3KVWA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2) in complex with an indirubin ligand
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
408
structure length
403
Chain Sequence
HHSGVDLGTENLYFQSMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSKGYPRYCTVTTLSDVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
publication title Crystal Structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (DYRK2) in complex with an indirubin ligand
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 125
structure length 403
sequence length 408
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kvwA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kvwA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kvwA02
4JBPA 4OTFA 4WUAA 2ZVAA 1OPLA 3GFEA 3NR9A 1H26A 5ETIA 3UNKA 3QRJA 4LV8A 2JDOA 3TNQB 5EYMA 4RC3A 3OW3A 3PXKA 4FIEA 2ONLA 3ZFMA 4KBAA 3IW7A 3VBTA 4DH5A 3SKCA 5DVRA 5HBHA 4O81A 3DJ7A 3OUNB 3KF4A 4JJRA 5IA2A 3LCTA 2ZOQA 4DBXA 5CVFA 3NVKI 3I79A 4BIEA 4TZRA 3D5UA 5HLNA 2G15A 4HVGA 2VX1A 3KC3A 4JIAA 5C8KA 5EQEA 4V05A 4BBEA 1GY3A 2CLQA 5CXHA 4ENYA 4GU6A 3RTPA 4AT4A 4CRSA 4ZTSA 2PUPA 1VJYA 3NNVA 3KCFA 5M4UA 1OL5A 4RX8A 3GGFA 3NCZA 4WIHA 2PZYA 2PE2A 3UOKA 3DCVA 3OG7A 3LXKA 1JQHA 4LOOA 2WMBA 4LGDA 5LCKA 3IS5A 3JPVA 4BCIA 3UZPA 4CZUA 4WRSA 3LOKA 3ERKA 4OT5A 4UMRA 1JOWB 2QR7A 1UVRA 3ZC6A 2YIXA 4FIGA 4ALWA 3TM0A 3VNTA 5CALA 4JOAA 3HRBA 1WBSA 3OTUA 3LFDA 2A27A 4PMSA 3KCKA 4FOBA 2C4GA 4F09A 2NRUA 3R1QA 4K9YA 3V8SA 2QOLA 2C0TA 1FQ1B 3QTRA 4YTHA 3RPSA 4AA4A 3EKNA 5L2WA 3RINA 4PPBA 1CKJA 5CSPA 2VTSA 2BRBA 3DBFA 1Q5KA 2EXEA 1SVEA 4HNIA 5LMKC 4J7BA 3ZEWA 1WVWA 4K2RA 3UQCA 5M57A 4L3LA 5DFPA 4UV0A 3ZLWA 2WTVA 2XUUA 4RJ6A 1P5EA 3MB7A 5DN3A 1OL1A 5HVYA 3T8OA 5AUVA 3SAYA 5E8XA 4UYNA 4H58A 4F9YA 2V7OA 1ZARA 4FC0A 2C5YA 4RJ8A 3TIYA 5AUUA 1URCA 3DZOA 3FQHA 4WOVA 4E6QA 3QZHA 5FP6A 2CNQA 1O6KA 1AD5A 4FZ6A 4WT6A 3W8QA 1KSWA 1OL6A 3QLFA 4FSMA 4CD0A 4OTPA 4S33A 4XG9A 4PRJA 4L7SA 4YSJA 1MP8A 2X1NA 4EYJA 3K3IA 3DXNA 1JNKA 1UA2A 2R7BA 5GIPE 4JQ8A 3CXWA 3KMUA 3FZSA 4F0GA 1LEWA 3FYKX 3FBVA 4O7RA 4R3CA 4FBXA 3BIZA 2QI8A 1S9IA 1YXXA 4QTDA 4DHFA 1GIIA 1WBVA 2HW6A 5HX6A 1RJBA 2DWBA 1ERKA 3N51A 4FSQA 4FZAB 3ZM4A 2W5HA 3C4ZA 4L9IA 3RPOA 4AGDA 5T6KA 1GIHA 5FEDA 3AD6A 4GVJA 4HGSA 3G6HA 3OCTA 5E92A 5D9HA 3N4VA 3TT0A 3W8LA 3O51A 4LFIA 4N57A 4BRXA 3Q2JA 5HIEA 2Z7SA 4BTKA 3ULIA 2UZEA 4QTAA 3RZBA 4QYHA 1DI9A 5KMMA 5CSHA 2YZLA 3QUDA 4RQKA 5CTPA 3W10A 2QURA 5L2SA 3NS9A 2O65A 4NJ3A 3MFSA 1YKRA 2J4ZA 4R6VA 1U54A 3OBGA 4IM0A 4KRDA 4NU1A 4M66A 4P5QA 2CHLA 4PP9A 5GJFA 3R01A 3ORKA 4CG8A 1H0VA 1H28A 4AGWA 2W5AA 4G6NA 2VTPA 2ZM4A 1JVPP 3GC9A 3A2CA 4XG6A 5AR4A 4FL1A 5F1ZA 4F1OA 5M4FA 2DS1A 1WVYA 5E8VA 5CXZA 2G2IA 3PIZA 3AMBA 1Y8GA 4FIIA 3RJCA 3HMMA 4JVGA 2W99B 2QKWB 5A54A 3EQBA 4FT5A 4U3ZA 2BRMA 4FG9A 4AGUA 3KXMA 4YGAA 2XA4A 4X6QC 4HGTA 4B7TA 4Y72A 3EMGA 3W18A 3HP2A 3LCSA 2WEIA 4F7SA 4GH2A 3E8NA 2Z7LA 3BX5A 3G0EA 4I94A 4IDTA 4ANNA 3F7ZA 4K18A 5BMMA 4D0XA 2X2LA 4JQ7A 5KBRA 5CSWA 4H3BA 2CPKE 3C4EA 4D58A 4R3PA 2PZ5A 2WZJA 3DJ6A 3NPCA 2VO3A 3VBVA 5CVGA 5C9CA 2ZV8A 4KB8A 3DV3A 2UVXA 3PY1A 4O0TA 3BLRA 4EOIA 1Q3WA 5ITAA 4O7LA 2Q0BA 1YRPA 4X7QA 4GIHA 4AGCA 4NM3A 4NFNA 1T45A 1XH9A 2C3KA 3BE9A 2QO2A 2J7TA 2OJ9A 3GQIA 5EHLA 3FHIA 3LQ8A 2RFDA 3LJ2A 2PVNA 2HXLA 3OEFX 3QA0A 4GCJA 3WIGA 4DT8A 1TKIA 4KSQA 1ZLTA 4J8NA 4BVUA 2WIHA 4RFYA 1WMKA 4WD5A 3VUHA 4CEGA 3EN7A 4J98A 1WZYA 3H4JA 1GNGA 4I21A 4JX7A 4FTQA 2B9HA 2BZIB 2HXQA 3KKVA 5AV4A 2WU6A 2UZVA 4GW8A 3GC0A 1U59A 3BWJA 3C4CA 3CD8A 2XIZA 5DE2A 5IA0A 2OJFE 3NX8A 4W8EA 4P4CA 4WSQA 4UXLA 3WZUA 2XK9A 4O2ZA 5ETCA 1CTPE 3EFLA 5L2IA 4FKJA 4FTUA 1SNUA 3L9MA 4GJ2A 3A7FA 5IG1A 1F3MC 5J5SA 5HBEA 1YDSE 5J7HA 2WNTA 3TTJA 3U8WA 3PY3A 2JKOA 1M52A 3O8UA 2ZV2A 4EOSA 2C6OA 2J0LA 4ZTNA 2GNIA 4Y46A 4I6BA 1TQIA 1ZYJA 4LRJA 4X3FB 3MY0A 4NW6A 4EKLA 1ZRZA 4FG8A 1IA9A 3MI9A 3JVSA 1UWHA 3UZRA 4FX3A 4BI0A 3A61A 1ZXEA 3DNDA 3D7TB 4QNYA 3RM7A 1H08A 4O0YA 4ZSGA 4MKCA 3E8DA 4BWPA 1M14A 4R77A 3HGKA 4TN6A 2CGWA 4BZOA 2W1CA 4OTGA 4L52A 4LMUA 3BHVA 3FZOA 5ANKA 3UO6A 5IKWA 5IMEA 3WZDA 3KREA 4KINA 1KE9A 1MUOA 2OFUA 3G51A 3D14A 5EH0A 3ZHPC 3EQHA 3H10A 2JFMA 4EH4A 4AOJA 1WVXA 2UZLA 3EB0A 3VS7A 2WB8A 3LM0A 4E93A 2YFXA 1SYKA 2GQRA 3KRJA 3Q6UA 3HKOA 5HI2A 3QQHA 5LWNA 2WTKB 5FXRA 3ZEPA 2IZUA 1R78A 1GZOA 3M11A 4ZTRA 3VJOA 4QPAA 2O5KA 3T9TA 1GOLA 4YP8A 4XOYA 4IVCA 3KN6A 3RVGA 4PPAA 2XS0A 4XG3A 2J50A 4EH2A 4BN1A 2BALA 2BZHB 3AG9A 5AV2A 5BVEA 2RFSA 4F9BA 4OW8A 2IWIA 2VWXA 2F7ZE 3E8EA 4U40A 3TV7A 2J51A 4J1RA 1Y57A 4Q5HA 5E91A 3ORLA 4GFMA 1NXKA 2C3IB 3UTOA 2VO6A 5L8JA 2C0OA 1IEPA 4HYIA 2PZRA 3TJDA 3AMAA 3DS6A 3UVPA 4EQCA 3VBQA 4RWJA 5T68A 2XKFA 4FTOA 5EI2A 3R8VA 4GFGA 3E64A 5GZ9A 3SC1A 1YHVA 1XWSA 4KKGA 3KL8A 3KXGA 3GQLA 4FEVA 5K0KA 5TR6A 3UG1A 1JSUA 5LMKA 3U55A 4RIXA 2F7EE 3ZH8A 5E8WA 3ELJA 5DA3A 5DT4A 2Z02A 1URWA 3BBWA 3R1NA 3BEGA 4O7TA 5AR3A 3CE3A 1M7NA 1E1VA 3ZBFA 5AWMA 1BUHA 2UZDA 3R73A 4WG3A 4C4GA 3RAKA 3MW1A 3F2RA 4FKWA 4TYHA 4UZHA 5K4JA 5KNJA 4MD7E 2GNJA 1LR4A 2V22A 1VR2A 3F5UA 5EI8A 4ITJA 4U3YA 