  3GLI E;  3FRI A;  1AIP C;  1VG5 A;  4Q7J A;  2K9D A;  3IHP A;  1OQY A;  2DI0 A;  2B3T A;  1VEJ A;  2KNV A;  1V92 A;  1WGL A;  2QNJ A;  3GLG E;  2DAM A;  2LVO C;  4DBG B;  2LTU A;  4GEW A;  1TR8 A;  2MGW A;  1EFU B;  2WZJ A;  1WHC A;  1IFY A;  2DKL A;  2JZ0 A;  2JY8 A;  3GLH E;  2LVQ D;  3MMP A;  3FRH A;  4WP2 A;  2JUJ A;  2MJ5 B;  2ZTD A;  2L4E A;  2O25 A;  2DAK A;  1HQY E;  5DFL A;  1DV0 A;  1DO0 A;  2JY7 A;  1A5T A;  1G41 A;  2LBC A;  2DAI A;  2K0B X;  2RRU A;  2LVA A;  1C7Y A;  1HJP A;  1OTR A;  2ZTC A;  1YLA A;  3T6P A;  2MR9 A;  1Y8G A;  1HT2 E;  2DHY A;  2MRO B;  2JY5 A;  1VEG A;  1G4A E;  2KNA A;  2OOA A;  2KNZ A;  1VQ1 A;  1QZE A;  2CP8 A;  4G3O A;  1P3Q Q; 
#chains in the Genus database with same CATH topology
 1UFZ A;  1T43 A;  1TTE A;  1MN3 A;  1IN5 A;  1L1Z A;  2RGH A;  3FUV A;  1SG9 A;  3MK6 A;  2VF8 A;  4LGM A;  5ITY A;  4GKK M;  1TDH A;  2L4F A;  2L6O A;  2KW0 A;  3LVV A;  3GLF E;  4F1I A;  1JQJ C;  2BWE A;  1HQC A;  4L8R C;  2FH0 A;  3LCU A;  2L09 A;  1GJS A;  4P17 A;  4NL4 H;  2XFT A;  3E9S A;  3SHG B;  2O01 F;  1T6O A;  4XGI A;  1G71 A;  1I4W A;  5JI2 E;  5ITT A;  1PM5 A;  2DAG A;  4XK8 F;  4FWG A;  4B3M M;  2L2D A;  4FCV A;  1DGH B;  3J80 S;  1BVS A;  4PDG A;  1IN7 A;  1R6B X;  3E21 A;  4W5W A;  4CIZ A;  4FCT A;  3H4J A;  4L15 A;  3HHZ A;  3HKP A;  4DV3 M;  4FWD A;  4LF8 M;  3GPX A;  2BJW A;  1JR3 A;  1PJS A;  1MJG M;  4I8O A;  1SXJ B;  2A5Y B;  2LVP C;  4IJE A;  4RNA A;  3LCV B;  4X66 M;  5L8R F;  5FLX S;  5JI3 E;  2XGN A;  1YUB A;  4IBC A;  3UZU A;  3K8Z A;  1D0K A;  1D0L A;  2XFS A;  3D8B A;  3GLH A;  4G4Q A;  2X8A A;  1PJT A;  2N35 A;  3HY5 A;  3AOG A;  1WIV A;  3DZD A;  1WGN A;  1ZMU A;  2P5T A;  3F92 A;  1WR1 B;  2H5X A;  2FFJ A;  5IWA M;  3AOE A;  1J7K A;  1IXZ A;  4JI0 M;  2UUB M;  2R46 A;  2KDL A;  4X62 M;  2OPF A;  4LJ4 A;  3GLF B;  2DEN A;  1KSF X;  1GLN A;  5EP2 A;  3FYD A;  3SMP A;  4G4R A;  3JAM S;  2KA6 B;  3CF2 A;  4NC6 A;  4BB9 A;  1QQW A;  3M7G A;  3U6C A;  3VDU A;  3B7Q A;  3IHP A;  3SAW A;  5EJC A;  2B3T A;  2KNV A;  3DOA A;  2CUZ A;  3SYK A;  4YY3 M;  2QNJ A;  1PJJ A;  3JR5 A;  5KPZ A;  2EUC A;  1FNN A;  1TR8 A;  5C18 A;  1W5S A;  2KEB A;  3VFD A;  4LJ5 A;  2JZ0 A;  1IBM M;  3C3D A;  3CGW A;  3GLH E;  2CHV A;  3GRV A;  3PNY A;  3SAU A;  3KP0 E;  4AI6 A;  1C1K A;  