3KVWA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2) in complex with an indirubin ligand
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
408
structure length
403
Chain Sequence
b'HHSGVDLGTENLYFQSMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSKGYPRYCTVTTLSDVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
publication title Crystal Structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (DYRK2) in complex with an indirubin ligand
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 125
structure length 403
sequence length 408
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kvwA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kvwA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kvwA02
2OK1A 2BMCA 4JX3A 5A4QA 5AWMA 5DGZA 4Z3VA 2X7GA 3CEKA 4JIAA 5EYDA 3O0GA 3ROCA 2QOLA 4YGAA 4RC2A 4WBOA 5J8IA 3R21A 1XH5A 1DAYA 3REPA 4DAWA 4QMPA 4MEDA 2FYSA 2VN9A 2Y4PA 3D83A 1YXTA 3E8EA 3PIZA 4YZMA 5AV0A 3RMFA 4APCA 5LMAA 3ZXZA 5AUWA 4FIJA 1S9JA 2WU7A 3SGCA 1H0VA 1TQMA 3PY1A 5D12A 5FTOA 2XS0A 3ZUTA 4A9RA 2HZIA 3I6WA 3FL5A 5J1VA 2OLCA 4M66A 2GDOA 3N4TA 2OO8X 4MK0A 2Z02A 4ZS0A 2NO3A 4YJOA 3GNIB 5A4CA 1JVPP 2WTJA 1JSTA 5CZHA 5CU2A 5TT7A 1OZ1A 4IH8A 2PUPA 3D5VA 3V51A 5L6OA 2XA4A 4TKSA 4W4YA 3U54A 4DFZE 4ANSA 3F7ZA 4O0VA 3GCPA 4YBJA 4BYIA 3PP0A 3V8SA 3UO5A 1YKRA 3C4CA 2YCQA 4J99A 2WTDA 4G1WA 2FSOX 4KIPA 2QONA 4GMYA 4OTHA 5AM6A 2HAKA 2C0IA 3GOKA 4FV7A 3LFEA 4W4VA 3FHIA 3FL4A 4XNEA 2E9UA 4XX9A 4NSTA 3CIKA 3OCSA 4FKTA 4PP9A 4B8LA 2R7BA 3PY0A 5H8GA 3THBA 4EOOA 3TKIA 4J1RA 4BKZA 3Q32A 3UBDA 5J9LA 4MBLA 3GT8A 2RG6A 4H3BA 1KE7A 3DJ5A 1MQBA 4HOKA 1SMHA 2BROA 2W1IA 4FKOA 2Z7LA 4KIOA 5EOLA 4DC2A 5E8UA 4C4JA 2R7IA 3TL8A 1WBTA 5JRSA 3FMDA 3I7CA 4U44A 4GG5A 5EW9A 3FZRA 4OTWA 5T68A 3KF7A 5J7BA 5KHXA 3DKFA 2XB7A 4FV4A 3BHYA 1H28A 3C51A 3KQ7A 5IA5A 1H1QA 3ZO3A 1H25A 4BDIA 4BZOA 4PMPA 5IQEA 5CSVA 5E8SA 5HD7A 3UVPA 3QTZA 1XBAA 1LR4A 4BCNA 1GAGA 3PSCA 1M7QA 2ZJWA 5HVYA 3DFAA 3QTUA 2UW5A 5L4QA 5LCKA 3ALNA 3WF8A 4FX3A 4MQ1A 5A6NA 4EOQA 4FGRA 4R7HA 2BR1A 5EHYA 3GCUA 3GFWA 3HA8A 5DRBA 2Z8CA 1GIJA 3O23A 2PVJA 3EJ1A 5AV4A 2NPQA 2PMLX 4E93A 3W2SA 2UZLA 2O5KA 2VWYA 1UA2A 4EEVA 4C4IA 2IJMA 3EKKA 1DM2A 2W5AA 4S30A 4PNKA 3T8OA 4U43A 1CMKE 2OICA 3FWQA 3IDBA 4K0YA 4ZTMA 2VTAA 2GFCA 3NNUA 4P2KA 2UW4A 4IB5A 4U80A 2BZJA 3W33A 2C5OA 5E7RA 2B9IA 4EK5A 4IWDA 5IA0A 4J71A 4O38A 4QQ5A 3RBWA 3EN6A 3ORKA 3U9NA 4RG0A 1MRVA 4PMTA 2CN8A 1ZMUA 4FZAB 3QRUA 2XNEA 2ZMDA 4YC3A 3OY3A 4DGOA 4O7WA 1FBNA 5IQAA 3NIEA 5EOBA 3KK8A 3KXNA 4GS6A 3VHEA 1H1RA 3GU4A 4HYHA 4V0GB 5IEVA 5LVLA 2XK4A 4FSQA 4ZZOA 1ZWSA 4XV1A 5DLSA 5HG7A 4I0TA 2CNUA 5D11A 3LCTA 3RI1A 1Q8TA 3KXMA 2H6DA 5EM8A 4MXCA 3UOLA 4BCIA 3PPKA 3C9WA 3UQCA 1ZRZA 3VS7A 3RK7A 3R9NA 4BYJA 4RX5A 3E3BX 2O63A 2VV9A 5BUJA 2EVAA 1WVXA 4ZJJA 2BTSA 1UU8A 4D9UA 3DT1A 3MVLA 4QT1A 4NFNA 4S33A 3R8LA 5LQFA 2HWOA 3W8QA 5A4TA 4LGHA 3OF0A 3PE2A 2JFMA 3W2QA 1Q3DA 3TXOA 4PNIA 3BBWA 4RVKA 1QPEA 4E7WA 4N57A 5HTCA 2IZRA 3CJGA 4DINA 3DKGA 2C4GA 2Q83A 2XVDA 2CCIA 5BUEA 1Q8WA 1B39A 1YOJA 2UZUE 3P7BA 2XIXA 3DCVA 3EZRA 4RIXA 3R01A 2B9FA 4TYIA 4WRSA 5FDXA 3HNGA 5HICA 4QMQA 1IAHA 4EOPA 4EHEA 5EQPA 1Q8ZA 4TWOA 5GZ8A 2PU8A 2WEIA 4QYYA 3OT3A 2B7AA 4L7SA 4MXYA 2WMAA 4KBKA 5IH4A 4H05A 3Q4ZA 3FMNA 3Q4TA 5AV1A 3LKMA 4IDVA 2VX0A 4F1OA 4Y95A 3LIJA 4YO4A 1FGIA 3CTQA 3C5UA 4XH6A 2W99B 3FZPA 3BHTA 5DHJA 3WF5A 3UTOA 3S0OA 1SVGA 3SXSA 4TZRA 2Q0NA 4RLKA 2WTCA 1PXPA 4FV5A 2W4KA 4LL5A 3QQLA 2PZRA 2WMVA 3PXYA 4FK6A 4FKWA 3RHKA 3T3VA 4EOLA 4M3QA 2CKOA 4ZMEA 1Z57A 4FT5A 3MY0A 5I9YA 5CENA 1J7UA 5CEIA 4F7SA 4N6YA 4LI5A 5BVNA 2JAVA 5FRIA 4FZFB 4TWCA 3UNKA 3P5KA 3OXIA 3V6RA 2BKZA 2YDIA 3LFQA 4AS0A 4O7SA 2GHMA 2FO0A 3FEGA 1WBNA 4FEXA 5HNGA 4X3FB 3K5UA 3B2WA 4DH3A 4MQ2A 2GSFA 2E2BA 5ANGA 5HKMA 3RP9A 5DA3A 5L3AA 5AX3A 3EYGA 4P4CA 4ITHA 4AA4A 4FOCA 4BTMA 3BV2A 4TYHB 2GMXA 3CCNA 3PG3A 4M0ZA 4QMLA 4PDOA 4G3DA 2W4JA 5E8YA 2WIPA 3C0HA 4BCFA 4HCUA 4XEYA 2C6KA 5CEOA 1FGKA 3UZPA 5BYYA 1TVOA 3I5ZA 5F9EA 3CBLA 4JVGA 4BIBA 2CHLA 2OU7A 5BQ0A 3UJGA 1QPJA 3OUKA 2BRGA 4RJ6A 4O86A 2J0IA 1H4LA 1Q24A 3FMHA 4QYGA 