3VVHA 3PFQA 4ACGA 1O9UA 2WMQA 3KFAA 4DT9A 4X2NA 5HCXA 4AT5A 3FSFA 2HZ4A 4O1OA 2QHMA 4RIYB 1IAJA 2W17A 1A06A 2C5VA 3LHJA 2ACXA 3QZGA 5F9EA 3KULA 3V5JA 5AR2A 2PE1A 2XK4A 4PTGA 4D1ZA 4DFNA 4IAAA 3UOLA 2RGPA 4QYFA 5HX8A 3ITZA 2JKMA 3FDNA 5CNNA 4EI4A 3R83A 3FI8A 2VTOA 3ETAA 3UJGA 3CKXA 2IZSA 5BVFA 2J0JA 1E1XA 2XCHA 4E8AA 4E6DA 4BKZA 4FSZA 3FLNC 3H0ZA 5L8KA 4PTCA 4K8AA 5EKNA 4AFEA 3OCSA 5E8ZA 4D2RA 3TZMA 4FE2A 2ZV9A 3RWPA 3L9LA 1IR3A 3EFKA 3TACA 4DFBA 4ALUA 4NL0A 5IH4A 3C0GA 4ZSJA 2IJMA 4N0SA 4BZDA 5IQEA 2QR8A 4GVAA 4HNFA 5KKRC 1XHAA 4M8TA 3RHKA 4R5YA 3F66A 3OEZA 2X9EA 2YIQA 4QMOA 5KZ0A 3ZTXA 3FXXA 2Y6MA 5FD2A 1WAKA 4F7LA 4ERKA 2XRUA 5F94A 3V8TA 1WBTA 4RLKA 3U51A 1V0PA 3POZA 4FKSA 4L43A 4TYIA 5CAQA 1UNLA 4UB7A 1KV2A 2O64A 4KBCA 3QCYA 4L67A 3TKIA 1PXNA 2ETRA 4QTBA 4U45A 4D1XA 3PA4A 3B8QA 4ZJJA 3VS5A 4EH8A 1OKVA 4EHEA 2AUHA 4UWCA 3S0OA 4S32A 4FV5A 1G3NA 2WOUA 4PTEA 2W1IA 2HWPA 5HOAA 4IC7A 4TNBA 4F70A 4LI5A 3SA0A 2FH9A 3UOHA 4QMYA 3ODZX 3P7AA 5DGZA 4DG3E 1K2PA 5LWMA 3ODYX 5FDXA 3ZS5A 4DFYA 2BIKB 3K54A 3HV3A 3E3BX 3HV6A 2IVSA 4YJOA 2BILB 4A9YA 1NA7A 4ASEA 4L45A 3C0IA 1KE5A 3R9OA 4EJ7A 4Q9SA 5HLPA 3NIZA 2C5NA 2F49A 4ZLOA 3FI4A 5JGDA 3DKOA 3ZDIA 3Q9XA 3IDCA 4QP4A 3JYAA 1VZOA 4OBOA 4IE9A 4F6SA 3LE6A 4ASZA 4X21A 4FVRA 4X2JA 1YXUA 5CEMA 4IANA 1OIYA 4WA9A 3QKMA 4LUEA 4WNPA 1Q61A 4EOPA 4ITHA 4R78A 1YI6A 4AE6A 4XP2A 4AOIA 5IQDA 4F64A 5IF1A 4V0GA 4A4OA 5B2MA 5IDPA 2CMWA 3QTXA 2Z2WA 4G5JA 2YJRA 4F1TA 3LMHA 5JN2A 4W9WA 4M67A 5IEVA 1IRKA 3NUSA 3NNWA 2Y6OA 2X7FA 4AOTA 4ASXA 2Y4IB 4E6AA 2F2UA 4I6FA 4D5HA 5J79A 4FT0A 5AFVA 3P08A 2QD9A 4D55A 3L8XA 1HCKA 4Z9LA 2R0UA 3QRUA 3IPHA 2WGJA 4DFXE 3H0YA 4UBAA 3RGFA 2YN8A 5EDQA 2F4JA 2B52A 2WQBA 4BI2A 3NWWA 3N4UA 1QPJA 3KK8A 2X6DA 1OPKA 5M56A 2OLCA 5G6VA 4KWPA 3E63A 1IASA 3UODA 1PXJA 4FA2A 3WIKA 3UPZA 2R3KA 3S4QA 2OG8A 4N70A 1XO2B 5CASA 2W4KA 4OGRA 4DYMA 2XNEA 3LFNA 4U5JA 4BWXA 3CEKA 4MYGA 2J0MB 1NT2A 2R64A 5JRSA 3WYXA 3GCVA 3FY2A 2YLFA 1JSVA 3BHUA 2XYUA 4ZTMA 3IQ7A 3F3UA 3FV8A 4BDDA 5KMOA 2WTDA 3MH0A 4IM3A 4YHFA 5FTOA 2VGOA 4F65A 1LEZA 4RFZA 4YJUA 3UQGA 4JR3A 2VO7A 1QPCA 4H3QA 4AP7A 1GZ8A 3IDBA 3C7QA 4DAWA 1Y6AA 1UKHA 1ZOGA 2HWOA 4PY1A 5IA1A 3SW7A 1TVOA 3DQXA 3F3TA 4IZ7A 4K6ZA 1F5QA 4FTMA 4DTKA 5C03A 4ZOGA 4FODA 4J96A 5H8GA 1PXMA 5I9UA 3COKA 3LFAA 5IQCA 4RIWB 2GPHA 4G3DA 5D11A 4DCAA 2BFXA 1Z57A 4GT3A 4DC2A 4EOOA 3PJ2A 2WMVA 5KZIA 3NAYA 2VD5A 5FXQA 3TNPC 5IQBA 2XJ1A 2OKRA 3FXWA 3GOKA 4OTRA 5D10A 2CNVA 2X8EA 3BU5A 4II5A 1UU7A 2WQNA 2QLQA 2I0YA 3E88A 4FV8A 3VW8A 5LCJA 2BIYA 4KABA 4E26A 4R3RA 2UV2A 4ANMA 4IB1A 5DWRA 5AV3A 5F20A 5AX9A 4QMPA 3BQRA 3CQEA 3WARA 3DBQA 4IM2A 4RVMA 4YJPA 2A0CX 2XRWA 3ORIA 4YC8A 5EHYA 2BAKA 5JFSA 4JIKA 1O6LA 3FI2A 3R8UA 3OHTA 1OUKA 4AXAA 4TT7A 2VU3A 4ZP5A 3V5TA 3OOMA 3KRLA 5CF4A 2ITNA 4BCFA 5CU6A 5IQGA 4ZSLA 2NP8A 4QYYA 1UNGA 2QLUA 4AZEA 3DLZA 2CN8A 2NNWB 1P14A 1OMWA 2E9VA 2OJJA 2IG7A 4OTHA 4CXAA 1ZY4A 4HGEA 3FC1X 3F5PA 3R30A 5CYIA 3VQUA 2YITA 3HVCA 4U44A 3ZXTA 2R9SA 3Q3BA 4BIBA 5DIAA 3SV0A 1W8CA 3GNIB 4GIIA 4GS6A 4KIQA 1WBNA 4JG8A 3WE8A 1ZYDA 1G8AA 2EXMA 4FI1A 2FGIA 3GCSA 4CVAA 3I6WA 5DR9A 2I0HA 4NWMA 4O7NA 3MFTA 3BKBA 1LP4A 5HIDA 3MJ1A 4U0IA 2XYNA 3HL7A 2HZ0A 3NCGA 3AC4A 3R2BA 3VUMA 5KBQA 4J71A 5TOZA 5CF5A 4RMZA 2HZIA 4MEDA 4RWIA 4C2WA 5IQAA 3C4WA 4V01A 1M2PA 4BL1A 3UOJA 5AAGA 1JBPE 3KY2A 1V0BA 3ROYA 4NJDA 4O21A 3JY0A 2QO7A 3PUPA 4BDGA 2B7AA 5DG5A 4F9CA 3F69A 4QMMA 3NYOA 3EQRA 4UX9A 4L3JA 3CSVA 4FR4A 4BWKA 3U6JA 1ZOHA 3O23A 4IAKA 3LFFA 5BNJA 5ANIA 3E3PA 4IX4A 2VTRA 1QPEA 3DA6A 1YQJA 3QF9A 3EIDA 5I9VA 1GJOA 2UW4A 4OTIA 5DEYA 4E5WA 3N9XA 2W05A 1V0OA 2XKCA 3QQKA 1RE8A 4OAUC 3Q53A 4DGNA 2O0UA 3QHRA 3KXNA 4TYEA 2VTIA 3DDQA 2UW7A 1H1WA 4ANQA 3P23A 3CY2A 3PYYA 1Q4LA 2XNBA 4M13A 4F9AA 2PL0A 1XJDA 2XJ2A 3LFBA 1PXLA 2YCFA 4Q9ZA 3JS2A 2B1PA 4FYNA 3GI3A 3U6IA 2R5TA 3AD4A 2IVUA 4HPUE 5FEQA 5CU0A 5A4QA 5FBOA 5E7RA 3ZU7A 3ZLSA 3K5VA 4DH1A 3QGYA 2VWBA 2PMLX 5A46A 1SVGA 2R3LA 3NYVA 4RRVA 2JC6A 5CU4A 3SG8A 4MXZA 1OKZA 1HCLA 2R3GA 4U97A 5M08A 4XV3A 1PXOA 2UW0A 3PTGA 3PY0A 4WSYA 5E1SA 2BTRA 4XP0A 2QHNA 2XKDA 1OM1A 3WZJA 4RZWA 3PA5A 2B4SB 3CC6A 3FSKA 3W2RA 2VN9A 3FEGA 1PYEA 3LFCA 4YPDA 3ZO3A 2PUUA 4M15A 3FLYA 4TW9A 2X39A 1I44A 2ZYBA 3OY3A 3PE2A 2ITTA 4UALA 3GENA 4CG9A 1ZYSA 5E8TA 3Q4ZA 4JS8A 2PMIA 4M68A 3QQFA 5HVJA 4FEUA 4GK4A 2F57A 1OPJA 3CQWA 4IC8A 3Q32A 3QALE 5HD7A 3F82A 3HYHA 4FUYA 3ZUVA 5EOBA 2BAQA 4LM5A 3PVGA 5DLSA 5T3QA 3VWAA 4FNWA 4HVHA 3NW6A 3U4UA 2CGVA 4DH7A 3WF8A 2IW6A 1NVRA 3LFQA 3HA8A 5L3AA 2C3JA 3Q6WA 2ITWA 2B9JA 3DDPA 4E7WA 5AP1A 5IUGA 3QTWA 5HO6A 4NEUA 1NY3A 4BF2A 3WYYA 3ZUUA 2UW8A 3FE3A 1R3CA 3ANQA 4BHZA 4BCPA 3GU6A 3AXWA 2YWVA 4AZVA 3BPRA 4C02A 3AT4A 3EL7A 2YM6A 3TZ8A 2UUEA 3BE2A 4FV3A 2G1TA 4EZ7A 4EK6A 3QTZA 5TO8A 4C7TA 5K5NA 4QP7A 3HV4A 3O96A 3G90X 3OWJA 3NYNA 2BR1A 3RALA 2ERKA 4A9RA 2Y8OA 4ORKA 4MQ1A 3R2YA 2VWUA 5E8YA 2XBAA 4O27B 3CIKA 4B9DA 5GJDA 5ANJA 4TRLA 1NVSA 2JDTA 4RWLA 4O6EA 5AAFA 2BTSA 4OBPA 4YZ9A 2VX0A 3L8SA 2B54A 3KQ7A 3ORNA 1F0QA 4XEYA 2X7OA 4YTIA 4AT3A 3BU3A 3UC4A 3DGKA 4IAIA 4BTMA 4E4XA 3QTIA 