3KVWA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2) in complex with an indirubin ligand
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
408
structure length
403
Chain Sequence
HHSGVDLGTENLYFQSMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSKGYPRYCTVTTLSDVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (DYRK2) in complex with an indirubin ligand
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
total genus 125
structure length 403
sequence length 408
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kvwA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kvwA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kvwA02
4FVPA 3QD3A 4KSPA 5TE0A 4HVIA 1LUFA 4F6UA 4MWHA 2PE1A 5KMNA 1GZOA 3M2WA 1M7QA 1ZLTA 2ZB1A 2B0QA 3UE4A 3ZRMA 4XBRA 3VS3A 2Y4PA 3QU0A 2IVSA 4NTSA 4RBLA 4ZY5A 3S0OA 5BYYA 1K2PA 2CLXA 2BAQA 1XH7A 2O8YA 2ACXA 4QNAA 4FVRA 4G2FA 4IIRA 5CALA 3KEXA 4L45A 4W4WA 3MTFA 4HYIA 3PSBA 3CJFA 3GI3A 1OPLA 2BIKB 3ACKA 3ERKA 3H0YA 4U43A 3BX5A 5KHXA 3T3UA 2FB8A 4E6AA 4J1RA 4I23A 3HECA 2QG7A 5AWMA 4QMTA 1BYGA 2QO2A 4FGRA 2PZYA 4XG7A 2CKEA 3DA6A 1CKIA 3G5DA 4UMRA 1J7UA 2PU8A 3ZH8A 5TR6A 4DFBA 5HLNA 4UV0A 5HESA 5GINE 2ZM4A 1R0PA 1V1KA 2QOHA 3CPBA 4MNFA 3ZO3A 4BHZA 4EH3A 3HVCA 3PLSA 4U44A 4FK3A 1W0XC 3QHWA 4IEBA 1JAMA 3DKGA 3LCOA 4M0ZA 3NUUA 4M69B 5EYDA 4TL0A 4X3JA 3TZ8A 5M51A 3G6GA 4D1XA 4ALUA 4OT5A 4PTEA 4GU6A 1H1QA 3IECA 3OHTA 4HOKA 4EORA 5DG5A 3BELA 2C3JA 1Y8YA 4MTAA 2BDWA 4QYHA 3VW6A 4UY9A 5A6NA 4NW5A 5AR8A 4O0YA 5HNGA 4C3FA 2Q83A 3RTPA 4O0VA 1BKXA 2YIQA 3HMOA 2UZLA 4TW9A 3IW4A 4Q9ZA 5A54A 4AG8A 4UZDA 4A9YA 1Q3WA 3ORPA 5D10A 4HVGA 4DFXE 4YJUA 4L8MA 5I9ZA 5IU2A 4TWPA 4A4LA 3VC4A 3LFSA 4TY1A 2P4IA 3V8WA 4AZFA 2YDIA 3SA0A 2BTRA 3KRXA 4UWCA 5LXMA 3W10A 4G17A 2PMLX 2VTRA 2W1FA 3H30A 4S30A 2XNPA 5HE0A 5TO8A 4BIEA 1GOLA 4V0GA 5J9ZA 1R0EA 2CDZA 4JI9A 3NGAA 3PE2A 2WMXA 4GS6A 5EKOA 3UTOA 4B99A 3KXNA 5AUXA 3R2YA 5E8UA 2JKMA 2PZIA 5B7VA 4QQJA 5EDRA 4R8QA 4ANQA 4BYJA 3PDTA 2UW5A 5H8EA 4EK6A 3IK3A 2X9FA 3O7LB 2C68A 4B8MA 4TKSA 1YWVA 4G9CA 1JKLA 1W83A 5LVOA 4K1BA 2BROA 3R7EA 4E5WA 5E8VA 4HPTE 4MNEB 5F4NA 2VGOA 5CEQA 2O0UA 4AWIA 3C5IA 2HK5A 4APPA 4N70A 2VTSA 3EFJA 2F49A 2JDSA 5M56A 4AW0A 3F82A 3FLWA 3TUDA 3W8LA 4W9WA 5IH5A 2RFEA 1ZYCA 3MIYA 2RF9A 3IOKA 4DYMA 3D15A 4CZTA 3CR0A 4KB8A 3ROYA 4PMSA 3RPSA 2ZYBA 4BCGA 3A7HA 4WRGA 2C6IA 2J0IA 3DJ7A 4BDKA 5DPVA 4KBAA 4ACDA 4XG8A 4DTBA 2HWPA 2J90A 2YLFA 5DR6A 3QYZA 4EOSA 1U5QA 2Q0NA 3GGFA 3KB7A 5E1EA 4BI2A 2UZOA 4I6BA 2BAKA 2BMCA 3CBLA 4BKJA 4EWQA 3PXQA 3L8VA 4L68A 4RQVA 4TWCA 4D2TA 4QP1A 2C5YA 3C50A 2QOLA 3KXGA 2C0IA 2OICA 4U3ZA 4DH3A 4CCBA 2GTNA 4EHEA 4D2WA 1PMEA 3UOJA 4M13A 3DQXA 4I4EA 3SXSA 3MGYA 3U6HA 2WXVA 2XM9A 4IANA 4KINA 5FBNC 4LYNA 4FV2A 3DLZA 4FSQA 5TKDA 3VRZA 4A4XA 4A9SA 4LV8A 3O50A 1H1WA 4AGWA 2NO3A 3NVMB 4HYUA 3ETAA 4QQTA 4AAAA 5C1QB 4QMSA 4BCMA 5F9EA 4IB1A 5C01A 3L9NA 2BAJA 4CMOA 4IAZA 3IQ7A 3NW7A 5LWMA 5A6OA 4CKIA 5KMKA 5CSHA 3O51A 4E5AX 3FMEA 4KRDA 4GEOA 4KKEA 4XOYA 3NUPA 2PUIA 2UW7A 4KABA 3HL7A 4LFIA 3BQCA 2GNHA 3LFNA 4UBAA 4BBFA 3DK6A 4DBNA 1E9HA 4AF3A 4J8NA 2WO6A 3DS6A 1YDSE 5IUIA 2FVDA 4I6FA 1FGKA 2YACA 3F3TA 1NT2A 4ACHA 2EU9A 3AD4A 4J95A 2H9VA 2X6EA 3E8DA 3MVHA 2XNEA 1KSWA 4ZS4A 3CGFA 2ZDTA 3JYAA 5D1JA 3TXOA 2VWWA 4XP2A 3VF9A 5IISA 4BI0A 4FI1A 3KRWA 4RC3A 1H28A 5BUJA 3I60A 5IA3A 5LQFA 3IONA 3H4JA 5F95A 3CY3A 1OPKA 4EOIA 3FMNA 3LQ5A 1WMKA 4RIYB 5B2MA 4IAKA 4L46A 4K2RA 4FTOA 4O0RA 5IQDA 2W0JA 3P78A 5HBEA 2WIHA 1M7NA 1WVWA 3E93A 4FTJA 3PPZA 5EW9A 4FUXA 4PX6A 4C4JA 2Y0AA 4MH7A 5JFXA 1CKPA 5FD2A 4UXQA 5HE1A 3MI9A 4Y8DA 4ASXA 4E4XA 5CAPA 1J7LA 4X3FC 2PVHA 4RQKA 3QF9A 4NYEA 2W1GA 3RM7A 3TZMA 3DDQA 4FBXA 3CY2A 3JPVA 4EH9A 5J79A 4ZLOA 1CTPE 2JAMA 3HV3A 2VGPA 3IS5A 3QRTA 4TNBA 4PL5A 2ITYA 5KO1A 2XS0A 3QC4A 3GVUA 3QTUA 4EH7A 4F6SA 4G5PA 3DBFA 4OT6A 4O7WA 5DVRA 1ZMVA 4DGNA 4HVHA 2YM6A 3FLZA 4QP9A 4AZTA 2C3LA 3AC2A 5C27A 3AC4A 3C51A 4USEA 5EQYA 2BILB 4G3GA 4FNZA 3O0GA 3SKCA 3MH3A 2VTJA 4QMOA 4RJ6A 3SW4A 4ASDA 4TPTA 4CFMA 4JBQA 1MRVA 1OUKA 3BI6A 3HV5A 2PY3A 3NDMA 3ZMMA 5AM7A 5M57A 4NJDA 1OKVA 4G3FA 3F3UA 2ZV7A 4IC7A 4X7QA 4D4YA 4O91A 4CMTA 3I5ZA 3G2FA 3UDBA 1PMUA 1REKA 4RSSA 3FUPA 2GQGA 3R71A 4XBUA 4DINA 5FBOA 3G6HA 3WILA 5A9UA 3LM0A 3C4FA 2XB7A 1S9JA 4FKWA 5GHVA 4BCNA 4QP6A 2W5BA 1QPJA 3G0FA 4ITJA 3DV3A 4BRXA 2JFLA 5IQAA 3EL8A 2VTHA 5EQEA 3MJ1A 1H1RA 4M7IA 2WU7A 2R3IA 4CKRA 3FMJA 5JGBA 4K9YA 2PHKA 4AW1A 2YAKA 3HYHA 5HO7A 4UWBA 5AM6A 5DWRA 4M3QA 3DK7A 5AIRA 3SDJA 1XH9A 5HD4A 5BVDA 2JFMA 3B8RA 3KCFA 5CU2A 2XNGA 4FV7A 4ZK5A 3HP2A 4EOMA 3BLHA 5FDPA 4DEHA 4PMMA 4EK8A 2JITA 3SOAA 3QUEA 3MJ2A 3MY5A 5D9HA 4JBVA 4A07A 4IMYA 4YLKA 2GQSA 2PVJA 4MX9A 2XMYA 4AACA 4CFFA 4DH5A 1Y6BA 4DCAA 1W82A 3KN5A 4WD5A 4XG9A 4C38A 4IM3A 3UNKA 3VUKA 4IVAA 4CMUA 1JQHA 2YM7A 3LFAA 5JGAA 2HZIA 4EHGA 5M44A 3WYYA 4O0WA 2ITUA 3BU3A 5M4UA 2HXQA 2P0CA 4FIHA 3LCSA 1Q5KA 4TTHB 3KULB 4S31A 4CT2A 4TN6A 4MWIA 2WQOA 4UMQA 2BRGA 3U9CA 4DFNA 4UMTA 5HVYA 3QTSA 3PIYA 2J7TA 3IW5A 5IQEA 2A4LA 2DUVA 2IWIA 4RJ7A 4C37A 5CAQA 3L1SA 