3KVWA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2) in complex with an indirubin ligand
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
408
structure length
403
Chain Sequence
HHSGVDLGTENLYFQSMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSKGYPRYCTVTTLSDVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
publication title Crystal Structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (DYRK2) in complex with an indirubin ligand
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 125
structure length 403
sequence length 408
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kvwA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kvwA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kvwA02
3Q4CA 5K0KA 2I6LA 3ALNA 2R3NA 4I6BA 3S1HA 3QHWA 4TRLA 2Y6MA 2WU7A 3WYYA 4F7NA 3L9LA 4UEUA 5JQ8A 3LCKA 2R5TA 5C26A 3W18A 5IMEA 2X7FA 3QALE 4JIAA 5D9HA 3GVUA 4CKIA 1O6YA 4NIFA 2ETKA 1BLXA 2C0OA 3QTXA 4U81A 4XOZA 3FMKA 1J1CA 3IS5A 4RSSA 5JGBA 2FSLX 1M14A 5L6WL 4AZSA 3UO5A 2IVVA 3ZSIA 3V6SA 4YTHA 2RG5A 2F9GA 3FPMA 4FKSA 4FKUA 4RWLA 5JFVA 1PXLA 3PY1A 3DS6A 3KXZA 4A07A 5CXZA 3MYGA 3RNYA 4UX9A 5C4LA 3HRCA 4IAKA 4F63A 3HMOA 3VS2A 4HYHA 2XYUA 3RCJA 4L9IA 3K5VA 4ACHA 3FMMA 3F2RA 1UU7A 3HAMA 3ATSA 3DAJA 3R2BA 3AT2A 3WBLA 3IW6A 2YLEA 1CDKA 2O2UA 3WF7A 4NFNA 4ZMEA 3TUCA 1XBAA 3OCGA 3PSDA 5CEIA 3TV7A 2YJRA 2OJ9A 4DH8A 4OTQA 4IZAA 2Y8OA 3TZ7A 3GP0A 3JS2A 3R1QA 3ZEWA 4K77A 3ZSHA 4WOVA 5F20A 5CT0A 3VJOA 4CYIA 4LUDA 3PE2A 5A4EA 3OHTA 3EH9A 5DNRA 3U6HA 3GCVA 4L52A 4YTFA 3LXLA 4E6QA 3LJ2A 4FODA 1ZYLA 2Z7SA 5HOAA 4KIKB 4O7LA 4LL0A 4JR7A 2Z8CA 5H3QA 1PY5A 5F1ZA 2P3GX 1UU8A 3NUXA 4LG4A 4AS0A 4HYUA 3C9WA 4DGGA 3R21A 3PA3A 2VTIA 2PVLA 3OVVA 3EFLA 4FMQA 3P23A 4HYIA 4MH7A 3S4QA 5CEPA 4A4OA 2XNPA 2ZDUA 4X7QA 2XJ1A 3ORPA 1PXKA 3THBA 3TNWA 4EK4A 2VD5A 4ASEA 5IQGA 2GNFA 4QMPA 4U5JA 5CU4A 5A4QA 5AV2A 4F7SA 3N4UA 4O0SA 1VJYA 5I9ZA 3JUHA 4GFGA 3FMEA 1HOWA 2WGJA 4JT3A 4HVSA 2XRUA 3FC2A 4ZJIA 4YHFA 3TV4A 4GUEA 3DOGA 3G6GA 1H1WA 2QVSE 4XCUA 4B4LA 1CKJA 2QD9A 4MHAA 3ZFXA 4DFYA 1FMKA 4QP8A 4QMQA 2YA9A 4YZ9A 2BKKA 1YXXA 1PW2A 2R2PA 4YURA 5IF1A 3GBZA 4FX3A 5IA3A 3OCBA 4G31A 3POOA 3U8WA 3ZEPA 3QHRA 2C68A 4Y95A 4XUFA 3CR0A 1DAYA 2GS7A 5DN3A 3VS6A 2EXMA 4MYGA 4ZP5A 4CV9A 5FEEA 3AT4A 4ZY4A 4R7IA 2E2BA 2RFSA 5D41A 5FP5A 4NYEA 5IQEA 2G01A 3DDQA 4FSYA 4NT4A 2ETMA 5FTGA 2VAGA 3VNTA 3QGWA 3ZMMA 4IJPA 4YUQA 1B38A 3KK8A 4I5HA 4FSRA 3PDTA 2QO9A 3B2WA 2PUNA 3QRIA 4IE9A 3BYOA 5M53A 5FUTA 3NYXA 3ORXA 4QO9A 3BWFA 4O7NA 3PXQA 4U3YA 4ACDA 3ZUVA 3SDJA 3TACA 3QTZA 4NJDA 4UYAA 3MB6A 1FMOE 2H9VA 3L9PA 4V05A 4U3ZA 4BGGA 1ND4A 3H10A 3UQGA 5EYMA 3KXXA 4FTKA 2J51A 4QP4A 3LAUA 5C4KA 2VU3A 2QURA 5IDNA 4K1BA 5FM2A 4JIKA 3A60A 3OBJA 3WYXA 4EH6A 5EYDA 3ATTA 5BVDA 2VNYA 4FK3A 3GU4A 3N4TA 4DH3A 4LRKA 3EN7A 3W2QA 5ACBC 4BKZA 4QTBA 3FI8A 3VBXA 4RJ6A 3AC3A 3FSFA 4KB8A 3VHKA 3FPQA 2ESMA 4L46A 2QI8A 2XYNA 3EL7A 3NUPA 4RVLA 5EM6A 2XMYA 1A06A 1S9IA 1XH7A 4FL2A 2P33A 3KRXA 5CSWA 3VBWA 4I6QA 4AZTA 4FSQA 2O0UA 3EQHA 4PV0A 4AW1A 4C3FA 5M4FA 2PVRA 3SOAA 3MJ1A 4QP7A 3QQGA 3D2IA 3UJGA 3ZDIA 4FKIA 3R9RA 1WZYA 3VW8A 2XIKA 3VHEA 3D5UA 4CTCA 3CQEA 4C3PA 4G3EA 5D10A 3FSKA 1LEZA 1UWHA 2BAKA 2NP8A 3C4XA 3GGFA 3PIZA 5HICA 2GHLA 4MNEA 4YC8A 1H07A 3QYWA 3BELA 2PE0A 1Q4LA 5AUYA 4CYJA 1ZAOA 4F1OA 2XJ0A 2OG8A 5IUHA 3R8PA 3DK6A 3QTQA 2I0EA 2G1TA 2XA4A 3UOKA 4FTCA 4U79A 2QOIA 3AD6A 4GT5A 3QU0A 5AR3A 2X8IA 5HO6A 3TKIA 4LUEA 3DKOA 1SVHA 2WMRA 2HXLA 2XZSA 2WXVA 4YC6A 5CZIA 4C0TA 4FKGA 4L01A 4PQNA 3DQWA 3DB6A 5EDPA 5CSXA 4O1OA 1HCLA 4IFGA 4TW9A 3KB7A 1RDQE 2V55A 2W1CA 4I5CA 3QD4A 2UW4A 2VN9A 3Q04A 4IVAA 3QQUA 4APCA 3F7ZA 4O91A 3IK3A 3ZDUA 3RVGA 4EHVA 4KSPA 5CVGA 1F3MC 1ZYDA 2UW7A 3EQFA 4DEBA 4F7JA 4BI1A 5AV0A 3PZHA 5HO7A 4ZJJA 4BWKA 5IH5A 2WKMA 4IAIA 1H24A 4AFEA 4YTCA 4XJ0A 5IH6A 5KMJA 4EOKA 4TWPA 4GRBA 3HX4A 4U6RA 4N4SA 2EWAA 2OU7A 3EN9A 3FXXA 4G6LA 3CQUA 4USDA 4O7VA 4E4NA 5KE0A 5CY3A 4F9CA 4O0YA 1ZY4A 4GU9A 3S00A 3C4ZA 3HMNA 4ITHA 3KRWA 5JT2A 4NM5A 3D7TB 4AFJA 4QQTA 4FV0A 3PVGA 3RI1A 4TYHB 2XNBA 3MW1A 2C6EA 2PMOX 1R3CA 2GMXA 3FHIA 3IDBA 4APPA 3ZYAA 3ZM9A 2QOOA 2PK9A 3LMIA 2BRNA 3P79A 4QYEA 3EFWA 4RIOA 4YZMA 4O7SA 2GFCA 3DAEA 1X8BA 2YISA 3LFSA 2X8EA 1KE8A 3UIBA 5J5SA 2UZLA 4FKLA 4FT3A 4IMYA 3C5IA 3DKCA 5BVEA 3NNUA 4XG7A 4BCMA 4RX7A 4UBAA 3ZLYA 2UZWE 3PPZA 3QTUA 2BILB 4I5PA 5DWRA 4D55A 4XP3A 3F3UA 3OCTA 1FQ1B 4XP0A 3FXZA 3TCPA 5EHYA 5BX0A 3FZSA 3BHHA 4C7TA 4ZSJA 2XNGA 3FXWA 4EOOA 4EL9A 1XH5A 2FVDA 1WBNA 3BYVA 3EYGA 4YHJA 1I44A 3TIZA 3Q3BA 2J90A 3OTUA 4BDHA 5IQDA 4X3JA 3QD0A 4UMQA 3U6JA 3W1FA 4X2GA 4IB5A 2JIIA 3AGMA 3NUUA 2ZM1A 3KXMA 5ITAA 2R3RA 2C69A 5HLNA 2E9UA 3VC4A 2ONLA 1YXTA 2C1AA 3BQCA 4X2FA 3MESA 2IJMA 4O82A 1K9AA 2IWIA 4FZ6A 4DAWA 4BWXA 1MUOA 4M66A 4G34A 4UZDA 3I0QA 3E92A 5EYKA 3NRMA 2XK8A 5KX8A 3Q6WA 4QTDA 1I09A 4OTDA 5TR6A 5L8LA 3GUBA 3AXWA 3NYNA 3RP9A 3W2PA 2X9EA 5JRSA 3BU3A 3BV2A 1VYZA 3QL8A 5AUTA 4ANLA 3RPOA 5J79A 5E7RA 1M7QA 3GENA 1H4LA 4ZTLA 1OKVA 3U9CA 4K11A 3VRZA 2JFMA 5CX9A 3VBVA 3D0EA 4RIYA 3PXFA 4YJSA 5FEQA 4D1XA 