1XH6A 3R28A 3RAIA 2R2PA 4RBLA 5AR5A 4N6ZA 2V62A 4UYAA 3EKKA 4AW5A 4BGGA 2BMCA 2VAGA 4TWNA 3KMWA 1CKIA 3KRXA 2JAMA 4MF1A 3QA8A 2Z7RA 4IJ9A 4BZNA 2YM4A 1V1KA 4QMSA 4E4NA 5FXSA 2VWWA 3CQUA 3OVVA 4YLLA 4ANOA 5IEXA 3IOPA 1PMEA 4RVTA 3TTIA 5I0BA 4G9CA 3H9FA 5AIKA 3REPA 3PIXA 4AZFA 5HO8A 4DH8A 4I22A 3IW6A 5D12A 5EYDA 3FKOA 4ZJVA 2HW7A 4O22A 2YWPA 3R9NA 2ZB1A 4JRVA 2OO8X 4CRLA 3BQCA 1CMKE 5CT7A 3FLSA 5EDPA 3VO3A 1U54B 4LG4A 2Y7JA 3S1HA 3NUPA 2PYWA 1U4DA 3KVXA 4GKIA 5HIBA 4G6OA 3HAVA 2HZNA 3DFCB 2WIPA 4FNXA 4HYUA 3HMOA 4ZY6A 4QYGA 4C59A 3MH2A 4RZVA 4GG5A 3EYHA 2QG5A 4U79A 4U80A 3UIBA 4ZY5A 4DG2E 3QKKA 2BRNA 2UW3A 4L8MA 3MVMA 3EQGA 4KS8A 4O0SA 4BFMA 2I0EA 3QL8A 4I24A 3IW5A 4CCBA 3Q2MA 4JX3A 2PUNA 4BICA 3C4XA 2W1EA 5EHOA 3I4BA 4Z7GA 1ZMUA 2WTCA 5H8BA 2ESMA 2QVSE 3TWJA 2W1GA 1UWJA 4KKEA 4L7FA 2VTMA 3RCJA 1JWHA 4ZS4A 4LRKA 2P2IA 4FTTA 3V5WA 3BI6A 4MWHA 4O91A 2VWIA 3UIXA 3G15A 1ZAOA 2X81A 3CPCA 3R04A 4FTAA 4YZDA 3LXLA 3UMWA 3ZZWA 4UN0C 3BYUA 5A6NA 3ORZA 5C8NA 4FKLA 1Q24A 5M55A 1J7LA 2GTMA 4XRLA 1PMNA 2HK5A 2X6EA 2QOOA 3ACKA 2PSQA 5FGKA 4ZLZA 3PVUA 3L8PA 1W84A 4OBQA 5EW8A 2CGUA 5CWZA 5AMNA 4GUEA 4AZTA 2X8DA 3KXHA 4LL0A 3KXZA 4YBJA 5FLFA 4H39A 3EN4A 3SW4A 2KTYA 2WMTA 2W0JA 5J5TA 3PLAE 5DMZA 4CMOA 1H27A 4FV1A 5CQWA 2BDJA 4G17A 3GCQA 4EK3A 1QPDA 5CQUA 5CLPA 5IH5A 1Q8WA 3ORTA 4U43A 5E1EA 2RG6A 2QOCA 3C9WA 3VS6A 2XNPA 2XNGA 4MWIA 2JBOA 2PUIA 4M0ZA 5DPVA 3OOGA 5IU2A 4LOQA 1S9JA 4TL0A 3FC2A 2BKZA 3A4PA 5CENA 4M69A 5BPYA 5CEPA 3DTWA 3W55A 4M12A 4FKGA 1ZMWA 4QMVA 4S2ZA 5M07A 3LCDA 4B6LA 4HCUA 4CKIA 3F3ZA 3EFJA 3FMLA 5LVNA 3THBA 4EK5A 4XX9A 3HV5A 3DBEA 3UDBA 3ZLXA 3SGCA 3LQ5A 3V01A 5BVOA 3LM5A 4I93A 4EZ3A 2IN6A 3PIYA 4YO6A 4R1YA 2XF0A 4PDOA 3R7EA 4CFMA 3D83A 4G5PA 2V7AA 4YJQA 5BYYA 3DU8A 2DYLA 4FKPA 5A9UA 3QXPA 2I1MA 4I5HA 5EYKA 4V04A 3OW4A 1Y91A 2OBJA 3PLSA 4RLLA 1Y8YA 2GS6A 3TUDA 2JKQA 3VRZA 4HVDA 3UNJA 4Z7HA 3IGGA 4YJSA 5IA4A 5E4HA 2OW3A 4F7JA 2GHMA 4ARKA 3COIA 2C1BA 5I3RA 3W1FA 3CLYA 4EC8A 3MYGA 4A9TA 1SNXA 1CDKA 4TTHB 4O7WA 4I0SA 5BVKA 3CTJA 4MF0A 4JR7A 4QQCA 5ACKA 3G0FA 1BKXA 3OP5A 2ZAZA 5M4CA 3MVJA 3QCXA 4JLCA 2R3JA 3PJ3A 3VBWA 1M2QA 4YUQA 3IDPA 4RX7A 3P79A 2YDKA 2O3PA 3NW7A 3UC3A 3A60A 4ASDA 2IVTA 2CKQA 3HUBA 3NUNA 4YMJA 2PVRA 3ZO4A 1XH4A 2W06A 5AM7A 1H24A 1XH7A 2GNFA 1OIQA 4R8QA 4C37A 1BX6A 2OXYA 3E5AA 4ZJIA 2GS2A 2R3OA 3RAWA 3FI3A 2JBPA 4QMXA 4BB4A 2GQGA 1K9AA 4I92A 5I4NA 2CDZA 4APCA 4K1BA 5AP5A 4BGQA 4GT5A 4N6YA 4CQGA 3ORXA 4D9TA 3POOA 2G2FA 3ALOA 3Q60A 5ANGA 4C4EA 1M7QA 4CYIA 4EEVA 4NIFA 5DRBA 1APME 4F0IA 2PMOX 4LV5A 5IZFA 3LQ3A 2OSCA 4XOZA 4CMUA 4HYSA 4DLIA 1G5SA 3RPRA 1PRYA 4EONA 4USFA 3QRIA 5KMKA 1ZYLA 3TXOA 4IACA 4ZZOA 2ITYA 5JMSA 3PJCA 4AE9A 1ZWSA 3EZRA 2FVDA 3A7GA 4ANSA 4GFOA 4X2GA 4RIXB 3FHRA 3NUYA 5CEOA 4TY1A 4A06A 5CSVA 2WMAA 4E4MA 5EQYA 3TNWA 2AC5A 2WHBA 3FZRA 4PDSA 4FSTA 5FRIA 4YJTA 5BUEA 4MXYA 4O0WA 3PXFA 4YZNA 4F4PA 2AYPA 2VTHA 4JRNA 4WNMA 4DGMA 1JKKA 4EUUA 4C58A 5J7BA 4AW0A 3UZTA 4QQJA 1J7IA 1NW1A 4O84A 2XBJA 3FMMA 5E8UA 5HTIA 4CGAA 4FUXA 4WRGA 4Y5QA 5FUTA 5J87A 3Q4CA 1VYWA 4TYHB 2GU8A 3I7BA 4HZRA 4ZK5A 1DI8A 3QD2B 3R8MA 3EYGA 3GU4A 3JVRA 5HCYA 4RSSA 2PU8A 1H25A 5KMLA 3ZRKA 4DH3A 4O7SA 4ACHA 4DG0E 3T9IA 4MVFA 1OBDA 3QLGA 4HYHA 3KVWA 5B2KA 1XR1A 3KULB 2E9NA 4BCKA 3PJ1A 2XK6A 4IZYA 5DRDA 3FUPA 2HELA 3Q52A 2QOKA 4C61A 5AR7A 3COHA 2UW5A 4CV8A 3R71A 4FKRA 5KHXA 5KUPA 3F2AA 3LW0A 4BDAA 5IMXA 5B7VA 2QKRA 4C0TA 4K0YA 2W9ZB 3AC8A 5C1QB 3B8RA 1MRYA 3WF6A 5DH3A 4RJ3A 4AA5A 4ZLYA 4F7NA 3RZFA 4DEDA 4R7BA 2EXCX 1O6YA 4DEIA 3P0MA 3R9HA 4YJNA 2PVYA 4Z16A 5A4EA 2OZAA 3LVPA 4FV7A 1B38A 3BHTA 5BVWA 2XM9A 4AW1A 2J9MA 2UZOA 2CSNA 3R1YA 4TPTA 4QQTA 3R7IA 5BYLA 4BTFA 4ANBA 1H1QA 2YDJA 2FB8A 3MN3A 3FPQA 1YW2A 3OS3A 3DAKA 5K3YA 5HEZA 5E9EA 2OZOA 3DB8A 1QMZA 4DFZE 3FZTA 4YBKA 5LVLA 1PJKA 3OUKA 4JL9A 3OXIA 3AD5A 3NW5A 4O2PA 2JIIA 2W1HA 5CI7A 4PMMA 1I09A 5AP6A 1M17A 3G2FA 3HEGA 3ZONA 3T3UA 5HU9A 3ATTA 5HE1A 2Y4PA 3DK7A 5CANA 4U6RA 3BWFA 2YCRA 3FWQA 3VBYA 4ZTQA 4BIDA 4K77A 3ATSA 2BDFA 1P4OA 5BVDA 3TNHA 3BELA 4XUFA 2PZPA 4BR3A 2ZM3A 4FSYA 5CI6A 5DBXA 4C4FA 4FK3A 4RT7A 3M1SA 3DKGA 5FWKK 2V55A 3AC2A 4H36A 2A19B 4HPTE 1PXKA 2IVVA 3QD4A 3QZFA 2WU7A 4ID7A 2YJSA 5A3XA 3W2QA 2PPQA 3E7VA 1LUFA 5AEPA 4IEBA 2PY3A 2R3FA 4FNZA 3VJNA 2NPQA 1FBNA 4G3GA 3R7GA 4KIKA 3W2CA 4AFJA 2J6MA 4F08A 5KMIA 5KE0A 2QQ7A 3QQGA 4J8MA 4JDIA 3W33A 3HP5A 2XJ0A 3DK6A 3CTQA 5CEQA 4EHVA 3QWJA 2CCHA 5JFXA 3UP7A 4A4LA 4WUNA 5LVOA 2VV9A 3DOGA 3OWPA 4PDYA 3W2PA 4CTCA 3BYOA 3P78A 5L4QA 4D4SA 5A6OA 4OTQA 4V0GB 2W1FA 3LLTA 4G31A 2IW9A 3W16A 1B39A 3LXNA 3BV2A 2GMXA 3BU6A 3MPTA 3QC4A 2PHKA 3Q9ZA 3CBLA 3DNEA 4YZMA 2JDSA 4TYJA 3LJ1A 3N4TA 3QQJA 3G33A 3RM6A 3ANRA 5BYZA 4DGOA 1WBOA 2PVHA 4FKOA 3ZFYA 5GIOE 5HCZA 3UBDA 4F0FA 3BBTB 2R3PA 3CJFA 2QOQA 3MV5A 3IW4A 5J1WA 3R8PA 4QOXA 2R3QA 2WD1A 4I5PA 4XYFA 4ANLA 4APPA 2VZ6A 5JGAA 4QMWA 3UYTA 5LOHA 2YA9A 3E92A 4RPVA 3GC7A 3FMEA 4RX9A 2QOFA 4UMUA 2GDOA 1U5RA 3R8LA 3NLBA 5HICA 5CAPA 3PVBA 5HVKA 2EU9A 5AR8A 3ZRLA 2HENA 4A9UA 2YERA 3QTSA 4XG7A 4K11A 4I5MA 4J97A 2FO0A 3BRBA 4Q5EA 4XLIA 