4KAOA 4DFZE 4CRLA 3UMWA 3BE2A 5FGKA 3LXKA 3UODA 5IEYA 5DEYA 4ORKA 3RAHA 5KBQA 3NUXA 3NW5A 3UVPA 4L7SA 4BDIA 4C2WA 4ENXA 3SXFA 4IH8A 3ZFYA 4D2SA 3QRJA 3KA0A 3FMHA 3PP1A 4IE9A 4XCUA 3R2BA 3LIJA 2QOCA 2C47A 3KF4A 4RVKA 5AP4A 3TWJA 3UIXA 4F63A 4KIQA 4W4XA 4CYIA 1Z5MA 4QTAA 3LE6A 4ZTNA 3RKBA 3CTQA 4U81A 4Q5HA 4LGGA 4Q2AA 4M67A 3DKFA 4XEYA 2VZ6A 1GNGA 4NJ3A 3R7IA 2UZEA 2XKDA 1PXMA 3V8SA 1ZWSA 4B0GA 3LQ3A 2WOUA 2R64A 3IW8A 4MHAA 4XP3A 2HY81 2OXDA 1HCLA 2WTJA 4O82A 3AQVA 5AV4A 3RWPA 2VWZA 3L8XA 4GH2A 5FEDA 5AP6A 1ND4A 4YHFA 3VBTA 3VUDA 3ZFMA 2WTKB 3ORKA 4YPDA 3BKBA 5I0BA 2WFYA 4QT1A 3EOCA 4QPSA 2HY0A 2VTAA 2ZV9A 3RAWA 5KZIA 2GCDA 1Y57A 3F66A 4K33A 4G34A 2XK9A 3F5GA 2C4GA 3BGPA 1JKSA 2JIUA 1FVRA 2F2UA 4RX9A 1U5RA 5CT0A 4EUTA 3EIDA 4CFWA 3ZOSA 4N0SA 4MKCA 1AQ1A 4P5QA 3WYXA 3R28A 4QMPA 1OPJA 1DAYA 4IWDA 5KKRB 3E87A 3MBLA 2OO8X 5KMLA 3DZOA 1BUHA 3FBVA 4FL3A 3BV2A 2HIWA 4OTWA 4FT3A 2W4OA 5J9YA 5K4JA 5GIPE 1LEZA 4FNWA 2BALA 3O8PA 4E6DA 1DS5A 4F09A 4MD9E 3CSVA 2ITZA 5AP1A 2WTWA 5A3XA 4BKYA 3JS2A 1Q24A 2A0CX 2C6TA 3QZIA 3MESA 3PXKA 4QMQA 1YDTE 4GVJA 4GW8A 4EC9A 1Q99A 2VTLA 4C02A 2DQ7X 3PY3A 2F4JA 2QOOA 3ORLA 5CSVA 3MFRA 2Y8OA 2CKOA 2YERA 3RAIA 4F0GA 3UYSA 3PTGA 4I41A 3EYHA 4RFMA 1OKYA 4CV9A 1OIRA 3FKOA 3NR9A 5M08A 3VBXA 2BPMA 3QCXA 1J3HA 1MP8A 2UW3A 4RIWA 5EKNA 5BPYA 4ZSLA 3CE3A 1G3NA 4ZSGA 3ZDIA 4IWQA 2E9VA 1SYKA 4QMLA 4GK3A 2KULA 2XJ2A 3GC9A 4V01A 4ERWA 4GCJA 4FL1A 4FSZA 2RGPA 3KRJA 4MXYA 5EYCA 5HGIA 5EHYA 3V01A 3QAME 4O7RA 1YDRE 4F99A 2GMXA 3VUIA 1WVYA 3QC9A 4BWXA 3GT8A 5KMIA 5CF4A 3UGCA 3FYKX 4ASEA 4ARKA 1ZZLA 2W5HA 2ZJWA 3EN5A 3GNIB 3NNUA 4NM3A 4EOPA 3MVJA 5J7BA 3W2SA 4FKPA 3CQWA 3QTQA 2Z02A 2X4ZA 5G1XA 1Q41A 5K4IA 5CAVA 2YDKA 2VX1A 3GU7A 3GCVA 4J71A 2WOTA 3E8NA 3P4KA 2QURA 1B38A 5DFPA 1OL1A 3B8QA 3DXNA 3O8TA 1HCKA 2HW6A 4YZDA 3FJQE 4B8LA 4DHFA 3ALOA 4HZRA 3RALA 1H26A 4NH1A 1H4LA 3QTIA 5H3QA 3T3VA 2XEZA 4P2KA 3ATSA 1YI6A 4ALVA 1O9UA 3FSKA 3UIUA 5I9XA 5M55A 2Q0BA 3H10A 4O84A 3JVSA 2XJ1A 5CNOA 4C0TA 3DZQA 1OB3A 4CEGA 5FUTA 2ITWA 2J0LA 4IZAA 3FZOA 4O2PA 3VVHA 5CASA 2QHMA 1Z57A 3FXZA 3DKOA 5TT7A 5ACKA 1PKGA 1UVRA 4O0SA 2XBJA 5GIOE 3D83A 2ERKA 2VUWA 2C30A 3R22A 3L9PA 4AZEA 1QPEA 1PYXA 3FPQA 4C62A 3D2IA 5LVNA 4RA5A 3S4QA 4JLCA 4FG9A 4C4HA 3DT1A 2B9HA 4F7NA 5EW8A 4QD6A 2QOIA 1M2RA 5J5TA 1PXLA 2PTKA 4I3ZA 3V5WA 4FICA 2VTOA 4R5YA 3C4XA 2BFYA 3LAUA 2QC6A 4TWNA 3FY0A 4DH7A 1Q97A 2XK6A 4XV9A 4ZJIA 3VS4A 5D41A 4FV0A 5AUWA 5L6OA 5LVPA 2VN9A 4YUQA 3AD6A 4XLIA 4WRSA 2FUMA 1CDKA 3FMKA 4ANBA 4C59A 1OBDA 1A9UA 1KE5A 2CGVA 2QKRA 2ITOA 3C5UA 3F5PA 4I1ZA 4EHZA 3IDPA 4FIIA 3HLLA 5FTQA 4JQEA 4HGEA 4FL2A 3ZC5A 3A99A 5DT0A 5JQ5A 3V5QA 1F3MC 5CVGA 3V5TA 4ZAUA 4PQNA 3MYGA 3OFMA 5ACBC 3D5VA 4G5JA 4TRLA 5I9UA 5AEPA 2FSMX 1XBBA 5HIEA 3ZEWA 1K3AA 4AT5A 4BZOA 1YXTA 4YTCA 5JT2A 1Q8ZA 5L3AA 4F0IA 3LCDA 3NLBA 3ENMA 2WQEA 3W16A 1JSUA 3IO7A 4IC8A 4JQ8A 4QYEA 5CQWA 2ZB0A 3VUGA 2WZJA 2FSOX 3DNEA 4OTQA 4EC8A 5J7HA 5J5SA 5EQPA 3P7CA 2PVMA 4YHJA 4LRMA 4X3FB 3UQFA 3N4VA 4BCIA 5B2LA 4RJ8A 3W2CA 3CKXA 4EI4A 5AV2A 4AFEA 3I0OA 1OIUA 4EK3A 1IEPA 5FQDC 1SZMA 2YIRA 3FLQA 4WT6A 2Z60A 5AX3A 3UP2A 4D4VA 4TYIA 4BY9E 3WZJA 5E91A 3KKVA 3RPYA 4ID7A 3D9VA 4RFYA 3B2WA 2XNOA 4D2PA 1GZ8A 2VTMA 3GC8A 3C4WA 2VO6A 4ZY6A 4IHPA 5DRDA 3R00A 4QTBA 5K5XA 3LW0A 3R9RA 1H0WA 1QPCA 5AUVA 5BNJA 3BBWA 3TM0A 1B6CB 3EYGA 3V8TA 5JZNA 2JD5A 1VEBA 2R0IA 4IWOA 2UUEA 2BRNA 3R9OA 4OAVB 5AP2A 2IVUA 2WMUA 3FLNC 4PPAA 4GFGA 2JIIA 1FQ1B 4KIKB 4PP9A 2G2HA 4H1JA 3ACJA 2ZMCA 4YTHA 4D4RA 4ENYA 3NYOA 1UU9A 1W8CA 2JDOA 2RIOA 3QQJA 2NP8A 1V0PA 5K3YA 5CI7A 4PDPA 4XNEA 3LOKA 3DXQA 3V51A 1H08A 1OECA 3LXNA 3BU6A 3OY3A 3K54A 3OEFX 3ZBXA 2BRMA 4WUAA 2X4FA 3NCGA 3PWYA 1H24A 4FZ7A 1VZOA 4HNIA 3GOKA 3VW8A 4EUUA 5HTBA 3FE3A 3BHYA 5EG3A 2J5EA 4DGGA 1S9IA 3VUHA 3SVVA 1JKKA 3TIYA 3GU8A 5M07A 3QA0A 4MYGA 1Q8UA 2QLUA 4XH6A 2PVFA 3RJCA 4Z3VA 2XM8A 5EHOA 4BDHA 2C6MA 3RP9A 2V7AA 4FKLA 3TUCA 3U4UA 4KIKA 4L42A 4QOXA 2WTCA 4HGSA 1KE7A 3LXLA 3PG3A 5J9LA 3PY0A 3W8QA 3A8XA 3FEGA 3AMAA 3UZTA 3U54A 4EH4A 3F2RA 4LM5A 3FC2A 1X8BA 3ZSGA 2JBOA 4L43A 3NNVA 3L8PA 5E8YA 3PY1A 4FTKA 3DK3A 5DT3A 5I3OA 3ZO1A 4TYHB 3FL5A 4GG5A 4CZYB 2RFNA 4EYMA 2CSNA 2UZBA 3EL7A 4WOVA 5L8JA 4I4FA 4OBOA 4UB7A 5L2IA 4F9WA 4U80A 4D1ZA 2RSVA 4FKTA 3FPMA 1J1CA 1SVEA 2B54A 4FV4A 5AR5A 1KWPA 3FI8A 5EK7A 2WMTA 5CXZA 3U6JA 4M68A 2W06A 4IM0A 4W8DA 4Y85A 1OIYA 3NYNA 4Y83A 3L9LA 3O71A 3I6UA 4IW0A 4F65A 5EI6A 3TNHA 1Y91A 1WVXA 2XK3A 5E7RA 4CSVA 2ITVA 4RX7A 3R8UA 4EL9A 3DPKA 4IZ5A 5LWNA 3BWJA 3F7ZA 4DLJA 4AFJA 2C5VA 4E20A 4LG4A 5GNKA 5JEBA 4FV5A 3R9DA 1UU8A 2X9EA 5C4LA 3FQHA 2Y9QA 4BDFA 2PUUA 4FKSA 5FG8A 4DN5A 3W33A 4GVAA 3KCKA 2VX3A 3OOMA 4RVLA 4AOJA 5FTOA 3RBWA 4YBKA 2C5NA 2YFXA 4MBLA 4K8AA 4WIHA 5LCKA 4BKZA 3OS3A 4BL1A 2J0JA 4JIAA 5IQIA 2XNBA 3QQGA 5EM7A 5EM6A 4DBXA 3OWPA 2XK8A 4C3RA 3RCDA 4RJ5A 3PA4A 5EYKA 4FEVA 2BRBA 4QMMA 3FZRA 5HD7A 2CJMA 4Y5QA 3IW7A 4MVFA 1SM2A 3HKOA 2PZ5A 4IB3A 4QYFA 2F7ZE 3WI6A 4UZHA 1XH8A 1MQBA 4K11A 4DAWA 4RZVA 4RX8A 1UU7A 4ZZMA 3RAKA 4E6QA 4RC2A 5LVMA 2WELA 3C4EA 4OLIA 5FDXA 3PP0A 