4ZEGA 1V0BA 5AV4A 1R39A 4DBXA 4QP9A 4YBJA 3KXGA 5L4QA 4H3PA 2HWPA 1SNUA 5HCXA 3LXNA 3FJQE 4FNZA 3H9OA 2YLFA 4BICA 4UXQA 4QQ5A 3G15A 4RWJA 3NW5A 1Q97A 2BHHA 4KD1A 4BCPA 2R3FA 5BNJA 4L6QA 2VO6A 5E8YA 4A06A 4FV5A 4UZHA 2YIYA 4IAZA 3PP1A 3UOLA 3AMBA 5KBQA 3QTSA 5CASA 3UNKA 3KN6A 3TZMA 5EQYA 3R8UA 3E5AA 3CKWA 2XP2A 3EB0A 3QXOA 4C38A 2YN8A 1YOJA 4FI1A 4GJ2A 3DBEA 3HRBA 4J97A 4BCKA 1M2QA 1Q24A 2OH4A 3EQPA 4FUYA 4GYGA 3RALA 3V8TA 3FY2A 5J1VA 4FSZA 4NSTA 4FEQA 4IWOA 3ZXTA 3MI9A 4F0GA 1NXKA 4EOQA 4DCAA 3FZRA 4DEIA 4R77A 4MXCA 3HDNA 4G3FA 2YDKA 4E4MA 3GOPA 4RX9A 4G3DA 4FKVA 2OJGA 3MSSA 4GJ3A 3K3IA 1VEBA 3QX4A 3BHTA 4MBJA 1GZNA 3ACJA 4FIEA 4RA5A 2C6LA 5ETFA 2PMNX 3G9LX 4QYFA 3UC3A 5BVFA 5HBJA 4E7WA 1PXOA 3O0GA 4KKHA 3W2RA 4GFOA 4JJRA 1Y57A 1KOBA 3TNPC 5AM6A 2B54A 1PKGA 3A7GA 4R3CA 2OLCA 4N70A 4J99A 4JLCA 4EQUA 1REKA 3QKMA 3Q9WA 4C59A 1OECA 4MK0A 2I40A 3TT0A 1OL2A 3F5PA 3S95A 4BCGA 1BMKA 1ZMWA 3C0GA 1ZOGA 2I1MA 4RBLA 4NM7A 4CEGA 5DHJA 3CGOA 1OL6A 4X2JA 4FV1A 4NCTA 2VX1A 2JC6A 1ZMVA 2Q0NA 4KINA 4M67A 4OTIA 4I3ZA 3MH1A 3R0TA 1H1PA 1RJBA 5LVLA 3SGCA 2UZUE 5ANDA 5EW8A 1J7IA 4IWDA 3Q5IA 1Q8TA 1MQBA 5ANKA 4RJ7A 4H58A 1UNHA 2UZNA 3SVVA 2HXQA 2C3LA 2UW0A 1YQJA 3PSBA 4FTQA 3HP2A 5C01A 3NR9A 2B52A 3V8WA 1M2PA 4NIFB 4ZY6A 5ANGA 1E1XA 4WBBB 4CKJA 4O22A 2IZTA 4BHNA 3HL7A 2ZVAA 3KVXA 5L2TA 3C4EA 4LRMA 5HIDA 5CAPA 4ORKA 4PP9A 4PUZA 3AC5A 2QO7A 3BBWA 2JD5A 1UU9A 2OXDA 2CGVA 2XIZA 2Z60A 4BYJA 3HZTA 3ZXZA 5HGIA 4DH5A 4F70A 3NWWA 1YW2A 2VTPA 4YNOA 1WAKA 3ORZA 4DC2A 5JZNA 2HENA 3LOKA 5GZ8A 5IQFA 1XH9A 2A0CX 3CTHA 3FE3A 4GG7A 5A14A 4RJ3A 4KS8A 3RPYA 3N9XA 3FMNA 3EQIA 2Q83A 4FSNA 4BZNA 2OBJA 3Q60A 1PMEA 1H0VA 2IZRA 4O0VA 1YDSE 3BZ3A 1M7NA 4OW8A 2HOGA 4FKTA 2BZJA 3QX2A 5M4IA 4EUTA 5CLPA 5FGKA 3MPTA 4EJNA 5GIPE 2CKQA 3TNQB 5I3RA 3EHAA 3KRJA 2CSNA 4BCFA 2CNQA 5M07A 2C0TA 3KKVA 3MWUA 3QUPA 4FT5A 4C37A 4JQEA 4O1PA 4TTHB 3ANQA 3RHKA 4HVGA 1JSUA 4WNOA 3BE2A 4D2TA 2WZJA 4ZS4A 2P55A 2R3GA 4FTAA 3POZA 5AUUA 3DU8A 4I21A 4NZWB 4AA0A 3ENMA 3JYAA 4DE4A 2C6TA 4Y85A 3D7ZA 4FC0A 3Q9ZA 1GOLA 4FNYA 4TWOA 2BAQA 1OUYA 2QODA 4RIWA 5ICPA 1R0EA 4Q5EA 3ORLA 2P2HA 4QMUA 2WTKB 4ZZOA 2QC6A 4XH6A 2JKMA 2DUVA 4D9UA 3MPMA 3EKKA 3KEXA 3OS3A 2FA2A 2QNJA 4EH4A 2I0YA 4FV8A 4CT1A 2YIQA 2Z7RA 4LQMA 4RMZA 4ASXA 4CKRA 2WTIA 2ZB1A 5IQAA 3UP2A 1QMZA 3JVRA 4PX6A 2DYLA 5HE3A 2XH5A 4IX6A 5KMLA 3DLZA 4HGTA 1IAHA 5HCYA 4FTLA 2GNGA 4BDGA 2WQNA 4HCVA 5HKMA 4QYHA 4DT9A 5KMMA 4O83A 2Y4IB 2QKRA 1H25A 2IN6A 4MWHA 4BF2A 4EYJA 1H00A 2HY0A 4MBIA 3TG1A 1U5RA 2VWUA 1Y8YA 3LCTA 3I0OA 3H9RA 4R78A 5BPYA 2R0UA 5AR2A 4C33A 5BYYA 4O2PA 5CSPA 4ZOGA 2PE2A 4S33A 4JG7A 5DOSA 4TYIA 3FHRA 4ANOA 2CJMA 5HZNA 3FI4A 2PTKA 2QOQA 4BL1A 2W96B 3NS9A 4M14A 3TUDA 4X6RA 4AZFA 3FMJA 3R71A 4PL4A 3AD4A 4YU2A 4EHZA 2GSFA 3UO4A 5HVKA 3PIYA 5CQWA 2BUJA 5EK7A 3ZZEA 4CRLA 4E73A 3R7UA 2XB7A 5J5TA 1U5QA 3ETAA 4FEWA 3A4OX 1ZYCA 4O7YA 2VWXA 2VGOA 3NYOA 5DE2A 3VS3A 3Q6UA 1RW8A 3FV8A 3K3JA 1KOAA 1PMUA 5L6PA 4XMOA 4J71A 5JQ5A 2JBOA 1OIUA 4O0XA 1Y8GA 4BDCA 3F5GA 2UZBA 4FVRA 2Y4PA 4FV9A 2H96A 5ETAA 3S3IA 4D2WA 3RHXA 2ITXA 1Z57A 4V01A 2C6MA 3DXNA 3BPRA 2XK7A 3DJ5A 3QAME 4ZSGA 3BV3A 5CNOA 4LM5A 1V0PA 2EUFB 3LFQA 4D0WA 2IZSA 5DLSA 4DFNA 2PUIA 4F1MA 4BKYA 3BGPA 4AP7A 4RC4A 2ZM4A 2GFSA 1ZZ2A 1SYKA 4X3FC 2B55A 3R1NA 2PU8A 5AAEA 3DA6A 3PLSA 2I0HA 3M42A 3QCSA 2WELA 4R6VA 2J50A 3E63A 4JVGA 3JY9A 4RX5A 4NW5A 2OIDA 3IW7A 3K54A 2IW6A 4NFMA 1BI8A 5HTIA 4MNEB 4RJ4A 4DFLA 2UW9A 1TQPA 2ITVA 4RZVA 3QCQA 4W9WA 4F0IA 4IZYA 5FD2A 5K3YA 3CLYA 1UA2A 3MFTA 4QMYA 4BCNA 2CKEA 3BEAA 3R8LA 2BRBA 4CRSA 3RZBA 3UYSA 3FZ1A 1ZXEA 3OEZA 2B0QA 4G16A 3UP7A 3ZFMA 2X81A 2OI4X 1Y91A 3OY3A 2ITUA 5C27A 4EBWA 4B8LA 3ZU7A 5EKOA 5CSVA 5DH3A 1KE7A 3EQCA 3EQDA 1ERKA 4PNIA 1FVRA 5HLWA 2W4KA 3LM0A 3NNXA 5F4NA 1XBBA 2DS1A 4M15A 3NLBA 5AP3A 3DPKA 4GEOA 2OH0E 2OICA 4U45A 5LWMA 5A6OA 5JZJA 1W84A 3FAAA 2QQ7A 3PY0A 3WZUA 4DGOA 4UMTA 4NEUA 2VV9A 4GS6A 4I1ZA 3AD5A 2B9JA 1FINA 2OO8X 2HAKA 3P78A 3G5DA 3QCYA 5DR6A 4USFA 2WU6A 1PXPA 4FEVA 4I4FA 5BVWA 3QBNA 2J0IA 2YEXA 3CTQA 4BTKA 5HD4A 2IW9A 3TM0A 4IZ5A 3R63A 2PMIA 2VTSA 5LJJA 2HZIA 2O65A 3GCUA 3SXFA 4M97A 5AP7A 4BVUA 3DZOA 4OGRA 5FP6A 4BHZA 3A7HA 4LOOA 5FXSA 4XG2A 4R1VA 1RQQA 2X39A 4KBAA 3F6XA 2HELA 4XBRA 1IA9A 4UWYA 5DEYA 1XBCA 3Q53A 2UZTA 5AUXA 2ACXA 3MVJA 3VQHA 2UV2A 3R7EA 4C36A 5M56A 1WVXA 3AQVA 4P5ZA 4ZTNA 1OKYA 1CMKE 3GC9A 4J98A 1JOWB 5TT7A 4TWCA 2VWVA 5G1XA 4Y73A 3AG9A 4ERWA 1BI7A 4BYIA 3PJ3A 4R5SA 5DBXA 5CAUA 5JGAA 5A54A 4NWMA 4RVKA 3GU7A 5I9UA 3RMFA 3JPVA 3MA3A 4ALWA 5IEVA 3UPXA 4DH7A 3HLLA 3R7VA 4G1WA 5AEPA 5HO8A 4U9AA 3O71A 3QQKA 4YSJA 4U42A 5KZ0A 3UOJA 4W8EA 5IA1A 3CS9A 4BDKA 3TWJA 2HZ0A 3RCDA 5HCZA 1WVWA 3QC4A 3GNIB 3IGOA 2HYYA 3BYUA 3Q5ZA 5HNIX 3TDWA 1UV5A 4J7BA 2VX3A 4CFVA 5AJQA 4WSYA 3PRIA 4L3LA 2XKCA 3IG7A 5CU2A 5D7AA 5AMNA 3R8MA 4ACGA 4B8MA 3FYJX 3IDCA 3CTJA 4GKHA 3V3VA 4Z16A 2GTNA 2BKZA 1NT2A 1SM2A 3QQJA 4BBFA 4ZSEA 2WNTA 3KA0A 5EW3A 2J9MA 4KKGA 1PXNA 3BGQA 3LFBA 3W2CA 4PPCA 1DI9A 5DVRA 2E9OA 3A62A 2V5QA 3D15A 2C3IB 4CTBA 4IB1A 1H01A 4M7IA 4M84A 4YNEA 3AOXA 2R3LA 