4JQEA 3Q96A 4HGLA 2YISA 1YOLA 3NEWA 5DHJA 3EQDA 2ZMCA 1FINA 2BRGA 2GNHA 1H07A 3A62A 3H9RA 4CCUA 3WZEA 3MESA 4G1WA 5BUJA 4F99A 4DN5A 2BROA 1VYZA 2C68A 2VUWA 3PPKA 2BKKA 2I40A 2HYYA 2VTAA 5IUIA 4JBOA 4D4YA 4M0YA 4H3PA 3FLWA 4I41A 3OT3A 3Q4TA 1SVHA 1UNHA 4BCQA 3BHHA 1Z5MA 2VRXA 3BEAA 3O2MA 4FTKA 4P7EA 3PDTA 4UWYA 3U54A 1ZZ2A 3PG3A 3V5PA 4GV1A 3NUUA 3UIMA 3UGCA 4ONAA 4ZSAA 4A4XA 3C51A 2HOGA 1OZ1A 3OC1A 2XCKA 3AQVA 1Q99A 3R7UA 2OXXA 1FOTA 4I5CA 3PXYA 3ACJA 4RC4A 4UY9A 4JDHA 4DEHA 4PDPA 4DBNA 3UQFA 2PWLA 5LQFA 1ATPE 1MQ4A 4FTRA 2OIBA 4RFMA 4KIOA 4QD6A 4YNOA 5AV1A 3RI1A 2VWVA 3V51A 2WXVA 2OICA 4TYGA 4B8MA 2WTJA 3MWUA 4KIPA 4GYGA 2XEZA 3ZSGA 3OWKA 3GC8A 4HVSA 2BVAA 3AT3A 5ACBC 4E5BA 4EKKA 4FEWA 1UU8A 1J1CA 2YLEA 3QRTA 2VWZA 4G3EA 2B9IA 4O0XA 5AP4A 1W7HA 4YLJA 4FZDB 1YXVA 3HECA 4IIRA 2PVJA 5DT3A 3EOCA 3PSDA 5EOLA 3MH1A 1H4LA 2CLXA 2Y9QA 5E90A 3KGAA 3MFRA 1U46A 4FKTA 5GINE 4FIJA 1J3HA 4BCJA 2JFLA 4NFMA 2C6KA 3CCNA 3MBLA 3O0GA 4UXQA 2R4BA 5J8IA 4MAOA 5C8MA 3H3CA 3TIZA 3OBJA 3V04A 2PVKA 4W4YA 4YTFA 2OJGA 3MJ2A 4EK8A 4NCTC 4FK6A 4IB5A 3CD3A 2QONA 2C6DA 3GBZA 1IA8A 1YI3A 3HV7A 4JDJA 4P2KA 3FQEA 5CU2A 2PVFA 3PWYA 3A8XA 3QQUA 4FL2A 4CSVA 4QMZA 4JDKA 5M06A 1WBWA 3PVWA 2YIRA 3LLAA 3SRVA 4DGGA 4IZ5A 5AUZA 2X7GA 3CGOA 4L3PA 1IAHA 1W98A 2FSTX 2WEVA 3OF0A 5ETAA 3PZEA 2VNWA 5JRQA 2YZAA 3AC3A 3P4KA 4D2VA 4PF4A 3D7ZA 4D1SA 4FGBA 3K2LA 3TZ7A 4AX8A 2Y0AA 4DITA 2ZV7A 5EYCA 5DEWA 3ENHA 4MCVA 3VF9A 4WNKA 3W2OA 4O86A 2C30A 4BDHA 4EH5A 2QCSA 3ZRMA 3RAHA 3UNZA 2UZTA 2RL5A 3SX9A 5ANEA 1LPUA 2XIRA 3MY1A 3LFSA 4I0TA 4IBMA 4CLIA 4NT4A 5KCVA 4BCHA 4YLKA 2R3HA 1PKGA 4FEQA 2QOHA 4BDKA 4QP1A 4ERWA 2C3LA 1H1PA 4QP2A 4FICA 1TQPA 4M14A 1H00A 2OGVA 3OCGA 5DT0A 3T3VA 4AACA 1TQMA 3QQLA 4B4LA 4IFGA 3LJ0A 3QHWA 1Q8YA 3ZZEA 5I9ZA 3KN5A 3MDYA 4E4LA 4CMTA 4DFUA 4O7YA 1FVRA 3HMPA 4DINA 1OBGA 4QMNA 2X4ZA 3UVRA 5GZAA 5M51A 3NIEA 3HAMA 3AGMA 4YTCA 1ZZLA 3HA6A 2ZDTA 3R8ZA 4YPSA 2RFEA 4FT9A 2XIYA 4IDVA 4PMTA 1E9HA 4RA4A 5EW9A 3UYSA 4L44A 4FVPA 2GFCA 4HOKA 2GNGA 4C4JA 3U6HA 3TDWA 2ETKA 3BLQA 2ITPA 4L46A 2XK7A 3GOPA 2OK1A 1EH4A 5I9YA 3DBCA 5KKRB 3SG9A 5JEBA 4H1MA 4BCOA 3PP0A 4LMNA 4PPCA 4NUSA 4FV4A 4FKIA 4MD8E 2WFYA 5I3OA 5IPJA 2OF4A 4CV9A 3ZO1A 4Y95A 4L00A 4CLJA 1JKTA 2X0GA 4BDJA 5IQHA 3CJGA 3E93A 2UW6A 2GQSA 2C6MA 3RMFA 4YO4A 2WMUA 5A4CA 2GCDA 3P1AA 3NAXA 3A7IA 5CVHA 1MQBA 4O0UA 4U9AA 3TZ9A 4FZ7A 4J95A 4W4XA 5HZNA 2E9UA 5K9IA 3D94A 5AJQA 3VS2A 2GSFA 5JFVA 3C13A 4M97A 4MH7A 4G9RA 3C4FA 3KRWA 2ZDUA 3EZVA 3D5WA 2SRCA 4AW2A 4AAAA 3SQQA 5EDRA 3QTQA 3AT2A 1PMVA 3AC1A 4X3JA 2WMRA 2I6LA 3EN9A 4GUBA 4J52A 3RHXA 3OWLA 1JSTA 2J5EA 4UEUA 3DJ5A 5DNRA 2XNNA 4I4EA 5K5XA 3ZM9A 2G9XA 3VQHA 3LCOA 4NM7A 3ZDUA 2OJIA 5ETFA 3U87A 5M09A 3GU8A 4BYIA 4OTDA 3GT8A 1A9UA 3DT1A 1JAMA 1HOWA 2G2HA 2YAKA 3VUDA 1RDQE 2PULA 3D15A 3DFAA 3I0QA 4H05A 2FA2A 1ZMVA 4FT3A 2BHHA 3O8PA 3WILA 5CAUA 4U42A 4BKJA 2FSOX 3F6XA 5D7AA 4X3FC 5EM8A 5J9LA 3NNUA 3G9NA 2VTTA 4FKVA 4MNEA 4ZMEA 2C5XA 2QU6A 4HJOA 3FZPA 5JK3A 3TEIA 3SOAA 4BHNA 3M42A 3I81A 5HTCA 5LVPA 4NKSA 3R63A 3QC9A 4EBWA 4O96A 3EQIA 4BDFA 3WI6A 4E1ZA 2IPXA 2VNYA 1OI9A 4KUJA 3QKLA 1BL7A 3UIUA 3QYZA 1FVTA 3A7JA 4EORA 4D2SA 2ITUA 3QU0A 3LZBA 3I5ZA 3ZLYA 4NSTA 2WELA 2VWYA 3CP9A 3HZTA 3C50A 4NKAA 4XHKB 5HNBA 2R3IA 2R7IA 5EM6A 5A14A 3SHEA 3O7LD 2ITXA 4X6RA 3C1XA 5J9ZA 1J91A 4C36A 4LL5A 2X8IA 3CY3A 5HE2A 2E2BA 3MY5A 3DBDA 2VTJA 4J53A 3UPXA 2WTKC 1PMUA 3EJ1A 4BBFA 2OF2A 3IO7A 2P0CA 4GL9A 2NRYA 2GHGA 4IZAA 1XBAA 5H3QA 4CZTA 5CY3A 3G9LX 4BDBA 2CKPA 4BCGA 4U8ZA 5LMBA 5LXMA 4RC2A 4FMQA 4S34A 4XV2A 3FY0A 4IWDA 2XB7A 3RKBA 2WAJA 1GZNA 4R7IA 4I1ZA 3P86A 3JUHA 3MA3A 4GG7A 4ITIA 2QODA 3OMVA 4IWPA 3FXZA 3EN6A 3RP9A 1Q8ZA 4IB0A 4DEGA 4EZ5A 2RKUA 1RQQA 4YC3A 3SXSA 3Q9WA 4NH1A 3DZQA 3GFWA 4PMPA 1PYXA 4IH8A 4QRCA 4TKSA 1PXPA 4MXCA 4DTBA 3MA6A 5C01A 4I6QA 3U9CA 2JIVA 5HD4A 3QD0A 4AN9A 1IG1A 4Y85A 5IISA 2YM7A 4EH7A 5BX0A 4BDIA 2DQ7X 4AA0A 4MXOA 4XNEA 4YJRA 5DOSA 1OKYA 3UVQA 4EYMA 4W4VA 2WMWA 1UU9A 1DM2A 4CYJA 4LUDA 4RJ4A 5IDNA 2LGCA 5JFWA 2XMYA 3A4OX 4JI9A 3VS0A 3TKUA 2JIUA 5CNOA 3EWHA 3D4QA 3NRMA 2WKMA 3LMGA 5HE3A 1JLUE 1KOBA 2JGZA 3HMNA 3WF5A 4QP6A 1PKDA 1JPAA 3MH3A 4I6HA 4QMQA 1KE6A 2W9FB 1W82A 3IONA 3IGOA 2H8HA 5CEKA 5GZ8A 1SM2A 4OTWA 3L1SA 4HZSA 4LQMA 2QNJA 4B99A 3A99A 3GUBA 1WCCA 4KAOA 2BHEA 4FVQA 5EFQA 4IWOA 5HKMA 5B2LA 3VUGA 4PQNA 1H0WA 1OECA 1CM8A 4DE4A 3JXWA 4NCTA 1CKPA 2CKEA 3PPZA 3VRYA 3VUKA 2YM5A 3MS9A 3R9RA 3ORMA 4CNHA 4FSNA 5JKGA 4M7IA 2CGXA 5I5ZA 4Y5HA 1KE8A 3EL8A 3UMXA 2XM8A 4WKQA 1SMHA 4OR5A 5JZNA 2ZB0A 5EM7A 4JAJA 4WBBB 1H1RA 3TJCA 4GU9A 3PXZA 4FL3A 2C69A 2FYSA 1BI8A 2AC3A 3P9JA 2F2CB 3LMIA 2WQEA 3FL4A 4CFNA 4C34A 5AP0A 3UG2A 4YU2A 1G8SA 4YHTA 3E87A 5AUYA 3A8WA 4R5SA 4AQCA 4XCUA 4HCVA 3EN5A 1P4FA 2ETMA 2W7XA 4J99A 4MBIA 3UP2A 5FM3A 3VC4A 3LFEA 3OXTA 5BQ0A 4C3RA 1XKKA 3IG7A 2YABA 3LKMA 3F5XA 5DI1A 3F61A 2B53A 3QWKA 3EH9A 4QMLA 3C5UA 4M3QA 5CX9A 1Q62A 4IB3A 5H2UA 3VN9A 4A9SA 4D2WA 4RWKA 5G1XA 4DEEA 2CKOA 4DA5A 2J0KA 3F5GA 4DEAA 3FQSA 4Z3VA 2BPMA 3FMNA 4M69B 1DS5A 3F2NA 5D7VA 4YNEA 3MPMA 4E73A 4FSUA 