5L2WA 1YRPA 3JR1A 4I24A 1STCE 2FYSA 2GS2A 3R21A 4YGAA 3F7WA 3P7AA 1UV5A 1UWJA 3PFQA 5LARA 4XRLA 4OTIA 3ZRKA 5HLPA 5BX0A 2BCJA 2BZIB 4BIBA 1M2PA 5EH0A 2GHLA 3F5XA 5IG1A 3CGOA 2H96A 5HIBA 3P5KA 3E92A 3ULIA 4JVGA 1H1PA 3AMBA 4YHTA 4PY1A 4PTGA 4H3BA 1TQPA 3ZLSA 1PXNA 3R1SA 1ATPE 3QHRA 4NCTA 3ROCA 5HBJA 4IX3A 1WBSA 5HOAA 4D9TA 3CP9A 4E7WA 3NIZA 5IF1A 3P79A 3QXOA 2PVYA 2VRXA 4L3LA 3PXZA 5C8KA 2BKKA 5EDQA 4GKIA 3Q04A 4IVCA 4ASZA 2A1AB 5L6WL 5KE0A 4LOOA 1IA9A 3TL8A 3FYJX 3Q53A 4K18A 4XG4A 3OD6X 3I79A 3KK9A 4L44A 3G0EA 4RIXB 2XZSA 4L6QA 5IEXA 5KMMA 4RIYA 5D11A 5KKRC 4CG9A 3QA8A 2PVNA 2O3PA 4WO5A 2R2PA 1NVQA 3CCNA 3QZHA 2XCKA 1E1VA 4LL0A 4DEBA 4KRCA 4BZDA 2H8HA 1KUTA 4KSQA 5DGZA 3OY1A 3TV7A 4CZUA 3HX4A 4QTDA 3WF9A 4ACCA 4BGHA 4MD8E 3QTRA 3OW3A 4FVQA 1QPDA 1CSNA 2WMAA 1RDQE 2XRWA 2WTKC 3QUPA 2R3RA 4RJ4A 4YZMA 2CMWA 5HO8A 3WZKA 3IKAA 4C36A 2ZDUA 4MQ2A 2CGWA 4V0GB 2Y4IB 3QTWA 4BYIA 4ZJVA 4R3RA 4LMNA 5IH6A 3LCKA 3LJ2A 1UKHA 4RMZA 4M8TA 2LAVA 5A4LA 1WFCA 2V5QA 2OZAB 3COMA 3ORNA 3VBVA 4PP7A 2XH5A 5FP6A 2R3MA 4ZLZA 3R6XA 4HGLA 1BI7A 4JX3A 4MNEA 4O1PA 3PSDA 3RZFA 2PMOX 3R7GA 5AV3A 2R3NA 2W5AA 4GSBA 2FGIA 2J9MA 3C13A 5HEZA 4AXAA 3COKA 4RWJA 3UO4A 5DN3A 5CVFA 5FXQA 4Q9SA 4LI5A 4ACMA 2LGCA 4AU8A 2J50A 2OZOA 1P2AA 3GEQA 5BUEA 4GG7A 4BDGA 3ZU7A 4EOJA 4EQMA 3KGAA 4GT4A 4L3PA 4YNOA 5HCZA 2RG6A 3NEWA 4LL5A 5CZHA 3ATTA 2HZ4A 1KOBA 3SD0A 4C7TA 2I0HA 2W1EA 4I5PA 4X2FA 3PPJA 5CT7A 5EOBA 4HJOA 5A4EA 3VIDA 4FUYA 4D55A 2E9UA 2PSQA 3GCPA 4EH5A 3AC5A 5HTIA 3MH1A 4K77A 4HCUA 3DB6A 4O7NA 2YZLA 3MB6A 3RNYA 3FKNA 2EWAA 4EYJA 1IRKA 4BDCA 3VS6A 3H9RA 4ZZNA 4CXAA 4DE4A 2UVXA 3JVRA 2OKRA 3UG2A 3NVKI 2XF0A 5AP7A 4P4CA 1WBPA 1P4OA 2W99B 3O23A 3OEZA 4GMYA 5CAOA 2YN8A 2VO7A 2QOKA 2QQ7A 4EZ5A 3FZPA 5FXRA 5HVKA 3BLRA 3KK8A 4FIJA 4MXCA 4I93A 2CCHA 1W98A 2QR8A 4QP3A 3UQGA 1FVVA 3GC7A 5HLWA 5IQHA 4YSJA 3F61A 2GQRA 4KWPA 5A4TA 3PWDA 3U51A 5CAUA 2UVZA 5ANEA 3UOLA 3RPRA 3OZ6A 3P9JA 3W2QA 4JG8A 5IA4A 5HO6A 3HRBA 4DITA 3NSZA 2W96B 4F7JA 1WAKA 2UW6A 3KMWA 2EB3A 5AAGA 5EM8A 3SOCA 2YM8A 2A2AA 3KULA 5HBHA 5L8LA 4DT9A 3QZGA 2HELA 2VU3A 3OOGA 4YPSA 4AA0A 5L2SA 4S32A 4I0TA 3LPBA 4EOOA 4YBJA 2OZAA 3MFTA 4CT1A 1YQJA 3OC1A 4HYSA 5DT4A 3EQHA 1H01A 4ANLA 4E1ZA 2IZRA 2XK7A 3IDBA 4CD0A 1BMKA 1R78A 1GY3A 4X2GA 4ZTSA 5T6KA 1ZY5A 4HYHA 2BFXA 4WSYA 3U4WA 1KV2A 5J87A 2W05A 1OMWA 1ZYSA 3DFCB 4YO6A 2ZOQA 3VS1A 3ZLWA 4OGRA 3BHTA 3ZXZA 2IZSA 2RKUA 3TT0A 4CQEA 4ZEGA 5DOSA 3NUYA 4IBMA 5IQFA 2G01A 1OGUA 4PNIA 2IW6A 3F5UA 1ZARA 2H6DA 2X7OA 3DBEA 5T68A 2OJGA 2OH4A 3MN3A 3FXXA 5IDNA 4G16A 4FKVA 3UNJA 4FSMA 3FSFA 4LOPA 4C8BA 3TV6A 1O6YA 2OXXA 2I7QA 3BGQA 3BWFA 4ZTRA 5E8TA 5BVFA 5DNRA 4H05A 1SMHA 1FPUA 3HMNA 4GK4A 3FZ1A 3QKLA 4ZMFA 5JRSA 3ENHA 4ACGA 3A4OX 3R73A 2X7FA 4ALWA 3HAVA 4IX4A 3WOWA 1PKDA 4QYGA 4TZRA 2ZMDA 2QR7A 4B6LA 5HTCA 5ETFA 4F7SA 2YM4A 1V0OA 4IX5A 4WUNA 4MQ1A 5JSMA 2B9JA 5CEIA 2QODA 4CFUA 2B53A 2BDJA 2WTDA 4BVUA 4CGAA 2NPQA 4EH8A 3UZRA 3VJNA 4CFVA 1OZ1A 3HV7A 3NCZA 3UNZA 2BUJA 2X7GA 1XH6A 3LZBA 3TDWA 4GV1A 1IG1A 3C7QA 3UC3A 3UOKA 5JMSA 2G2FA 3ZUTA 2WAJA 3AGMA 3GU6A 3I4BA 4BDBA 1GIIA 3TCPA 1RE8A 5E92A 3ZDUA 4DCEA 2OK1A 3DBCA 2WNTA 3EQRA 4QQ5A 4Z7HA 3RNIA 4A9TA 2FSTX 1SNXA 2OJFE 2QO7A 5ICPA 2X1NA 3ZZEA 1MRYA 3DJ6A 4P7EA 3Q3BA 2E2BA 5BQ0A 2X81A 1QMZA 2PYWA 3KREA 2VX0A 5AV0A 4AE9A 5CF5A 3Q4CA 3E88A 4DF3A 3GQLA 2YIWA 4PUZA 3ZXTA 4ANMA 4O6LA 2W17A 3MSSA 4J53A 2CKQA 3BQRA 4E5BA 4NM7A 4N4SA 4DEEA 2BRHA 3HA6A 3F6XA 3QCQA 2IN6A 4MXZA 1WBOA 2BZKB 3BIZA 2BZJA 4CLJA 5HG7A 1J1BA 1QL6A 2CN8A 3S2PA 4CV8A 1YOJA 2VTQA 2WEIA 2YISA 3E5AA 4AZSA 5KMOA 5FRIA 3UVRA 2IG7A 3OW4A 4NFMA 2BDFA 2BHHA 2QNJA 2UZDA 4YLLA 5GZ8A 5I9VA 4I22A 2ITQA 2UW9A 3I7CA 3V3VA 3KRRA 4XP0A 5CENA 3ET7A 1PXPA 2VTIA 5AV1A 1RQQA 4AN9A 4FV8A 3LFEA 1NXKA 2X0GA 1OITA 4GYIA 5CEOA 2Z7SA 4WNMA 3TNWA 3KC3A 4D28A 3FQSA 4QMUA 1EH4A 2XA4A 4FV3A 4FTIA 3FLSA 5BMMA 2UW4A 2FH9A 3S1HA 4EK5A 4YP8A 5DE2A 1PF8A 2DWBA 2QU6A 5HCYA 2R9SA 3R9NA 3TTIA 4OAUC 1KE8A 4GJ3A 1BLXA 1ZXEA 2QHNA 4RPVA 4TYGA 4A7CA 1PW2A 3CD8A 3PVGA 3UOHA 4I5MA 4TYEA 4A9RA 3DAJA 3C0IA 4HPUE 5AFVA 3E7VA 4O21A 3MW1A 3ULZA 4FSRA 2NNWB 5ETCA 1TKIA 4IX6A 5GJFA 3JUHA 4AS0A 5JGDA 1IAJA 2EVAA 3I81A 3UBDA 1H07A 5F1ZA 5ETAA 4KKHA 5AA8A 2WEVA 5E4HA 3HZTA 3ITZA 2YA9A 1ZMUA 2VWUA 5CS6A 2ITNA 2VWIA 5LCJA 3G90X 2YIXA 2C3IB 3LCTA 4HGTA 4KNBA 3SW7A 5HX6A 3ODYX 3DOGA 4U41A 4P90A 4ZOGA 1PJKA 1VYWA 5L2QA 3WF5A 3LKMA 4L9IA 3H9OA 2IPXA 3D5UA 3QQUA 4FR4A 4M12A 2GS7A 4S33A 4XG2A 3ZC6A 4R78A 3F88A 5KUPA 3TG1A 5A4QA 4PMTA 2X8IA 4AGCA 1PMNA 3BYMA 3EFKA 4RG0A 5CU3A 3R9HA 1BL6A 3ZS5A 4CG8A 4ZSJA 3D7TA 2UZWE 4GUEA 3CPCA 3QKKA 3V04A 4I92A 2WMQA 3FHIA 3QX4A 4MBJA 2QKWB 5DRBA 3QUDA 3TUBA 3QTXA 2C5XA 3LFDA 4O1OA 4MXXA 4QMYA 4V04A 4C61A 1BX6A 4I94A 3LHJA 1XH5A 1ZRZA 3QFVA 1WBNA 2WHBA 4J7BA 3NX8A 4E4NA 5JK3A 5E9EA 1NVRA 2XIXA 3VBQA 4R3PA 1LR4A 4RJ3A 4YC8A 4CCUA 3ZBFA 3FMMA 5JRQA 4AA5A 3Q9YA 1ZYLA 3PZHA 3Q32A 4NTTA 3NPCA 3EWHA 4NFNA 5CF6A 4I6QA 3W18A 4EJNA 2YABA 3R63A 4U40A 4BDJA 5CYIA 2EXCX 2BZHB 3UVQA 4AX8A 5L8KA 5EI2A 4WNPA 3HNGA 3WE4A 3QRIA 