2PZPA 4QMUA 4D9TA 5C01A 4DBXA 2VWVA 2IZSA 2SRCA 3MTFA 3EQFA 2XBJA 1Y6BA 4FTQA 4I92A 2ZMCA 4DEBA 4BICA 2ITXA 3CXWA 3FQHA 3F82A 5FP5A 1YHWA 3GCSA 2OXXA 3AC3A 1H1SA 4K77A 4AA5A 4JG7A 4GVJA 2IW6A 3MTLA 4H39A 4H58A 4C3FA 5CY3A 4O2PA 3GVUA 4QP9A 5KBRA 2ZVAA 4F99A 4YMJA 3O50A 2B4SB 2QR8A 2YCSA 3LJ1A 1WBPA 4G31A 5HI2A 2QO9A 2YERA 3OTUA 2WMTA 4LGDA 2QOFA 5CF4A 3PXFA 4K2RA 3DDQA 4RSSA 5BVFA 3WZDA 3GFEA 1FVVA 3FSFA 2OH4A 1VYZA 3ANQA 4FV6A 4KKEA 1UNLA 3R8PA 4CKRA 3ZRMA 5TKDA 3PZEA 1LPUA 4PL5A 5JGBA 4ANMA 4XBRA 3Q9WA 3R04A 2C5XA 3MFSA 4GFGA 4HGEA 3LXLA 3Q9ZA 3VBTA 3WBLA 4EK6A 5KMIA 2WO6A 5DIAA 3WZUA 5IDNA 3L1SA 3HUCA 4OTQA 2X2MA 4U3YA 4X6QC 5E8WA 3MH1A 4GL9A 4NTTA 4R6VA 4DEEA 3VF9A 2OJJA 3LAUA 4IAFA 4QD6A 5BYLA 1ZZ2A 2WQBA 4IADA 2W1GA 1I44A 4O0TA 3TNHA 1A9UA 4XS2A 4XG9A 3QWJA 2R3GA 3HMNA 1JAMA 4L53A 3UQGA 3E7VA 4GFMA 4CZUA 1FVTA 5AUZA 4F65A 2PE1A 5HX8A 3TUBA 4X7QA 4Z7GA 1OIUA 5CS6A 4DCEA 3IW4A 2J9MA 4OT5A 4R5YA 3MWUA 3DNDA 4ANBA 3SX9A 1JNKA 5ETIA 4AFJA 4BCMA 3FI8A 3PA5A 4FKGA 4AT5A 3SQQA 5HORA 2W1HA 1UU9A 4DITA 4I6QA 2Y4IB 4FEQA 2W5BA 4ALUA 4NYEA 1S9IA 2G9XA 2XNOA 3QX2A 3PJCA 4O27B 3TNIA 5LMBA 5BYZA 3G0FA 4APPA 3FY2A 2FVDA 4BF2A 4CYJA 4DEHA 3KY2A 3MBLA 3ZEPA 2UZDA 4P5QA 3MH3A 1GY3A 2YAAA 3KU2A 2BUJA 1WVYA 4G3EA 3UMXA 2PZYA 2QOQA 4DEIA 4F1TA 2G2HA 5J95A 5HIEA 5IMXA 5ANEA 3PRIA 5KO1A 5J1WA 2XJ2A 4L43A 5AFVA 4TYEA 4USFA 4PPCA 2P33A 4KKGA 5FD2A 4DT9A 3NEWA 1NW1A 5CSXA 4XLIA 2WD1A 5EDQA 3HDMA 3OC1A 4FL1A 3L9LA 3PJ2A 5ANJA 4OTGA 2VTOA 3ITZA 4WNPA 4A9TA 4L44A 4YPDA 2EB3A 2XCKA 4GU6A 3W1FA 5BMSA 3VQHA 4WA9A 2QOIA 3ORZA 2DS1A 3QUEA 4MYGA 4AWIA 2CKQA 4OAVB 2R3MA 4BCKA 3AOXA 5C8MA 4NIFB 5AR4A 4YP8A 2VTNA 4BKYA 3F66A 1V0PA 5H9BA 2X6EA 3E63A 2AC3A 4C4HA 3FZ1A 4ASXA 2CGWA 4FIIA 2IN6A 5CQUA 4Y46A 2NP8A 3BGZA 2ACXA 4FZ7A 4A9UA 3MA3A 5LVPA 3NVMB 1SVHA 2Y8OA 4KS7A 5KKRC 3D5WA 4QP8A 5FP6A 4CZTA 4D2WA 4FEUA 3DBCA 2HW7A 2QNJA 3C4EA 3HMIA 4G5PA 4MNFA 4PWNA 3R9OA 2J51A 1G8AA 4FTTA 4RIYA 3HGKA 5CNOA 1G8SA 4QTEA 1QPCA 4BDKA 3SG9A 4L3PA 3H9FA 4FK3A 3QHWA 3GCQA 3BBTB 4NKSA 2GTMA 4UMQA 4EHGA 3WIGA 1WBSA 3OS3A 2WTWA 4BCHA 1GIIA 3LQ5A 4ZTRA 2VX1A 5CSPA 4UZHA 3LXPA 4HVDA 1CM8A 3BELA 3EWHA 1Z9XA 3OP5A 2YN8A 5H3QA 4FT9A 4W9WA 5JRQA 2CJMA 3GP0A 1KV2A 4J8MA 5AEPA 4KSQA 5ETAA 3HRBA 4ZTNA 3WE8A 4GH2A 4RX8A 2X6DA 4FSMA 3TKHA 3NMUF 3JY9A 3P7AA 4WUAA 5LOHA 2GNLA 2CKPA 1QMZA 5FLFA 4TTHB 2WOTA 3TZ8A 4I93A 4XCUA 3DBFA 4EOSA 1B38A 1DAWA 4WG3A 3BHHA 3GQIA 3R7YA 5AUTA 5IQHA 1U4DA 3P4KA 3ATSA 2KTYA 5HBHA 4BCPA 2B52A 4F0FA 3S1HA 2PPQA 4M12A 4BN1A 4XV3A 3AMYA 2CNVA 4CV9A 4RMZA 1YDSE 4FF8A 4HNIA 4FKVA 1SYKA 1YHVA 3Q96A 3IPHA 4QYFA 4IM3A 3R8MA 3ZBXA 3ZEWA 4AU8A 4BGHA 3U6JA 1ZMWA 5EW8A 3A61A 3HV4A 4QYHA 2Z7RA 4D1ZA 2DUVA 5F4NA 3W2PA 4D0XA 4I24A 4M69B 1ZYCA 4Y5HA 3B8RA 4YHTA 1VZOA 2CSNA 2QOKA 3K3JA 3BGQA 3DS6A 4HVGA 3R6XA 5CF8A 3EOCA 4EBWA 4F9AA 4A9YA 4DGGA 2XRWA 4WOVA 4FEVA 5A4EA 2VTIA 1CKIA 3FI4A 3OZ6A 4AZVA 3D9VA 3BE2A 2BAKA 1GNGA 4MNEB 4R3PA 4AFEA 3RAHA 2VO6A 3ORLA 2WMBA 3RZFA 5HU3A 4GG7A 4AZEA 3MVHA 4I4FA 4J53A 1Q41A 3LXKA 5DRDA 1JSVA 2XK6A 4QPMA 2JEDA 3QF9A 3EZVA 2J6MA 4O1PA 2C3KA 4OT6A 5DT4A 1YXUA 3SV0A 4CFNA 3HV3A 4HYUA 3RM7A 2R3OA 2GCDA 4I5CA 3VQUA 4JR7A 3BU3A 4BIEA 5CSWA 2XIZA 2YM6A 3BI6A 3CE3A 2GU8A 3W2OA 2ZM3A 3QBNA 4KIKB 3RNYA 4RPVA 3R73A 3EQRA 3OWPA 2VWWA 3DB8A 3W32A 3LM5A 3HL7A 2JDVA 3Q4UA 3GOPA 5HE1A 2WNTA 2V7OA 3FE3A 3W18A 5TR6A 3MB6A 5BUIA 2YM7A 3KRJA 3FYKX 3QUPA 2YJSA 4IXPA 4W9XA 3EH9A 4E5AX 2UW9A 5KMKA 4IJ9A 4IVBA 4KABA 5EM5A 3R7OA 2VWBA 4BCQA 3DQWA 4XHKB 2PZIA 2O8YA 3C7QA 2BILB 3BE9A 2VO0A 1FINA 1PMUA 2A27A 4Z16A 5HNIX 1TQPA 4CMUA 3FSKA 4YTFA 3CD3A 4HPUE 3QRKA 2PVHA 5AIRA 3ENHA 3Q6WA 4L6QA 5EM7A 3WYXA 5IQIA 2O3PA 1P5EA 3PXRA 4TNDA 3CPCA 3EQBA 3R8VA 3R83A 2R3FA 2YJRA 2IPXA 1OL6A 2EXEA 2W05A 2Z2WA 4IM2A 2ZV7A 4FBXA 2XIYA 4FTJA 1OUKA 4JAJA 4NWMA 3MVMA 2RFEA 3CTHA 4OR5A 4ASZA 4ZY4A 4DG2E 3RAIA 2YWVA 4BC6A 5A9UA 3ACJA 5E92A 3QCYA 4NM0A 4D1SA 4CT1A 2ITWA 4WSQA 4FE2A 3OBGA 4UBAA 3P78A 3KVXA 2CLQA 3ZDIA 1CTPE 3MYGA 3F5XA 2JD5A 4NJDA 1SZMA 2B9JA 3IOKA 4FTUA 2UZOA 4QMZA 4XG7A 4F4PA 5KMMA 3VN9A 2B0QA 4C3PA 2VWXA 