4KD1A 4EOKA 3F88A 4ZIMA 5TT7A 4XH6A 4QYEA 4B8LA 4BDEA 4C38A 2W1DA 4G16A 3C0HA 2UVYA 3ZFXA 4XRJA 4EH6A 4HVIA 4RIOA 5HO7A 2C0IA 2WTIA 3DPKA 4CFUA 2UW9A 3VUTA 2C6EA 2HAKA 3NZ0A 3HRCA 3WBLA 4QQ5A 3R6XA 5IH6A 4FOCA 1KOAA 5A4LA 3DTCA 3GCUA 1REJA 3QCSA 4LGHA 1U5QA 3IOKA 3KA0A 3O8TA 3QX2A 3AOXA 3F3WA 3I7CA 4IVDA 4UWBA 5AUXA 5FM2A 4FTJA 4ZS0A 3GP0A 5FQDC 5L2TA 3KK9A 4PUZA 5CU3A 4C8BA 1XBBA 3TNIA 4FTLA 4RVLA 3Q5IA 3LIJA 2JLDA 1UU3A 4QMTA 3MIAA 4E20A 5BUIA 5AUTA 2O2UA 4W4WA 1YI4A 5F4NA 1UV5A 3HDNA 2ZMDA 5F95A 2YIYA 3D5XA 5HG5A 3V6RA 4CFVA 4EL9A 2YAAA 4UMPA 1L8TA 2JKKA 4RA5A 4AG8A 3SDJA 4EQMA 4NYEA 4KNBA 5ANOA 2P33A 4F63A 4GJ3A 1Q8UA 5B0XA 4JNWA 2HY0A 4QP9A 3W2SA 3TN8A 4KA3A 4IXPA 5FP5A 5AP2A 4CT2A 4DEBA 2UZUE 4YZBA 4IQ6A 5FG8A 4QT1A 2P4IA 2WQMA 2O63A 2WMSA 4AZWA 4CKJA 3NMUF 4X0MA 4E6CA 2ITQA 4O0VA 3KU2A 2RF9A 4XG4A 1X8BA 3TV6A 3ZCLA 4XMOA 1QL6A 4WBOA 3M2WA 2Y4IC 4IADA 3A7HA 1PXIA 1FVVA 3CS9A 3VS1A 4EH9A 3PE1A 5HG8A 4YC6A 3OCBA 4I20A 3FL5A 3QXOA 3VHKA 5EG3A 2O8YA 4ACCA 3P7CA 3BGZA 2W96B 4BTJA 1OL7A 2YACA 3E62A 4NIFB 4Q2AA 2BFYA 5TF9A 2C5OA 3BGQA 2GTNA 4MQ2A 4QP8A 4X3FA 2FSMX 4Y73A 2OI4X 4X2FA 5AUWA 5FTQA 4XBUA 4BCNA 4EUTA 4OUCA 3HRFA 4IFCA 4IJPA 4EOQA 1SZMA 3R22A 4TWOA 3NUAA 3D7TA 4KKHA 1BI7A 1GZKA 3R1SA 3S2PA 4QPMA 3S95A 5AAEA 1YVJA 4X2KA 2CN5A 2X2KA 3OROA 1FMOE 3PWDA 3EQPA 4O1PA 4WO5A 4YSMA 4D2TA 3RNYA 4EK4A 4GEOA 5HHWA 1OKWA 3R02A 4EOJA 4PNKA 3PPJA 2H9VA 3EHAA 3DAJA 2VX3A 4QTCA 4JT3A 1XH8A 2VGPA 1REKA 4IAFA 2H6DA 3ZUTA 2BZJA 2J2IB 4O38A 3ID6C 3D2KA 2VTQA 3VUIA 3NVMB 3DB6A 3V6SA 3OT8A 3VHEA 2C47A 3MFUA 4R7HA 5C27A 4E3CA 3IK3A 3WOWA 5JT2A 4HW7A 4D0WA 1PHKA 1YXSA 3UE4A 3QCQA 3D5VA 4CQEA 5IEYA 4CFWA 4FIFA 4YURA 3NGAA 3R7OA 4I0RA 4MK0A 2EB3A 3OFMA 4RX5A 4XJ0A 3VF8A 2R0IA 3HX4A 1K3AA 5CT0A 3IW8A 2GNLA 3EQCA 4EH3A 3LXPA 4IW0A 3P5KA 5C4LA 5TKDA 1FPUA 2YDIA 2XK8A 3FPMA 4JBVA 3DLSA 4F6WA 3ROCA 3FAAA 3AGLA 1YHSA 3ZXZA 3SVVA 3H30A 2W5BA 3NUXA 2WO6A 2YCQA 2OXDA 1FGIA 2OZAB 3H9OA 2R3NA 3QUEA 2PZIA 1R39A 2RIOA 1FMKA 4MXXA 4PP7A 4ZZNA 2CCIA 5CSXA 3TV4A 4P5ZA 5JZJA 2FUMA 4ZTLA 5CAVA 3GCPA 3P7BA 4EWQA 3VIDA 2Q83A 3U9NA 3NYXA 4FT7A 2QC6A 3RBWA 5KHWA 4TWCA 4WHZA 5GHVA 3F7WA 2R3MA 3GXLA 5J95A 4C35A 3ALNA 4MHAA 1Q97A 3E8CA 1YXTA 4C3FA 3BV3A 4E5AX 3O17A 2H34A 2NO3A 4CFFA 2PVLA 4ZSEA 3ZOSA 3I60A 2FSLX 4BI1A 3R7VA 4CT1A 2B9FA 3KRRA 4ENXA 3MTLA 2J0IA 3FJQE 2ITVA 3OTVA 4G6LA 2VO0A 4GSBA 4NTSA 4XBRA 3WF9A 2VTLA 1YWVA 3FKNA 4N4SA 5H9BA 3KXXA 4QMUA 5J9YA 2C6IA 5LMAA 3GB2A 4EHGA 2XNMA 4DCEA 5AP3A 4O6LA 1OIRA 3BCEA 3EFWA 4K33A 3VW6A 4NW5A 1NVQA 4M84A 4RIYA 3PP1A 4XV1A 2XNOA 4G3CA 2V0DA 4AU8A 4AWIA 3FLQA 4KSPA 1H01A 4LYNA 4W9XA 1KE7A 3AC5A 4U7ZA 2WTWA 4RJ7A 2RG5A 2W4JA 3ZYAA 4C62A 2HCKA 2JDRA 4KIKB 4TXCA 2R3RA 2YEXA 4EBVA 5K0XA 1AQ1A 2XP2A 5AP7A 4RQVA 3UO4A 5LJJA 2YM3A 1A48A 4ZAUA 4BGHA 1Q8TA 4O0RA 1YHWA 4WG5A 5AIRA 4RG0A 3ZMMA 4NM0A 5JGBA 3FKLA 1W83A 3PRFA 1DAYA 4GYIA 3HLLA 3TG1A 4L42A 3FYJX 4KS7A 2X4FA 4L01A 2KULA 5D41A 5EI6A 4F6UA 2HY81 5IA3A 5FBNC 4MX9A 2ITOA 2EUFB 4H1JA 4BC6A 4D5KA 5KX8A 3B2WA 2YIWA 3ULZA 3O50A 4C4IA 1XBCA 2OIQA 1M2RA 3QX4A 2B0QA 5HGIA 3SXFA 3V8WA 4A07A 5CZHA 3Q04A 5HE0A 1Q41A 1T46A 3F9NA 3PA3A 3PXRA 5CF6A 4FTIA 3PRIA 2P2HA 3TUCA 4FKQA 4QNAA 4EQUA 5M53A 5AV0A 2QG7A 2ONLC 4JXFA 3U4WA 3DXQA 1QCFA 2REIA 4XP3A 2C6LA 4MD9E 3TL8A 4Z55A 4XG2A 4EWHA 3KF7A 4ACDA 3TDVA 4FTNA 4KBKA 4ACMA 3BLHA 2QU5A 4FEXA 2WQOA 2DUVA 4OLIA 2GS7A 3OD6X 1H1SA 2F9GA 2EVAA 2VTNA 2XKEA 3MB6A 4C33A 1JKLA 4CTBA 1MRUA 1ZY5A 2P55A 3GEQA 2IW8A 4F9WA 2ZM1A 4USEA 4PL4A 4TWPA 5D1JA 2G01A 3PJ8A 1BMKA 3ENMA 3I5NA 4FV0A 3JY9A 4MXAA 4IVBA 1PW2A 2OFVA 3G6GA 4IX5A 3W32A 3L9NA 3EQFA 4EOMA 2IZTA 3K3JA 1BLXA 1BL6A 1YOMA 2C6TA 2JDVA 2OU7A 3OY1A 3VULA 4AF3A 5K4IA 1FGKA 3PG1A 4F1MA 4IWQA 2ERZE 2XH5A 2IZRA 4RJ5A 5IA5A 2LAVA 3R7YA 4A7CA 4CFXA 1KV1A 3GU7A 3LCKA 5HQ0A 5IQFA 2XIKA 2Z8CA 5HORA 5JSMA 3OZ6A 2OWBA 2YCSA 5GNKA 4IAYA 4O83A 5FTGA 4GK2A 4MBLA 3S00A 3O7LB 1DAWA 2F7XE 4QTEA 3TUBA 4FV6A 5HLWA 3DQWA 4D2PA 5EQPA 2BRHA 5EM5A 2XZSA 3OXZA 3RK9A 4EJNA 4MTAA 4IVAA 4DLJA 3QTUA 4EOLA 3PZHA 4LGGA 4I23A 2RFNA 4FV2A 4S30A 5JQ8A 1RW8A 2E9OA 2PVMA 3ET7A 4FSWA 4C57A 4IX3A 4D9UA 4U41A 1BYGA 4ZXTA 1OITA 4LOPA 1Z9XA 4QPSA 5ANDA 1OL2A 1GAGA 4EC9A 4AUAA 2BAJA 3QYWA 4NZWB 4YZCA 4C3PA 5AA8A 5LVMA 4U81A 3NSZA 4O82A 3BGPA 5L8LA 2GFSA 1YOJA 2H96A 1R1WA 3IECA 4Y8DA 3PXQA 2XVDA 4W8DA 3V3VA 4CKRA 4ZMFA 2QO9A 4GK3A 4LRMA 2J90A 4ZY4A 3LPBA 5CF8A 1J7UA 4JAIA 5EK7A 3CTHA 3QGWA 4DFLA 1OB3A 5KO1A 5M4IA 1YWNA 4QP3A 5HG7A 2V5QA 4TNDA 4UMTA 3FMHA 2X2MA 2Z7QA 4USDA 5JQ5A 3KMMA 1MRVA 4PX6A 1Q3DA 2WMXA 5C26A 4FG7A 4YJVA 5BVNA 2A4LA 3WZKA 2EB2A 4RGJA 4ALVA 4D28A 3MIYA 3Q9YA 4IMYA 5EW3A 3RK7A 1ND4A 4P90A 3MTFA 5HG9A 5CAOA 2WPAA 1W0XC 5J1VA 4FGRA 2ITZA 4BYJA 2XIXA 1XQZA 3BYVA 4S31A 1R0PA 3FLZA 3BYMA 3NDMA 3SRVB 5AA9A 5IUHA 4DF3A 3SLSA 2OH4A 3ZSHA 5IQIA 3I0OA 4PV0A 5DR2A 2W1ZA 3L8VA 4RVKA 4AS0A 1YDRE 1B6CB 3D2IA 3QBNA 4FV9A 3TCPA 3VS3A 3DAEA 1OUYA 2JITA 3TKHA 4L6QA 5DYJA 4FIHA 3CKWA 3IKAA 3HMIA 2YM8A 3HDMA 1YWRA 3SXRA 1PY5A 4OT6A 3MPAA 4AZSA 3QUPA 1KWPA 4PWNA 5CS6A 