4MEDA 1UNLA 4HJOA 5CQUA 3MH2A 3SA0A 1LP4A 3UTOA 3D14A 4O0WA 1MRUA 5EYCA 5HLPA 2ONLC 5BUIA 4RIYB 4IAFA 3FLQA 5FRIA 5HG7A 4EKKA 3ELJA 3MTFA 4LGDA 5L8JA 4O81A 3SX9A 3DBFA 1YWNA 3KF4A 3LFEA 4AF3A 2J7TA 4FZ7A 4TNBA 5E90A 2R4BA 4AOJA 2WFYA 4E93A 5ANJA 3RK7A 5E8TA 5IKWA 2IG7A 4M0ZA 4C2WA 2F2UA 3NSZA 4FIHA 3VUHA 4CZTA 2BVAA 4YC3A 4M3QA 5CEQA 4B99A 3MGYA 3DNEA 3QTWA 4IM0A 5L3AA 4AT4A 2J0JA 4DG3E 3HYHA 4L7FA 3A8XA 1VZOA 4U97A 5JEBA 3DAKA 3OC1A 2GHMA 3NUNA 3B8RA 3BWJA 4FSTA 4L3JA 4U44A 4ZTHA 1FGKA 4K8AA 3SG9A 1H1SA 3A61A 3PJ2A 5E1EA 3R7YA 3K2LA 1JKSA 4QQCA 4DG2E 1UKIA 2B9FA 3OF0A 4HCTA 4TKSA 4JRVA 3OOGA 4KIQA 2ZV9A 5E4HA 4Y83A 3R6XA 4J53A 3MA6A 4TNDA 5AWMA 2C5VA 3TN8A 3ZOSA 3FQHA 1LR4A 3MJ2A 1KSWA 4JDHA 4I92A 2XS0A 2F57A 3CD8A 4JG6A 5AR8A 3I7BA 3UVQA 3UNZA 4PDOA 4ZK5A 2I7QA 3PZEA 4KIPA 2VTTA 2X7GA 3LZBA 2XNEA 3AC1A 1QCFA 3GU8A 2V7AA 4FKOA 4GW8A 4U40A 4N0SA 4IEBA 4R5YA 4O96A 2FUMA 3ORIA 4Q9ZA 1QPCA 1BL7A 3W10A 4WKQA 2P0CA 1R1WA 5LQFA 1W98A 2Y6OA 3LCDA 3L8VA 5K9IA 4PMMA 4DGNA 2YCRA 1U54A 4R3PA 1GZOA 3E93A 5CAOA 2AUHA 1HCKA 3PJCA 3QF9A 5IEXA 5JFSA 3OTVA 4WO5A 4AOIA 3PXKA 1A48A 3FBVA 3ZBXA 5HBEA 5M55A 3FL5A 3IW8A 1SMHA 3QTRA 4E5WA 2VWZA 4E1ZA 2JGZA 2JIVA 4WNKA 3ZLWA 4BTFA 1Q99A 2QR8A 3WF8A 5JFXA 3NAXA 4FTOA 5F9EA 5DRDA 3R2YA 4O7ZA 3KCKA 5KHXA 3IDPA 5DEWA 3ORTA 4P5QA 4ZZNA 5HTCA 5EKNA 3E8NA 3Q4TA 5JSMA 4CNHA 4O27B 2WQMA 3IW5A 1JAMA 2BRMA 3RZFA 4U7ZA 4AG8A 4CZUA 4ZMFA 3I4BA 2VO0A 4XOYA 4CFFA 5AIKA 3PTGA 1PYEA 5K5XA 4CMTA 5LWNA 2WTCA 3MN3A 1WCCA 1KV1A 1UVRA 3R04A 3UZTA 1V0OA 4BTJA 3R02A 3QWKA 3ZO3A 3KVWA 1ZWSA 2ZAZA 4RZWA 4Y5HA 3E64A 4QTCA 4W9XA 2QR7A 2J5EA 3BX5A 2WMTA 2J0LA 5H8GA 2YERA 3EZVA 2GQRA 3OW3A 5CEOA 3RK5A 2CNVA 5JFWA 5K0XA 5C8NA 3KREA 3Q9YA 5FDPA 1REJA 1NVSA 1JKLA 4MXYA 4NM0A 5HX6A 4I24A 4I0RA 1PKDA 4EZ7A 4BY9E 3C1XA 5FBNC 3P4KA 4IC8A 2WO6A 5I9YA 3DKGA 3I5NA 4JDIA 5D11A 3F66A 4EONA 2V62A 4CG8A 4FYOA 5L2QA 1WBWA 2PVMA 2PUPA 1YDRE 4DFZE 4MF1A 3UGCA 4GV1A 3D5XA 4EUUA 1WBVA 3JVSA 1UKHA 2QLUA 2HK5A 3RK9A 4BIDA 3VJNA 3JR1A 2VWWA 2F49A 4Y5QA 2OF2A 3PPKA 4RG0A 3Q2MA 5FEDA 4C4HA 4F6UA 5HU3A 4YJQA 4D58A 3UDBA 3D83A 4U0IA 3UG1A 3EQGA 4AX8A 4QP6A 2JKKA 2YAAA 3MPAA 1APME 4ALVA 2CKOA 4D28A 1QL6A 4FKWA 4MKCA 2F7ZE 5B7VA 5C8MA 2EB2A 4EJ7A 3BLHA 3RWQA 4ALUA 4U43A 3HVCA 4YTIA 3E3BX 3IO7A 4QMVA 4R3RA 5IU2A 3SKCA 4YBKA 5D1JA 4BZOA 4RIWB 3GXLA 5JKGA 2YHVA 4YJPA 4QMSA 2UW5A 4A9TA 4BCOA 4O0UA 3I79A 4J1RA 5CXHA 4OTGA 5E1SA 4E5AX 3TUBA 3KRRA 4EH2A 2JITA 3MH3A 2QKWB 4IAYA 3VS1A 1Y6AA 5B2KA 4CD0A 3MIAA 4C02A 4LGHA 1L3RE 4I4EA 2C47A 3M2WA 1XJDA 2OJJA 3QZFA 4FT9A 4KABA 4BBEA 4KBKA 4MXZA 1OGUA 2EXCX 2HIWA 4QMZA 4ZSLA 5GIOE 3ERKA 3OXIA 1B39A 1NA7A 2YCQA 4Y46A 4C35A 3ET7A 2PVHA 3BIZA 3GC7A 3TKUA 3WZKA 2ITTA 4OBPA 4PTCA 4EEVA 3D4QA 3MFRA 1P4OA 2C0IA 3O51A 3P9JA 4RWKA 4J8MA 3L1SA 4FV7A 1KWPA 2WIHA 3RKBA 2V22A 3KFAA 2JDSA 3PE1A 5EM7A 2BDWA 3T3UA 4O0TA 3EIDA 5H9BA 4GL9A 2C5NA 3EQRA 3SXSA 4RWIA 2YACA 3DV3A 4FGRA 4HVIA 2W0JA 5BVKA 5BYLA 1TVOA 2X4FA 2YM7A 3S0OA 1W0XC 2C5OA 3KMUA 5FQDC 3GI3A 1H26A 4AT5A 4QMWA 4F4PA 1CKIA 2ZJWA 4JDKA 5K5NA 5AP0A 1H08A 4Z9LA 4HNIA 4QPSA 3UVPA 5EOLA 4FOBA 3WOWA 4BIBA 2DWBA 4PMPA 4YJVA 4JQ8A 2VWYA 2JDVA 4X2NA 2VRXA 2EU9A 4U41A 3KQ7A 3OZ6A 2GNHA 2Y9QA 4IADA 5LARA 4F7LA 5J7HA 1CSNA 4BBMA 2UZVA 3I5ZA 4JOAA 4O7TA 1F5QA 1OIYA 3SLSA 3VWAA 4E4LA 2ZOQA 4KRDA 2V7OA 5DG5A 1KE6A 5KHWA 5LVOA 4RFZA 1OMWA 4AN9A 1WMKA 3Q2JA 5CU3A 5A3XA 2XIYA 2YM6A 4GYIA 3C0HA 5KCVA 3FYKX 4CCBA 4FTNA 4HOKA 3ITZA 1ZZLA 2J0KA 4QMTA 5J9ZA 2OJIA 2WIPA 3CPBA 1YXSA 2XK4A 2GNJA 5BMMA 2YM3A 2ITYA 5HIBA 5GNKA 4JBQA 4JG8A 2BIKB 4QPAA 2PYWA 5AX3A 1CKPA 3COHA 3OXZA 4YZBA 4FE2A 4XV1A 3FUPA 3RAKA 3NW7A 4GT3A 4ANQA 4TY1A 2BROA 3C51A 4LOQA 2ERZE 3H3CA 2W5AA 5AR7A 3FQSA 3UNJA 1OITA 4AGUA 4AZVA 4UWBA 5DT3A 2ZMDA 3ODZX 3OG7A 3QA0A 4HZSA 2UW3A 3W33A 4BDAA 3D94A 4L3PA 1URWA 5KMIA 2JKOA 4OLIA 4IH8A 3R7IA 3GEQA 1TQMA 5E8ZA 3TZ9A 5L6OA 4W4XA 3IOPA 5GJGA 3ZUUA 3UZPA 5BVOA 4L44A 2OXXA 3CQWA 2AC5A 3QLGA 3WZDA 1WBSA 2GNLA 2E9PA 3SHEA 5FWKK 3N4VA 4G9RA 4EH3A 1XH6A 2IZUA 3NYVA 5AA9A 2X0GA 4Q9SA 3I6UA 5FLFA 4I22A 2CGXA 2ZV2A 1OUKA 3R22A 3DBCA 2BRGA 4NM3A 5IQIA 3LFCA 5A6NA 5I5ZA 4O6LA 2XM8A 5DGZA 3TI1A 5HIEA 2VNWA 2W4OA 2XNMA 4R1YA 5CU0A 3HMPA 4FSUA 1BUHA 1YVJA 3BLRA 5GJDA 3HECA 2WMXA 5KKRB 1OIQA 4FZAB 3RINA 1QPEA 4C2VA 4NTTA 5EQPA 2RFDA 2PVNA 4C3RA 2Y0AA 2PZ5A 2VO7A 4S34A 5TOZA 3SXRA 1E9HA 3FLNC 3TIYA 4DBNA 4UMPA 3WIKA 4AGWA 2GPHA 4EK8A 3V8SA 2F7XE 2R3HA 1Q3WA 4DYMA 2GQSA 4IXPA 2WQOA 3BEGA 5M06A 2Z7LA 1GJOA 3DB8A 3ZO1A 4I6HA 4KRCA 3ZLSA 5KZIA 1FGIA 3C7QA 4MAOA 3VUIA 4RGJA 5AADA 2ZDTA 3VUMA 1GAGA 1ZOHA 2WMWA 2VTOA 3A2CA 3DZQA 3GQLA 4PPBA 4ZXTA 1OL5A 3FKOA 2HY81 2X8DA 3P86A 3TEIA 3TL8A 4II5A 4IIRA 1GNGA 1R0PA 5TKDA 1PXIA 3WILA 3VIDA 3O7LD 3OT3A 2YM8A 4XG3A 1P14A 4HGEA 3TDVA 3F7WA 2W06A 5HVYA 5JN2A 4CV8A 2JAVA 3FZPA 1OI9A 4FSMA 4GG5A 3WI6A 4EOMA 4FTIA 4ZTMA 5M57A 3KF7A 4EH8A 1CM8A 2FO0A 3HAVA 3FZTA 4GKIA 2F7EE 4ZJVA 3B8QA 4O7WA 4J95A 3VF9A 4BGHA 1YWVA 3GOKA 3A7FA 1IEPA 5E8XA 4AAAA 3QRTA 1OB3A 3V5JA 4O6EA 2XF0A 5AAFA 4FKQA 3VUTA 