1UKIA 4JXFA 1UNHA 5CSXA 3RK9A 3ZLXA 4C4EA 3S00A 2OU7A 4IVDA 2IO6A 3NRMA 4M84A 1FGIA 3GENA 4M14A 4ZMEA 2J4ZA 2PWLA 1UA2A 2FA2A 3PIXA 2RG5A 4O0XA 4TNDA 4DTAA 2JDVA 4PWNA 4DGLC 3MVLA 5EYMA 4O27B 3UP7A 3FDNA 2XKFA 4IB5A 3MH2A 2A27A 2P2IA 2WGJA 5LMAA 3R8PA 5IMXA 2OJIA 1T45A 3LMIA 4JAJA 3W1FA 3Q4ZA 3IGGA 1DI8A 4QRCA 1VYZA 4F70A 4DG3E 4L01A 4JRNA 2PMIA 3QQFA 4NW6A 4BWKA 4BDEA 5JFVA 4ITHA 3GFEA 3Q5ZA 5CSPA 1FOTA 1IA8A 3KU2A 5KX8A 2QU5A 4D2RA 4BCKA 3FMLA 3OVVA 1ZOGA 1SVGA 4KIPA 4BICA 3W32A 4CKJA 2CKPA 4EHVA 1TVOA 3JY0A 3TDVA 4XRJA 2XJ0A 3TNPC 4O7VA 4AN2A 5EDPA 3COHA 3D4QA 4H36A 4KBKA 3FKLA 5AIKA 3MPAA 2G2IA 3WIGA 1JSTA 1PXOA 3KF7A 1F0QA 3R7VA 2EXEA 3TZ7A 4EQUA 2OFVA 3QCSA 1R3CA 3DTWA 4FZ6A 3VBYA 2PMNX 1ZMWA 1OI9A 3C9WA 3HV6A 2I0YA 4JT3A 2XKEA 2P33A 2R4BA 4XX9A 2QOQA 3AT2A 3OWLA 2VWBA 3AMYA 5IA5A 2EXMA 3CQUA 3IOPA 4D58A 4I0SA 4F6WA 4L67A 4ZIMA 2XK4A 2UZTA 4UN0C 2QLQA 3Q60A 1LP4A 5C8NA 3A8WA 3PA3A 3V6SA 2WQBA 4X0MA 4XG6A 4KKGA 4RIOA 1BI8A 4RWLA 2ITTA 4USDA 4YC6A 1PXJA 4H1MA 5HHWA 2OBJA 1T46A 2IVTA 1RJBA 4JG6A 4BDDA 3ELJA 3KVWA 4M97A 1M17A 2R7BA 2BIYA 3FL4A 2GNJA 4YJRA 5A4CA 4F4PA 4EKKA 5HIDA 2PZPA 4XJ0A 3R04A 5CZIA 4FK6A 2EUFB 1CMKE 1V0BA 2XIRA 1ZZ2A 5FM2A 3LXPA 3PA5A 5AADA 3THBA 5CI6A 3JXWA 2UW8A 4FKJA 4BTFA 3R0TA 4O0TA 3VWAA 2WMRA 1LEWA 3PJ1A 3CTJA 4DFYA 3AXWA 5E90A 5JZJA 5ANGA 3FQEA 4U79A 3F2AA 3TI1A 2C1AA 2UZVA 3OTVA 4K6ZA 4X2KA 2X8EA 1UNLA 3PVBA 4AW5A 2C6EA 2UZNA 4AE6A 3C0GA 3EZRA 3ORTA 2VTTA 4R5SA 3LFFA 5AX9A 4RRVA 4CLIA 4ERKA 3E8EA 4FKUA 3REPA 5BUIA 3I6WA 2OH0E 5BYLA 5TOZA 2Z7RA 4OBQA 2R7IA 2V55A 3RZBA 5E8SA 4AZVA 3EQFA 2E9OA 1W7HA 4HCTA 2C0OA 4EZ7A 2V62A 3KRLA 3PG1A 5J8IA 4C57A 4IM2A 4CTCA 1KE9A 2GHMA 4YZNA 4ITIA 2ZM3A 3IG7A 3OROA 2XNMA 2GS6A 3E8CA 4WKQA 4ZSEA 1I09A 2YM5A 3GC0A 4LUDA 3DU8A 3V5PA 3QGWA 5D12A 1RW8A 4O7YA 3CS9A 3CD3A 4YJNA 1XH4A 3OCTA 5EW3A 4FSNA 4OR5A 1F5QA 4UYAA 2PE2A 4FSWA 4FOBA 1XBCA 5CVHA 3WIKA 5AR7A 3RHXA 5CU4A 3QQKA 4O22A 4FG7A 3ZO2A 5BVEA 3DQWA 4ZTLA 3BYVA 3A7GA 4JR3A 4UEUA 2O2UA 4FV1A 4O7SA 4U42A 1ZOEA 3OF0A 3VQHA 2WD1A 5C8MA 1ZOHA 2YCFA 3D0EA 1H27A 3RCJA 2W9FB 4PL3A 4R7IA 4A4OA 5BYZA 2BVAA 3EQCA 3DFAA 4BDAA 5AUUA 5IA2A 2ZV2A 4U9AA 3P23A 3N4UA 1XJDA 4IFGA 4GYGA 4XG3A 1H1SA 3R7OA 2VO0A 4EJ7A 1O6KA 4CTBA 5ETIA 1H8FA 2P3GX 5LMBA 3FC1X 5CXHA 3VRYA 1UWHA 2WMWA 3GBZA 3QLGA 3RPVA 2JKOA 1U59A 3EFLA 4IZ7A 5K0XA 4PPCA 5AAEA 4MF1A 4EKLA 1ZYJA 3HMPA 4W8EA 2J0MB 3MPMA 2JLDA 2Y4IC 5CNNA 3CJGA 3VUTA 4E3CA 3V5LA 2ETKA 3UMXA 4JG7A 5HU9A 5F94A 1GAGA 1JBPE 5I5ZA 1PMVA 3A7IA 2PUPA 4XV2A 5C4KA 4GJ2A 4D9UA 3P7BA 4O86A 4JDKA 2OFUA 3SQQA 4KS8A 1J7IA 4Z55A 2Y7JA 1PXIA 3SLSA 4BB4A 1JKTA 2QOFA 4FTRA 2YCSA 3NZ0A 3QD0A 4LRKA 1PRYA 2IZUA 4AP7A 5AJQA 2Z7QA 3QZFA 5CY3A 2YITA 5K5NA 3IW6A 5DR9A 2JDTA 3POZA 5H8GA 1DI9A 3UG1A 4G6LA 2YWVA 4C4GA 1M2QA 4OUCA 3U8WA 2ZAZA 3FY2A 4C4FA 4OTRA 4R3CA 3TNQB 2OJJA 4PRJA 4BZNA 3VS0A 4C33A 5HCXA 2QVSE 3QD4A 4JAIA 4YJOA 4QMXA 4D5KA 4NT4A 1PHKA 3B2TA 2YM3A 3E7OA 4NWMA 4EONA 4FOCA 2YWPA 4U6RA 5K9IA 5AAFA 2WPAA 4JDIA 2FO0A 4WHZA 4YLJA 5L2TA 3Q4TA 4IZYA 5ITAA 1M52A 4F9AA 3IPHA 3SHEA 2XBAA 3W2RA 3ZEPA 4DEGA 1Q62A 3LVPA 4CNHA 3KXXA 3MIAA 1TQIA 5M53A 1LPUA 3MA6A 4WG3A 2B9IA 4XUFA 4JX7A 3QKMA 5HU3A 4OTGA 1I44A 3BCEA 4DEDA 2OF2A 1XBAA 4UYNA 5HICA 2WB8A 2I40A 3A60A 3RI1A 2UZUE 5ANKA 5H9BA 4F9BA 4H39A 5DA3A 1P5EA 4H3PA 4YJSA 4GU9A 5JFWA 2YCRA 1YKRA 2AC5A 1REJA 3KVXA 4FV9A 3PUPA 3OCSA 4DFUA 2XKCA 3VS5A 3I1AA 5FWKK 3BE9A 3EN4A 5FM3A 4H3QA 4AA4A 4JQ7A 3G9LX 3QWKA 5HZNA 4BBEA 2YAAA 4RT7A 1H25A 4C2VA 2OW3A 1WBTA 2B9FA 3VS2A 4ZXTA 1A06A 3P08A 2WKMA 3W55A 4ZLYA 4F9CA 4DT8A 3NYVA 4KIOA 4K0YA 5E8XA 2G15A 3AT4A 3R02A 1NW1A 3NUNA 3PPKA 2XUUA 2W9ZB 5A46A 3VULA 4O0UA 4Z9LA 4E8AA 4TYHA 3ZHPC 1YW2A 3FAAA 1JLUE 4F0FA 2R3QA 4GIIA 3F3VA 4DGMA 5DHJA 3A4PA 1FMKA 3EH9A 1OKWA 5JQ8A 3AD5A 2BKZA 3QQHA 3ID6C 4N6YA 2C0TA 2G9XA 5HE3A 5CLPA 2YHVA 3DBQA 3SRVA 4HVDA 4ZSAA 2W1ZA 4GT3A 5EOLA 4LV5A 1R39A 5AR3A 1L8TA 3FLYA 3Q9ZA 4N6ZA 3HA8A 3KY2A 2R3PA 3BBTB 4S34A 4UMUA 5CEMA 1M14A 4TT7A 2C6OA 3AG9A 3H0ZA 4BCPA 3KXMA 3HGKA 3GB2A 4DFLA 3DTCA 2I0EA 4HZSA 2E9NA 4TYJA 3VO3A 4BF2A 3Q6UA 1URWA 4YTIA 3ORIA 3UPXA 3UZPA 2VD5A 4R7HA 3A7JA 3FMDA 2GNIA 5DBXA 3O17A 4RFZA 4OTFA 3TIZA 3EB0A 4JDHA 3OCBA 4IAYA 3QRUA 4DH1A 4R77A 4WA9A 4BGQA 3GOPA 4PMPA 3FZSA 1GZNA 4F1OA 3QGYA 2CGUA 3HEGA 4ANNA 3CLYA 3BYSA 5M4CA 4GT5A 3EKNA 4DG2E 4FTNA 1MRUA 3PIZA 2WMVA 3UJGA 3PXFA 4YC3A 2XNNA 1Q8YA 3IDCA 2ETMA 1OM1A 1IASA 2CHLA 3BEGA 2OIQA 3DLSA 2R3GA 3VNTA 3F3WA 5IPJA 3VAPA 4FA2A 4ZTMA 2OWBA 4HW7A 3ZLYA 3W2PA 4QYYA 4EH2A 2IJMA 4NM0A 2JEDA 3Q52A 3WARA 4G3EA 1OL6A 3COIA 3O8UA 4CFNA 5HQ0A 5I4NA 3Q4UA 3OT8A 1OKZA 3D5WA 4J52A 1KE6A 4E4LA 3LM5A 4Z16A 1IAHA 1UNGA 4A9UA 3OG7A 5HNBA 2I6LA 4QQCA 3UIMA 3FI4A 3NW6A 3VHKA 4KD1A 2VO3A 4EOKA 1QCFA 4IQ6A 3NUAA 3EJ1A 2HOGA 5EI8A 4BBMA 5KHWA 3R1NA 4UX9A 4B7TA 5E8ZA 2HAKA 4U3YA 4EQCA 4MEDA 3ZFXA 3OXTA 2JGZA 2IW8A 5F20A 2ZM1A 4GUBA 1Q8TA 3EN9A 3OWKA 4B4LA 2V22A 2VV9A 3FI2A 3EN7A 1XWSA 4Y72A 4FZDB 4X2JA 4C35A 3EQDA 5D7AA 5C26A 5C9CA 1GIJA 5ANDA 3R8VA 2YJSA 3PVUA 4BFMA 