5M44A 5GJGA 4NTTA 3DY7A 4WG4A 4AN3A 3E7OA 3SOCA 3VAPA 4O7ZA 1OVEA 3RK5A 4B0GA 3C5IA 4UMQA 4RIWA 5JH6A 2WOTA 4BDCA 2GHLA 3CGFA 5BMSA 5ICPA 4O7VA 3DK3A 3FMKA 1GIJA 3BHYA 3O71A 2XEYA 2BZKB 4PL5A 1AGWA 1H8FA 3DKCA 3D9VA 4C2VA 3Q4UA 4FF8A 3S3IA 5L6PA 3G5DA 4XV9A 3DXPA 2E9PA 3R0TA 3FMDA 3V5LA 5KMNA 5L2QA 3LAUA 1JKSA 4IX6A 4D4VA 1XH5A 1UKIA 3I1AA 2C1AA 2UVZA 2QOIA 5DR6A 5HNGA 4OAVB 4G3FA 2BDWA 2BUJA 1OIUA 2EWAA 2BCJA 3CPBA 2CJMA 3L9PA 3COMA 2Z60A 3HUCA 4IHPA 5H8EA 3RNIA 3BZ3A 3RPYA 3UO5A 3GU5A 3ZBXA 4XS2A 4FNYA 5L6WL 3PSBA 1Y6BA 2PMNX 4IAZA 4XLVA 5HNIX 3FZ1A 5LARA 4PL3A 1PF8A 2CNUA 3AMYA 2YHVA 4DGLC 3R9DA 2HIWA 4JBQA 2PTKA 3VS4A 4Y83A 4R1VA 3R21A 2ZJWA 4GRBA 4ZTHA 2I0VA 2UZNA 1YDTE 4GT4A 5C4KA 2PE0A 4JG7A 4MBJA 4XG8A 4FKUA 5I9WA 1OGUA 4BKYA 1WFCA 4L68A 3GVUA 3ZC5A 4C4HA 3MVHA 3QFVA 2QOBA 3QZIA 1P2AA 3KB7A 4I4FA 4G34A 4NK9A 2B55A 5AX3A 4CZYB 2X9FA 1ZYCA 3MGYA 3ORPA 3VBXA 4L53A 4PNIA 3MVLA 3F3VA 4D4RA 4FZFB 4FSRA 3R00A 5L6OA 4FTCA 5CEIA 4KRCA 1J1BA 2PK9A 2UZWE 3B2TA 4HCTA 3K5UA 1CSNA 3FMJA 4MNFA 4EHZA 3NNXA 4G2FA 3SD0A 3V5QA 5FDPA 5I9XA 3RPVA 4JG6A 2IO6A 2RSVA 4GMYA 4NM5A 3MSSA 2UZBA 3WF7A 5AADA 3QRKA 3HNGA 1R0EA 2XK3A 3DKFA 3I6UA 4FYOA 2J5FA 5HESA 3RWQA 3CR0A 3PSCA 4BCMA 1KUTA 2Q0NA 3ZSIA 4YR8A 1WBPA 5EKOA 3KEXA 5HBJA 5TE0A 2P3GX 4BBMA 5HTBA 3BYSA 4ZEGA 5E8SA 5KMJA 4QO9A 5FEEA 3WE4A 3JR1A 3TI1A 2A1AB 2OIDA 2A2AA 5AM6A 4AN2A 1STCE 3QD3A 4BY9E 4MNEB 2I7QA 2W4OA 1VEBA 5A4TA 3RCDA 4UZDA 3ZO2A 3D0EA 4DTAA 2JD5A 2OH0E 4I3ZA 1L3RE 3II5A 2JEDA 4WNOA 1ZOEA 5CZIA 4ZZMA 5HU3A 4YHJA 4GKHA 3QAME 3Q5ZA 2JAVA
chains in the Genus database with same CATH superfamily
4JBPA 1LV7A 1OPLA 2LXEA 1H26A 2JDOA 4KBAA 4O81A 3OUNB 4DR6M 5CVFA 2VX1A 5C8KA 4V05A 3RTPA 4AT4A 2PUPA 1TH3A 3NNVA 3GGFA 3OG7A 3LXKA 1JQHA 3ERKA 2QR7A 1UVRA 3VNTA 5CALA 3KOZE 4YHHM 4LZZA 2C4GA 3R1QA 4LGYA 2QOLA 3QTRA 3EKNA 4PPBA 1CKJA 3DBFA 1Q5KA 4HNIA 4UV0A 2XUUA 4RJ6A 4H58A 1ZARA 4FC0A 3TIYA 5AUUA 1URCA 4I4LA 5FP6A 3QLFA 4CD0A 4S33A 4A3VB 2L4FA 3CXWA 4F0GA 3FYKX 4FBXA 4GC5A 1YXXA 4DHFA 2HW6A 2W5HA 3RPOA 3W8LA 5BPVA 5HIEA 3VDUA 3RZBA 4QYHA 2YZLA 3QUDA 4PCZA 3W10A 5L2SA 1YKRA 4KRDA 4P5QA 4PP9A 5GJFA 1N32M 1H0VA 4G6NA 4F1OA 3A2CA 5AR4A 5F1ZA 3AMBA 4FT5A 3W18A 2FOIC 2WEIA 4GH2A 1TTEA 2CHVA 2Z7LA 3BX5A 3F7ZA 2Z7JA 4D58A 3PY1A 3BLRA 1YRPA 4AGCA 4NFNA 3BE9A 3FUVA 2QO2A 5EHLA 2RFDA 2PVNA 4KSQA 4J8NA 3VUHA 4CEGA 3H4JA 1GNGA 2HXQA 1U59A 2R4JA 4W8EA 3WZUA 1QAOA 1YDSE 3O8UA 2GNIA 4Y46A 4I6BA 4NW6A 3U61B 4GRIA 1IBKM 1A5TA 1UWHA 3JVSA 4GITA 3RM7A 4ZSGA 1FJGM 3E8DA 4BWPA 4TN6A 4MGYE 3KREA 4KINA 1MUOA 3DFZA 2FH0A 3D14A 3G51A 4EH4A 4AKHA 3EB0A 4GHAA 4E93A 1SYKA 5HI2A 3QQHA 1I94M 2WTKB 5LWNA 5FXRA 3M11A 4GKKM 4XOYA 4IVCA 3W0RA 3RVGA 4PPAA 2XS0A 2J50A 1L2DA 1VEGA 2BZHB 5AV2A 5BVEA 2RFSA 4F9BA 4OW8A 5L8JA 2C0OA 2PZRA 3UVPA 1DO2A 2XKFA 4FTOA 2JP7A 1XWSA 3KL8A 4FEVA 5TR6A 3ELJA 5AR3A 3UZUA 1BUHA 3R73A 3F2RA 3MW1A 5KNJA 2C5VA 2ACXA 1OIPA 5F9EA 3V5JA 5AR2A 4D1ZA 4IAAA 2BNKA 2RGPA 4QYFA 3ITZA 2JKMA 2VTOA 5BVFA 1E1XA 2XCHA 3FLNC 3H0ZA 4PTCA 3OCSA 3TZMA 4DV1M 4IBJA 1NJGA 3TACA 4DFBA 1PRBA 3GPPA 2Y6MA 3CGWA 5FD2A 1WBTA 1V0PA 4UB7A 2O64A 3QCYA 1PXNA 3V76A 3HZJA 4D1XA 1OKVA 3KS8A 4S32A 1L1ZA 1G3NA 2WOUA 5HOAA 4F70A 4OX9M 3SA0A 4QMYA 3ODZX 3P7AA 4DHZA 3E3BX 3J80S 4YJOA 2BILB 3C0IA 4EJ7A 3L28A 5HLPA 4BBAA 2C5NA 4P16A 5JGDA 3ZDIA 1VZOA 1QUTA 3SHGB 4X2JA 1YXUA 4WA9A 4R78A 1YI6A 4AE6A 4AOIA 3J81S 4F64A 4V0GA 1Q02A 4LJ7A 5JN2A 1IRKA 1IAJA 2Y6OA 5J79A 4FT0A 5AFVA 3P08A 3QRUA 2WGJA 4UBAA 2YN8A 4BI2A 2X6DA 5G6VA 1TFFA 1IASA 5ITYA 1TGUA 4B3SM 2V6ZM 2W4KA 2XNEA 4BWXA 4MYGA 1NT2A 2R64A 3BOSA 4L6V6 3K92A 3BHUA 3IQ7A 5KMOA 1LEZA 3UQGA 2VO7A 1QPCA 4GC9A 4DAWA 1ZOGA 1Z5BA 1IXZA 5H8GA 3U6QA 2BFXA 1Z57A 5IQBA 2VD5A 2OKRA 3FXWA 2CNVA 2BIYA 5IREB 4QMPA 1OAIA 5EHYA 4LF7M 4X62M 4JIKA 3BL9A 1O6LA 3R8UA 2X49A 4QYYA 3HU1A 2NNWB 4CXAA 4HGEA 5CYIA 1XXHB 3Q3BA 3SV0A 3GNIB 4JG8A 4FI1A 4CVAA 1IN7A 5HIDA 3HL7A 2HZ0A 5KBQA 4C2WA 5AAGA 1JBPE 3JY0A 3U6OA 2QO7A 4BDGA 3F69A 4L3JA 4FR4A 4BWKA 1V33A 4GH9A 3O23A 4IAKA 3LFFA 5ANIA 3EIDA 4OTIA 1V0OA 4DGNA 2O0UA 3LVWA 2VTIA 3DDQA 3CY2A 2PL0A 4FYNA 5FEQA 5A4QA 3I01M 5E7RA 1SVGA 4RRVA 5CU4A 5E1SA 4WSYA 2WSEF 1PYEA 2PUUA 4PT5A 2ITTA 4UALA 3GENA 2UUCM 1UFZA 4IC8A 3QALE 5HD7A 3ZUVA 5DLSA 4HVHA 1NY6A 3Q6WA 2ITWA 5HO6A 3WYYA 2BJWA 3FE3A 1R3CA 3AXWA 3EL7A 4GMQA 5TO8A 4QP7A 3HV4A 4KT0F 2KNVA 3SASA 1GLNA 1HJPA 4O6EA 2KNZA 1DGHA 3L8SA 2B54A 3ORNA 4XEYA 3BU3A 3C58A 2XEPA 3RAIA 4RBLA 5AR5A 2J7NA 1GO5A 4AW5A 2BMCA 4MF1A 2Z7RA 2YM4A 1IY0A 4QMSA 3NWLA 3IOPA 1PMEA 4RVTA 3TTIA 5AIKA 5HO8A 4DH8A 1KSFX 4I22A 5D12A 3R9NA 4JRVA 3H4MA 4CRLA 4G4NA 4G4RA 5EDPA 2Y7JA 3S1HA 4G6OA 4FNXA 3HMOA 4QYGA 3MH2A 2JY5A 4GG5A 4U80A 4Q7JA 1WXQA 4BFMA 3QL8A 4I24A 3Q2MA 4BICA 4L15A 2W1EA 2P5TA 2QVSE 2W1GA 1UWJA 3RCJA 2VTMA 2A98A 4O91A 4JI0M 3ZZWA 5A6NA 3LXLA 3RGSA 1J7LA 4XRLA 1PMNA 2X6EA 3ACKA 2XAOA 4GUEA 2X8DA 3TE6A 2WMTA 2LWXA 4JI3M 4FV1A 1Q39A 2BDJA 4LJ9A 4G17A 3HKPA 4EK3A 5CQUA 3B74A 2XNPA 4LOQA 1S9JA 4TL0A 3GPXA 3A4PA 5CENA 2DWLA 5CEPA 4S2ZA 4JI7M 5M07A 3LCDA 