3LMHA 2OW3A 5EW9A 3ZRKA 2XK9A 2R3MA 5E8UA 4C4EA 4JBPA 2RIOA 3E7VA 3OROA 2ZV7A 5AV3A 2IO6A 4NJ3A 2YJSA 3H0ZA 3Q96A 3DFAA 4A9UA 3R7GA 3IKAA 4C4FA 4XV3A 2J6MA 3R9NA 3U4UA 4E20A 5AA8A 3LKMA 1YXVA 2QONA 2WMUA 2B9IA 3F82A 3D5VA 3EFKA 4WUNA 4C4JA 4PY1A 4AA5A 4TYJA 1GZKA 4LGGA 3V51A 4MD7E 2JEDA 1MRVA 3OWLA 3QC9A 3SW4A 3ZSGA 3U54A 4BDDA 4JXFA 1GIHA 4X2KA 2C3JA 4FIIA 5CZHA 1O6KA 4AW0A 5JRQA 1JWHA 4EQCA 1ZYJA 3R9DA 4H05A 3KMMA 3VN9A 4CLIA 3C13A 4F09A 1KE9A 3BYSA 1RE8A 5LVPA 5IG1A 4FNXA 4DTBA 2EXEA 4I0SA 1V1KA 3P0MA 4K33A 4ANNA 3VS5A 3CC6A 3KK9A 5M08A 3KMWA 2OZOA 3PRFA 4S2ZA 2ITQA 4YLKA 3HA6A 3OBGA 5HEZA 3WIGA 3RWPA 4F08A 5GINE 2X6EA 2BPMA 2OJFE 3SD0A 3OP5A 4L42A 4BKJA 3UIMA 4OBQA 5CF5A 3VBTA 4F9WA 5BUEA 4FTRA 3COKA 4I23A 2WD1A 4DN5A 1PXMA 4IHPA 4CLJA 2HCKA 4IX5A 5KNJA 2XVDA 4NUSA 3GB2A 3CXWA 4IB3A 5DR2A 2VTAA 2PVKA 2CLXA 2WTKC 4PTEA 4BDJA 4DEGA 4DH1A 2Z7QA 3PA4A 4CCUA 4PMSA 3O96A 4O0RA 4DFUA 4I41A 1PYXA 5L2WA 1OKWA 5LXMA 5HESA 3WZEA 5AUZA 1AD5A 2BFYA 4QMLA 5A46A 5HG5A 4CG9A 3MY1A 2FSTX 3MVMA 4HCUA 2WEIA 4ZTQA 2WMSA 3V5QA 4EOIA 3CJGA 4OAVB 4YJNA 3VQUA 4AW2A 4C57A 4YSMA 5J9LA 3OOMA 4W8DA 3DXQA 5FTQA 5KUPA 2C1BA 4QTEA 4FVQA 3F5UA 3ANRA 5AUVA 2YCFA 4IWPA 4G17A 5KBRA 4L68A 3BYMA 4FSWA 4E4XA 5K4IA 3KXHA 4EYMA 5A4LA 2R7IA 3MFUA 1IRKA 3DDPA 5T68A 4IBMA 4IX3A 4JR3A 2Y4IC 3ORMA 5AP5A 3EZRA 5CNNA 1DI8A 2VTQA 3ZH8A 4CQGA 3QQLA 4JNWA 3LW0A 4KAOA 4XNEA 2R3PA 3RPVA 3DGKA 3TNIA 1YRPA 4A4XA 2EB3A 4FYNA 4ITIA 3FMDA 2PSQA 4JBOA 4AGCA 4ZSAA 2E9VA 3C4FA 3II5A 4A7CA 4IWQA 4MX9A 5AIRA 5ETIA 4HVDA 4UWCA 3E87A 3F61A 4JRNA 3ZFYA 2QOHA 4BRXA 4DFXE 2F4JA 2VZ6A 1PMVA 3VRYA 2ERKA 3BRBA 3RPSA 3HDMA 4FV2A 3OWJA 2NPQA 4LL5A 5HU9A 4G2FA 3DXPA 1TKIA 4F6SA 2UZDA 2C30A 4JX7A 3W2SA 1U54B 2WAJA 4PDPA 4H39A 3W55A 3A7IA 4O7RA 2XEYA 2QOCA 4FEUA 2OFUA 3OXTA 1OZ1A 4FG8A 3TTJA 2BR1A 2BZKB 3NCGA 1Q8YA 2A4LA 4G3CA 3WF5A 2Z02A 2XUUA 3P08A 2QG7A 3L9NA 2R9SA 4QRCA 2BFXA 4RLKA 3A99A 4GMYA 4DITA 4WNMA 1Z5MA 2EVAA 4WRSA 3WARA 1KV2A 3FWQA 5H8EA 3UYTA 3TZ8A 4FNWA 3ORNA 3F3WA 3MVHA 3CY2A 3H30A 3FMLA 5L2IA 1WVYA 5A4CA 4WHZA 3F3VA 3DJ6A 3TTIA 4AW5A 4D1SA 3QLFA 1IASA 4PWNA 3ULZA 1KUTA 4TL0A 3E3PA 4XP2A 2UW8A 3CJFA 3D2KA 4RPVA 5CANA 5CF8A 4LFIA 3NNWA 4PPAA 4UB7A 2C6OA 1UWJA 3W2OA 5L2SA 4YJRA 5CVFA 1KE5A 4RVTA 1OVEA 2XNNA 4NTSA 1PHKA 1XWSA 1YXUA 2XBAA 4F6WA 4O2ZA 4AUAA 5HX8A 4DEEA 2NNWB 1GIJA 2UZOA 3VBYA 1O6LA 2XKEA 2BTRA 4BI2A 3L8SA 4OR5A 3LVPA 3P7CA 5FDXA 4C4GA 4FTUA 4KNBA 4K0YA 3MTLA 1OPKA 2C3KA 3O8PA 4DGLC 1OBDA 2WMQA 1OL7A 3GC8A 5HG8A 3NPCA 2W5HA 2ZMCA 3K5UA 4U80A 4YR8A 4XEYA 3MIYA 2C6IA 3NGAA 3ULIA 4EH5A 3UMXA 4A9SA 3HMMA 4BFMA 1S9JA 1O9UA 1K3AA 2YIRA 3QQFA 1Q62A 2VTNA 3AT3A 3GQIA 3NZ0A 4JAJA 5KMOA 2R3QA 2ETRA 2GS2A 4C4IA 3ACKA 3PJ8A 4RC2A 5ETCA 3S2PA 4AT3A 4XV2A 5EI8A 3A7JA 4J96A 2XCKA 3DK7A 3FQEA 4IC7A 3E88A 3O23A 4QYGA 3VO3A 2PHKA 3JXWA 3NIEA 1W83A 1DS5A 2G2HA 5D7VA 4N57A 4GVAA 4QNAA 2PWLA 2QHNA 4KA3A 4ASZA 5DT0A 3ID6C 2CCIA 4AN2A 3FEGA 1XQZA 3ZBFA 5AFVA 3G90X 2E9NA 2AC3A 2PUUA 3QRUA 5CEKA 4AA4A 4GK3A 4GUBA 2XJ2A 5TE0A 4EBVA 3OUNB 3U4WA 3ROYA 3MB7A 4JDJA 3OWPA 3LCSA 4RVMA 4IAAA 1AGWA 2ITOA 4GK4A 3FZOA 3R8ZA 2OZAA 3HUBA 1XHAA 5H8BA 2X4ZA 4DEHA 5IQBA 5F94A 4K18A 5HNBA 5LMAA 4G3GA 3U9NA 4UN0C 3CE3A 4ANMA 2R3JA 1YI3A 4OT6A 4RQVA 1JPAA 2HZNA 5HVJA 2OF4A 4D2PA 3HV4A 1PF8A 4LYNA 2QOBA 3DT1A 1MP8A 4RA4A 4XRLA 3ROCA 3LIJA 2YM4A 3CP9A 4NW6A 3UE4A 3ZTXA 1FVTA 2GCDA 4UMRA 3DK3A 3NMUF 2UUEA 2VTMA 3OUKA 3EN5A 1ZYSA 1P5EA 2BZHB 3P7BA 4I6FA 2YZLA 2WMVA 2VUWA 3HNGA 4YGAA 2G9XA 1YOLA 2OSCA 5DR9A 3IONA 4EK6A 2X2KA 4G9CA 4WG3A 3A8WA 3PP0A 3KULA 4M8TA 3T8OA 2O8YA 2QLQA 1F0QA 2VWIA 3O7LB 3QZHA 2JKQA 2F2CB 3QQHA 3BE9A 4P7EA 4JS8A 3SOCA 1T45A 5EI2A 2X2MA 5KMNA 4DT8A 2C5YA 3C5UA 3GT8A 2BCJA 5EM8A 5AR5A 5I9XA 5EHLA 3Q9XA 3BHUA 4RIXA 3REPA 4C58A 4ENXA 5FTOA 1H28A 2R7BA 4BCIA 5EDRA 2SRCA 3PPJA 3QXPA 5CI7A 3ZONA 4BTMA 4R8QA 4MWIA 3C4CA 3DTCA 5FXQA 4L00A 2PY3A 3MBLA 3ZRMA 4MNFA 5DPVA 2RGPA 3HV3A 3AC4A 2X6DA 3OY1A 1ZARA 4MXAA 4LOPA 3U6IA 2W05A 4OTPA 3ZHPC 5LVNA 5IUGA 5A4TA 5J7BA 3CSVA 4J8NA 5EFQA 5CENA 4H1MA 3BHVA 4HW7A 5HTBA 4H3QA 4GK2A 4MD8E 2CNUA 4RQKA 4M69A 4V0GA 2RKUA 3PXZA 1PMNA 4K2RA 4RFMA 4B7TA 3O50A 4ACCA 5C8KA 1E1VA 1OKZA 3F9NA 1L8TA 4WA9A 4W4VA 5AM7A 3B2TA 1EH4A 4W4YA 4WIHA 4KWPA 3SC1A 3GCQA 4CZYB 5J1WA 4WD5A 2IPXA 4DLJA 2OKRA 4IB0A 2PZRA 3UIXA 1FVVA 3ZS5A 4CFWA 2HW7A 3NAYA 3SW7A 3BQRA 3DTWA 1XO2B 3PSCA 4FIJA 2JBPA 4IFCA 3MH0A 3OEFX 2WMBA 3N51A 3R01A 2W5BA 1Q8WA 1DM2A 5KMKA 3RM6A 1XH8A 2PPQA 3COIA 3ORKA 3BBTB 4RT7A 2W4JA 3U55A 3VW6A 3PLAE 3WF6A 2PVFA 4DF3A 3SAYA 4EH9A 2O64A 3PXRA 4WRGA 4XBUA 3TV6A 2GU8A 1STCE 4EK5A 4PL5A 5E8SA 2WOUA 3TKHA 4UY9A 3AMAA 3G33A 3FI3A 3V01A 2BAJA 4XS2A 1P2AA 3GCPA 4EQMA 2FGIA 3ZC5A 2GNIA 3KL8A 3LQ3A 2B1PA 3H0YA 3F2NA 2JDOA 3FDNA 4FIFA 5CTPA 4AGDA 5EOBA 4GT4A 3RBWA 4N6ZA 4FKRA 4L7SA 1ZY5A 3I81A 2W17A 5IH4A 2PVJA 4TYEA 5AR4A 4S32A 4MBLA 2RF9A 3CBLA 4QT1A 3LPBA 4LRJA 3CKXA 4O86A 4TPTA 4MQ2A 5FM3A 5LCKA 2OGVA 3M1SA 3SRVA 2YZAA 1CTPE 1PJKA 3A4PA 1YDTE 5CF4A 2YWVA 4LV5A 3BU5A 3PUPA 4JBVA 4ZTRA 3VBQA 4F64A 