3O96A 4J98A 4S31A 4RX7A 4D4VA 3QTXA 3VAPA 4C02A 4IWOA 3F3VA 3OXZA 3ZO2A 5HCYA 3LFNA 4UB7A 3SG8A 4XRLA 5ANIA 5CEMA 4ZEGA 4CG9A 3ZRLA 5F95A 2CN5A 2V62A 3R1QA 4FV3A 2J90A 4BI1A 3BEAA 4RX9A 3G9NA 4BDCA 3KK9A 4QNYA 3B8QA 4KRDA 2FGIA 4YJSA 3LFBA 3LJ0A 4DG0E 5JT2A 3SRVB 3T3UA 5JEBA 2B9HA 2CGUA 2VTSA 3BYSA 4LQMA 2OXDA 1JWHA 1YW2A 3FPMA 4O6EA 4ACCA 4F64A 4YU2A 4C34A 2ZDTA 4FT7A 4AW0A 4E6AA 4EH3A 3E87A 3FMLA 3KULB 5HTIA 2FSLX 1URWA 3MPMA 1UNHA 4NU1A 5AX9A 2GNIA 3ACKA 2OSCA 2IVVA 4IB0A 2P0CA 2WTKC 2QU6A 2PUNA 1BLXA 1XO2B 4RZWA 3EIDA 1IASA 1OM1A 4C36A 4ZS4A 4JBVA 3QKLA 4G3FA 4EYMA 3N4VA 2V22A 4FL3A 4XMOA 4OBQA 2YHVA 5H8BA 3QTIA 2BHHA 4DFUA 3VUHA 2PVRA 4EUUA 1R3CA 2R9SA 2ZOQA 2ITZA 1PHKA 1K2PA 2BALA 4YC8A 1H1WA 3EN4A 2H8HA 3KRRA 1R78A 5LARA 3SKCA 4E73A 1OBDA 3PPZA 4LM5A 5DEYA 5IH5A 4AG8A 3E8CA 5L2IA 4BIDA 5CANA 3AC4A 2XH5A 2ZB1A 3C13A 4M15A 4MHAA 4EH2A 2VD5A 3U4WA 2VTRA 4N4SA 2OZAB 3NNXA 3NW5A 1P14A 4FTNA 3V5PA 1YQJA 3LPBA 1HCLA 3V8TA 4O83A 4FKUA 2C1BA 5M57A 3VRYA 1GIHA 5CAPA 2DYLA 2BDWA 4PTCA 1Q3WA 3ZLXA 1V0OA 3NUYA 4I21A 3QD4A 3TV7A 3VBQA 5DMZA 3GCVA 3BU5A 4DHFA 3BRBA 3E62A 3ORNA 4XP2A 5IF1A 2R64A 4IZAA 4EJ7A 4DH8A 3V01A 4GJ2A 2YITA 4JX7A 4IX6A 2R3PA 3S2PA 1FOTA 4WD5A 1GZKA 1WCCA 2FSMX 3MY1A 4HVSA 1IAJA 4DTAA 4NCTC 1L8TA 4L9IA 4BBEA 4WHZA 5C1QB 3O71A 1E9HA 1T45A 1Y91A 3UOJA 3EL7A 4V0GA 1M2PA 1OL5A 3BQRA 3VUMA 4RWIA 1M7NA 3QL8A 4MXXA 4N6ZA 5FXQA 3QTRA 5L8JA 5DG5A 5I4NA 3D94A 3F3WA 1P2AA 3A4OX 1ZOHA 4XG8A 3TTIA 3RWQA 2BZIB 4FUYA 3R8UA 4A4LA 3PIXA 3RAWA 3ZC6A 3PP1A 1O6LA 3V5TA 4FKPA 4GVAA 3OVVA 3DNEA 3EL8A 1PXKA 4RIOA 4XG4A 2REIA 3EQIA 3R0TA 4AN9A 4F7LA 5HLWA 2HXLA 2QURA 3R7EA 1A48A 3POOA 2BIYA 4FV8A 3QWKA 4DH7A 3Q4CA 4FSRA 4L46A 4L3JA 5KMJA 2VO3A 5ANDA 5HO8A 3VRZA 3WIKA 2Z7QA 1REJA 4BGQA 4EONA 2CLXA 3NRMA 1ZAOA 4KIQA 4YJVA 4YZDA 5EHLA 5B2LA 5M51A 2IG7A 5LVNA 5I9XA 1PW2A 3P0MA 4ZY6A 3H30A 1X8BA 2OWBA 4B8MA 4EC9A 4P90A 2C0TA 3V5QA 3VUKA 3CTJA 4IANA 2NRYA 2XEYA 3H10A 4FTMA 5JKGA 3BHUA 3BYMA 3NR9A 1LEWA 2F7XE 2WMQA 3F61A 3FV8A 5DH3A 3FI2A 5KMLA 1OL7A 3KREA 4KUJA 4IBMA 3NGAA 3OY1A 2OG8A 2OF2A 4O82A 1AGWA 4EH6A 4G2FA 2HIWA 2W9ZB 2PVLA 3TACA 3WZEA 1OMWA 4IX4A 4X2NA 3CLYA 1ZY4A 2PMNX 5CEKA 4C4EA 3ZRKA 3L9NA 4GUEA 4ONAA 3UE4A 2GS7A 3QRJA 3IG7A 2J5EA 1QL6A 3LCDA 4YJUA 3W55A 4O7NA 3QU0A 2XBAA 2XZSA 3RPOA 4ORKA 3NUUA 4OTDA 3HV6A 1CSNA 1BMKA 3QALE 3R7UA 4RQVA 3F6XA 1BL7A 1PMEA 3IW5A 4IZ7A 2JC6A 5K5XA 3TM0A 3DDPA 1H00A 3RK9A 2E9VA 2IO6A 1GZ8A 2LAVA 2VNYA 2ZYBA 2OJFE 3VBVA 3K5VA 2OH0E 5HHWA 4PQNA 1WBVA 4RVLA 4YPSA 3UO6A 3GI3A 2X39A 1OECA 5EI2A 5FEDA 3ZO1A 4NJ3A 3R71A 4L68A 4E6CA 4C8BA 1SNUA 2C6DA 2QQ7A 4CD0A 5HBJA 5JFVA 3D7TB 4QNAA 4WSYA 4G9RA 4U41A 4O0RA 3PVWA 3HV5A 3A7GA 5AR2A 4PRJA 3QKMA 4FTRA 4HGLA 4ZSJA 3DK7A 4TYJA 1XWSA 5HG8A 5HE3A 1H08A 4OAUC 3PVBA 3DQXA 2YCRA 3AD4A 4G6LA 3UP7A 5FXRA 4TYHA 4UWBA 4DN5A 1OB3A 2IZUA 3ZSGA 4BDEA 1PXIA 4Y85A 5JZNA 3HYHA 1KOAA 5DEWA 3O7LD 3GC7A 5I9UA 3VBWA 3SW4A 4I5MA 3NSZA 3E5AA 2WQMA 3RM6A 2ITTA 5IKWA 3DLSA 3AQVA 5CI6A 4G6NA 2J2IB 5AP1A 5KHWA 5EYMA 4O7RA 2PL0A 5HZNA 4WG4A 3A62A 4AN3A 4BTFA 5JGDA 5KNJA 4U7ZA 3OG7A 4I3ZA 3BLQA 4FSYA 4DF3A 1Q8UA 3NNWA 3ZMMA 3R2YA 3S4QA 3P9JA 1ERKA 1YOMA 3QRTA 5CWZA 5D7VA 4JQ8A 4DTBA 3MPAA 3LCOA 3QGWA 2V5QA 4ZAUA 5JMSA 4YLJA 5M07A 1PXNA 2OJIA 4NH1A 4I6BA 5DBXA 3FLYA 3LFCA 3PZHA 3ANRA 3UZRA 1P4FA 3RNIA 4IACA 5KZ0A 3DTWA 4QMMA 3TNWA 4BL1A 2BFYA 1Q99A 2UZNA 5HNBA 4C3RA 1O9UA 3FXWA 2P4IA 4D5KA 4E1ZA 5CT7A 3UZTA 2GNHA 5HIDA 4CG8A 2C69A 1OIRA 2ZDUA 4OGRA 4ANOA 4ERWA 1WVWA 4G17A 2P3GX 3R9DA 3CJFA 3OFMA 3FBVA 4X2KA 3VUTA 1XH7A 1U54B 5EKOA 5EH0A 1LP4A 4K18A 3OTVA 4IJPA 3ID6C 4O91A 4GT4A 4PY1A 4W8DA 4EOIA 4F6SA 4B4LA 3BWJA 4GUBA 4ZLOA 3L8PA 4DCAA 3UC3A 3F69A 3RCDA 4GRBA 5JFSA 4NTSA 3I81A 1PXLA 2HOGA 3C4FA 5TO8A 3RJCA 4LOOA 4EOKA 5IEYA 2RFNA 4AXAA 3S00A 5EQEA 3RWPA 4RC4A 2VWIA 2XKFA 4I5HA 4HW7A 1Z5MA 4HCVA 3CKXA 3DXPA 5ITAA 3LCSA 1UKIA 2QOBA 3QQFA 3RKBA 4N0SA 2ITOA 3RPRA 1YI3A 5KUPA 3PXQA 5L6WL 2W96B 3RPYA 5CSHA 4J8NA 4OLIA 4AN2A 2X4ZA 4DGNA 4IW0A 4LOPA 3CPBA 2UW8A 3FLSA 3HLLA 1Q61A 3UODA 3LVPA 3HP2A 5HIBA 3OOMA 3BPRA 3DU8A 