2HZ0A 4RIXA 5J95A 4J96A 2OGVA 4WNOA 3T9TA 4FKQA 4G6NA 4IVBA 4U0IA 2FSLX 3K5UA 3MV5A 4C4IA 2W1HA 3DAKA 2ZVAA 3EHAA 3OT3A 4W4YA 4LQMA 4E4MA 4QMZA 3PJCA 5FLFA 2X8DA 3PZEA 4JBOA 4YR8A 1YXVA 3PE1A 4IDVA 4YZ9A 5HE2A 4IWPA 4I6HA 3K2LA 3GXLA 3AC8A 1FVTA 3WF6A 2HW7A 1PY5A 1Y8GA 1W84A 3OXIA 3ALNA 4LRJA 5HG8A 4Q5EA 4NIFB 5I9WA 2W1IA 3CEKA 3WZEA 3EZVA 5BVWA 4JS8A 3R7UA 4AOIA 3VJOA 1Q4LA 3P86A 1H0VA 2GTMA 3CKWA 5DR2A 2W7XA 3AC1A 4HVSA 3BV3A 2J2IB 1K9AA 4E26A 3E64A 4RC4A 5AUYA 4MAOA 4IACA 4CYJA 3WE8A 3D14A 5E1SA 1E1XA 2A19B 4NUSA 2QG5A 3GFWA 3R83A 1OVEA 3AC3A 4YJVA 2C6KA 2GPHA 3U9NA 3DCVA 4MF0A 4HNFA 1SVHA 1XKKA 2OSCA 3DGKA 4BCOA 4FNYA 4QMVA 1PXKA 3M11A 4MXAA 2QO9A 4BCHA 5A14A 5IQBA 4NCTC 1URCA 4G3CA 4D4SA 2Y6OA 2PL0A 3LFCA 2VWXA 2DS1A 3ZYAA 4BGGA 3MWUA 2DYLA 3NWWA 4DH8A 5H8BA 4FKRA 2YDJA 3Q5IA 4G1WA 1VR2A 4H58A 5BVNA 4J98A 3MY0A 3FV8A 3R30A 3ZSIA 2QONA 2WQMA 2QI8A 1L3RE 2UV2A 4XOZA 4O96A 3KMUA 4FT0A 4RIWB 4F08A 5M06A 3AT3A 4FC0A 2R5TA 1YOLA 3Q6WA 4MXOA 4QP7A 4RLKA 3RPOA 4QP2A 5FTGA 5IDPA 3NAXA 4C34A 3G33A 4E6CA 3SGCA 3BU5A 4I5CA 3MFSA 4UALA 4XV3A 3QCYA 2ERZE 3SV0A 5KNJA 1YI3A 4IADA 3HUBA 5TF9A 5AUZA 4U45A 2F57A 1NVSA 2OIDA 4G9RA 1G8SA 3ZUVA 3ZSHA 3EKKA 3OP5A 4JDJA 4KS7A 1KOAA 4LGHA 3KMMA 3PYYA 3KXHA 4CQGA 5BVKA 2W4KA 2VWVA 3UO6A 4ANOA 2GDOA 3FXWA 3UQCA 5DH3A 5KZ0A 3FWQA 2EB2A 3R1YA 4YJPA 5BMSA 2YZAA 5FEEA 4FSYA 4U7ZA 4DA5A 4F1TA 3NAYA 4F7LA 1Q61A 2QD9A 4BTKA 3ZONA 5IA0A 4FKGA 2JC6A 3I7BA 5L4QA 3QD2B 5LVLA 1G8AA 3GQIA 4PNKA 5CX9A 3PRFA 4L7FA 3QRKA 5DMZA 1OL2A 3ANQA 5IMEA 3OBGA 2REIA 1ZY4A 3NNXA 3CTHA 5M4IA 3R8LA 2PK9A 4QTEA 4FEXA 4FT9A 4IFCA 3RGFA 4CFXA 3MTLA 3H9FA 3M1SA 2PUNA 3KQ7A 4BCQA 2P55A 4L53A 2HZNA 2CPKE 1U54A 4YNEA 4DGOA 2V0DA 5JFSA 4RWKA 4R7BA 2OI4X 2PZRA 2VNYA 3FI3A 3N9XA 3QBNA 3K5VA 4WSQA 4F64A 2OXYA 2XYUA 4JBPA 2X2MA 3MDYA 2BHEA 2CN5A 2OLCA 3CIKA 1TQMA 1YHVA 1ZAOA 2AUHA 5BVOA 4RGJA 3RHKA 2WIPA 2I1MA 3F9NA 5LMKA 2C3KA 1ZYDA 5HG5A 4UMPA 2YCQA 2ITXA 3MVMA 2CCIA 4AN3A 4TWOA 3TZ9A 3BEAA 1FINA 4JNWA 4XYFA 3PXYA 2YEXA 5DEWA 1P14A 3HP5A 3OWJA 2UW0A 5CTPA 3EQBA 5CF8A 1NY3A 3QWJA 1WBVA 4GIHA 4R1YA 4XHKB 3SXRA 3VUMA 3JY9A 4NL0A 1YXSA 4J8MA 2W1DA 4ZS0A 4G3DA 2ZV8A 5HG9A 2R3FA 5J1VA 1XQZA 1KV1A 4O7TA 3CXWA 4WBOA 2GFSA 3DAEA 3AOXA 3U87A 2VNWA 2QOBA 2R0UA 2YIYA 4RLLA 4NK9A 5CANA 3EQGA 2C6DA 4YMJA 2B1PA 4FSTA 4JOAA 3DB8A 3N4TA 2AC3A 5AR4A 4XLVA 5CU0A 2Y6MA 4R6VA 5CQUA 2CNQA 4NEUA 4BCFA 4FTQA 3NNWA 3QL8A 2Z7LA 4WG5A 4AGDA 3UPZA 4QPAA 5CU6A 4D5HA 1YXUA 2HENA 3VBWA 2I0VA 2G1TA 5FP5A 3VF8A 3BPRA 3DBDA 4W4VA 3C0HA 4X6QC 5KCVA 4M69A 4EEVA 5IH4A 3K3JA 4L52A 3EQIA 1WZYA 1BL7A 2R3JA 2JKQA 4MK0A 3RWQA 5ANIA 5IQGA 2WMSA 3CC6A 4AT4A 3QQLA 4DEIA 3WF8A 3TJDA 3VN9A 4AUAA 4EWHA 3OUNB 3MFUA 4FSUA 2CNVA 3U55A 4IB0A 3OMVA 4FTUA 4NSTA 4PF4A 4U5JA 1OL7A 4JJRA 4EOLA 2PPQA 4PDYA 4M66A 4FKOA 3UO5A 3PJ2A 3BHUA 2Z2WA 2PVLA 2Z8CA 4YJTA 2GFCA 4E93A 5C03A 2JDRA 3NS9A 2O65A 3PJ3A 4PDSA 4YJQA 3GUBA 1FBNA 3O2MA 4QNYA 3MY1A 3ORMA 4FTMA 4FTLA 2H34A 3UIBA 2VTPA 2ONLC 2J6MA 2J51A 3LQ8A 3OUKA 4J97A 4BN1A 2BTSA 3NUSA 3T9IA 3T8OA 1CM8A 4LUEA 2XIYA 4BR3A 5B0XA 5M4FA 1U46A 1YWRA 5DI1A 3KFAA 3O96A 5AMNA 4IJ9A 1JVPP 3BHVA 3I5NA 3BHHA 1PYEA 1Q8WA 4FT7A 4NIFA 2OG8A 4D0XA 2O5KA 2ESMA 1O6LA 4YZCA 2X6DA 2XIZA 3I0QA 5T3QA 3R8MA 2C1BA 3RK7A 1AGWA 4JL9A 4BWPA 1OUYA 1SNUA 4CRSA 5IEVA 5E8WA 5GJGA 1Z9XA 5FXSA 3C4CA 3PJ8A 4I0RA 3OXZA 3TN8A 4Y5HA 4X3FA 1NA7A 4YSMA 2V7OA 2YLEA 2C69A 4JRVA 4BTJA 4GFMA 5HKMA 5KBRA 3QTZA 4JIKA 1P4FA 2HXLA 4C58A 4R1VA 2PULA 2ITPA 4FF8A 4X2NA 1JOWB 3D5XA 3G51A 2W1CA 2HWOA 3A62A 4V05A 3D94A 3TACA 3D2KA 3E3BX 3MS9A 3A2CA 4AQCA 2X2LA 3DDPA 3PLAE 2XYNA 3R8ZA 2C5OA 3GCSA 1GIHA 3MA3A 4FX3A 3OTUA 5J1WA 5L6PA 3C1XA 4G6OA 4QTCA 4ANSA 4IAAA 5EM5A 3NMUF 4FEWA 5AP5A 1YHSA 3ANRA 4OTPA 2RFDA 5CSWA 2CGXA 3W2OA 5HX8A 4RVTA 4NU1A 3BGZA 4WNKA 2GHGA 3LFBA 2WQNA 5I3RA 2W4JA 4FEQA 5LOHA 4U97A 5HNIX 4AOTA 4Y95A 5JN2A 2SRCA 2PVKA 4O2ZA 2GSFA 2ONLA 2RL5A 3O7LD 4O38A 3TKHA 3ZO4A 3TTJA 4D1SA 4EBWA 4YO4A 4EOQA 4EBVA 1YOMA 3QXPA 2PE0A 4LMUA 4NM5A 2B4SB 2P2HA 3VHEA 3ZRLA 1XHAA 3NIEA 4O81A 3LJ0A 3LJ1A 2YJRA 4DTKA 3MH0A 3F3ZA 2HCKA 1IR3A 3R1QA 2JAVA 3GP0A 3II5A 4PL4A 5HI2A 4M15A 2OIBA 3M42A 1JPAA 1YVJA 4RVMA 2VTNA 5EFQA 4E73A 2NRUA 4O83A 4ZZOA 3G9NA 4RX5A 5AA9A 3Q9XA 2XP2A 3HDMA 3RM6A 4NKSA 1YHWA 3SX9A 2J0KA 1UU3A 2R3OA 4O6EA 3TKIA 2GNGA 2GU8A 3DY7A 4ZY4A 3SG8A 2HYYA 2PVRA 4WG4A 4YURA 4EH6A 4LOQA 4FZAB 1YXXA 3LFQA 3NYXA 4BIDA 4UWYA 3BLQA 4FMQA 4FG8A 5HORA 4X6RA 4WBBB 3KL8A 3RMFA 5ANOA 1OBGA 4IJPA 3LLTA 3P1AA 5DYJA 3QLFA 2OF4A 3C4ZA 3QX2A 4TXCA 4FKIA 3MPTA 4I20A 5D7VA 3U6IA 5GJDA 2B52A 5ANJA 3TEIA 2JKKA 2R3LA 1G5SA 3ZZWA 4PPBA 4FNXA 4IDTA 2CNUA 1R1WA 2WMBA 2NRYA 5G6VA 3QALE 4OTDA 1JNKA 3TJCA 3HAMA 2WU6A 4ZTHA 5DLSA 3WZUA 4G31A 3V6RA 2RFSA 4JR7A 4AGUA 5CEPA 3LMGA 5JKGA 3F2NA 3L8SA 4APCA 4FYNA 4BC6A 4BI1A 4L00A 3D7ZA 3POOA 4USFA 3OBJA 4D2VA 5AP3A 3S95A 4FTAA 4RZWA 1OL5A 3HMIA 3ODZX 4D0WA 2VWYA 4DC2A 4FYOA 4NZWB 5IQCA 3BZ3A 4DLIA 2F7EE 4QPMA 1CKJA 2KTYA 4Y46A 4F9YA 4ONAA 2XIKA 4LGDA 5GZ9A 1Y6AA 4RWIA 4F1MA 4M0YA 4X21A 