4II7 A;  4GH9 A;  4LZJ A;  3U6S A;  3VK8 A;  2ZTD A;  2O25 A;  3ILK A;  1GJT A;  4DV2 M;  2LHG A;  1OIZ A;  2O5R A;  4LJ8 A;  4NRW A;  1L2D A;  4K0K M;  4KOD A;  1A5T A;  3AJI B;  2K0B X;  1N36 M;  2RRU A;  5DYG A;  4FCW A;  3GO8 A;  1C7Y A;  3UK6 A;  1XMQ M;  1V33 A;  3CF0 A;  4JI2 M;  1YE9 A;  3U6E A;  3J7B A;  5LMU M;  2KXE A;  3AKZ A;  4AQY M;  1TH3 A;  2XZU A;  4I4L A;  1NO1 A;  2DWM A;  1E9S A;  4B3S M;  4HL4 A;  4GKJ M;  3CTW B;  4Y28 F;  1G4A E;  2XEP A;  3HU3 A;  4GIP A;  3AFH A;  1P3Q Q;  2ZAM A;  3UJN A;  2JY6 B;  2DAE A;  3HU1 A;  3B74 A;  1LTM A;  4HEO A;  4PT5 A;  3GQ5 A;  1QZM A;  2UUA M;  4L6V 6;  4RKU F;  3LQR A;  2J7O A;  1G59 A;  2QP9 X;  4NXM M;  2X49 A;  2Z3X A;  3L25 A;  4JN6 A;  5ITQ A;  1NNU C;  2EKK A;  3GLH B;  4TUW A;  3T1Y M;  1GO5 A;  2L7H A;  4KT0 F;  3TPZ A;  3KP1 E;  3VLF B;  1CUK A;  1XB2 B;  3TQS A;  4YHH M;  3E46 A;  4AW4 A;  2QBY B;  1L1T A;  2YR0 A;  4L16 A;  5ITR A;  1K3X A;  3QWL A;  5KQD A;  5EXP A;  2APL A;  2VDB B;  4DV6 M;  4B3T M;  3GQ4 A;  2HKJ A;  1NJF A;  1Z6T A;  4M9Z A;  2YNM D;  1EE8 A;  7CAT A;  4DR3 M;  1NY5 A;  3L28 A;  3SYL A;  3KOY E;  4NXN M;  3RE8 A;  3WHL A;  4LJ7 A;  3JR4 A;  2J7N A;  1UM8 A;  2YFQ A;  3I4V A;  3K9O A;  1E94 E;  1XNQ M;  1NV8 A;  3Q8X A;  2KHH A;  3C58 A;  1H6U A;  2C99 A;  3L29 A;  2OOB A;  3K92 A;  2Z4R A;  4FW9 A;  5EP1 A;  2LWX A;  3TWK A;  4IBF A;  1ZV1 A;  1G3I A;  1N34 M;  4JI1 M;  4JV5 M;  3M0E A;  4IBJ A;  1NV9 A;  2CEA A;  2HAK A;  2DWL A;  1Z59 A;  4LY6 A;  4FVM A;  4CGY B;  2QSF X;  3C3E A;  4FWH A;  3THG A;  4LFC M;  1ZMV A;  3H4M A;  2GQF A;  2EKF A;  1KYI A;  2C9C A;  1Z5C A;  3KS8 A;  2EA0 A;  3HGI A;  1IY0 A;  3FTD A;  3FUU A;  1QAN A;  2R62 A;  2R0I A;  1AIP C;  1VG5 A;  4PDI A;  3ZCB B;  4R7G A;  4LG2 A;  2J5Y A;  2K9D A;  4GC9 A;  1NY6 A;  3HU2 A;  3PNV A;  1E32 A;  1Q3C A;  1ZQ9 A;  1V92 A;  4MH0 E;  1WGL A;  3RFW A;  4JI6 M;  4GHL A;  2DAM A;  4DBG B;  4EIW A;  1PRB A;  2F4V M;  3R9X B;  5FTL A;  1TF0 B;  2MH8 A;  2FOI C;  3A45 A;  1SXJ D;  1EFU B;  2XSZ A;  1NHG C;  3KOZ E;  1IFY A;  3BXW A;  2R6F A;  2DKL A;  2JA2 A;  5EXX A;  4GMQ A;  4AKI A;  2JY8 A;  1IN4 A;  1X37 A;  1QVR A;  2JWS A;  2XZF A;  4LJ9 A;  2LVQ D;  3D8L A;  2Y0Q A;  2QBY A;  3VDP A;  3SMS A;  4CJ6 A;  4DV1 M;  4KO8 A;  2JUJ A;  2R65 A;  