4X3FA 4DG0E 2W1FA 2ZV8A 1ATPE 4FZFB 4P90A 4AOTA 2J0MB 4IW0A 2BHEA 4N6YA 5AP1A 2A19B 4FICA 5DRBA 4YLJA 2ITNA 5M44A 3RM7A 4NCTC 4NH1A 4WBOA 5LOHA 5I4NA 3P5KA 4RJ8A 2GTMA 4BCQA 2PZYA 3C0IA 2C6KA 1Q8ZA 3F69A 2ZYBA 3RTPA 1M17A 5EM5A 1Q8UA 3KRLA 4YP8A 3VS0A 4E3CA 3Q32A 3VUKA 5AV1A 3PG1A 2CDZA 3LFNA 4E8AA 3NNVA 2BTSA 2W1EA 2CGUA 4ITJA 4ONAA 3V5PA 4GSBA 4KS7A 2B7AA 2QU6A 3G0EA 3P7AA 4DTAA 3HUCA 3JY0A 4LMUA 3V04A 4C34A 4C8BA 1ZRZA 1DAWA 3OT8A 4BI0A 2CMWA 4I5MA 3EWHA 2VTLA 5B0XA 2WEVA 4DGMA 3QWJA 4FOCA 5HHWA 3G9NA 4WT6A 4DFBA 4R7BA 4Q5HA 5T3QA 4U8ZA 3GFEA 1NY3A 5IA0A 1G8SA 3NIZA 2REIA 2WOTA 3ZRLA 4CMUA 4Q2AA 4FG7A 3MVLA 5CS6A 2Y7JA 4RC3A 4DHFA 5F95A 2X2LA 5E91A 1XKKA 2NRYA 4L45A 4XYFA 3RJCA 3KC3A 4FA2A 3VS4A 2A2AA 4IZ7A 4X0MA 4O84A 4ZAUA 4O21A 3UO6A 5C1QB 3FC1X 3RAHA 5AP6A 4B6LA 5AAGA 4UXLA 3NUAA 2OIBA 1GIIA 1WBOA 2J4ZA 4FG9A 2YDIA 1R78A 4FL1A 4D2VA 5IZFA 4CGAA 3LJ1A 2PMLX 5GHVA 3F3TA 4IM3A 2XRWA 3VVHA 2XM9A 2PZIA 5DA3A 1H8FA 3BKBA 5JMSA 2BDFA 4YPSA 4YHTA 4IQ6A 4FV4A 5GJFA 1JSVA 3EQBA 3F5XA 3TXOA 1Q61A 4KSQA 3RAIA 5DMZA 3CEKA 2GQGA 1B6CB 4O38A 3EMGA 4WSQA 4NKSA 4GIHA 3SV0A 5IA2A 3LXPA 5DT4A 3GU5A 5AP4A 1IA8A 3O8UA 3PVWA 3IECA 3R7OA 4DA5A 4DEDA 4FZDB 4BDEA 4C61A 3R30A 3R00A 2BDJA 4ZLZA 2UVYA 3G2FA 4XV9A 3UC4A 2GHGA 3I6WA 3EL8A 4ASDA 5IDPA 5J87A 4YLLA 2W9ZB 2ITPA 5T6KA 3F2AA 5M09A 1OIRA 4ID7A 3L9MA 3RGFA 5CAQA 4X21A 3DFCB 5IEYA 3DBQA 3MDYA 4P4CA 4AWIA 1WFCA 2W1ZA 4HVHA 3PYYA 4HZRA 2H8HA 4I93A 4F99A 4Z7GA 3G0FA 4WG5A 5E9EA 3LFFA 2CKPA 2C6DA 4F0FA 4HGLA 4FVPA 4QMOA 2C5XA 2XKDA 4FV3A 2WTVA 1OL1A 5J95A 4JX3A 1H27A 3GFWA 2R3KA 3VAPA 2XIXA 4FT0A 4UV0A 3UQFA 5IA4A 3R9OA 5IQCA 4K6ZA 4D4SA 4WG4A 2X1NA 5LMKA 2VTHA 4EWQA 4DLIA 4BN1A 3E8EA 3Q52A 3UG2A 3EFJA 1GZ8A 4DEAA 4D9TA 4H36A 4D5HA 2PULA 3NVMB 3QZIA 4KIKA 2JDTA 5DFPA 4KKEA 1U4DA 5CI6A 3H4JA 4R7HA 1XR1A 3CPCA 3QYZA 4CFXA 5BYZA 3FLWA 4H3BA 4OTHA 3RNIA 2AYPA 5EHOA 3W16A 4AXAA 5LCJA 4HPUE 4ANSA 4EHGA 5M51A 5IA5A 3O2MA 4ARKA 3VF8A 3PWYA 4MF0A 1ZMUA 1UU3A 3PJ1A 2X7OA 5LMBA 3QGYA 2B53A 5HORA 2WB8A 1MRYA 3QKLA 3GC0A 2IVUA 4IACA 1WBPA 1YOMA 1WBTA 1Q5KA 5BMSA 2WTDA 1J91A 4HPTE 5HNGA 2NRUA 2XNOA 3ZM4A 3QKKA 3PWDA 5CAVA 4L43A 4FEXA 3SQQA 2WMAA 3BCEA 4NKAA 2XEZA 3Q4UA 4L8MA 5EDQA 1VR2A 5HG9A 3U51A 4EOSA 5GZAA 2CHLA 5I9WA 1W7HA 5BUJA 3V5WA 4FTJA 5GZ9A 4B0GA 3MY0A 3V5TA 1JVPP 1Y6BA 2Z2WA 3DQXA 1Q3DA 3W8QA 4USEA 1QPDA 4D2RA 3UIUA 2J2IB 5TF9A 1LEWA 2LGCA 3E7OA 2R64A 4UYNA 2PE1A 4EORA 5ANOA 1H0WA 4TYGA 3FLZA 3ODYX 1ZOEA 2X9FA 4BDBA 2XCHA 3DBDA 4H1JA 4OAUC 2W99B 5IQHA 3D5WA 2BMCA 2FSOX 4E26A 4YO4A 3NEWA 2YFXA 3DY7A 4YJOA 3E62A 4ZLOA 3KN5A 5EQEA 4QP1A 2C4GA 1IG1A 2JLDA 3NX8A 1FPUA 4YPDA 1W8CA 2A27A 5JH6A 3LJ0A 4QPMA 3MY5A 4CFNA 5ANIA 5CEMA 3BU6A 4A4LA 4FK6A 1PXJA 3HV7A 4G5JA 4PTGA 3NW6A 2G2IA 4CMOA 4AZWA 4M12A 4FF8A 5I9VA 2R3OA 1TQIA 5J8IA 5C03A 1IR3A 4EZ5A 4LV8A 4TN6A 2RL5A 1Z9XA 4I0TA 3W32A 4ZLYA 3L8XA 5KO1A 4HGSA 3ZCLA 5FBOA 2FSMX 2KTYA 4M68A 5FG8A 3T9TA 2H34A 2HW6A 3IOKA 2O5KA 3R8VA 4CQEA 4EC9A 1ZLTA 3O17A 5HE1A 4YMJA 3LXKA 2PZPA 2HWOA 2WPAA 3PVUA 3C50A 4PDSA 1PRYA 3CCNA 3IPHA 4TXCA 1YKRA 3NUSA 1AQ1A 3DCVA 1SNXA 4BC6A 3R83A 2KULA 2B9HA 2PVYA 3T9IA 3GU6A 4GIIA 4K9YA 1BKXA 2WQEA 2CPKE 2DQ7X 2GDOA 4BZDA 4AZEA 5JK3A 4I94A 1XH4A 3PFQA 1JLUE 1YHWA 1M52A 3I1AA 5CU6A 3AGLA 5EG3A 3R9HA 1J7LA 3T3VA 3FKNA 5KKRC 3BLQA 4FR4A 1LPUA 4EKLA 4UALA 4AACA 4AE6A 4D4VA 4L53A 4IVCA 4RRVA 3ENHA 4FKJA 4ZY5A 4FUXA 4ZIMA 1SVEA 5BQ0A 3RPRA 4FTMA 3R1SA 2RFEA 3L8PA 1BYGA 4PL3A 3UVRA 4EC8A 5M4UA 2YIXA 1P4FA 5LVMA 4GCJA 3WZJA 1JKKA 1A9UA 1H1QA 5IUIA 5CF6A 1IAJA 3EYHA 4E6AA 5IISA 3SG8A 1SVGA 4MXOA 4BCJA 2OZAB 4F9BA 1JNKA 2YWPA 4QMXA 4QOXA 4XG9A 4CFUA 4E6DA 2W7XA 4IVBA 3LFAA 4XRJA 2ZM3A 5CALA 3PA5A 3PVBA 4FBXA 4RX8A 3QZGA 3E8DA 2W1GA 4PDYA 4AE9A 4DTKA 4EZ3A 1G5SA 2OK1A 3MV5A 3QD3A 4JI9A 2QOKA 3LCOA 4WNPA 4IX4A 4MQ1A 4BDFA 4X6QC 1U46A 4E6CA 4OUCA 3LQ5A 4FT7A 5HE2A 2OWBA 1GY3A 3O8TA 4IDTA 4PMTA 1VYWA 3E8CA 2B4SB 2FH9A 3BHYA 4F9YA 4ANBA 1YI6A 3EN4A 4UMUA 2QOFA 3DNDA 3Q4ZA 1BL6A 4I20A 5D12A 3DKFA 5TO8A 2IVTA 4IM2A 4OTRA 4GH2A 3D9VA 3FY0A 3KULB 4Z3VA 3DJ7A 3IW4A 4EOJA 3OWKA 4XX9A 4OBOA 4CSVA 4MXXA 3I7CA 4ZTSA 5E8VA 4D1ZA 4PF4A 4TWNA 1YHSA 3VULA 3QUEA 3WF9A 1J1BA 4A9RA 5DYJA 3I60A 2YABA 2JFLA 2YM5A 3EOCA 3UBDA 2UVXA 2BRHA 4RIXB 1H1RA 4EOLA 3R1YA 2O3PA 3U87A 4XLIA 3KGAA 5CYIA 5CWZA 3ZO4A 4L67A 3IQ7A 3PIXA 3ZC6A 3D7TA 4EK3A 2QOLA 2UVZA 4TYHA 2O63A 5HE0A 3LLAA 3KY2A 5JGDA 1OM1A 3QRKA 3QRJA 3QTIA 3FI2A 4YJUA 5DI1A 5IPJA 1SZMA 5L8KA 2NO3A 3VUDA 2J5FA 2A1AB 5BVNA 3OW4A 2XKFA 3P1AA 5DIAA 4M69B 5HD7A 5I3OA 4RLLA 3WE8A 4V0GB 4AN3A 4GVJA 3UODA 4EWHA 3ZO2A 4DINA 1K2PA 3HA8A 2I0VA 4XG4A 4ENYA 3LLTA 2LAVA 2OXYA 1T46A 3V5LA 3ALOA 5E8WA 1NVRA 4BB4A 2QG5A 4OTFA 4C62A 2PL0A 2BZIB 4XG8A 1Q41A 2QHMA 1MQ4A 2FYSA 4D4RA 3AMYA 3QD2B 2XK6A 3BGZA 3HV5A 3R73A 4D0XA 5AX9A 4D5KA 4P2KA 4YZCA 1M2RA 4HNFA 5J9YA 1OBGA 3NVKI 3TJDA 3NDMA 3ZLXA 4QQJA 2VGPA 4W4WA 2QU5A 3NCZA 4YO6A 3MS9A 3UZRA 5ACKA 4PRJA 4G6OA 5EH0A 2XBJA 2WTWA 1FBNA 4QP3A 3G51A 4M13A 1G3NA 2BIYA 2VO3A 2W1HA 2WTJA 2CN8A 3OMVA 4D4YA 4BIEA 4M0YA 