5CVFA 1M2RA 4L67A 5IQBA 2WGJA 3MIAA 4EZ3A 2XKDA 4DFXE 1PJKA 2GTNA 2YDJA 3O8PA 2YEXA 4EWQA 5JN2A 4D2RA 5K5NA 4Q5HA 1J3HA 1KE5A 2W1DA 4EI4A 4YZNA 4EL9A 4ZP5A 5AADA 4AW5A 5BPYA 4FZ6A 4YJPA 4BFMA 2J7TA 4OUCA 5B7VA 1YI4A 3QQUA 4XV2A 5HG5A 3ZFMA 4K1BA 3RHXA 4E4NA 3R8ZA 2BZKB 5L8KA 3F2RA 3FJQE 3DGKA 2V7AA 1H27A 4XLVA 3DAKA 3KKVA 4RBLA 2XF0A 3K54A 3UYTA 3VO3A 3ZFXA 4A07A 1PKDA 2R3HA 5KMNA 2A19B 2WIHA 4LMNA 3B2TA 4U81A 1WBWA 4IAAA 2QOHA 1UU7A 5M55A 3ORXA 4EQMA 5FDPA 3V8WA 4XG3A 4F09A 4AZWA 2J0JA 5HVJA 4EZ5A 5EYKA 3NS9A 2HY81 5FTGA 2UZBA 3I1AA 1KOBA 1OPKA 2R4BA 3PSBA 1U46A 3TV6A 4IDTA 2A0CX 2YCFA 3KXHA 4O7YA 3PVUA 4FZDB 5B2KA 4XV9A 3UPZA 3MFUA 4D58A 4LV5A 3KMWA 1V0BA 3F5PA 5ETFA 3EB0A 2F2UA 4O84A 5M44A 3DOGA 2W5HA 4BDGA 2VU3A 3D5UA 4ENXA 5C8KA 4IIRA 3ODYX 4NIFA 4S2ZA 3ZDUA 3OWKA 5AJQA 2CGXA 2O2UA 3PSDA 4JQ7A 4MD7E 4PTGA 5AR8A 3DBQA 3CD8A 3QRIA 4V01A 5IG1A 5C4KA 1F0QA 3HAMA 4X3FC 3DY7A 3V5LA 4CFXA 5BVOA 4PDYA 4QMNA 2JDOA 4G5JA 4H3QA 2WKMA 4UMUA 3NDMA 2UZWE 4X0MA 4EH7A 3MGYA 2UW6A 1JPAA 3KGAA 3ROYA 3ZLWA 3ZSIA 3CGOA 4JDKA 1M14A 3I7BA 2UW0A 5EM6A 3E92A 4RGJA 2BCJA 3FDNA 3IQ7A 3VS0A 2R2PA 1ATPE 4XRJA 4J95A 3FC1X 4BTJA 1VYWA 2AYPA 1CDKA 4EH9A 3UP2A 3VUDA 1Q8YA 3IECA 4IEBA 5K4IA 3L9PA 1RW8A 2C5NA 3FKNA 3G6GA 3GUBA 4FIGA 4KD1A 4FI1A 4UV0A 1APME 5GIOE 4BDFA 4PPAA 2BTRA 4QOXA 4XOYA 5EQYA 4HYSA 2PE0A 3EFKA 2ERKA 3P23A 4CCBA 4RJ5A 2R3RA 5M53A 2JDSA 2GHGA 5CX9A 3WE4A 2JLDA 4MD8E 4JG8A 2YIWA 3IOPA 4HGSA 3PA3A 4FNWA 5IUIA 4RIWB 5CAUA 4I22A 4MWIA 4FV9A 4IHPA 3BU6A 5E9EA 2XM9A 4S32A 3TDVA 1IA8A 3C50A 3H9OA 3QKKA 3AG9A 4XG2A 3G33A 2OJ9A 2JBOA 4FOBA 1KV1A 2Y6MA 5JGAA 5HD4A 4CRSA 3LMGA 4BWXA 4FV0A 1R0EA 4CFWA 1CKJA 5AP2A 4IB3A 3R28A 5I9ZA 4DTKA 4BWPA 2YIQA 3RGFA 3C0IA 2KULA 4ZOGA 3QLGA 4R7BA 3ERKA 5FM2A 4BKJA 4AGUA 5AV2A 3SXRA 4O7VA 4DT8A 4RJ7A 2H34A 2WHBA 4AA0A 3FUPA 4AP7A 4IC7A 4IX5A 5D7AA 4CZYB 4CGAA 2I0YA 5ACKA 3QFVA 2I6LA 2X8DA 4HJOA 2ZM4A 3JUHA 2XUUA 3LXNA 4FTIA 3VIDA 4HYIA 4EK4A 2VNWA 3PLAE 5DPVA 3CQWA 1JLUE 1XH6A 4IC8A 2GPHA 4MF0A 4OBPA 5BX0A 3A7JA 2X0GA 4EKKA 2OI4X 1W0XC 5K0KA 1PF8A 3LFDA 2R3NA 2R3KA 2IW8A 1OBGA 2GQSA 1MRUA 4D4RA 4EWHA 4E6QA 2GNGA 2J0MB 1U5RA 3PRFA 4MAOA 4DFLA 5GZAA 2WOUA 4U6RA 3UNJA 2DWBA 3UG1A 2X1NA 3KN5A 4KIKA 3EQCA 2YWPA 2GNFA 4CFUA 3DKOA 5IA2A 5M4IA 2C3JA 2Y4IC 2WMRA 3NYXA 3O2MA 2Y6OA 4I6HA 4F7NA 4F7JA 2Z7SA 1J7IA 4O7LA 2QHNA 5J9ZA 3FZSA 3FQEA 3VS4A 3MS9A 3QTWA 3HMPA 5LWMA 2C30A 4DGMA 4GYGA 4CFVA 5J9YA 4LRJA 3A4PA 4X2JA 4B0GA 5FEQA 4ZSGA 1TQIA 3BLRA 4C4GA 3Q04A 5BVKA 4RT7A 5C8NA 2IW9A 1JKTA 2O64A 2VZ6A 3DKCA 4IB1A 4F1MA 2ZM1A 4I20A 3DB6A 4RJ3A 3N4UA 5IA1A 4BCJA 4JQEA 4KAOA 3AGLA 1Y8YA 3UPXA 3AC5A 3UDBA 3U9CA 4BCOA 4ZJVA 2XNBA 2QO2A 5AAFA 3GXLA 4XUFA 4DH1A 4CFFA 4NZWB 3VUGA 5IQGA 2J0KA 2W1CA 4QP2A 3U87A 2F49A 4ENYA 5AA9A 4MXOA 3G51A 2GS2A 3MA6A 3R1YA 2V0DA 3O17A 5CVHA 2ZAZA 1XBBA 4C38A 4D2TA 3KVWA 3L8XA 3COMA 3I79A 4E8AA 1IA9A 3WILA 2UZEA 2PZ5A 4RVTA 4FSNA 2W1ZA 4PUZA 4IWPA 4QMXA 4H1MA 3IW6A 3GB2A 4F9WA 3ORPA 1SM2A 3DZQA 2G2IA 4AUAA 2EXCX 3E64A 4YLLA 3QHRA 3PWYA 3LCKA 2E9OA 4OTRA 5CF6A 1FMOE 3BGPA 4YJTA 5EW3A 4PP7A 4NEUA 4DE4A 5ACBC 2E9NA 2EU9A 4EH8A 4IAKA 3HAVA 3V5JA 4IVDA 4DH5A 4MXZA 1RDQE 5AUVA 4RJ8A 5HVKA 4FNYA 4PMMA 3SRVA 4FKLA 4F70A 3COHA 2YLFA 2YM5A 2HENA 4XBUA 5DE2A 3W2RA 4BHNA 5A6OA 5JFWA 4FIHA 1K9AA 3Q5ZA 3ATTA 4RC3A 3GC0A 3HUBA 4G3CA 5F94A 4BZDA 2IWIA 3MDYA 4TNBA 4UWCA 3WARA 4Q9SA 1OL2A 4NCTA 4U3ZA 3CC6A 2WEVA 5JSMA 2VRXA 4TYGA 4FNXA 4I5PA 4AACA 4M97A 4DG3E 3BLHA 3H0ZA 1ZOEA 2IZTA 2YLEA 3NNVA 1JKSA 4MBIA 4P5ZA 1YWVA 2YZAA 4WT6A 4ZTQA 4B99A 4ZTLA 4EORA 2QLQA 3NLBA 2XM8A 5CXHA 2QODA 3FC2A 5LVMA 4CTBA 3C4WA 1VEBA 3CY2A 5CVGA 2HZNA 3SOAA 2WMSA 1W7HA 2YFXA 3OOGA 5LMKC 1BL6A 4BDJA 3FKOA 4KBAA 4U8ZA 5DNRA 3QCXA 4Y5QA 4O81A 3V5WA 4CSVA 5I9WA 5JFXA 3PE1A 4FKQA 4K9YA 4U9AA 5EHOA 2OZAA 5HU9A 4YZCA 4I0RA 4BBFA 3ZU7A 2G1TA 5B2MA 4YSMA 4UZDA 3FYJX 3QA0A 4EZ7A 5A4LA 1KE9A 2PMIA 2VWZA 3KMMA 2W1EA 4BVUA 1KE6A 4RZVA 2C5VA 3D2KA 1MP8A 3FY0A 4UXQA 3ULIA 4BHZA 3RINA 3PVGA 3M2WA 3U6HA 3Q9XA 5H8EA 4QP7A 4ITIA 2IVTA 4W4XA 4ZJIA 2X2LA 4H1JA 4CVAA 1OGUA 1PMNA 4F9YA 2XK3A 