4B6LA 4XX9A 3SGCA 4BLCA 3LM5A 3R7EA 4R1YA 2XF0A 4CFMA 3GLIB 3D83A 2V7AA 3DU8A 3QXPA 4V04A 3UMMA 1Y91A 4RLLA 2JKQA 3VRZA 4HVDA 4Z7HA 5IA4A 3HWSA 5I3RA 1HNZM 1CDKA 1SNXA 4QQCA 7CATA 3QCXA 3PNVA 4RX7A 3GLFE 1NSFA 3NW7A 4ASDA 2IVTA 3NUNA 2PVRA 3ZO4A 1XH4A 1DO0A 5AM7A 1H24A 2GS2A 2JBPA 4QMXA 3W0OA 3GQ4A 4N6YA 4D9TA 3POOA 1XWIA 1APME 4F0IA 2PMOX 5IZFA 4HYSA 4USFA 5KMKA 3KOYE 4X2GA 2GNOA 3AKLA 4E4MA 4FSTA 5FRIA 4O0WA 3GRRA 4QQJA 5E8UA 4WRGA 2X0QA 5FUTA 3Q4CA 2GU8A 2HHHM 3R8MA 3JVRA 2PU8A 4RSSA 4HYHA 5B2KA 1XR1A 3KULB 2HELA 2QOKA 5IMXA 4K0YA 2W9ZB 4R7BA 1O6YA 4AKIA 5BVWA 4AW1A 3QAUA 2UZOA 1H1QA 3R9XB 2OZOA 3DB8A 3OUKA 3AD5A 3NW5A 4K0KM 4PMMA 5FTMA 5EP4A 1M17A 3ZONA 2WSCF 3T3UA 3BWFA 2YCRA 4K77A 5FTNA 1P4OA 4BR3A 4XUFA 4HPTE 1PXKA 1XB2B 3HHXA 5A3XA 3W2QA 2PPQA 3E7VA 1LUFA 4IEBA 2PY3A 3W67A 2LH0A 2FS1A 3W2CA 4F08A 5LVOA 1VQ1A 1N36M 4CTCA 4D4SA 3KSXA 2W1FA 3M6AA 3W16A 3MK6A 5ITXE 3BU6A 3CBLA 4YZMA 2Z4SA 3LJ1A 3N4TA 3QQJA 3RM6A 2PVHA 5HCZA 4F0FA 2DZLA 4ANLA 1KFVA 4X65M 1K82A 5LOHA 1G4AE 3FMEA 5CAPA 3PVBA 2HENA 4K11A 3BRBA 3Q96A 2YISA 3NEWA 3A62A 1H07A 4DN5A 2BROA 2C68A 2BKKA 2HYYA 3BHHA 2VRXA 3O2MA 4P7EA 4UWYA 3V5PA 3OC1A 2UUBM 3R7UA 2OXXA 4L78A 4RC4A 2PWLA 5LQFA 1MQ4A 4RFMA 2VWVA 3V51A 3ZSGA 2DAIA 3OWKA 3AT3A 4E5BA 2YLEA 5DT3A 3EOCA 3MH1A 5E90A 2CLXA 4NFMA 1N34M 4UXQA 3H3CA 5BV3A 5CU2A 3A8XA 4FL2A 3HGIA 3PVWA 3GLGA 3LLAA 3SRVA 3CGOA 2FSTX 3PZEA 2VNWA 3K2LA 4DR1M 5EYCA 3ENHA 3RAHA 2RL5A 3RGPA 2CP8A 4NT4A 4FEQA 4QP2A 3T3VA 3ZZEA 5I9ZA 4E4LA 2VF7A 4DINA 1OBGA 5GZAA 3HA6A 3R8ZA 4YPSA 4FCVA 4IDVA 4FVPA 3U6HA 2ETKA 2ZFYA 5KKRB 4BCOA 3PP0A 1PJIA 4FV4A 4Y95A 1JKTA 5IQHA 3CJGA 3GLHB 1TDZA 4CIZA 3NAXA 3TZ9A 4FZ7A 4J95A 5HZNA 5AJQA 3VS2A 4M97A 4MH7A 3EZVA 3D5WA 3QTQA 3OWLA 4UEUA 2OJIA 2QSFX 2ZAMA 1A9UA 2XSZD 2G2HA 4MB7A 3WILA 5JI2E 5JK3A 3SOAA 4BHNA 5HTCA 4NKSA 2YFQA 4BDFA 3WI6A 1BL7A 3GRUA 1FVTA 3A7JA 4EORA 2Z4RA 3QU0A 3LZBA 3I5ZA 3C50A 4XHKB 1WR1B 3DBDA 2VTJA 3IO7A 5CY3A 3T6PA 4CGYB 1HT2E 3T1YM 3JUHA 4ITIA 5F3WA 3ML1A 2RKUA 1PYXA 4IH8A 4QRCA 4DTBA 5C01A 3U6CA 5HD4A 3QD0A 4XNEA 5DOSA 5FTJA 4LUDA 2JIUA 3D4QA 3LMGA 2AQXA 4Z16A 4I6HA 2W9FB 3IONA 1SM2A 4IWOA 5HKMA 3VUGA 2K47A 4PQNA 1H0WA 3QWLA 3JXWA 3PPZA 3VRYA 2YM5A 3MS9A 4M0DA 3TMOA 2CGXA 4WKQA 1R7RA 4OR5A 4JAJA 4WBBB 3VK8A 1H1RA 4GU9A 2FYSA 2AC3A 3FL4A 4CFNA 3UG2A 2ETMA 3IG7A 1C7YA 3LKMA 3F5XA 1SG9A 3F61A 3QWKA 4D2WA 5H2UA 4IB3A 4RWKA 2R65A 4YNEA 2UUAM 4E73A 2D7GA 4EOKA 1R5LA 4XH6A 4XRJA 2C0IA 3GQ3A 2C6EA 3WBLA 4HEOA 3R6XA 3QX2A 5AUXA 4IVDA 3GP0A 5L2TA 5CU3A 3Q5IA 3MIAA 5F4NA 3HDNA 2ZMDA 5F95A 3V6RA 4CFVA 3SDJA 2P33A 5B0XA 3TN8A 4KA3A 4IXPA 5AP2A 5FG8A 4YZBA 3JR4A 2O63A 3NMUF 4O0VA 2RF9A 4XG4A 4XMOA 1QL6A 3M2WA 4EH9A 3A7HA 1PXIA 3CS9A 4YC6A 3OCBA 4I20A 3QXOA 4BTJA 2YACA 4NIFB 5TF9A 4MQ2A 4Y73A 2OI4X 4BCNA 4IFCA 1SZMA 4KKHA 3R1SA 2F5PA 1YVJA 4YSMA 3OROA 1OKWA 2H9VA 2VX3A 4QTCA 2VGPA 4IAFA 1VLRA 2H6DA 2BZJA 3NVMB 4R7HA 3IK3A 1NJFA 4D0WA 4HW7A 3QCQA 4CQEA 1QAQA 4RX5A 5CT0A 3LXPA 4IW0A 2YDIA 3SVVA 2WO6A 2YCQA 4PP7A 4MXXA 2CCIA 3GCPA 3P7BA 4EWQA 3NYXA 5GHVA 3F7WA 3GXLA 5J95A 4MHAA 1Q97A 2W82A 2PVLA 4CT1A 3KRRA 3MTLA 2J0IA 3FJQE 2ITVA 3OTVA 4G6LA 3WF9A 1ST4A 5J9YA 5LMAA 3GB2A 4EHGA 3BCEA 3VW6A 4AU8A 4KSPA 4F2LA 5FLXS 4W9XA 1KE7A 2Q2EB 4U7ZA 3ZYAA 4C62A 2R3RA 5LJJA 2XP2A 1D2NA 1W83A 3HLLA 3TG1A 3FYJX 4F6UA 4L01A 5EI6A 2HY81 5FBNC 2ITOA 4BC6A 3B2WA 4MUQA 4C4IA 5CZHA 1T46A 2UU9M 2P2HA 4EQUA 2QG7A 5M53A 2EKFA 2C6LA 3TL8A 4JYAM 4EWHA 4ACMA 3BLHA 2WQOA 2DUVA 2GS7A 3OD6X 2F9GA 2XKEA 4IBFA 2IW8A 4PL4A 4FV0A 4IVBA 2L09A 3EQFA 4EOMA 1BLXA 1FGKA 2ZTCA 3FTDA 2IZRA 4RJ5A 2LAVA 3R7YA 5IQFA 5JSMA 2YCSA 3TUBA 3OXZA 4I23A 1RW8A 2E9OA 4D9UA 1BYGA 4LOPA 1J5EM 5ANDA 3U6PA 1GAGA 3QYWA 4YZCA 5AA8A 4U81A 4O82A 3BGPA 2GFSA 4Y8DA 4W8DA 4NRWA 3B7QA 4GK3A 4LRMA 2J90A 5CF8A 5KO1A 1OB3A 3FTFA 2Z7QA 4USDA 2WSFF 2RKOA 2WMXA 5BVNA 3WZKA 4IMYA 2DAMA 4WP2A 5HG9A 5KQDA 2XZFA 5IUHA 5AA9A 4B7HA 3I0OA 1QZMA 3SHFA 1B6CB 4LG2A 2JITA 3FUUA 3CKWA 3IKAA 3HDMA 3SXRA 4AZSA 2L2DA 4PWNA 3VAPA 1VDDA 3C5IA 4UMQA 3DK3A 3FMKA 1F4IA 3BHYA 3O71A 1AGWA 1H8FA 3DKCA 3SARA 5L6PA 4QNRA 3R0TA 3FMDA 3LAUA 1XH5A 5HNGA 4G3FA 2EWAA 3L9PA 1HR0M 3CPBA 4IHPA 3BZ3A 4XS2A 5L6WL 1Y6BA 5HNIX 1PF8A 2CNUA 3R9DA 4JBQA 4Y83A 4R1VA 3R21A 3QYEA 4GT4A 4MBJA 1WFCA 3J27B 4L68A 4C4HA 3QFVA 2QOBA 2B55A 5AX3A 3MGYA 3MVLA 4FZFB 5L6OA 4FTCA 2UZWE 4MNFA 3NNXA 5I9XA 4JG6A 2UZBA 2OPFA 3QRKA 4DV0M 2XK3A 3FD9A 1WBPA 5HBJA 5HTBA 1ZQ9A 2DVWB 4AN2A 1STCE 4BY9E 3ZO2A 1L3RE 3II5A 1W5SA 4RNAA 5HU3A 4GKHA 3GFEA 3NR9A 3TNQB 4FIEA 4LDTA 3IW7A 4DH5A 2NQ8C 2GQFA 5HBHA 2XAMA 4DBXA 3NVKI 3I79A 5HLNA 2H5XA 4HVGA 5EQEA 3KC3A 1Z59A 4BBEA 5CXHA 2CLQA 4ENYA 5ITQA 4CRSA 4ZTSA 3SMSA 1VJYA 3KXEC 4RX8A 4WIHA 4FVMA 2LVAA 3JPVA 3UZPA 1JOWB 4DR3M 4FIGA 1IXSB 4FOBA 4F09A 3V8SA 2C0TA 3RINA 5CSPA 2VTSA 5LMKC 3ZEWA 4K2RA 4L3LA 2WTVA 5E8XA 4UYNA 2V7OA 4RJ8A 2C5YA 3DZOA 3FQHA 4WOVA 2CNQA 1O6KA 4WT6A 3W8QA 4FSMA 4L7SA 1K3WA 3VDPA 4EYJA 3K3IA 1UA2A 5GIPE 4JQ8A 3FZSA 4R3CA 2QI8A 1WBVA 5T6KA 2O5RA 5FEDA 4GVJA 1N78A 3G6HA 4HGSA 3OCTA 5E92A 5D9HA 3W0QA 