4J99A 4QMNA 4PTCA 3WBLA 5AR2A 3RINA 3ZCLA 4FIEA 1H00A 5HVJA 1GZKA 5GZAA 1J91A 3A61A 4GRBA 3SAYA 3ZTXA 4XS2A 3K3IA 1HOWA 1B39A 4IAFA 4B9DA 4XMOA 2IVVA 4S2ZA 2GNFA 5KMJA 2XVDA 5DIAA 3L9MA 2AYPA 3GCUA 4QP4A 2VAGA 2BR1A 4QP8A 5LMKC 1APME 3ZUUA 3FZTA 3HRCA 2X39A 3SC1A 5LJJA 3TNIA 4I5HA 1U4DA 4QO9A 3PVWA 2GNLA 4EK4A 3IGOA 3F69A 4EZ3A 2B55A 2XRUA 4FTTA 3UC4A 1ERKA 4O7ZA 3PSCA 3Q2MA 1XO2B 1JWHA 4OW8A 3LMHA 2O64A 3PXRA 3HV4A 4FGBA 3P0MA 4FIFA 1WCCA 3DNDA 3GU4A 4XV1A 2JBPA 4ZP5A 3ORZA 2ETRA 4ZJJA 5IA1A 1A48A 1XR1A 3VQUA 4KUJA 3DKCA 4DG0E 5IUHA 3A7FA 3EMGA 3MB7A 3HUCA 3GCQA 3LLAA 3ZM9A 3AGLA 1OIQA 2WTVA 2XEYA 3E63A 4FIGA 1Q3DA 3TKUA 4A06A 4N57A 4YZBA 5AUTA 5IUGA 5FEQA 5IZFA 4NKAA 3CQEA 4QMWA 1JSVA 2QCSA 4PDOA 3BYOA 3EQPA 5CEKA 4FV6A 4W9XA 1YI4A 5AP0A 4GKHA 3H3CA 3WZDA 2XCHA 1AD5A 4IAIA 3WF7A 2JIVA 3RK5A 3D7TB 1MUOA 2E9PA 3R01A 3N51A 3SRVB 4FE2A 3BRBA 4I21A 3BYUA 4MD7E 1GJOA 2J5FA 3KXZA 3Q9WA 4OBPA 3Q96A 3S3IA 4UXLA 3RVGA 1DAWA 1DM2A 3OCGA 4II5A 2R3KA 4GFOA 1MQ4A 3HRFA 4FTCA 3FHRA 4YU2A 5I9YA 4OTHA 4BTMA 3UYTA 4IXPA 1WBWA 4KA3A 4DEAA 2O63A 3TV4A 2IZTA 3GU5A 2IW9A 4MBIA 4GK2A 2R3HA 4PV0A 3ZM4A 5JH6A 2F9GA 4O7LA 4GL9A 4CVAA 2C6LA 3EFWA 4FODA 4U8ZA 3VS7A 4BCJA 1VJYA 4BHNA 5B2KA 3R7YA 4YTFA 4Y73A 2UVYA 5IKWA 4C3PA 1U54B 4FZFB 4AW2A 3QYWA 5H2UA 4KBCA 3SG9A 3KN6A 2WTIA 3E3PA 4L3JA 3PRIA 4FEUA 4RA4A 3E62A 3DXPA 1FMOE 2X2KA 2F2CB 5EHLA 5K0KA 4P5ZA 3V5JA 2B7AA 5M09A 4HCVA 4ZTQA 4AT3A 2CLQA 3HMMA 4FT5A 3Q2JA 3DJ5A 3G15A 3HDNA 2F7XE 4MCVA 1YWNA 5CWZA 2OJ9A 3ORXA 4AZWA 4Z7GA 3EN6A
chains in the Genus database with same CATH superfamily
4FVPA 3QD3A 4KSPA 5TE0A 4HVIA 1LUFA 4F6UA 4MWHA 3HKPA 4MGZE 2PE1A 5KMNA 1EE8A 1QUSA 1NJGA 2V1CA 1GZOA 1M7QA 1ZLTA 2ZB1A 3M2WA 3UE4A 4XBRA 3VS3A 2Y4PA 3QU0A 2LVAA 3ZRMA 2UXCM 2IVSA 4NTSA 4RBLA 4ZY5A 3TL4X 4LY6A 1OFIA 3S0OA 5BYYA 2RGOA 1K2PA 2CLXA 2BAQA 1XH7A 2O8YA 2ACXA 4QNAA 4FVRA 4G2FA 4IIRA 5CALA 3KEXA 4L45A 2G5GX 3MTFA 3GLFA 4HYIA 4W4WA 5EJCA 3PSBA 2DKLA 3CJFA 3GI3A 1OPLA 2BIKB 3ACKA 3ERKA 3H0YA 2FFJA 4U43A 5LMUM 3BX5A 3T3UA 5KHXA 2FB8A 4E6AA 4J1RA 4I23A 3HECA 4WURA 2QG7A 5AWMA 4QMTA 1BYGA 2QO2A 4FGRA 1JB0F 4MUQA 2PZYA 4XG7A 2CKEA 3DA6A 1CKIA 3R9XB 4FWHA 3G5DA 4UMRA 1J7UA 3ZH8A 2DAEA 5TR6A 2UUBM 4DFBA 4G3OA 5HLNA 4UV0A 5HESA 5GINE 2ZM4A 1R0PA 1V1KA 3SYLA 2QOHA 3CPBA 3IHPA 4MGHA 4MNFA 3ZO3A 3HVCA 3PLSA 3SARA 4FK3A 4U44A 1W0XC 3W0PA 3QHWA 4IEBA 1JAMA 3DKGA 3LCOA 4M0ZA 3CF6E 3NUUA 4M69B 5EYDA 1SXJC 3L2AA 4TL0A 4X3JA 3TZ8A 5M51A 3G6GA 3PFYA 4D1XA 2XGNA 4ALUA 4OT5A 4PTEA 4GU6A 3IECA 1H1QA 3OHTA 4HOKA 4BCPA 5DG5A 3TWKA 2C3JA 1IN4A 1Y8YA 2BDWA 3BELA 4MTAA 4QYHA 4UY9A 3VW6A 4F64A 4NW5A 5AR8A 1HQYE 4O0YA 5HNGA 4C3FA 2Q83A 3RTPA 4O0VA 1BKXA 2YIQA 3HMOA 2UZLA 4TW9A 2X0PA 3IW4A 4Q9ZA 3RGSA 1K82A 3A98B 5A54A 4AG8A 4UZDA 4A9YA 1Q3WA 3ORPA 5D10A 4HVGA 4DFXE 4YJUA 4L8MA 5I9ZA 5IU2A 4TWPA 4A4LA 3VC4A 3LFSA 4TY1A 2P4IA 4W5WA 3V8WA 4AZFA 2YDIA 3SA0A 2BTRA 3KRXA 4UWCA 5LXMA 3W10A 4G17A 2PMLX 2VTRA 2W1FA 3I04M 4L16A 3PNVA 3H30A 2XNPA 4S30A 2JNHA 5HE0A 1GOLA 4V0GA 5TO8A 1R0EA 4BIEA 5J9ZA 2CDZA 1I94M 4JI9A 3NGAA 3PE2A 2WMXA 4GS6A 5EKOA 3UTOA 4B99A 3KXNA 4JI5M 5AUXA 3R2YA 4IIWA 5E8UA 2JKMA 2PZIA 5B7VA 1N77A 2DHRA 4QQJA 5EDRA 4R8QA 4ANQA 4BYJA 3PDTA 3LQRA 2UW5A 1IN5A 5H8EA 4EK6A 1XXHB 3IK3A 2X9FA 3O7LB 4EL9A 1R2ZA 2C68A 4B8MA 3KSXA 4B7FA 4TKSA 1YWVA 4G9CA 4E8AA 1JKLA 5IISA 1W83A 5LVOA 2HHHM 4K1BA 2BROA 3R7EA 4E5WA 2XH9A 5E8VA 3T1HM 4HPTE 4MNEB 2XFSA 2VGOA 5F4NA 2O0UA 5CEQA 4AWIA 3C5IA 2HK5A 4APPA 4N70A 2VTSA 2KZSA 3EFJA 2F49A 2JDSA 5M56A 4AW0A 5FTNA 3F82A 3FLWA 3TUDA 3W8LA 2F4VM 4W9WA 5IH5A 2DWNA 2RFEA 1ZYCA 3FTCA 3MIYA 1WGNA 2RF9A 3IOKA 4DYMA 3D15A 2Z4RA 4CZTA 3CR0A 4KB8A 4O4DA 3ROYA 4PMSA 3RPSA 2ZYBA 4BCGA 1OJLA 3FYDA 3A7HA 4WRGA 2C6IA 3GPPA 2J0IA 3DJ7A 4BDKA 5DPVA 4KBAA 4ACDA 3U6LA 4XG8A 4DTBA 2HWPA 2J90A 2YLFA 1GLNA 5DR6A 5I4NA 3QYZA 4EOSA 1U5QA 2Q0NA 3GGFA 3KB7A 5E1EA 4BI2A 3MMPA 2UZOA 4I6BA 2BAKA 2BMCA 3CBLA 4BKJA 4EWQA 3PXQA 3L8VA 3AJIB 4L68A 4RQVA 4TWCA 4D2TA 4QP1A 2C5YA 3ILKA 3C50A 3THGA 2QOLA 3KXGA 2C0IA 2OICA 4U3ZA 4DH3A 3SAVA 4CCBA 2GTNA 3PFIA 4EHEA 3U60A 4D2WA 1PMEA 3UOJA 4M13A 1G4AE 2A98A 3DQXA 4I4EA 3SXSA 3MGYA 3U6HA 2WXVA 2XM9A 4IANA 1Z6TA 4JI4M 4KINA 5FBNC 3C3DA 4LYNA 4FV2A 3DLZA 4FSQA 5TKDA 3VRZA 4A4XA 4A9SA 4LV8A 4GKJM 3O50A 1H1WA 4AGWA 2NO3A 3NVMB 2PPQA 4HYUA 3ETAA 1MU5A 4AAAA 4QQTA 5C1QB 2KRKA 4QMSA 4BCMA 1J5EM 4IB1A 3GQ4A 5C01A 3L9NA 5F9EA 2BAJA 4CMOA 2XANA 3Q8XA 4IAZA 3IQ7A 3NW7A 5LWMA 5A6OA 1TTEA 4CKIA 5KMKA 5CSHA 3O51A 4E5AX 3FMEA 4KRDA 4GEOA 4KKEA 1NV8A 4XOYA 3NUPA 2PUIA 3HHYA 2UW7A 4KABA 3HL7A 4LFIA 2QCUA 2GNHA 3BQCA 3LFNA 4UBAA 3DK6A 4BBFA 4DBNA 1E9HA 4AF3A 4J8NA 2WO6A 3DS6A 1YDSE 5IUIA 2FVDA 4I6FA 1FGKA 2YACA 3F3TA 1NT2A 4ACHA 2EU9A 1XC8A 3AD4A 4J95A 2H9VA 2X6EA 3E8DA 2YR0A 2XNEA 4JI7M 1KSWA 4S12A 3MVHA 3CGFA 2ZDTA 3JYAA 5D1JA 3TXOA 2VWWA 4XP2A 4I8OA 3VF9A 4BI0A 4FI1A 3KRWA 3NWLA 1H28A 4RC3A 3I60A 5BUJA 5IA3A 3IONA 3H4JA 5F95A 3CY3A 1OPKA 4EOIA 3FMNA 3LQ5A 1WMKA 4RIYB 5B2MA 5IZ7D 4IAKA 4L46A 4K2RA 4FTOA 4O0RA 5IQDA 2W0JA 