1UV5A 5CU6A 3OCTA 3OT8A 5AIKA 4D55A 4EK8A 3MESA 4A9SA 5HE2A 3HRCA 3KCFA 2QOCA 2HCKA 1I09A 2F57A 2G01A 3UOHA 2I0EA 2ITQA 1Y57A 3DTCA 3PJ1A 2BAJA 1H24A 2QI8A 2XP2A 3G5DA 3UIBA 3AT2A 4ARKA 4F6UA 4AOTA 4AW1A 4CMOA 3AD6A 3GU5A 3ETAA 4XP3A 5A46A 4FODA 2XNNA 3WF7A 3NAYA 3VC4A 5I5ZA 3DA6A 3CGFA 3QCQA 5IZFA 2VGPA 4U5JA 2EB2A 5CEQA 3WF9A 5GIPE 3LZBA 4HVIA 1U5QA 3OCGA 1QPDA 3KL8A 4XYFA 4C61A 3TG1A 3MV5A 4FVRA 2WZJA 3O8UA 4E5WA 1YWRA 3F88A 3R7VA 5LWNA 3A8XA 5B0XA 3IONA 5G1XA 3A7HA 1F5QA 4G3GA 4L42A 5C9CA 5EDPA 5HGIA 3S95A 3R30A 4EBVA 4O0WA 1ZXEA 2C6LA 4M7IA 3FZOA 2CPKE 4G9CA 5EFQA 4CCUA 4UYAA 5EI6A 1KSWA 1H0WA 3QCSA 4FG9A 3CY3A 4GK3A 4LRMA 2ZV9A 4M84A 4O6LA 4FSWA 2Z60A 3LHJA 3MSSA 5DI1A 4AGCA 5IMEA 1W98A 2W7XA 3NPCA 3O7LB 4PPBA 5IUHA 5LXMA 4N70A 3TEIA 3D2IA 3HDNA 1XBCA 4FICA 4WG5A 4ALWA 3G9LX 3ORTA 5L2WA 4WUNA 4KNBA 1URCA 3VUIA 4EHVA 4L00A 2ETKA 5IU2A 4YNEA 5FBOA 1MUOA 1M52A 2P55A 5EK7A 3SA0A 5DYJA 3JYAA 4GYIA 3OEZA 3G2FA 2WXVA 2GNJA 3EN7A 4PDSA 4CNHA 5CASA 2W0JA 4UEUA 5CU3A 4JDIA 3P1AA 4YC6A 3R9HA 1PRYA 5AAEA 4PDPA 4I6FA 2WQNA 2W17A 4GFOA 4YJNA 3NAXA 3DK3A 4EH5A 2J50A 2V55A 4FEWA 1ZOGA 3HP5A 2RL5A 4DFNA 4KRCA 4BB4A 2W1FA 3U55A 3VWAA 4CQGA 2GQRA 3TUDA 4IZ5A 1RJBA 1OKVA 2JIVA 3HEGA 3M11A 4C33A 2RFDA 2WFYA 3CP9A 3HMOA 2PVYA 4ANLA 3K2LA 2ITVA 1OKYA 4F6WA 2BKKA 1MRYA 5C26A 3MFTA 4ACGA 1A06A 3CKWA 4XP0A 3HA6A 4BGGA 2X7FA 1EH4A 2YM3A 3G90X 3KB7A 3PIYA 2BIKB 3LW0A 5GJFA 2CGVA 1P4OA 3DFCB 2JKKA 2GQGA 3HECA 5FBNC 3RALA 5FG8A 1BUHA 4YO6A 4O1OA 3TV4A 2ITYA 1YOLA 1J7LA 3R63A 4FV2A 4YZBA 2VUWA 3QQGA 2W9FB 5LVOA 4EJNA 4ZSEA 1ZARA 3FLZA 3QZGA 1DI9A 4YTIA 2BRNA 4K33A 3PJ8A 3P79A 2PMOX 3T9TA 4QTAA 3KFAA 3SAYA 1NXKA 3WF6A 3PDTA 4U45A 2UVYA 4D2VA 4ZIMA 1JQHA 3DAEA 2G2FA 1PXMA 3DBDA 5FM3A 3GC9A 2PYWA 4CFMA 4CEGA 3DPKA 2ESMA 4CT2A 3WZJA 4CRLA 2W06A 3EHAA 1H1PA 4ID7A 4XOZA 4C2VA 3M42A 4C57A 5D41A 3HZTA 1H8FA 1GJOA 3D4QA 1DS5A 3AC2A 5AR3A 3MI9A 4YSJA 1OITA 2B53A 2WAJA 1UWJA 3H0YA 2OIBA 4BCGA 1NVRA 3U6IA 3FLWA 3A8WA 1HCKA 5DWRA 3HV7A 5AR5A 3VHKA 4CXAA 4O7ZA 3I0OA 4GEOA 4JNWA 1H26A 3JS2A 2JIUA 3KXXA 3D0EA 3DK6A 1WZYA 3JY0A 4JIKA 4HCTA 4CMTA 2YIRA 3BHVA 4TT7A 3VJNA 4XG6A 4E4MA 2C6OA 3FHRA 4GW8A 1PY5A 4GKIA 3F2NA 2X9EA 2XIRA 4R7IA 3LMHA 3NUAA 3D7ZA 1U54A 4X6RA 2QU5A 2PY3A 4H3PA 3A2CA 4UMPA 1KUTA 1SVEA 3MIYA 4JBOA 2P2HA 3GU8A 3L8SA 2CNQA 2NRUA 5T3QA 4E26A 4ASEA 4NFMA 2VTMA 2YA9A 5G6VA 2PULA 4E4XA 3CQUA 2BDJA 3EQHA 3JXWA 4AZTA 3OMVA 3VS3A 5CQWA 4OW8A 1J91A 2R0UA 3JPVA 4FKSA 4FNZA 3QQHA 4WKQA 5M09A 2QR7A 3FQSA 1MQ4A 4LRKA 2VGOA 4QMSA 5DOSA 3NUSA 4O21A 2XMYA 4AZFA 1JSUA 2PVMA 1UU3A 4O2ZA 4KA3A 2JIIA 3OBJA 3ELJA 2GHLA 4AGWA 3Q9YA 5F20A 2VTTA 2RF9A 2XK9A 2PUIA 4E20A 2RSVA 1NT2A 2PK9A 4RWJA 4YZ9A 3Q60A 2JKQA 3DZOA 3QXPA 5EI8A 4J97A 5ANKA 4PL3A 2AC5A 2HW6A 5J7HA 5FTQA 4FYOA 3TZ9A 1T46A 2C3LA 4MTAA 3SXFA 3PTGA 1ZLTA 1IRKA 3R00A 5DT3A 4M8TA 1FVRA 3MN3A 3QTSA 4RRVA 4ANNA 3FLNC 1CKPA 4WBBB 1ZZLA 2Q0BA 4A7CA 3AMAA 4M0YA 2C6TA 3QZHA 3GGFA 4JDJA 3VS2A 5JK3A 5IPJA 5AUYA 4L7FA 2LGCA 3IDCA 4GIHA 2ETMA 4G16A 3UNZA 3VS6A 4X3FA 3SW7A 4JDHA 4X2GA 4AT3A 3KC3A 2RKUA 3MH2A 1QCFA 4QP3A 2HELA 3N9XA 3H4JA 3M1SA 5HBEA 3QD2B 4LL0A 4FTCA 5I9VA 3O51A 4WO5A 4ACDA 3TNPC 4NK9A 1NVQA 1OKWA 1R39A 1PYEA 3A7IA 1OL1A 2PSQA 4Q9ZA 5E4HA 1OIYA 4GK2A 3QGYA 4I4EA 3NCGA 2OIDA 2UW3A 1SNXA 3LFFA 1L3RE 3EN5A 2QVSE 2H9VA 3IK3A 4TRLA 2PE2A 4QP6A 3LMIA 4DFBA 3PXZA 2HZ4A 2BRBA 4W8EA 4B6LA 3BQCA 2Y7JA 3LE6A 5DT0A 2I1MA 4IFGA 4XJ0A 4FKJA 2YZLA 2CDZA 3FKLA 4JRVA 2FA2A 2RFSA 2G15A 3COIA 4O0SA 2ERZE 5HOAA 3ZUVA 4CTCA 3NYOA 5CAQA 5KE0A 4RWKA 4GU9A 2XIKA 4TWNA 4RA5A 1PKGA 3CSVA 5J87A 3S3IA 3I6UA 4FT0A 4ZMFA 3W10A 4M68A 4PF4A 4C59A 1LUFA 1H07A 3BX5A 4FTOA 4DEGA 3LJ2A 4CLIA 4DYMA 5AP6A 3QQKA 4AQCA 1PYXA 3R9RA 4BY9E 5L2SA 4BTKA 4QTDA 2JGZA 3L9MA 5IQFA 4DLJA 5C27A 1ZMVA 2UV2A 2YM8A 3NUNA 2PVKA 4FTLA 5HQ0A 4YJQA 1JKLA 4AZSA 5CZIA 3MW1A 4AW2A 2B55A 5D1JA 2HY0A 3COKA 3OW3A 4FT3A 4R3RA 2BZHB 3VS1A 1OIQA 4F0IA 3IS5A 4Y73A 5DR6A 1W83A 4K11A 5E91A 5C03A 4RLLA 2ONLC 4HPTE 3IGOA 3LQ8A 1KE8A 4RWLA 3AXWA 4W4WA 5HCXA 1XH9A 3RPVA 1M2QA 3NUPA 3DV3A 4QMVA 5KZIA 3SOCA 