4DCEA 2ITWA 5M4CA 5HI2A 1JSTA 2IVSA 4YZNA 3R28A 4EOPA 2R0IA 3F88A 3LE6A 2R3IA 4RFYA 2XIRA 2VTRA 2YCSA 5EI6A 5I0BA 1NW1A 2CCHA 2FB8A 3OCSA 3PXYA 4OT5A 1U59A 4FV6A 3KXNA 5ANEA 2ITZA 4MVFA 4F65A 2XK3A 4MD9E 3CD3A 1JBPE 2QO2A 3IGGA 4ZS0A 2WHBA 4Z55A 1UNGA 5HBHA 3BI6A 3HGKA 2H6DA 4QMMA 3FKLA 3FMHA 3FLYA 4CVAA 5FXRA 2IW8A 4YZDA 3KU2A 5B2LA 5B2MA 4FIGA 1LUFA 2W9FB 5H2UA 4PP7A 4ERKA 3CY3A 2JIUA 2VTJA 3FL4A 3H9FA 3HKOA 3UMWA 1BX6A 3UPZA 4XG6A 3CGFA 1YHVA 3AC8A 4CT2A 4QMNA 3HEGA 4A9YA 3RAWA 3SRVB 3MFSA 4WUAA 4EH7A 4ACMA 2Q0BA 3EN6A 3PY3A 4S30A 3CIKA 4KIOA 5LMKC 4GU6A 3HV6A 2JDRA 2CLQA 4X3FB 4LMNA 3LM5A 4IDVA 3TNHA 3QUDA 4RJ5A 4F9AA 4PNKA 3VUGA 3LHJA 5AP2A 4E5BA 4JL9A 4QP2A 2BALA 3GCSA 3ZZWA 4OTWA 1J3HA 4HYSA 4TT7A 1W82A 4MTAA 5AUWA 5IMXA 4BWPA 3G6HA 2OIQA 4EHEA 4G6NA 1OPJA 2RFNA 1QPJA 5CVHA 3AC2A 1YI4A 3WE4A 2GS6A 2P4IA 4NK9A 2UW6A 3DLSA 2YAKA 4CXAA 2G15A 5C9CA 4F1TA 1JKTA 4AQCA 2CN5A 4TZRA 4FTTA 4MCVA 3HP5A 1YWRA 3TJCA 4CFMA 2RG6A 3EKNA 5A9UA 1J7UA 3UOHA 4FKPA 4BR3A 4IVDA 4QD6A 4B9DA 3OFMA 4IANA 3QCXA 4ZZMA 3LFDA 3COMA 2OFVA 4QTAA 2W1IA 4FGBA 5E92A 2JAMA 4Y72A 5K4JA 4XLVA 1URCA 2V0DA 4J52A 4LI5A 4NU1A 3PG3A 4YJTA 3W8LA 4FL3A 3QA8A 1FOTA 4G5PA 3NUYA 2WQBA 2YDJA 4GFMA 4JQ7A 5CT7A 4JAIA 4IJ9A 4Z7HA 4QYYA 3HRFA 4D2SA 4QNYA 3FLSA 4EI4A 2RSVA 3ZUTA 4S31A 1G8AA 1NVQA 2CGWA 2VWBA 2YIWA 3V6RA 2G2FA 2YITA 3KCFA 3C4WA 3F3ZA 3VS7A 3OD6X 2VX0A 2W1DA 5CSHA 4BDIA 1OPLA 3UQCA 3LQ8A 4AU8A 3LMGA 2HZ4A 5G6VA 4BGQA 4NL0A 2UZEA 2P2IA 5HQ0A 3QFVA 4KUJA 3HMIA 4V04A 2ZB0A 4BCHA 1JQHA 4Y8DA 3M11A 4XHKB 3EJ1A 2QCSA 4KBCA
chains in the Genus database with same CATH superfamily
3ALNA 4TRLA 4F7NA 1IQPA 5JQ8A 3QALE 3GVUA 2FSLX 3V6SA 2RG5A 3FPMA 1OAIA 4UX9A 4A07A 5CXZA 1P3QQ 2CV0A 3RCJA 3HAMA 1GO5A 3AT2A 1KSFX 3WBLA 4ZMEA 1Q39A 4DR7M 3PSDA 5CEIA 3GLGB 2YJRA 4OTQA 2Y8OA 3TZ7A 4CYIA 5F20A 5ITYA 3EH9A 4AAYA 1ZYLA 4O7LA 4LL0A 2P3GX 4MGIE 1UU8A 5IREB 2KA6B 4LG4A 4AS0A 3S4QA 4A4OA 1PXKA 5IQGA 4M0DA 4U5JA 5A4QA 4O0SA 3JUHA 3FMEA 3BOSA 1HOWA 2WGJA 3FC2A 4ZJIA 3G6GA 4XCUA 1CKJA 2QD9A 4DFYA 2R2PA 3GBZA 3OCBA 1OIZA 4G31A 4Y95A 3T1HM 2GS7A 5DN3A 2EXMA 5FEEA 5FP5A 5IQEA 2G01A 3SAUA 3HU3A 4FSRA 5M53A 3BWFA 3U61A 3PXQA 1W2DA 4NJDA 2H9VA 1ND4A 3H10A 1K3WA 5EYMA 3KXXA 4MH0E 3DFZA 4QP4A 2VU3A 2FE8A 4K1BA 2VNYA 4DH3A 3EN7A 4BKZA 3VBXA 4RJ6A 3AC3A 4KB8A 4RVLA 2FFJA 5CSWA 2XZFA 3U6OA 3D2IA 3U60A 1WZYA 2XIKA 3D5UA 3QYBA 1ZAEA 3CQEA 4CTCA 1UWHA 4BJJB 2GHLA 4CYJA 2XA4A 1QDTA 2WMRA 4YC6A 5CZIA 4FKGA 4L01A 3DQWA 3DB6A 2V55A 2W1CA 4APCA 3QQUA 4EHVA 4R3DA 1F3MC 4F7JA 3PZHA 5IH5A 1H24A 4QDVA 4XJ0A 2C96A 4TWPA 3HX4A 4U6RA 4N4SA 2EWAA 3A98B 4USDA 4E4NA 4B3TM 4O0YA 3HMNA 3D7TB 4FV0A 1MU5A 2C6EA 3FTDA 2F4VM 4APPA 2GMXA 4F78A 2QOOA 2BRNA 3P79A 4RIOA 4O7SA 5KQDA 3LFSA 1G8PA 2UZLA 4IMYA 5BVEA 4BCMA 4UBAA 3F3UA 3OCTA 5EHYA 1AIPC 4C7TA 2FVDA 3EYGA 2BWEA 4X3JA 3U6JA 3W1FA 4DDGA 3KXMA 2R3RA 5HLNA 3VC4A 1YXTA 3BQCA 4X2FA 2IJMA 4FZ6A 4BWXA 4M66A 1I09A 3GUBA 3RP9A 4I8OA 3GRUA 5AUTA 3RPOA 1M7QA 1OKVA 3D0EA 4RIYA 5FTJA 4ZEGA 1R39A 2JZ1A 3FJQE 3H9OA 4BICA 4QQ5A 2BHHA 4GHLA 4FV5A 2YIYA 3PP1A 3QTSA 3TZMA 4J97A 1M2QA 4DBGB 3V8TA 3ZXTA 4NSTA 4GRIA 1NXKA 4MXCA 4G3FA 2DZOB 4JXJA 3BHTA 3UC3A 1WGLA 3O0GA 4JJRA 1KOBA 3TNPC 2B54A 3A7GA 4N70A 4C59A 4MK0A 1OL2A 3F5PA 2I1MA 4RBLA 4NM7A 5DHJA 2QCUA 4NCTA 5DNYA 4OTIA 3AKKA 5EW8A 4IWDA 1Q8TA 2C3LA 2UW0A 2DWZB 3V8WA 3VKHA 3KXEC 4WBBB 4CKJA 4BHNA 2ZVAA 3KVXA 5L2TA 5HIDA 4ORKA 4PUZA 3GQ5A 3BBWA 2XIZA 2Z60A 4BYJA 4F70A 1WAKA 2ZM6M 4GG7A 3UJNA 4F1IA 4FSNA 3Q60A 2IZRA 4O0VA 2Z7JA 4FKTA 2BZJA 4EUTA 2JP7A 5CLPA 3EHAA 2CSNA 4FT5A 4O1PA 4TTHB 3ANQA 3BE2A 3POZA 4AA0A 3VONA 4Y85A 3SC3A 1Q3BA 3D7ZA 4FC0A 2BAQA 2P2HA 4D9UA 2DUVA 3OS3A 3Q8XA 4QOSA 2I0YA 2YFQA 4FV8A 2YIQA 2Z7RA 4RMZA 4CT1A 4CKRA 2ZB1A 1QMZA 2DYLA 5HE3A 4G4OA 2XH5A 2GNGA 2WQNA 4HCVA 5HKMA 4DT9A 5KMMA 5DFLA 3J7BA 2QKRA 1H00A 3VK7A 4MBIA 2VWUA 5BPYA 2R0UA 4O2PA 4TYIA 2EUCA 2QOQA 4X6RA 3FMJA 4YU2A 3ETAA 2VGOA 5DE2A 4J71A 2JBOA 1OIUA 2H96A 4V01A 2XK7A 4M0WA 4LM5A 4D0WA 4F1MA 1ZZ2A 3IHPA 1NV8A 3DA6A 2I0HA 3M42A 3QCSA 1GVNA 4RX5A 2OIDA 4RJ4A 3ZQJA 1TQPA 2UW9A 4RZVA 3A46A 4BCNA 3R8LA 3RZBA 3FZ1A 3UP7A 2X81A 2MH8A 1ERKA 3LM0A 5F4NA 5LWMA 2KZSA 5JZJA 4GS6A 1PXPA 4P17A 3CTQA 4BTKA 2IW9A 4IZ5A 5LJJA 4QHTA 2O65A 4BHZA 5FP6A 3F6XA 1XBCA 3Q53A 2UZTA 3U5ZA 4C36A 3AQVA 3L29A 5G1XA 5DBXA 5CAUA 5JGAA 1R4GA 3RMFA 5HO8A 1WVWA 3GNIB 3B9PA 3Q5ZA 4CJ6A 3AOEA 5AJQA 4ACGA 5AMNA 4Z16A 2GTNA 4BBFA 4ZSEA 5EW3A 2C9OA 3E46A 3W2CA 2V5QA 1L2DA 1VDDA 4IB1A 4M7IA 4M84A 4HJOA 5CQUA 3MH2A 3D14A 5HLPA 2ONLC 3MTFA 5E90A 2R4BA 4E93A 5ANJA 2IG7A 3NSZA 3VUHA 4CZTA 4YC3A 4M3QA 3HYHA 3A8XA 1VZOA 3DAKA 3OC1A 3B8RA 3BWJA 4B3RM 3R7YA 3K2LA 1UKIA 4HCTA 4J53A 3ZOSA 3TN8A 2HKJA 3FQHA 2XS0A 3UNZA 4GW8A 4IEBA 1W98A 3LCDA 3L8VA 5LMKA 1GZOA 5CAOA 5JFSA 3OTVA 4AOIA 3PXKA 3FBVA 3QTRA 4WNKA 1D2NA 3ZLWA 2QR8A 3WF8A 4FTOA 5F9EA 3GPUA 5KHXA 3ORTA 2OOAA 4ZZNA 5EKNA 3HKPA 3I4VA 2BRMA 3RZFA 4U7ZA 4ZMFA 3I4BA 3R04A 3R02A 3BLAA 3KVWA 3E64A 3BX5A 1DGGA 2WMTA 2J0LA 2D7GA 2YERA 2G3QA 5JFWA 1REJA 2K9DA 1JKLA 