4BLCA 3P78A 2WIHA 5HBEA 1M7NA 1WVWA 3E93A 4FTJA 1P3QQ 4D81A 2VQEM 3PPZA 5EW9A 4FUXA 4PX6A 3R8FA 4C4JA 2Y0AA 4MH7A 5JFXA 1R7RA 1CKPA 4UXQA 5FD2A 3MI9A 4Y8DA 5HE1A 4ASXA 4E4XA 5CAPA 4X3FC 2PVHA 4RQKA 1J7LA 3QF9A 4NYEA 2W1GA 3RM7A 3TZMA 3W67A 3DDQA 4DR3M 3CY2A 4FBXA 3JPVA 3MHVC 4EH9A 5J79A 2Z3XA 4ZLOA 1CTPE 2JAMA 3HV3A 4F9AA 4UN2B 3K9PA 2VGPA 3IS5A 3QRTA 4TNBA 4PL5A 2ITYA 5KO1A 3K1JA 2XS0A 3QC4A 2M60A 3GVUA 3QTUA 4EH7A 4G5PA 4F6SA 3DBFA 4OT6A 4O7WA 4LJAA 5DVRA 1ZMVA 4DGNA 4HVHA 2YM6A 3FLZA 4QP9A 4AZTA 2C3LA 3AC2A 5C27A 3AC4A 3C51A 4USEA 5EQYA 2BILB 4G3GA 2DENA 4FNZA 3O0GA 3SKCA 3MH3A 2VTJA 4QMOA 4RJ6A 3SW4A 4ASDA 4TPTA 4CFMA 4JBQA 1MRVA 1OUKA 3BI6A 3HV5A 4DCEA 2PY3A 3NDMA 3ZMMA 2UXDM 2FS1A 5AM7A 5M57A 4NJDA 1OKVA 4G3FA 3AKJA 3F3UA 2ZV7A 4IC7A 4X7QA 4D4YA 3D8LA 4O91A 4CMTA 3I5ZA 3VFDA 3G2FA 3UDBA 1PMUA 4B7GA 1REKA 4RSSA 3FUPA 2GQGA 3R71A 4XBUA 4DINA 5FBOA 3G6HA 3WILA 2IF8A 4NRVA 5A9UA 3LM0A 3C4FA 2XB7A 1S9JA 4FKWA 5GHVA 1XMMA 4BCNA 4QP6A 2W5BA 5J5TA 1QPJA 1XNRM 3G0FA 4ITJA 4LGYA 3DV3A 2MR9A 4BRXA 2QENA 2JFLA 5IQAA 3EL8A 2EA0A 2VTHA 5EQEA 1NV9A 3MJ1A 1H1RA 4M7IA 2WU7A 2R3IA 3L25A 4CKRA 3FMJA 5JGBA 4K9YA 2PHKA 4NOOB 2YAKA 4AW1A 3HYHA 5HO7A 4UWBA 5AM6A 5DWRA 4M3QA 3DK7A 5AIRA 3SDJA 4ZS4A 1XH9A 5HD4A 2XARA 5BVDA 2JFMA 3B8RA 3KCFA 1PRBA 2QSFX 2XNGA 4FV7A 3HP2A 5CU2A 3BLHA 4EOMA 5FDPA 5KQ8A 4DEHA 4PMMA 4EK8A 2JITA 3SOAA 4QNRA 3QUEA 3MJ2A 3MY5A 5D9HA 4JBVA 4A07A 4IMYA 4YLKA 2C9OA 4AG6A 2GQSA 2PVJA 4MX9A 2XMYA 4AACA 4CFFA 4DH5A 1Y6BA 4DCAA 1W82A 3KN5A 1HT2E 4WD5A 4XG9A 4IM3A 4C38A 3UNKA 3VUKA 4IVAA 4CMUA 2FH0A 2KZUA 1JQHA 2YM7A 3LFAA 5JGAA 2HZIA 4EHGA 5M44A 3WYYA 4O0WA 2ITUA 3BU3A 5M4UA 4DR2M 2K0BX 2MJ5B 2HXQA 2P0CA 1Q5KA 3LCSA 4FIHA 4TTHB 3SAUA 3KULB 4S31A 2GNOA 4MWIA 2WQOA 4TN6A 2BRGA 4UMQA 3U9CA 4DFNA 3DOAA 4UMTA 5HVYA 3QTSA 3PIYA 2J7TA 3IW5A 5IQEA 2A4LA 2DUVA 2IWIA 4RJ7A 4C37A 3BXWA 2F5OA 5CAQA 3KS4A 3L1SA 4KAOA 3GLHA 1QZMA 1UFZA 4CRLA 4DFZE 3UMWA 3BE2A 5FGKA 3LXKA 3UODA 3HU2A 5DEYA 5IEYA 3RAHA 3TPZA 5KBQA 4ORKA 3NUXA 3NW5A 3UVPA 4L7SA 4BDIA 4C2WA 4ENXA 5F3WA 4IH8A 3SXFA 3ZFYA 4D2SA 3QRJA 3KA0A 3FMHA 3PP1A 1VEGA 4IE9A 4XCUA 3R2BA 3LIJA 2QOCA 2C47A 3KF4A 4RVKA 5AP4A 3TWJA 3UIXA 4F63A 2XZUA 1TDHA 5ITXA 1YUBA 4KIQA 4W4XA 4CYIA 1Z5MA 4QTAA 3AKKA 3LE6A 4ZTNA 3RKBA 3CTQA 4U81A 4Q5HA 2CV1A 4LGGA 4Q2AA 4M67A 3DKFA 4XEYA 2VZ6A 2HWJA 1UM8A 1GNGA 4NJ3A 3R7IA 2UZEA 3IG8A 2XKDA 1PXMA 2RKOA 1ZWSA 3V8SA 4B0GA 3LQ3A 2WOUA 2R64A 3IW8A 4MHAA 4XP3A 3WZDA 2HY81 2OXDA 1HCLA 3KXEC 2WTJA 4O82A 3AQVA 3E21A 5AV4A 3RWPA 2VWZA 3L8XA 4GH2A 5FEDA 5AP6A 1QUTA 1ND4A 4YHFA 3VBTA 3VUDA 3ZFMA 4DDIA 2WTKB 3ORKA 4YPDA 3BKBA 2G8LA 5I0BA 3A42A 2WFYA 4QT1A 3EOCA 4QPSA 2HY0A 2VTAA 2F5QA 2ZV9A 3RAWA 5KZIA 2GCDA 1Y57A 3F66A 4K33A 4G34A 2C4GA 2XK9A 1JKSA 3BGPA 2JIUA 3F5GA 1FVRA 2F2UA 4RX9A 1U5RA 5CT0A 4EHZA 3EIDA 4CFWA 4EUTA 3ZOSA 4N0SA 4MKCA 2DWMA 1AQ1A 3U60B 4P5QA 3R28A 4QMPA 1OPJA 3WYXA 2KEBA 2KNZA 1DAYA 4IWDA 5KKRB 3E87A 3T1YM 3MBLA 2OO8X 2LVPC 3DZOA 5KMLA 1BUHA 3D8BA 3FBVA 3I4YA 4FL3A 3BV2A 2HIWA 1Q02A 4OTWA 3GLGA 2W4OA 4FT3A 5J9YA 5K4JA 5GIPE 1LEZA 5DFLA 4FNWA 2BALA 4M9SA 3O8PA 4E6DA 1DS5A 3QYBA 4MD9E 4F09A 3CSVA 2ITZA 2VQFM 5AP1A 2WTWA 5A3XA 4BKYA 4GH9A 3JS2A 1Q24A 2A0CX 2C6TA 3QZIA 3MESA 3PXKA 4QMQA 1IN8A 1YDTE 1L2CA 4GW8A 4GVJA 4EC9A 5ITQA 1Q99A 2VTLA 4C02A 2DQ7X 2CFOA 2F4JA 2QOOA 3ORLA 3PY3A 1R5LA 3LMMA 3MFRA 2Y8OA 5CSVA 2CKOA 5FTKA 2YERA 3RAIA 5LWNA 4F0GA 3UYSA 3PTGA 4I41A 3EYHA 1NY6A 3UDSA 4RFMA 2LTUA 1OKYA 1OIRA 3FKOA 3NR9A 4CV9A 3VBXA 2BPMA 3QCXA 1J3HA 1MP8A 2UW3A 4RIWA 5EKNA 5BPYA 4ZSLA 5DYIA 3CE3A 2L2DA 4NXNM 1G3NA 4ZSGA 3ZDIA 4IWQA 1EFUB 2E9VA 1SYKA 4QMLA 1BVSA 2KULA 4GK3A 2XJ2A 3GC9A 4V01A 4ERWA 4GCJA 4FL1A 4FSZA 2RGPA 3KRJA 4MXYA 5EYCA 5HGIA 5EHYA 3V01A 3QAME 4O7RA 1YDRE 4F99A 2GMXA 1D0KA 3VUIA 4QHSA 4YY3M 1WVYA 3QC9A 4BWXA 3GT8A 5KMIA 5CF4A 3UGCA 3FYKX 4ASEA 4ARKA 1ZZLA 2W5HA 2ZJWA 3EN5A 3GNIB 3NNUA 4NM3A 4EOPA 3MVJA 5J7BA 3W2SA 4FKPA 3CQWA 3QTQA 3VJOA 2Z02A 3T38A 1OTRA 2X4ZA 1Q41A 5G1XA 5K4IA 1DGGA 5CAVA 2YDKA 2VX1A 3EIEA 2E5LM 3GU7A 3GCVA 4J71A 2WOTA 5C8NA 3E8NA 3P4KA 4LJ4A 4PDIA 1L8QA 2QURA 1B38A 5DFPA 1OL1A 3B8QA 3DXNA 3O8TA 1HCKA 2HW6A 4YZDA 3FJQE 4B8LA 4DHFA 3ALOA 4HZRA 3RALA 2CUZA 1H26A 4NH1A 1H4LA 1W2CA 3QTIA 5H3QA 3T3VA 2XEZA 4P2KA 3ATSA 1YI6A 4ALVA 1O9UA 3FSKA 3UIUA 5I9XA 5H37D 5M55A 2Q0BA 1W2FA 3H10A 3JVSA 2XJ1A 5CNOA 4O84A 4C0TA 3DZQA 1OB3A 4CEGA 3GLGE 5FUTA 2ITWA 2J0LA 4IZAA 4REZA 3FZOA 3VK7A 4O2PA 3VVHA 5CASA 1Z57A 2QHMA 3FXZA 3DKOA 5TT7A 5ACKA 1PJQA 2BJVA 1PKGA 1UVRA 4O0SA 2XBJA 5GIOE 3D83A 2ERKA 2VUWA 2C30A 3R22A 4X64M 3L9PA 4AZEA 1QPEA 1PYXA 3FPQA 4C62A 3D2IA 5LVNA 4RA5A 3S4QA 3AKZA 4JLCA 4FG9A 4C4HA 3DT1A 2B9HA 4F7NA 5EW8A 4QD6A 2QOIA 1M2RA 3HX3A 1PXLA 2LHCA 2PTKA 4I3ZA 3VLFB 3V5WA 4FICA 2VTOA 4R5YA 4IBBA 2BFYA 3C4XA 2QC6A 3LAUA 4TWNA 3FY0A 4DH7A 1Q97A 3UDZA 2XK6A 4XV9A 4ZJIA 3VS4A 5D41A 4FV0A 5AUWA 5L6OA 5LVPA 2VN9A 1VG5A 4YUQA 3AD6A 2R6FA 4XLIA 4WRSA 2FUMA 1CDKA 3FMKA 4ANBA 4C59A 3CTWB 1OBDA 1A9UA 5KPTA 3ZCBB 1KE5A 2OQ4A 2CGVA 2ITOA 2QKRA 3C5UA 3F5PA 