5KQ8 A;  4LF4 M;  3FTC A;  4B08 A;  1HR0 M;  2F5S A;  2WSF F;  1N78 A;  1GL7 A;  2I7P A;  4XBO A;  2HL7 A;  3T1H M;  1NHW C;  5E6J A;  3W0F A;  5DFL A;  3VK7 A;  1DV0 A;  1DO0 A;  2KZS A;  3FTE A;  3LQQ A;  2LHC A;  3U6P A;  3QYE A;  1NJG A;  2DAI A;  2FNA A;  2VII A;  1XWI A;  1J5E M;  4LF7 M;  2CE7 A;  4X65 M;  3TWM A;  3SBJ A;  3C9P A;  1R7R A;  2Z4S A;  3NWL A;  3QYB A;  4LF5 M;  3U6L A;  1R5L A;  2C96 A;  1D0M A;  3T6P A;  1N75 A;  4KHP M;  3ZC7 B;  3FUT A;  3TE6 A;  4NSR A;  3KOX E;  3SAV A;  2EO2 A;  1OFH A;  2KNA A;  1VEG A;  2DWN A;  3L26 A;  2HCB A;  3DA1 A;  4IBI A;  4AG5 A;  4PD2 A;  1QDR A;  4QNM A;  3EIH A;  1LV7 A;  4G4N A;  3UMM A;  3IG5 A;  1OAI A;  4NSO B;  2UXB M;  2V1U A;  1PGY A;  2CRU A;  2RKO A;  3GRY A;  2F5O A;  2EJS A;  1EIJ A;  3W67 A;  3VKH A;  4DV4 M;  2D7G A;  1IXS A;  4G4O A;  1DGB A;  3I01 M;  3KSX A;  2C98 A;  5ITX A;  4OVZ A;  4ZPX A;  2JNH A;  1IBK M;  3LMM A;  2DHR A;  1ZMW A;  3J2P B;  2KZU A;  3GPY A;  4S12 A;  5EXS A;  4LFA M;  3A42 A;  2VQF M;  2K47 A;  2R18 A;  2W82 A;  1XC8 A;  4UN2 B;  3PFI A;  2DVW B;  5IZ7 D;  4MM3 B;  3U6O A;  2UU9 M;  1N77 A;  3FYC A;  2R44 A;  1Q02 A;  1XXH E;  2R45 A;  2WSC F;  3E4R A;  3GRR A;  3NBX X;  5GKN A;  3ZH9 B;  3GLI A;  2V6Z M;  3GP1 A;  3K9P A;  1Q39 A;  2Y21 A;  2HHH M;  3ZQJ A;  2DZL A;  1DGG A;  2BNK A;  1YSY A;  3M6A A;  4LCB A;  2ZAO A;  4NRV A;  1OJL A;  2UXC M;  1IM2 A;  4PCZ A;  4DR6 M;  1ORY B;  2BJV A;  4WUR A;  1AUA A;  2CWB A;  4P16 A;  2VF7 A;  5BR8 M;  1QYR A;  4DR5 M;  2Z8Y M;  1OKS A;  1JR3 D;  3B89 A;  4NOO B;  3OTO M;  4QOZ C;  4GIT A;  2LXE A;  3SFZ A;  1Z5A A;  4QNR A;  5ITX E;  4JI5 M;  1OIP A;  2AHM A;  2HWJ A;  3HJS A;  1PJQ A;  4IBB A;  4M0D A;  1T3T A;  4DV0 M;  1VDL A;  1TH2 A;  2Q2E B;  4R71 A;  1XMO M;  4X64 M;  2XLJ A;  5EXT A;  2BWB A;  1WJ7 A;  5E26 A;  1L2C A;  3WHK A;  4ANR A;  3GLI E;  1W5T A;  4OW0 A;  4Q7J A;  5FTK A;  2OQ4 A;  2V1C A;  4LJA A;  4MGH A;  4DR1 M;  3FUX A;  3HJ8 A;  2WSE F;  4M9X A;  3HZJ A;  1L8Q A;  2DI0 A;  2LNH C;  1OQY A;  3A46 A;  1VEJ A;  2JXN A;  1KFV A;  4IBE A;  1J09 A;  3PVS A;  3GLG E;  4IJF A;  4L78 A;  2RGO A;  2LTU A;  1XXH B;  3DFZ A;  3K1J A;  5IRE B;  2MGW A;  2M5Z A;  5ITU A;  2WZJ A;  1WHC A;  2XH9 A;  2KRK A;  1Q3B A;  3J7A S;  3FTF A;  1ZAE A;  2G8L A;  4Z8X