3K3IA 4ZSLA 3NX8A 5HLPA 5IA4A 2UVZA 5FEEA 4GKHA 3ZUUA 4RJ4A 5LCJA 3FMEA 5T6KA 1WBOA 2FH9A 1DI8A 3G0EA 4V05A 4X3JA 3IW8A 3F3ZA 3OCBA 2UZVA 3QA8A 4JR3A 3LQ3A 3MFRA 3Q5IA 3QLFA 4R5SA 4RIWA 4ZK5A 4NUSA 5JQ8A 1VR2A 2X7OA 4KSPA 3U8WA 3JVSA 3EFLA 3G15A 4USEA 2X8EA 4EH4A 4EQUA 3L8VA 4MKCA 4TW9A 5AA8A 3IGGA 2BHEA 4QPSA 3BIZA 3ZONA 4WRGA 5KBQA 3FMKA 3OEFX 4ZTSA 5J5TA 4CKIA 1OPLA 5FUTA 4LOQA 5HO6A 3UYSA 2C6EA 4RVMA 4JG6A 5CYIA 1NA7A 4D5HA 4V04A 4F0GA 4DA5A 4NW5A 1STCE 4CV8A 5I3RA 2X4FA 1ZYLA 3EYHA 4UMRA 2Y9QA 5HLNA 2CKEA 2ITUA 3QC4A 4QTCA 3SLSA 1R0PA 5F1ZA 3KA0A 3QZIA 2XNMA 1Y8GA 5K4JA 2XEZA 4TL0A 3R1NA 3BEGA 4Y83A 1O6YA 4R1YA 4X2FA 4GK4A 5H2UA 4JL9A 3RZBA 4UN0C 5BVDA 2B1PA 4U40A 3NW7A 4BI0A 3G6HA 4DGLC 3VW8A 2OJGA 2VAGA 1NVSA 4JBPA 3OXTA 1AQ1A 3PYYA 4FTAA 3RAKA 2UW7A 3P86A 2QOOA 3D15A 4QRCA 3EFJA 4MXAA 5CAOA 2QC6A 2B54A 5CXZA 4FUXA 3MVJA 4QQCA 3LFSA 4Y72A 3SVVA 3Q53A 3KXZA 2OGVA 3ORMA 2F7EE 4FSZA 3QX4A 4MD9E 4EOJA 4JAIA 2BRMA 3PUPA 3OWLA 3Q2MA 2Y0AA 4QPAA 2WQOA 4USDA 4PV0A 5AV3A 1OVEA 3MH0A 3TZMA 1VJYA 2QCSA 3FAAA 4ZTHA 4AAAA 2DQ7X 3E3PA 2VTHA 1YXXA 4O0XA 3VNTA 2VTJA 5IUGA 5EG3A 5IDPA 3KCKA 3ZO4A 4TN6A 1ZY5A 4BZNA 5BNJA 4IX3A 5IQDA 3VBXA 3DLZA 1WMKA 3EQDA 4FV1A 4JRNA 3AC1A 4UXLA 2C6IA 1Q97A 3F5UA 4FMQA 4J7BA 4JJRA 4A4OA 3II5A 1YVJA 2I40A 3CS9A 3VS5A 3A99A 3NW6A 3PJ3A 2JFLA 3POZA 1E1XA 4FG8A 4KINA 4KB8A 3W16A 3ZCLA 5GINE 3EFWA 3ZZWA 4JT3A 5I3OA 5L2QA 3U51A 3ZFYA 1G3NA 3D14A 4C7TA 2WMXA 2VTPA 3AMBA 3IW7A 3PFQA 4QMWA 2F7ZE 2EWAA 4IWQA 3KXGA 3A7FA 4KKHA 4QYEA 3DJ6A 4RFZA 5AUXA 2F9GA 2WMWA 4HZSA 5FWKK 3FI3A 1JKKA 5JH6A 4UWYA 1PXJA 3ET7A 2PTKA 5AAGA 1BI7A 3TIZA 2QG7A 2JDTA 2A1AB 2XJ1A 4S34A 4D4YA 3R02A 4L45A 3RTPA 4C4FA 2HK5A 5HTBA 1HOWA 1M17A 3TDWA 2PWLA 3BCEA 3IO7A 3OW4A 5TOZA 1UKHA 4MX9A 4B9DA 2ZV2A 1AD5A 4TY1A 4YJRA 4NKAA 3V04A 4BRXA 4ERKA 4M67A 2HZ0A 4JBQA 4FA2A 1OKZA 4C2WA 2YDKA 3KMUA 2X9FA 1FQ1B 2C68A 3IDPA 4P7EA 5D10A 4YLKA 4ASDA 4WNKA 2X8IA 2PVFA 5AMNA 3MJ2A 2XKEA 4TXCA 4DLIA 5L8LA 1H01A 4RIXB 3W2CA 4DFYA 4EK3A 2F2CB 3OWJA 5LMKA 3TUCA 3QAME 3ALOA 1XH4A 3Q52A 4EQCA 3QD0A 4A06A 3HVCA 1GOLA 4MF1A 3ZSHA 3TJCA 4IE9A 2QKWB 3BKBA 2QG5A 2BFXA 4IAZA 4JLCA 4RFMA 3TN8A 2FSTX 3WZKA 2IVSA 2XNGA 3R7GA 3UIMA 3TJDA 2BRHA 4AE6A 4LMUA 3VBYA 1OUYA 4AE9A 2C5YA 4LG4A 4WNOA 2EUFB 4HVHA 1BKXA 4KWPA 2JKMA 1KWPA 1YHSA 4PMSA 4I23A 4RA4A 2C1AA 2YABA 4MWHA 2PHKA 4M69A 3D5XA 4ZZNA 3H9RA 3AD5A 3QQJA 4GT3A 3ODZX 3V3VA 4QP1A 4HNFA 2J4ZA 4TPTA 4FSTA 5CU4A 2QHMA 4A4XA 3VF8A 2YAKA 2OIQA 1XH8A 2P2IA 4YTHA 5TE0A 2QO7A 4Z7HA 5J5SA 5IQCA 4YHJA 4NM7A 3LFAA 2X2KA 5EDRA 5KMOA 5ETCA 4MNEA 4EUTA 4GT5A 2R3LA 5M4FA 2ITNA 5AP5A 5HCZA 4D28A 3QC9A 4F9BA 3ULZA 5GJGA 4M14A 4IMYA 2HXQA 5EYCA 3GU7A 1XR1A 2YISA 4PTEA 2CCHA 4K6ZA 2I7QA 5CLPA 2WMUA 3UIUA 1JOWB 4HGTA 4FC0A 1UVRA 3FPQA 1UNGA 5A14A 5JQ5A 3C5IA 5HO7A 5ANOA 2R3JA 5GZ9A 5KKRB 2ETRA 3ZTXA 4K8AA 4YUQA 4NW6A 4I1ZA 3RPSA 3MB7A 3GENA 5A3XA 3NYVA 4OTPA 3VW6A 5E8ZA 4U97A 5HESA 3F7WA 2OBJA 4M13A 2I0VA 3HRFA 5A54A 2FUMA 2YACA 3C0GA 3BWFA 4YNOA 3MPTA 3ZYAA 5BVEA 1FPUA 4CQEA 4QO9A 4MH7A 4Y8DA 2RGPA 4FIFA 1TKIA 2XKCA 5DFPA 3VVHA 1B6CB 3R22A 4O22A 3UVQA 3RVGA 3E7OA 4C58A 3DAJA 3MY5A 3Q3BA 3WI6A 5CAVA 1GZNA 4E3CA 2VTLA 2GS6A 2RG5A 1BX6A 2WU6A 4FGBA 2OKRA 2BPMA 4RQKA 4F08A 1Q4LA 3F9NA 1ZYSA 3LOKA 3SC1A 4JOAA 4BI2A 4C35A 4D2SA 2HYYA 2ZV8A 3EN9A 4IQ6A 5JZJA 3TNQB 4DEDA 4D2PA 4YHFA 3UMWA 2YM4A 2FB8A 2R0IA 4Q5EA 4UY9A 3EKNA 4QTBA 2WQEA 2VO7A 4L8MA 2UVXA 3I5NA 3AT3A 4FYNA 3SDJA 5IISA 4EC8A 2NNWB 5E8TA 3UO4A 3I4BA 3LLTA 4ITJA 4H36A 4IZYA 2A4LA 3PG1A 2EXMA 3FXXA 4ZY5A 5CU0A 3KF4A 5AP0A 4ALVA 1GZOA 4IM0A 4JI9A 2JDRA 1ND4A 4QQJA 3LLAA 3TWJA 2R5TA 5DN3A 3F5GA 4BDDA 1YDRE 4FVQA 4UYNA 4DBNA 1WFCA 3H3CA 2QD9A 3DJ7A 3GEQA 5CI7A 3RK5A 4C37A 4ZZMA 3ORIA 2XCHA 2E9PA 3LM0A 3P08A 4D1XA 2VTQA 1RE8A 2OXYA 5CTPA 4Z9LA 5K9IA 4FVPA 1UWHA 5E90A 2PUUA 3ZBFA 3VULA 4JXFA 4IVAA 4L01A 4TWPA 5M56A 2I0HA 3KULA 2J0LA 2PVNA 3SD0A 3E88A 3ZC5A 3Q6UA 3QUDA 3E8DA 3KRWA 4FKRA 3QYWA 1IEPA 4ZLZA 3MJ1A 1G5SA 5KX8A 5E8XA 3QTQA 5IA3A 3KRXA 2WTVA 4E5BA 1ZYDA 4G6OA 4FL2A 5AUUA 2WPAA 4BR3A 1O6KA 4G34A 4O0YA 5K0XA 3W8LA 