4I24A 4EZ7A 5I9YA 3I5NA 5L2QA 1WBWA 4MF1A 3D5XA 4EUUA 1IN6A 3JVSA 1UKHA 2HK5A 1PJTA 3RK9A 1Z59A 4Y5QA 5HU3A 4YJQA 4D58A 3UK6A 3UG1A 3SHGB 2YAAA 4MKCA 2F7ZE 4EJ7A 3I51A 4ALUA 3E3BX 4L16A 4JI4M 4RIWB 3GXLA 4YJPA 4QMSA 4O0UA 3I79A 3W0NA 5B2KA 4LGHA 3GRYA 1XJDA 4KABA 4KBKA 4QMZA 5GIOE 1NA7A 2B3TA 3MFRA 3KFAA 3PE1A 1L1TA 4O0TA 3EIDA 4LJ5A 4GL9A 2C5NA 3NWLA 4RWIA 2YACA 4FGRA 5BVKA 5BYLA 2C5OA 5K5NA 1H08A 4X66M 4HNIA 1HQYE 2DWBA 4FWDA 2JY8A 5LARA 1XHBA 2UZVA 4E4LA 3TWKA 5LVOA 1OMWA 4PCZA 3FYKX 2OJIA 2WIPA 1YXSA 4RKUF 5GNKA 2BIKB 2PYWA 3OXZA 4YZBA 3FUPA 4FRFA 3H3CA 3FQSA 4AGUA 4HZSA 3HHXA 3D94A 4L3PA 3LCVB 5L6OA 4OLIA 3R7IA 4W4XA 1WBSA 2GNLA 3SHEA 2FNAA 5AA9A 3I6UA 4LJ6A 2CGXA 1OUKA 3DBCA 2BRGA 4O6LA 5DGZA 2VNWA 5CU0A 3HMPA 4REZA 1BUHA 1YVJA 2WMXA 4FZAB 2RFDA 5BPVA 4S34A 4EK8A 2F7XE 2GQSA 4IXPA 3GLIA 5KZIA 3VUIA 4RGJA 5AADA 3VUMA 1ZOHA 3A2CA 4ZXTA 5ITXA 5TKDA 2BJVA 1PXIA 3O7LD 4XG3A 2UUBM 4BBAA 5JN2A 1IY2A 4GG5A 4FSMA 4EH8A 3FZTA 4DV0M 5FTNA 3VF9A 3V5JA 4O6EA 2XF0A 5AAFA 3VUTA 3LMHA 4YY3M 4C4EA 1OGYA 3E7VA 5AV3A 2IO6A 4NJ3A 1NVMA 4A9UA 3R9NA 3I4YA 2QONA 2WMUA 2B9IA 3F82A 4PY1A 2JEDA 2C3JA 4AW0A 4EQCA 3LVWA 4F09A 3BYSA 1RE8A 4ANNA 3CC6A 2V6ZM 4S2ZA 3AKZA 5GINE 3WIGA 4F08A 3VBTA 4F9WA 4FTRA 3J80S 1L2BA 2LHGA 1D0KA 4DH1A 4PTEA 4DFUA 5A46A 2FSTX 1JR3A 2WEIA 2WMSA 3V5QA 4YJNA 4AW2A 5J9LA 1SXJC 5KUPA 2C1BA 4QTEA 3ANRA 5AUVA 4IWPA 5KBRA 4L68A 1N34M 5K4IA 3KXHA 3DDPA 4JNWA 2C98A 4ZSAA 4B08A 3II5A 1L1ZA 2QOHA 2NPQA 3A42A 3DXPA 3C3EA 4JX7A 2WAJA 4PDPA 4H39A 1VG5A 3OXTA 1OZ1A 2DNAA 2BZKB 2A4LA 1NJFA 4RLKA 4GMYA 4DITA 4WNMA 2EVAA 3K9PA 3WARA 3UYTA 3TZ8A 3FMLA 1E32A 3TTIA 3QLFA 2UW8A 3NNWA 4UB7A 1WIVA 1KE5A 1OVEA 2XNNA 4NTSA 1PHKA 1YXUA 2XSZA 4G6ZA 1XWIA 4OR5A 3O8PA 3NPCA 2ZMCA 2XARA 4YR8A 2I7NA 3UMXA 1S9JA 3AT3A 3GQIA 4C4IA 3PJ8A 2DWMA 1OIPA 3S2PA 4J96A 4CIZA 1QZEA 4FWHA 1DS5A 5D7VA 4N57A 2AHMA 3UGJA 4KA3A 4ASZA 1XQZA 3ZBFA 5CEKA 4LJAA 4GUBA 4LZJA 4JDJA 4RVMA 2OZAA 2X4ZA 2EA0A 5F94A 4K18A 5LMAA 3U9NA 3CE3A 3C58A 2QOBA 1MP8A 4RA4A 3ZTXA 3LIJA 3CP9A 5EXPA 3NMUF 1ZYSA 3EIEA 1YOLA 3IONA 4M8TA 2QLQA 3O7LB 3QZHA 2JKQA 2F2CB 1XMMA 4M9ZA 1T45A 3MJ5A 2C5YA 3GT8A 2BCJA 5EM8A 5EHLA 3Q9XA 3BHUA 5FTOA 4BCIA 4BTMA 4R8QA 2PY3A 1OQYA 4MNFA 5DPVA 2RGPA 4KLNA 2W05A 1Z5CA 1MX0A 5IUGA 4J8NA 4H1MA 4H3QA 4MD8E 4V0GA 3PXZA 3F92A 4B7TA 1E1VA 4WA9A 4W4VA 1EH4A 4WIHA 4KWPA 4NXNM 3GCQA 4CZYB 4WD5A 3HHYA 2OKRA 4CFWA 3NAYA 1Z6TA 3DTWA 2JBPA 4IFCA 1DM2A 2PPQA 3BBTB 4RT7A 2PVFA 4DF3A 4EH9A 4XBUA 2QBYB 5JI2E 3LQ3A 4AGDA 3H0YA 5EOBA 3RBWA 4N6ZA 4L7SA 3I81A 1OFHA 4QT1A 3CKXA 4TPTA 4MQ2A 4GKJM 1CTPE 3BU5A 4JBVA 3VBQA 2ZV8A 4AOTA 4FICA 5M44A 4NH1A 4RJ8A 4BCQA 2PZYA 3F69A 1M17A 3Q32A 8CATA 3LFNA 2QQ8A 3JY0A 4C8BA 2WEVA 3QWJA 3G9NA 4WT6A 4Q5HA 1NY3A 3NIZA 2REIA 3MVLA 4RC3A 5F95A 1XKKA 3RJCA 4ZAUA 3UO6A 5C1QB 3RAHA 3NUAA 2OIBA 4FG9A 2YDIA 3GLIE 2PMLX 1OJLA 2XRWA 1IXSA 2BDFA 5DMZA 3F5XA 3RAIA 5ITXE 1B6CB 4O38A 3EMGA 3SV0A 2CE7A 3LXPA 3R7OA 2F5SA 4DA5A 3R30A 3HY5A 4ZLZA 4OVZB 4XV9A 3UC4A 3EL8A 4ASDA 3MK6A 5J87A 3F2AA 3L9MA 3MDYA 1WFCA 4HZRA 1AUAA 3G0FA 5E9EA 2C6DA 4HGLA 4QMOA 1OL1A 3GFWA 4FT0A 5IQCA 4K6ZA 1TH4A 2VTHA 4EWQA 5JI3E 3Q52A 4DEAA 4D9TA 3NVMB 2PULA 4KIKA 1VEGA 3QYZA 3CPCA 4CFXA 3RNIA 4AXAA 2AYPA 5IA5A 4ARKA 1UU3A 4GHAA 2O25A 5LMBA 2B53A 2WB8A 3QKLA 3GC0A 4RNAA 2JUJA 3ZH9B 1J91A 2NRUA 4DUYM 4L43A 4FEXA 2WMAA 3BCEA 4NKAA 2XEZA 5GZAA 1VR2A 3LCUA 3U51A 4RF0A 2HL7A 3V5WA 3MY0A 3V5TA 2V1UA 1Y6BA 3PUFC 1Q3DA 3UIUA 2J2IB 3E7OA 4UYNA 4EORA 2ZTCA 4DV7M 4NL4H 3ODYX 2BMCA 3NEWA 2YFXA 4ZLOA 4QP1A 2C4GA 3NX8A 2JLDA 1FPUA 1W8CA 2EKKA 3LJ0A 4CFNA 5CEMA 4A4LA 3HV7A 4G5JA 4PTGA 2G2IA 5I9VA 4AZWA 1Z9XA 2Y0TA 3W32A 4HGSA 1TH2A 4M68A 2M5ZA 3T9TA 2HW6A 1ZLTA 4TXCA 1V92A 2B9HA 2R45A 1IBKM 2X0QA 4K9YA 2DQ7X 4BZDA 4AZEA 3PFQA 1JLUE 3AGLA 3R9HA 3T3VA 3FKNA 3BLQA 3BBZA 4UALA 4AE6A 4ZY5A 3KOWE 2RFEA 3UVRA 4EC8A 2YIXA 4IJFA 5IUIA 4E6AA 5IISA 2DAGA 1JNKA 2YWPA 4XG9A 2W7XA 4IVBA 3QZGA 4AE9A 3QD3A 2XALA 4BDFA 4X6QC 5HE2A 4IDTA 3BHYA 1NV9A 3DKFA 2IVTA 4IM2A 3KULB 4XX9A 4OBOA 4MXXA 3VULA 2Q2EB 5DYJA 2YM5A 2O5RA 3SYKA 3R1YA 2O3PA 3U87A 3GP1A 3KGAA 5CYIA 1Z5BA 3PIXA 3QRKA 3QRJA 2OPFA 5FTLA 5L8KA 5I3OA 4KHPM 1QAMA 4ENYA 3LLTA 3ALOA 1HR0M 2PL0A 2BZIB 4XG8A 3BGZA 4D5KA 5J9YA 4P2KA 3NVKI 4LJ7A 3ZLXA 5EXTA 2VGPA 5ACKA 4PRJA 5EH0A 3G51A 2VO3A 2BIYA 3OMVA 3WHLA 4BIEA 4D4YA 2WSEF 4DCEA 2ITWA 2IVSA 4YZNA 3GQ3A 2YCSA 4AXEA 4FV6A 3KXNA 2UXBM 4F65A 3IGGA 4Z55A 2WHBA 1UNGA 3BI6A 4CVAA 5FXRA 4YZDA 5B2LA 2W9FB 2VTJA 3FL4A 4M9SA 3H9FA 3UMWA 3MFSA 4WUAA 3EN6A 4KIOA 4X3FB 2JDRA 2CLQA 4AQKA 5FSWA 3TNHA 2VDBB 2BALA 4OTWA 4HYSA 5AUWA 1W82A 4MTAA 1IFYA 4BWPA 4EHEA 1V33A 3WE4A 4PD2A 2BJWA 2G15A 1JKTA 4AQCA 4LG2A 4CFMA 4TZRA 3HP5A 5A9UA 1J7UA 1L2CA 3UOHA 5KO3A 4IANA 3LFDA 2OFVA 4QTAA 4Y72A 5K4JA 4J52A 3W8LA 3KSJA 3QA8A 4G5PA 1IXZA 2YDJA 4GFMA 4S31A 1NVQA 2W1DA 1OPLA 3LQ8A 4BB9A 5G6VA 4KUJA 4Y8DA 3M11A 4XHKB 2QCSA 4KBCA 3Q4CA 4I6BA 2WU7A 3L9LA 3LCKA 5C26A 5IWAM 4DFZE 1NNJA 5KPTA 4U81A 3IS5A 4RSSA 1M14A 4AZSA 3UO5A 2IVVA 5JFVA 3RNYA 3HRCA 4IAKA 3VS2A 2XYUA 3J81S 