A;  1L2B A;  1K82 A;  4A3V B;  3MMP A;  4IBD A;  4WP2 A;  3U6D A;  4D80 A;  2MJ5 B;  3J27 B;  1N33 M;  3KVW A;  2Z7J A;  4B3R M;  1TH4 A;  3T38 A;  4DR4 M;  1QUT A;  2X4A A;  4GRI A;  1HQY E;  2ERC A;  1VDD A;  3W0L B;  1IXS B;  3SC3 A;  1WXQ A;  5FTM A;  2K6B A;  4OVZ B;  1IXR C;  3HHX A;  1G41 A;  4MGK E;  5C1B A;  2LBC A;  1IN8 A;  4MGZ E;  3AV0 A;  1QAM A;  3LVW A;  1GAB A;  2LVA A;  1OAO C;  3EIE A;  3FUW A;  4GHA A;  4LFB M;  4BBA A;  1HJP A;  1JB0 F;  2FS1 A;  1FJG M;  1OTR A;  1XHB A;  2ZTC A;  1YLA A;  3U5Z B;  5FSW A;  1GKI A;  4R3D A;  4LRT A;  4AKG A;  1E9R A;  2I7N A;  4Z6Y A;  3GLI B;  4OU7 A;  2OOA A;  3HWS A;  1GL6 A;  4BLC A;  2CP8 A;  4G3O A;  5EP4 A;  8CAT A;  4CIS A;  3HHW A;  1XNR M;  4L4U A;  1NNJ A;  1MU5 A;  4G6Z A;  4LF9 M;  3VKG A;  2JP7 A;  3GLG B;  1R4G A;  5FTJ A;  4DUZ M;  3I51 A;  3KFU G;  1S3S A;  3IEC A;  2OO9 A;  1IQP A;  2DNA A;  4MGI E;  3A98 B;  3KDS E;  1I94 M;  4JI7 M;  2DZO B;  1OFI A;  4MGY E;  2CV1 A;  1HNZ M;  3J81 S;  1HT1 E;  1NSF A;  2G3Q A;  1DO2 A;  3RGP A;  2R4J A;  2LVN C;  3FE3 A;  4B7F A;  5KPT A;  2CHQ A;  4JI4 M;  2UUC M;  5IT9 S;  3KOW E;  3IG8 A;  4IBK A;  4RF1 A;  2DWZ B;  4GC5 A;  1XXH A;  2GNO A;  3B7Z A;  4RF0 A;  3CF6 E;  4DV5 M;  3L27 A;  3T15 A;  2NQ8 C;  3FKE A;  3HHY A;  2Y0T A;  3QAU A;  3U61 B;  4IBG A;  5F3W A;  2QPA A;  4I81 A;  3SHF A;  2CV2 A;  1V34 A;  4B7G A;  4F2L A;  2ZM6 M;  2CFO A;  4IIW A;  5H37 D;  5KPR A;  3U6Q A;  1VEK A;  4AG6 A;  5BPV A;  4DR2 M;  3BOS A;  2F5Q A;  2QCU A;  1JR3 E;  2Y20 A;  3HX3 A;  4KLN A;  5DNY A;  2KRU A;  4DUY M;  4AZF A;  3U60 B;  2M60 A;  3R8F A;  2QHO B;  1TDZ A;  4D82 A;  3MJ5 A;  4JI8 M;  1G8P A;  3AOE C;  3U5Z A;  4LF6 M;  5EP3 A;  4JXJ A;  3AL0 C;  2FE8 A;  2QEN A;  2F5N A;  2VQE M;  4LRS A;  1N32 M;  2CV0 A;  1F4I A;  3BBZ A;  5DYI A;  3V76 A;  2UXD M;  1D2N A;  1DGH A;  1Z5B A;  2JZ1 A;  3KXE C;  3I4Y A;  3FRI A;  2G5G X;  2D7E A;  3KW6 A;  4QOS A;  3GPP A;  3HJQ A;  5FTN A;  1IN6 A;  1IY1 A;  4OX9 M;  3GLG A;  4DV7 M;  4LZZ A;  1TGU A;  3L2A A;  3LW5 F;  2LVO C;  3PXG A;  3TL4 X;  3GPU A;  1QAO A;  1SXJ A;  2H1R A;  1QAQ A;  2C5R A;  4GEW A;  1K3W A;  1IY2 A;  3B9P A;  4I5S A;  1QDT A;  4LJ6 A;  2DXI A;  1HNW M;  4REZ A;  3TWL A;  2XSZ D;  2LH0 A;  3GRU A;  4D81 A;  4FD2 A;  4CHT B;  5LMN