3IKAA 3PA4A 4KS8A 3DXNA 4FR4A 5E1EA 5AP3A 3BYOA 2JAMA 4CKJA 4AX8A 4QQTA 4FKIA 1OPJA 4QMYA 3BYVA 4ACHA 4U42A 3GU6A 4AOIA 1E1VA 3NCZA 3UG2A 3UVRA 3Q2JA 4MCVA 5FQDC 5EKNA 2XRUA 5BMMA 4IAIA 3ZM9A 2JBPA 3FMJA 2OF4A 4X21A 4QMOA 5AP7A 4ANQA 2BDFA 4YURA 1BI8A 1PXOA 1XQZA 4GCJA 3ENMA 3GBZA 4IAYA 4D0WA 3E8NA 3UC4A 4UALA 3FMMA 4FG7A 3UQFA 2X81A 3RCJA 1IG1A 4II5A 3TIYA 3F2AA 2WB8A 4AT4A 5L2TA 3ZZEA 2WELA 4UMTA 4UX9A 4WNMA 1YI6A 4GIIA 3VJOA 4NL0A 5IH6A 3KRLA 1OI9A 2XYUA 3OROA 3P7CA 3ZLSA 1Q62A 4GSBA 5TF9A 4LV8A 3TTJA 3I60A 3ZOSA 5CALA 3PY3A 3TKUA 4ACMA 3C1XA 1R1WA 4NM5A 1W82A 4LFIA 5KCVA 5CEPA 5IEXA 3PPJA 4LUEA 3TI1A 3KEXA 3QYZA 5CNNA 1JBPE 5LJJA 4PX6A 3T9IA 2OW3A 4QMTA 5E1SA 4OTIA 3EQPA 4ZXTA 1XKKA 3V6SA 5C4LA 1ZYJA 4R78A 1YDTE 4FSUA 4FIEA 4EHZA 2C6MA 3F3TA 4ZLYA 4MBJA 3BYUA 1K3AA 5FGKA 2A2AA 2XYNA 1U59A 1YWNA 2JITA 3FZTA 4OTFA 5DR2A 3PLSA 3UGCA 4CYIA 3PWDA 3GC8A 3WYYA 5M06A 4RIYB 4BDAA 3KN6A 4I0SA 4O0UA 4O96A 4DEAA 3CQEA 2QKRA 2VX3A 3N51A 2ZB0A 2XNPA 2AUHA 3C4ZA 1XHAA 4I41A 5BVWA 1W84A 3A60A 3PXKA 4F63A 2R3QA 2F4JA 3TZ7A 4U79A 5GNKA 4IFCA 3OUNB 5D9HA 1LEZA 4D4SA 2QLUA 3QXOA 2YIYA 4I94A 3F3UA 4E4LA 1YXVA 2VWUA 2WTKB 2W4OA 4L3LA 2JKOA 5AP4A 3ZM4A 3UIXA 2XK7A 4KBCA 4NM3A 5HEZA 1V1KA 1PMVA 3NWWA 3ZH8A 2C0OA 3GQLA 2RIOA 4J52A 2XJ0A 4EYJA 3NIZA 2BAQA 4QP4A 1FMKA 2C3IB 2O65A 2WTIA 5ICPA 3R2BA 3NVKI 3E93A 5CF5A 5HX6A 5M4CA 5DR9A 2OFVA 3NZ0A 2O0UA 4IVCA 4L52A 5J79A 3TT0A 1BYGA 5HE0A 4AOJA 5GHVA 4BBMA 3QD3A 4EOMA 5M4UA 2XK8A 3JVRA 3HKOA 3QZFA 3UOKA 4CLJA 5AR7A 3R1SA 4HZRA 3I0QA 4R3CA 2OZOA 1WAKA 4JS8A 3OHTA 5DVRA 3NYNA 4BDBA 4AF3A 4R8QA 4LUDA 4R77A 1IR3A 2OFUA 4U0IA 4E6DA 3HMMA 3BV3A 5FXSA 4WIHA 5GJDA 4YR8A 3D7TA 1F3MC 4YTCA 2IVUA 3OD6X 1RQQA 2R3IA 3ZHPC 3ZLYA 5L6PA 3JR1A 2HWPA 3CR0A 3EQGA 5CT0A 1W8CA 4J96A 4C0TA 2BVAA 4B7TA 5AM7A 4GJ3A 2ITPA 4YBKA 3AC8A 4NT4A 4F9CA 2J5FA 1YXSA 4AGDA 3R7IA 4ZSAA 3AGMA 3EMGA 3TCPA 3WOWA 4O7TA 2UUEA 1J1BA 3DBEA 4RFYA 4BWKA 3AT4A 3C4XA 5M08A 1NY3A 1J1CA 4EKLA 4MVFA 3BZ3A 4GV1A 3SHEA 1YRPA 4OBOA 1XJDA 3ZS5A 5I0BA 4PL4A 3U4UA 2C47A 2GFSA 4LGGA 2H96A 4LYNA 2ONLA 3HX4A 2UZTA 4BDHA 3NUXA 5E8VA 1REKA 2YIXA 3ZXTA 4Z55A 4FTKA 2CMWA 3FLQA 4R1VA 3DXQA 1Q5KA 3O8TA 1Y6AA 4Q2AA 4C62A 3FXZA 5HG9A 5K3YA
chains in the Genus database with same CATH superfamily
2BMCA 3VDPA 3AV0A 4JX3A 4CJ6A 1IXRC 3O0GA 4RC2A 2VN9A 4YZMA 5LMAA 3OTOM 1TQMA 4JV5M 2HZIA 4M66A 4MK0A 4YJOA 3VDUA 2WTJA 3GPXA 4ANSA 1I4WA 1YKRA 3HJ8A 2D7EA 4W4VA 3LFEA 4XNEA 3FL4A 2E9UA 4NSTA 4PP9A 3THBA 3TKIA 3GT8A 1KE7A 2Z7LA 5E8UA 2R7IA 3I7CA 4U44A 1PJQA 3DKFA 5KPTA 4GC9A 1H1QA 5IQEA 5CSVA 1XBAA 3PSCA 1T3TA 2ZJWA 3QTUA 1UFZA 3ALNA 4MQ1A 3T38A 2BR1A 5EHYA 2QCUA 3HA8A 1GIJA 3O23A 3EJ1A 5AV4A 3W2SA 1NJFA 2UZLA 1UA2A 2IJMA 3T8OA 4U43A 1CMKE 4K0YA 2VTAA 2BZJA 2C5OA 5E7RA 5IA0A 3U9NA 4RG0A 3KK8A 1H1RA 4V0GB 5IEVA 3PNVA 5DLSA 3RI1A 3PPKA 1ZRZA 4RX5A 4BYJA 4QOZC 1UU8A 3DT1A 4D80A 3THGA 1L2DA 2JFMA 4PNIA 4X66M 4E7WA 1QPEA 4N57A 5HTCA 2C4GA 1Q8WA 2UZUE 4RIXA 4ANNA 5HICA 1IAHA 4QYYA 4KBKA 5IH4A 3Q4ZA 3Q4TA 3LKMA 2VX0A 3LIJA 3C5UA 2W99B 3FZPA 2Y0QA 3UTOA 3S0OA 4FV5A 2W4KA 2WMVA 4FKWA 2CKOA 1VLRA 2UUAM 1YLAA 4N6YA 2F5NA 2X0OA 4FZFB 3A46A 2OO9A 3P5KA 2BKZA 3LFQA 2GHMA 3FEGA 4FEXA 4DH3A 2E2BA 2M60A 3RP9A 3EYGA 3BV2A 3CCNA 4M0ZA 2W4JA 4XEYA 1FGKA 5BYYA 1TVOA 3GLIE 3K9OA 3KOWE 3UJGA 2BRGA 2VWVA 3MTFA 3EQFA 3CXWA 1YHWA 4PCZA 3GCSA 3U6DA 4H39A 5KBRA 4YMJA 2YCSA 2QO9A 2WMTA 5CF4A 3DDQA 5BVFA 3GFEA 4KKEA 3ANQA 1VYZA 5TKDA 5JGBA 1LPUA 4PL5A 2C5XA 4HGEA 3WBLA 3VBTA 4EK6A 5DIAA 4B7GA 2O01F 3L1SA 4NTTA 4R6VA 5BYLA 2WQBA 4O0TA 4XG9A 4GFMA 5HX8A 4X7QA 4Z7GA 4DCEA 3KDSE 3IW4A 3MWUA 4ANBA 3GRUA 4BCMA 1QAOA 2Y4IB 4FEQA 2W5BA 3MK6A 1L8QA 2KNAA 2G9XA 5BYZA 2F5PA 3G0FA 5E26A 4APPA 3C58A 3KY2A 3MBLA 2A5YB 1IBLM 2YAAA 1WVYA 3KU2A 2G2HA 4L6V6 5J1WA 2UXBM 3VK7A 2P33A 4KKGA 4DT9A 1TFFA 3NEWA 1NW1A 5EDQA 4A9TA 5BMSA 3VQHA 3ORZA 3AOXA 5AR4A 4YP8A 1V0PA 4C4HA 2AC3A 4DV5M 2IN6A 2NP8A 4A9UA 3MA3A 4QHSA 4CZTA 4D2WA 3P5JC 3DBCA 3R9OA 2J51A 4FTTA 4RIYA 3HGKA 4L3PA 3WIGA 4LJ7A 1WBSA 3OS3A 2DWZB 5CSPA 3LXPA 1N36M 4FT9A 4W9WA 2CJMA 3GP0A 2XFTA 5ETAA 