3IDPA 3HLLA 5FLXS 4FIIA 4I1ZA 4JQEA 5FTQA 4HGEA 4FL2A 3ZC5A 3A99A 5DT0A 5JQ5A 3V5QA 1F3MC 5CVGA 5ITXE 3V5TA 4ZAUA 4PQNA 3VS1A 3MYGA 3OFMA 5ACBC 3D5VA 5BPVA 4G5JA 4TRLA 5I9UA 4DUZM 2DXIA 2FSMX 5AEPA 1XBBA 5IREB 5HIEA 3U6SA 1K3AA 3ZEWA 4AT5A 1YXTA 1IXRC 4BZOA 1Q8ZA 4YTCA 5JT2A 4F0IA 5L3AA 3LCDA 3NLBA 3ENMA 1QVRA 3I01M 2RRUA 4AQYM 1JSUA 2WQEA 3IO7A 3W16A 4IC8A 4JQ8A 4QYEA 5CQWA 2ZB0A 3VUGA 2WZJA 2FSOX 3DNEA 4OTQA 4EC8A 5J7HA 5J5SA 5EQPA 3P7CA 1WXQA 2PVMA 4YHJA 4LRMA 4X3FB 3UQFA 4OW0A 3N4VA 4BCIA 5B2LA 3PNYA 4B3MM 4RJ8A 3W2CA 3U6EA 2L7IA 1ORYB 2QQ8A 3CKXA 4EI4A 5AV2A 4AFEA 3I0OA 1OIUA 4EK3A 1IEPA 5FQDC 1SZMA 2YIRA 3FLQA 4WT6A 2Z60A 5AX3A 3UP2A 4D4VA 4TYIA 4BY9E 2DWLA 3O5AA 3U6MA 3WZJA 2WSFF 5E91A 3KKVA 3RPYA 4ID7A 4FCWA 3D9VA 4RFYA 1S3SA 3B2WA 2XNOA 4D2PA 1GZ8A 2VTMA 3GC8A 3C4WA 2VO6A 4ZY6A 3R8PA 4IHPA 5DRDA 3R00A 4QTBA 5K5XA 3LW0A 3R9RA 1H0WA 1QPCA 5AUVA 5BNJA 2LH0A 1KFVA 1T43A 3GLIE 3BBWA 1B6CB 3EYGA 3V8TA 3TM0A 1N33M 5JZNA 1K3XA 2JD5A 2R0IA 1VEBA 4OU7A 4IWOA 3W0SA 2UUEA 2BRNA 3L28A 3R9OA 4OAVB 1IBMM 3I4VA 2IVUA 2WMUA 3FLNC 4GFGA 2JIIA 4PPAA 5AP2A 4QDVA 3AFHA 4AKIA 1FQ1B 4KIKB 4PP9A 2G2HA 4H1JA 1XMQM 3ACJA 2CP8A 2XEPA 2ZMCA 4YTHA 2A5YB 4D4RA 4ENYA 3NYOA 5L2TA 4DV1M 3RFWA 1UU9A 1W8CA 2JDOA 4PT5A 2RIOA 4FD2A 2NP8A 3QQJA 1V0PA 5K3YA 5CI7A 3GQ5A 4PDPA 4XNEA 3LOKA 3DXQA 4AAYA 3V51A 2BWBA 1H08A 1OECA 3LXNA 3BU6A 3ZM9A 4BJJB 3GLIA 4LJ9A 3K54A 3OY3A 3OEFX 3ZBXA 2BRMA 1TF0B 4WUAA 2X4FA 3NCGA 3PWYA 1H24A 4FZ7A 1VZOA 4HNIA 3GOKA 3VW8A 4EUUA 5HTBA 3FE3A 3HJ8A 3BHYA 5EG3A 2D7EA 2J5EA 4DGGA 4FWDA 1S9IA 3C58A 4M0WA 1JKKA 3GU8A 3TIYA 1WHCA 3VUHA 3QA0A 4MYGA 1Q8UA 2QLUA 4XH6A 2PVFA 1IY2A 3RJCA 2XM8A 5EHOA 4BDHA 2C6MA 3RP9A 2V7AA 4DBGB 4FKLA 3TUCA 4CG8A 3U4UA 4KIKA 4L42A 4LFAM 4OX9M 4QOXA 4I4LA 2QPAA 2WTCA 4HGSA 1KE7A 3LXLA 3PG3A 5J9LA 4CISA 3PY0A 3W8QA 3A8XA 3FEGA 2FNAA 3AMAA 3UZTA 4IBCA 3B7ZA 4EH4A 4LM5A 3U6OA 3KW6A 3FC2A 3F2RA 3U54A 4AQKA 1X8BA 3ZSGA 4AXFA 2JBOA 4L43A 3NNVA 2LWXA 4GC9A 3L8PA 2P5TA 5E8YA 4BJJA 3PY1A 4FTKA 3DK3A 5DT3A 5I3OA 3ZO1A 4TYHB 4IBDA 2HKJA 3FL5A 4GG5A 4CZYB 2RFNA 4EYMA 2CSNA 2UZBA 2D7HA 3EL7A 4WOVA 5L8JA 4I4FA 4OBOA 4UB7A 5L2IA 4F9WA 3KP0E 4U80A 5FTJA 4Q7JA 2RSVA 4FKTA 4D1ZA 3FPMA 1J1CA 1SVEA 2B54A 1QANA 4FV4A 1KWPA 5AR5A 3FI8A 5EK7A 2WMTA 2B3TA 5CXZA 2HL7A 4M68A 2W06A 3U6JA 2LXEA 4IM0A 4W8DA 2UUAM 4Y85A 1OIYA 3NYNA 4Y83A 3L9LA 3O71A 3I6UA 4IW0A 4F65A 5EI6A 3TNHA 2WSCF 1Y91A 1WVXA 1KYIA 2XK3A 2DZOB 2ITVA 4RX7A 2ZANA 5E7RA 3DPKA 4IZ5A 1L1ZA 3R8UA 4CSVA 3BWJA 3F7ZA 4DLJA 4AFJA 2C5VA 4E20A 4LG4A 5GNKA 2C5RA 5JEBA 4FV5A 3R9DA 1UU8A 1DO2A 2X9EA 4G6ZA 4YMJA 2JP7A 5C4LA 3FQHA 2Y9QA 4BDFA 2PUUA 4FKSA 5FG8A 5A2QS 4DN5A 3W33A 4GVAA 3KCKA 2VX3A 3OOMA 4RVLA 4AOJA 5FTOA 3RBWA 4YBKA 2C5NA 2YFXA 4MBLA 4K8AA 4WIHA 5LCKA 4BKZA 3OS3A 4BL1A 2J0JA 4JIAA 5IQIA 2XNBA 3QQGA 5EM7A 5EM6A 4DBXA 3OWPA 4RNAA 2XK8A 3RCDA 4RJ5A 3PA4A 5EYKA 4C3RA 4FEVA 2BRBA 4QMMA 3FZRA 5HD7A 2CJMA 4DR4M 3IW7A 4Y5QA 4MVFA 1SG9A 1SM2A 2PZ5A 3HKOA 4IB3A 4QYFA 1YE9A 2R45A 2F7ZE 4UZHA 3WI6A 1XH8A 1MQBA 4K11A 4DAWA 4RZVA 4RX8A 1UU7A 3HJQA 4ZZMA 3RAKA 4E6QA 4RC2A 5LVMA 2WELA 3C4EA 2I7PA 4OLIA 5FDXA 1PGYA 5EQTA 3VKGA 3PP0A 5L2WA 1YRPA 2DI0A 3JR1A 4I24A 1STCE 3KP1E 2FYSA 2GS2A 3R21A 4YGAA 3F7WA 3P7AA 4D82A 1UV5A 1UWJA 3PFQA 5LARA 4XRLA 4OTIA 3ZRKA 5BV3A 5HLPA 2Z7JA 5BX0A 2BCJA 2BZIB 4BIBA 1M2PA 5EH0A 2GHLA 3F5XA 5IG1A 3CGOA 2H96A 5HIBA 3P5KA 3E92A 5IWAM 3RGPA 3ULIA 4JVGA 1H1PA 3AMBA 4YHTA 4PY1A 4PTGA 4H3BA 1TQPA 3ZLSA 4LFBM 1PXNA 1ATPE 3QHRA 3R1SA 2NQ8C 4NCTA 4IX3A 1WBSA 5HOAA 4D9TA 3CP9A 4E7WA 3NIZA 5IF1A 3P79A 4FRFA 3QXOA 2PVYA 2VRXA 4KODA 3PXZA 4L3LA 5C8KA 5EDQA 2BKKA 3Q04A 4IVCA 4ASZA 2A1AB 4GKIA 5L6WL 5KE0A 4LOOA 1IA9A 3TL8A 1DGBA 3FYJX 3Q53A 4K18A 3OD6X 3I79A 3KK9A 4L44A 3G0EA 4XG4A 4RIXB 3DA1A 2XZSA 4L6QA 5IEXA 5KMMA 4RIYA 5D11A 5KKRC 1ZQ9A 4QHTA 2AEGA 4CG9A 3LCVB 3QA8A 2PVNA 2O3PA 2WSEF 4WO5A 2R2PA 1NVQA 3CCNA 4O4CA 4LF4M 1QDRA 3QZHA 1SXJE 2XCKA 1E1VA 2KRUA 4LL0A 4KRCA 3R7UA 2H8HA 4BZDA 4KSQA 4DEBA 1KUTA 1VDDA 4AKHA 5DGZA 3AKLA 3OY1A 3TV7A 4CZUA 2XF3A 2XSZA 4I5SA 3HX4A 4QTDA 3WF9A 4ACCA 3TE6A 4MD8E 3QTRA 4BGHA 3OW3A 4FVQA 1QPDA 1CSNA 2RGHA 1RDQE 2WMAA 2WTKC 2XRWA 2R3RA 3QUPA 4RJ4A 2CMWA 4YZMA 5HO8A 3IKAA 3WZKA 4C36A 2ZDUA 4MQ2A 2CGWA 4V0GB 2Y4IB 3QTWA 4BYIA 1F4IA 4FVMA 4ZJVA 2LVOC 4DDGA 4R3RA 4LMNA 5IH6A 3LCKA 3LJ2A 1UKHA 5EXPA 4M8TA 4RMZA 2LAVA 5A4LA 1WFCA 2V5QA 4CGYB 2OZAB 3COMA 3ORNA 3VBVA 4PP7A 1HR0M 2XH5A 3W0QA 5FP6A 2R3MA 3TDWA 4ZLZA 3R6XA 4HGLA 4XBOA 1BI7A 4JX3A 4MNEA 3PSDA 4O1PA 2PMOX 3R7GA 2V1UA 5AV3A 2R3NA 2W5AA 4GSBA 2FGIA 2J9MA 3C13A 5HEZA 4AXAA 1YSYA 3COKA 4RWJA 3B7NA 3UO4A 5DN3A 5CVFA 5FXQA 4Q9SA 4LGMA 2O01F 4LF5M 2LGCA 4LI5A 4ACMA 2J50A 4AU8A 2OZOA 1P2AA 1J7KA 1W5SA 3AV0A 3GEQA 5BUEA 4GG7A 4BDGA 3FUWA 3ZU7A 4EOJA 3KGAA 4GT4A 4L3PA 4YNOA 5HCZA 4EQMA 2RG6A 3NEWA 4LL5A 5CZHA 3ATTA 2HZ4A 1KOBA 2MROB 3SD0A 4C7TA 4DV5M 2I0HA 2W1EA 4I5PA 3PPJA 4X2FA 5CT7A 3VKHA 5EOBA 4HJOA 5A4EA 3VIDA 2ZFYA 4FUYA 3TMOA 4D55A 2E9UA 2PSQA 3GCPA 4EH5A 3AC5A 5HTIA 3MH1A 4K77A 4HCUA 3DB6A 4CT2A