3TT0A 3O51A 4BRXA 4QTAA 1DI9A 5CSHA 4RQKA 5CTPA 2QURA 2O65A 4NJ3A 2J4ZA 4R6VA 1U54A 4NU1A 5I9UA 4G4QA 4M66A 3ORKA 4JXJA 4CG8A 1DGFA 2W5AA 3GC9A 4XG6A 5M4FA 4FL1A 1Y8GA 2W99B 5A54A 3EQBA 4U3ZA 4FW9A 4FG9A 3KXMA 3U6MA 4YGAA 4HGTA 1SXJD 3HP2A 3LCSA 3E8NA 3G0EA 5BMMA 2X2LA 1D0LA 3DJ6A 3W0SA 5CVGA 4EOIA 4O7LA 2C3KA 5KPTA 2J7TA 2OJ9A 3GQIA 2KW0A 4BVUA 1N75A 4RFYA 4FTQA 5AV4A 3C4CA 4WSQA 1MN3A 2XK9A 4O2ZA 5L2IA 3EFLA 2YNMD 1SNUA 3J7AS 2HL7A 1F3MC 2WNTA 3TTJA 3U8WA 2UXCM 2JKOA 2ZV2A 2J0LA 1TQIA 4LRJA 4X3FB 2EUCA 2VIIA 4BI0A 4O0YA 4R77A 3HGKA 2CGWA 1HNXM 4LMUA 3FZOA 3WZDA 3NBIA 3H10A 2UZLA 3LM0A 2X8AA 3KRJA 3HKOA 1P3QQ 4ZTRA 4QPAA 3T9TA 4BN1A 2VWXA 1E9RA 5E91A 3LQQA 2X0PA 4KO8A 3TJDA 4EQCA 4RWJA 5EI2A 5GZ9A 5DYIA 4KKGA 2KNAA 3UG1A 5LMKA 1JSUA 3U55A 2O25A 4RIXA 5DA3A 4O7TA 3ZBFA 2MH8A 3F5UA 3OTOM 3KFAA 3W0FA 5HCXA 1SXJC 4S12A 3W0LB 4DFNA 3UOLA 2KZUA 3T15A 5CNNA 3FI8A 2J0JA 3FTCA 5EKNA 4D2RA 4FE2A 3EIEA 2ZV9A 4ALUA 4NL0A 5IH4A 4N0SA 4HNFA 1XHAA 2X9EA 5KZ0A 1WAKA 4ERKA 2XRUA 3U51A 3POZA 4L43A 3B7ZA 5CAQA 4KBCA 3TKIA 2ETRA 4QTBA 2B3TA 3B8QA 2AUHA 2HWPA 3KS4A 4TNBA 2F5SA 1K2PA 5LWMA 5FDXA 4A9YA 2IVSA 1KE5A 3R9OA 4AXCA 3NIZA 1W2DA 3Q9XA 4QP4A 3HHZA 4OBOA 4F6SA 1G8KA 3QKMA 4LUEA 4EOPA 2CV1A 5IF1A 5B2MA 5IDPA 2Z2WA 4G5JA 3LMHA 3NUSA 2Y4IB 2RRUA 4D55A 3L8XA 1HCKA 3B89A 4ZPXA 2F4JA 2B52A 3N4UA 4KWPA 3UODA 3UPZA 1QUSA 2DWZB 2OG8A 4N70A 1XO2B 5CASA 4OGRA 4DYMA 3LFNA 3E4RA 2J0MB 3FY2A 1JSVA 2XFTA 2WTDA 3MH0A 4IM3A 4F65A 4JR3A 5EP3A 1Y6AA 1UKHA 5IA1A 3E21A 3DQXA 3F3TA 4IZ7A 1PXMA 3LFAA 5IQCA 4RIWB 5D11A 4GT3A 4EOOA 3PJ2A 2XJ1A 1X37A 4OTRA 5D10A 5ITRA 4FV8A 2I0YA 5DWRA 5AV3A 5F20A 3DBQA 4RVMA 2BAKA 4TT7A 3V5TA 3OOMA 2ITNA 1G3IA 5CU6A 4BJJA 2NP8A 3DLZA 1OMWA 4OTHA 3VQUA 1WJ7A 3WE8A 2D7EA 2EXMA 3GCSA 3I6WA 2I0HA 4O7NA 1IQPA 1LP4A 3BKBA 4U0IA 3SBJA 2XYNA 5CF5A 4RMZA 5IQAA 4BL1A 1G59A 4O21A 2RGOA 1SXJA 1JB0F 5DG5A 3EQRA 3HJQA 3CSVA 2QCUA 4JI1M 3E3PA 3HJ8A 5DEYA 4E5WA 4G3OA 2XKCA 3QQKA 4OAUC 3Q53A 4TYEA 3QHRA 1H1WA 3P23A 2L4EA 1Q4LA 4M13A 4F9AA 1XJDA 2XJ2A 3JS2A 3U6IA 2R5TA 1R4GA 3ZU7A 3ZLSA 3K5VA 5A46A 2LBCA 2R3LA 2JC6A 3SG8A 4MXZA 1OKZA 2R3GA 5M08A 1PXOA 3PTGA 3PY0A 3PA5A 2VN9A 4YPDA 3FLYA 1I44A 4CG9A 3Q4ZA 4IBCA 4JS8A 4M68A 3QQFA 4GK4A 1QDRA 3Q32A 3F82A 5EOBA 4LM5A 3U5ZB 2CGVA 4DH7A 3WF8A 2IW6A 2B9JA 4NEUA 1NY3A 3ANQA 4BHZA 2YWVA 3BPRA 4C02A 2YM6A 5DNYA 3BE2A 3QTZA 4JI2M 2CFOA 5K5NA 2Z3XA 3GPUA 3RALA 2ERKA 2Y8OA 2XBAA 4O27B 5GJDA 5AAFA 4OBPA 2BTSA 2X7OA 4AT3A 2MJ5B 4E4XA 3QTIA 1NNUC 1CKIA 3QA8A 4IJ9A 2VWWA 3CQUA 4ANOA 5IEXA 3REPA 4ZJVA 4O22A 2YWPA 2OO8X 2KHHA 1NHWC 4LG4A 2PYWA 4GKIA 5HIBA 3DFCB 2QG5A 4U79A 2BRNA 3MVMA 3HX3A 5EP1A 5EHOA 2WTCA 5H8BA 2ESMA 3TWJA 4NC6A 1JWHA 2P2IA 3V5WA 3U6LA 4UN0C 3CPCA 3BYUA 4LJ8A 5M55A 2HK5A 4ZLZA 3PVUA 3L8PA 5EW8A 4AG6A 3KXHA 3KXZA 5FLFA 3SW4A 2W0JA 1EE8A 5L8RF 2R4EA 3GCQA 5CLPA 3AKZA 4OU7A 2JBOA 2PUIA 3OOGA 3FC2A 5BPYA 1T6OA 4DR5M 1ZMWA 4CKIA 3HV5A 2C5RA 3UDBA 3LQ5A 4EZ3A 2IN6A 4YJQA 4I5HA 3OW4A 3PLSA 1Y8YA 2GS6A 3IGGA 2C1BA 4CHTB 3W1FA 4EC8A 4A9TA 4I0SA 3CTJA 4MF0A 4JR7A 3G0FA 1BKXA 1MU5A 3MVJA 3CF6E 3PJ3A 1M2QA 1W2CA 3P79A 2YDKA 2KZSA 3A60A 2W06A 1OIQA 4R8QA 2OXYA 2R3OA 3FI3A 4BB4A 2GQGA 1K9AA 2CDZA 5AP5A 4GT5A 2G2FA 4C4EA 1G8JA 4EEVA 5LMNM 2HCBA 2XARA 1ZYLA 4AE9A 3A7GA 4GFOA 5CSVA 3TNWA 3FZRA 4F4PA 2VTHA 4DGMA 1J7IA 4AW0A 1NW1A 4O84A 5HTIA 4FUXA 4Y5QA 3I7BA 4DR7M 1H25A 5KMLA 3ZRKA 4QDVA 4DG0E 4MVFA 3KVWA 4IZYA 3IG8A 3Q52A 4CV8A 2Y20A 3F2AA 5B7VA 2QKRA 4C0TA 3AC8A 3SFZA 3B8RA 3RZFA 2EXCX 4YJNA 2PVYA 4FV7A 3BHTA 4Y28F 2J9MA 2CSNA 3R1YA 4QQTA 3B7NA 4FWGA 1IBLM 2FB8A 5LVLA 5DYGA 3OXIA 2JIIA 2W1HA 1I09A 3G2FA 5HE1A 2Y4PA 2DENA 5CANA 3FWQA 3VBYA 4BIDA 5BVDA 3BELA 4C4FA 4FK3A 3M1SA 3DKGA 3AC2A 4I81A 2IVVA 2YJSA 2DWMA 3K9PA 2J6MA 5CEQA 2CCHA 3DOGA 3OWPA 3W2PA 4V0GB 4G31A 3P5JC 1B39A 3MPTA 3QC4A 3DNEA 2DXIA 3ANRA 4DGOA 1WBOA 3UBDA 4DBGB 2R3PA 4Z8XA 2CWBA 1TDHA 4B3MM 2VZ6A 5JGAA 4QMWA 1SXJE 1U5RA 3R8LA 5HICA 3ZRLA 3QTSA 4XG7A 4I5MA 4J97A 5DHJA 2BRGA 3H9RA 3PPKA 4H3PA 3OT3A 3Q4TA 3BEAA 3U54A 3L26A 3UIMA 4ZSAA 3C51A 1OZ1A 3VFDA 3AQVA 3PXYA 4UY9A 1CUKA 4DEHA 3CTWB 4PDPA 4DBNA 4FTRA 2OIBA 4HL4A 4KIOA 4QD6A 4B8MA 3TL4X 3TWMA 3GC8A 1UU8A 3QRTA 4G3EA 4O0XA 1W7HA 4YLJA 1YXVA 2Y9QA 1U46A 1J3HA 3MBLA 3O0GA 4MAOA 5C8MA 3TIZA 3V04A 4YTFA 3CD3A 2G3QA 4P2KA 2CE7A 3QQUA 4QMZA 5M06A 1WBWA 5FTLA 4IZ5A 1WGNA 2X7GA 1OTRA 4D2VA 4PF4A 2KDLA 2Y0AA 4DITA 3JR5A 3VF9A 4O86A 1Z6TA 4BDHA 3ZRMA 3SX9A 4GEWA 3LFSA 4I0TA 4CLIA 4BCHA 4YLKA 4BDKA 4ERWA 1H00A 2OGVA 4AACA 3QQLA 4IFGA 8CATA 3QHWA 1Q8YA 3MDYA 4QMNA 3UVRA 5M51A 2ZDTA 4FT9A 4PMTA 4RA4A 2GFCA 4LJ4A 2GNGA 2ITPA 2XK7A 4LMNA 4NUSA 4FKIA 5I3OA 2OF4A 4CV9A 1E9SA 3ZO1A 4L00A 4YO4A 3CF0A 3A7IA 5CVHA 1MQBA 4U9AA 3D94A 2GSFA 4G9RA 2ZBKB 2ZDUA 2SRCA 5EDRA 1PMVA 4X3JA 2I6LA 3FKEA 4GUBA 3RHXA 3DJ5A 2XNNA 4I4EA 5K5XA 3ZM9A 4NM7A 5M09A 4OTDA 1JAMA 3VUDA 1RDQE 3DFAA 4H05A 4O4BB 3GQ5A 3O8PA 2FSOX 4QNMA 5EM8A 5J9LA 4FKVA 3ILKA 4HJOA 3M42A 4EBWA 3EQIA 2ERCA 4E1ZA 1OI9A 4KUJA 3QYZA 1J09A 2WELA 2VWYA 3HZTA 5HNBA 1DGHB 2R3IA 2R7IA 5J9ZA