4ACHA 3F2RA 1UU7A 3DAJA 2YLEA 4DH8A 4IZAA 4K77A 3SYLA 5A4EA 5DNRA 3U6HA 3LXLA 3LJ2A 5HOAA 4JR7A 5H3QA 3D8LA 3R21A 3OVVA 3P23A 2XAMA 4EK4A 5CU4A 5AV2A 4HVSA 4YHFA 4GUEA 3DOGA 4MHAA 1FMKA 1YXXA 5IA3A 3POOA 3QHRA 1WJ7A 3KIOC 4CV9A 4ZY4A 4R7IA 2RFSA 3QGWA 1B38A 3KK8A 1KYIA 2PUNA 4O7NA 3ZUVA 3SDJA 3MB6A 1FMOE 3UQGA 2J51A 2QZ4A 3LAUA 3A60A 4DHIB 1OTRA 4EH6A 3GU4A 5ACBC 1T6OA 2ESMA 2XYNA 3EL7A 3NUPA 1A06A 1S9IA 2P33A 1IN4A 3VBWA 4AZTA 4B3MM 2O0UA 4C3FA 4PV0A 5M4FA 2PVRA 3SOAA 3QQGA 4LFAM 3R9RA 2NP8A 3C4XA 5HICA 3GLHA 4YC8A 1H07A 3QYWA 3BELA 1Q4LA 1ZAOA 2XJ0A 2NQ8C 2QOIA 4GT5A 3QU0A 2X8IA 1SVHA 2HXLA 2XZSA 4TW9A 3QD4A 3Q04A 4II7A 4IVAA 3F7ZA 2R4JA 4LF9M 4KSPA 5CVGA 3M6AA 5LMNM 4BI1A 5HO7A 4BWKA 4AFEA 4YTCA 1PRBA 3CQUA 4O7VA 4ITHA 5JT2A 4AFJA 4IBBA 4TYHB 3MW1A 1R3CA 4QYEA 5BR8M 2FS1A 3DAEA 4DR6M 3C5IA 4FT3A 2R46A 3DKCA 4RX7A 3PPZA 3QTUA 5DWRA 5BX0A 1FQ1B 3AV0A 3FZSA 3BHHA 2XNGA 1XH5A 1WBNA 4YHJA 3TIZA 3Q3BA 2J90A 3QD0A 4IB5A 2JIIA 3W0SA 5ITAA 2E9UA 2ONLA 3MESA 4L78A 1W5TA 4O82A 1K9AA 1XNQM 4UZDA 3I0QA 3E92A 5KX8A 3NRMA 3Q6WA 4OTDA 3AXWA 3NYNA 1NY5A 5JRSA 3SATA 4ZTLA 1H4LA 3U9CA 3FUXA 3PXFA 4YJSA 4YBJA 3KXGA 4H3PA 1QQWA 1SNUA 5HCXA 4FNZA 2YLFA 4KD1A 5BNJA 3QWLA 2KRUA 4IAZA 3UOLA 3UNKA 3U6LA 2XP2A 4C38A 2YN8A 4FI1A 4BCKA 3KW6A 4FUYA 4GYGA 4IWOA 4EOQA 4DCAA 3FZRA 4DEIA 4E4MA 4G3DA 2NYAA 3K3IA 2UU9M 4FIEA 2C6LA 2PMNX 4E7WA 5GKNA 2OLCA 2XZUA 5L8RF 4J99A 4JLCA 1REKA 2I40A 3C0GA 3CF2A 2VX1A 2JC6A 2LBCA 4KINA 4M67A 4I3ZA 3MH1A 4FW9A 1H1PA 1RJBA 5LVLA 1MQBA 4RJ7A 4H58A 3IG8A 2UZNA 1M2PA 4ZY6A 4O22A 2IZTA 3HL7A 4PP9A 3AC5A 2XGNA 5HGIA 1YW2A 2VTPA 4I4LA 3ORZA 2HENA 5IQFA 1XH9A 3N9XA 3EQIA 3BZ3A 4OW8A 5FGKA 3MPTA 1GJSA 2CKQA 5I3RA 2Y21A 2C0TA 3MWUA 4HVGA 1JSUA 2P55A 2CV2A 2YR0A 4G4RA 4I21A 3ENMA 3JYAA 2C6TA 3Q9ZA 4TWOA 1OUYA 3ORLA 2JKMA 2FA2A 2QNJA 4LQMA 5IQAA 4Y28F 1IAHA 4FTLA 4WP2A 1J7KA 2Y4IB 4BF2A 4FD2A 2HY0A 1Y8YA 4R78A 3H9RA 1DV0A 5CSPA 4JG7A 3FHRA 2CJMA 5HZNA 3FI4A 2W96B 3TUDA 3GPPA 3UZUA 3U61B 2GSFA 5HVKA 3PIYA 5EK7A 2HCBA 3ZZEA 4CRLA 4I5SA 5J5TA 1QYRA 2VWXA 3Q6UA 1RW8A 1IBMM 1KOAA 1PMUA 5L6PA 5JQ5A 4O0XA 1Y8GA 4BDCA 4FV9A 4D2WA 3RHXA 2ITXA 3DJ5A 3BV3A 2IZSA 5DLSA 3BGPA 2ZM4A 1SYKA 4X3FC 3R1NA 2PU8A 3PLSA 2WELA 3U60B 3E63A 3PXGA 2DZNB 1TDHA 2ITVA 4W9WA 5FD2A 5K3YA 3CLYA 1UA2A 4WURA 3MFTA 4QMYA 3UYSA 2B0QA 3OEZA 2R18A 1ORYB 2OI4X 4EBWA 4B8LA 3ZU7A 5EKOA 3EQDA 1FVRA 3NLBA 3DPKA 4GEOA 2OH0E 2OICA 2JY5A 4U45A 2QQ7A 3PY0A 4DGOA 2VV9A 2OO8X 3G5DA 2WU6A 1H6UA 4FEVA 5BVWA 5HD4A 2VTSA 2HZIA 2LVOC 3GCUA 3DZOA 4OGRA 3A7HA 5FXSA 1PJIA 2X39A 3GLHE 4KBAA 4XBRA 2ACXA 3VQHA 1Q02A 4P5ZA 4ZTNA 1CMKE 4TWCA 2VWVA 3AG9A 1BI7A 4R5SA 3JPVA 3MA3A 4DH7A 4O4CA 1DGHA 5AEPA 5KPZA 4JI8M 5KZ0A 3UOJA 3HHWA 4BDKA 3TWJA 2HZ0A 3RCDA 3QC4A 3TDWA 1UV5A 4J7BA 4CFVA 3GPXA 3PRIA 4L3LA 3IG7A 5D7AA 1T3TA 4B8MA 3RE8A 2BKZA 3QQJA 2WNTA 3KA0A 1PXNA 3BGQA 1DI9A 5DVRA 2E9OA 3D15A 3SA0A 3UTOA 4O0WA 1MRUA 5EYCA 2L4FA 2WSCF 4RIYB 3FLQA 4EKKA 4DV4M 1SXJA 3DBFA 3KF4A 4AF3A 1EE8A 2WFYA 5IKWA 1F4IA 3DNEA 4AT4A 4M9XA 4L7FA 2GHMA 3NUNA 4ZTHA 4K8AA 4K0KM 3A61A 1JKSA 3OF0A 4JRVA 3OOGA 5E4HA 3R6XA 5AWMA 4JDHA 5AR8A 3I7BA 3PZEA 2VTTA 4FKOA 4U40A 1QCFA 3AC1A 3GU8A 2V7AA 4N0SA 5K9IA 4DGNA 1U54A 4R3PA 3PJCA 1A48A 3QF9A 4WO5A 3ZBXA 5HBEA 3B7ZA 4E5WA 2VWZA 5H37D 2JIVA 4LV7A 2RGHA 1MN3A 4O7ZA 5HTCA 5JSMA 4O27B 4CZUA 4O4EA 3MN3A 3QWKA 1QZMA 1ZWSA 4RZWA 2F5OA 5H8GA 3OW3A 5CEOA 3RK5A 3Q9YA 5FDPA 1NVSA 4OU7A 4BY9E 4NRVA 1PKDA 5FBNC 2WO6A 4EONA 5D11A 2PVMA 3JR1A 4RG0A 3PPKA 3Q2MA 4F6UA 3UDBA 4AX8A 3MPAA 4ALVA 5B7VA 5C8MA 3IO7A 4R3RA 5D1JA 5JKGA 2YHVA 2V1CA 1N32M 4OTGA 3KRRA 3MH3A 3M2WA 3QZFA 3BIZA 3TKUA 4OBPA 4PTCA 4EEVA 4AKGA 2DENA 2C0IA 3P9JA 4YHHM 3L1SA 2V22A 5H9BA 3SXSA 2XANA 3DV3A 2YM7A 1R5LA 4AT5A 4F4PA 4BIBA 4YJVA 5DYIA 1NHGC 2JDVA 2VRXA 2EU9A 4U41A 3KQ7A 2GNHA 4F7LA 5DG5A 2V7OA 5KHWA 4RFZA 2YM6A 4FTNA 2FOIC 5J9ZA 4AQYM 2GNJA 2ITYA 1XB2B 4JG8A 1HNWM 4FE2A 3RAKA 5AR7A 2W5AA 4AZVA 5E8ZA 5GJGA 3UZPA 4L44A 2OXXA 3WZDA 2E9PA 3N4VA 4NSOB 3KSXA 5FTKA 5FLFA 4NM3A 5IQIA 2W4OA 2XNMA 4R1YA 5GJDA 1QAQA 5EQPA 2PVNA 2RGOA 1E9HA 3J7AS 4AGWA 2GPHA 2R3HA 4DYMA 3BEGA 5M06A 2Z7LA 3DB8A 1FGIA 3C7QA 3L27A 3U5ZB 2ZDTA 3DZQA 2VTOA 4MGZE 2HY81 3P86A 4II5A 4IIRA 1GNGA 1R0PA 3VIDA 3OT3A 2YM8A 2DHRA 1P14A 3TDVA 3NBIA 4CV8A 4FTIA 1G3IA 4ZJVA 4O7WA 4BGHA 1YWVA 3GOKA 1OB3A 2R3MA 1OAOC 3QAUA 3Q96A 3R7GA 4XV3A 3U4UA 4AA5A 3ZSGA 1GZKA 2Y20A 3QC9A 4BDDA 4JXFA 1GIHA 5CZHA 1O6KA 5JRQA 3TWLA 3KMMA 3VN9A 4GMQA 3C13A 1KE9A 2EXEA 1V1KA 3CTWB 3KK9A 5HEZA 2X6EA 3SD0A 3COKA 4DN5A 3AJIB 3V76A 2HCKA 4IX5A 3KDSE 2XVDA 3CXWA 4IB3A 5DR2A 3PFIA 4CCUA 4PMSA 3O96A 3WZEA 1AD5A 4HCUA 3CJGA 4YSMA 1IN7A 4W8DA 5FTQA 4P16A 4QEBA 4G17A 4FSWA 4E4XA 4EYMA 5T68A 1IRKA 2Y4IC 3ORMA 5AP5A 3TNIA 2R3PA 3RPVA 3DGKA 2EB3A 4AGCA 4A7CA 5AIRA 4UWCA 3FTFA 3F61A 1XXHA 2VZ6A 2ERKA 3OWJA 1SXJE 4LL5A 2UUAM 5HU9A 3FRIA 1QDRA 2XEYA 2QOCA 4FEUA 4FG8A 3TTJA 2BR1A 3WF5A 2XUUA 2QG7A 2R9SA 4QRCA 4KO8A 1Z5MA 1KV2A 4FNWA 3F3WA 4WHZA 4AW5A 4D1SA 4PWNA 3ULZA 1KUTA 4TL0A 4RPVA 2C9CA 2J7NA 4HL4A 4A3VB 4RVTA