M;  4M9S A;  3MHV C;  2QZ4 A;  3FRH A;  3W68 A;  4DR7 M;  1IBL M;  3SAS A;  2YQZ A;  3B7N A;  1QUS A;  2QQ8 A;  4LGY A;  3FD9 A;  1NVM A;  2ZAN A;  3Q8G A;  1R2Y A;  2L4E A;  3I04 M;  2DAK A;  3KSJ A;  4AKH A;  3GLF A;  2C9O A;  3GQ3 A;  2JY7 A;  1MX0 A;  3U61 A;  1HNX M;  2E5L M;  3SAR A;  1GVN A;  5EQT A;  3NBI A;  2D7H A;  3SAT A;  3K2L A;  5A2Q S;  4B7H A;  1SXJ C;  2L7I A;  5KO3 A;  4ITQ A;  2R4E A;  1R2Z A;  2DZN B;  2MR9 A;  2XF3 A;  1SXJ E;  4QHS A;  1PJI A;  4WW0 A;  4JYA M;  1Y8G A;  1HT2 E;  4JI3 M;  1RU3 A;  2DHY A;  4HLQ A;  2MRO B;  3RGS A;  2JY5 A;  3U60 A;  2KNZ A;  1VQ1 A;  1QZE A;  4MB7 A;  4QHT A;  3U6M A;  2F5P A;  4M0W A;  3UGJ A;  3KS4 A;  1DGF A;  2CHG A;  2ZBK B; 
#chains in the Genus database with same CATH homology
 2JY6 B;  2DAE A;  1UFZ A;  1OAI A;  1T43 A;  2JP7 A;  1R4G A;  1TTE A;  1MN3 A;  1PGY A;  4HEO A;  2EJS A;  3IEC A;  2OO9 A;  2DNA A;  1SG9 A;  2L4F A;  1IXS A;  3GLF E;  1HT1 E;  2EKK A;  4F1I A;  2BWE A;  2G3Q A;  1DO2 A;  2JNH A;  1GO5 A;  2LVN C;  3FE3 A;  1CUK A;  3LCU A;  1XB2 B;  1ZMW A;  3E46 A;  1T6O A;  4UN2 B;  5JI2 E;  2DAG A;  2L2D A;  1Q02 A;  1XXH E;  1BVS A;  3E21 A;  3K9P A;  2DZL A;  3H4J A;  4F2L A;  3K9O A;  1IM2 A;  1E94 E;  1NV8 A;  1VEK A;  2KHH A;  2LVP C;  2CWB A;  3LCV B;  1JR3 E;  1OKS A;  2OOB A;  3B89 A;  1ZV1 A;  1G3I A;  1NV9 A;  2HAK A;  2HWJ A;  2QHO B;  1WIV A;  2QSF X;  1WGN A;  1ZMU A;  1VDL A;  1WR1 B;  3F92 A;  2H5X A;  1ZMV A;  4R71 A;  2EKF A;  1KYI A;  2BWB A;  1WJ7 A;  1F4I A;  3BBZ A;  2DEN A;  2JZ1 A;  2R0I A;  3GLI E;  3FRI A;  1AIP C;  1VG5 A;  4Q7J A;  2K9D A;  3IHP A;  1OQY A;  2DI0 A;  2B3T A;  1VEJ A;  2KNV A;  1V92 A;  1WGL A;  2QNJ A;  3GLG E;  2DAM A;  2LVO C;  4DBG B;  2LTU A;  4GEW A;  1TR8 A;  2MGW A;  1EFU B;  2WZJ A;  1WHC A;  1IFY A;  2DKL A;  2JZ0 A;  2JY8 A;  3GLH E;  2LVQ D;  3MMP A;  3FRH A;  4WP2 A;  2JUJ A;  2MJ5 B;  2ZTD A;  2L4E A;  2O25 A;  2DAK A;  1HQY E;  5DFL A;  1DV0 A;  1DO0 A;  2JY7 A;  1A5T A;  1G41 A;  2LBC A;  2DAI A;  2K0B X;  2RRU A;  2LVA A;  1C7Y A;  1HJP A;  1OTR A;  2ZTC A;  1YLA A;  3T6P A;  2MR9 A;  1Y8G A;  1HT2 E;  2DHY A;  2MRO B;  2JY5 A;  1VEG A;  1G4A E;  2KNA A;  2OOA A;  2KNZ A;  1VQ1 A;  1QZE A;  2CP8 A;  4G3O A;  1P3Q Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...