2X6DA 3I04M 2H5XA 3GLHB 3DBFA 5IQHA 2KTYA 2DWNA 2B52A 4BCPA 4M12A 4XV3A 3CTWB 1YDSE 4FKVA 3LQRA 3Q96A 4QYFA 3U6JA 3ZEWA 1ZMWA 3HV4A 4Y5HA 1ZYCA 4YHTA 2CSNA 3K3JA 3DS6A 4DGGA 4LV7A 4AZVA 3OZ6A 1GNGA 3L29A 3UDTA 4I4FA 1XXHB 5DRDA 2HHHM 3EZVA 3RM7A 4I5CA 4LJ9A 2GU8A 3W2OA 4RPVA 3OWPA 3LM5A 3Q4UA 3GOPA 3FE3A 3KRJA 2YJSA 4IXPA 2UW9A 4DV1M 4IVBA 2VWBA 3DQWA 2O8YA 3C7QA 2VO0A 1FINA 2QSFX 4G4NA 4CMUA 4HPUE 5AIRA 4L6QA 3Q6WA 4TNDA 3R83A 2IPXA 1OL6A 2W05A 2ZV7A 1OUKA 4NWMA 2RFEA 3L27A 4DG2E 4NM0A 4UBAA 2CLQA 2JD5A 1SZMA 2DKLA 3IOKA 4QMZA 2UZOA 3FD9A 2B0QA 4C02A 3SBJA 3B74A 3OXZA 4IJEA 5HCYA 3LFNA 4XRLA 2KW0A 4ZEGA 4BI1A 3BEAA 3G9NA 3KK9A 3R8FA 3LJ0A 4DG0E 2OOBA 2VTSA 3BYSA 4AXEA 5BR8M 1JWHA 3FPMA 4C34A 2FSLX 3TQSA 1URWA 3MPMA 2IVVA 2PUNA 2I7PA 1XO2B 3EIDA 3QKLA 1ZV1A 3W0FA 3GLFB 3VUHA 1K2PA 2BALA 3SKCA 4E73A 3PPZA 4LM5A 3I51A 5CANA 2XH5A 2ZB1A 4M15A 2XFSA 2Z3XA 3V5PA 1HCLA 3HHYA 5M57A 3ZLXA 3ORNA 4WW0A 4ANRA 2YITA 4JX7A 1E9HA 1T45A 3UOJA 3BQRA 4RWIA 1M7NA 3QL8A 1N75A 4N6ZA 3QTRA 3TTIA 2BZIB 3RAWA 4FKPA 4GVAA 1A48A 2HXLA 2BIYA 4FV8A 2HKJA 4L46A 1IN5A 3HJSA 3J80S 3VRZA 1REJA 2Z7QA 2CLXA 5EHLA 4KIQA 2OWBA 2F5SA 2XEYA 3BHUA 3BYMA 2QHOB 2F7XE 3OY1A 4EH6A 3CLYA 4C4EA 5EP2A 2XZSA 3HV6A 3QALE 4DR1M 3IW5A 1H00A 3RK9A 3VBVA 4B08A 5EXTA 5HHWA 4PQNA 3UO6A 4II7A 2XZUA 2C6DA 2QQ7A 4WSYA 4U41A 3PVWA 3A7GA 4PRJA 3PNYA 3DQXA 3UP7A 4G6LA 5FXRA 2IZUA 5I9UA 3NSZA 1XB2B 1DO0A 2J2IB 5HZNA 4BTFA 4AN3A 5JGDA 3ZMMA 3R2YA 2JZ0A 3K8ZA 1YOMA 5CWZA 3LCOA 5M07A 2OJIA 5DBXA 4I6BA 3FLYA 3LFCA 4BL1A 2BWBA 2XSZA 5HNBA 4C3RA 1O9UA 1LV7A 2P4IA 5CT7A 5HIDA 4CG8A 4ANOA 3FBVA 5EH0A 3ID6C 4W8DA 4EOIA 3BWJA 4DCAA 3RCDA 4GRBA 3V76A 4EOKA 1JQJC 1Z5MA 4HCVA 5ITAA 1UKIA 4AN2A 3PXQA 3RPYA 4J8NA 4OLIA 3CPBA 2UW8A 3HLLA 4PDIA 3DU8A 1M2RA 2WGJA 3O8PA 4EWQA 5K5NA 4EI4A 4YZNA 3SHFA 4FZ6A 3GP1A 4YJPA 4OUCA 1YI4A 3ZFMA 3F2RA 4OX9M 3FJQE 3ZFXA 2XF0A 3UYTA 2B3TA 2A19B 1WBWA 5M55A 4XG3A 5EYKA 2C5RA 5FTGA 3I1AA 1KOBA 4IDTA 3PVUA 4GHLA 4FZDB 4XV9A 3UPZA 3MFUA 3KMWA 5ETFA 3EB0A 2F2UA 2W5HA 2VU3A 5C8KA 4ENXA 4IIRA 4NIFA 4KHPM 4JQ7A 4MD7E 5IG1A 2JDOA 3MGYA 1JPAA 3KGAA 3ROYA 3CGOA 1M14A 4RGJA 3FDNA 3IQ7A 3AL0C 4XRJA 4J95A 4BTJA 4JYAM 1Q8YA 5K4IA 2C5NA 4FIGA 4BDFA 4XGIA 2BTRA 4OW0A 2PE0A 3EFKA 2ERKA 4CCBA 2GHGA 2JLDA 3PA3A 4RIWB 4I22A 3TDVA 4S32A 1IA8A 4XG2A 3QKKA 4FOBA 3GPPA 2Y6MA 5JGAA 5HD4A 4CRSA 4JN6A 3LMGA 5AP2A 4AAYA 4DTKA 4ZOGA 5D7AA 2I0YA 4HYIA 4EK4A 2VNWA 2GPHA 3IHPA 4MF0A 5BX0A 2CWBA 2X0GA 1W0XC 1PF8A 2IW8A 4LZJA 4D4RA 4EWHA 4E6QA 5GZAA 2DWBA 4KIKA 4CFUA 2K9DA 1D0KA 4CIZA 4I6HA 4F7JA 4CHTB 3HX3A 2NQ8C 4DGMA 4CFVA 5J9YA 1PM5A 4LRJA 4X2JA 4ZSGA 5BVKA 4RT7A 1JKTA 4IB1A 4F1MA 3DB6A 4RJ3A 3N4UA 5IA1A 3SAWA 5AAFA 1WXQA 2J0KA 3U87A 5AA9A 4MXOA 1LTMA 3FTCA 4C38A 3O17A 2ZAZA 4D2TA 4LCBA 3COMA 3I79A 3WILA 2PZ5A 4FSNA 3GB2A 4F9WA 3DZQA 2G2IA 3PWYA 4OTRA 2E9OA 1FMOE 4YJTA 4NEUA 2LVQD 4IVDA 1GKIA 4DH5A 1RDQE 4F70A 2YLFA 5A6OA 4FIHA 3GC0A 2RRUA 4UWCA 1IQPA 2A98A 4JI1M 2WEVA 5JSMA 4TYGA 4FNXA 3NNVA 4WT6A 4B99A 3GO8A 1JKSA 1YWVA 4DR4M 2XM8A 2R44A 4RNAA 5CVGA 2HZNA 1GABA 1W7HA 2WMSA 3OOGA 4KBAA 4CSVA 3PE1A 4FKQA 2OZAA 4YZCA 3FYJX 3KMMA 4BVUA 1KE6A 1YE9A 3FY0A 4BHZA 3RINA 3PVGA 1NHWC 3U6HA 1G41A 3Q9XA 5H8EA 4ITIA 1VEGA 2X2LA 3OCTA 5KQ8A 3UOHA 1I09A 3ML1A 4QMMA 1Y57A 3DTCA 2XP2A 1H24A 3UIBA 3AT2A 4AOTA 3AD6A 3ETAA 2XNNA 3DA6A 4AG5A 2VGPA 5CEQA 2DI0A 3HU1A 2Z4RA 4E5WA 3KOXE 1YWRA 5LWNA 5HGIA 1VEKA 4G9CA 4MGYE 5EI6A 4M84A 4O6LA 4AGCA 2Z60A 3LHJA 4PPBA 3NPCA 4CISA 5LXMA 1XBCA 4FICA 5L2WA 4WUNA 3VUIA 5IU2A 4EHVA 2ETKA 4YNEA 1MUOA 2P55A 5DYJA 4GYIA 3OEZA 3EN7A 4PDSA 4UEUA 3P1AA 2K47A 4PDPA 4GFOA 4FEWA 3HP5A 4BB4A 3VWAA 2GQRA 3TUDA 5FSWA 4IZ5A 3HEGA 2WFYA 3CP9A 4F6WA 2ITVA 1WIVA 4ACGA 1A06A 3LW0A 1P4OA 3DFCB 2RGOA 1L2BA 1QDTA 5FG8A 3TV4A 1DGGA 2ITYA 3R63A 4FV2A 4YZBA 3QQGA 5LVOA 3KS8A 3FLZA 2BRNA 1MJGM 4FCVA 2UVYA 4D2VA 2G2FA 4O4DA 5FM3A 2PYWA 4XOZA 1H8FA 3D4QA 3MI9A 4YSJA 2OPFA 2WAJA 3H0YA 4BCGA 3A8WA 3HV7A 3VHKA 4JNWA 1H26A 3JS2A 2YIRA 2C6OA 3FHRA 4GW8A 4X65M 1U54A 4H3PA 2PY3A 3A2CA 1OJLA 3L8SA 4E26A 4NFMA 4IBEA 2BDJA 3OMVA 3VS3A 4FNZA 1MQ4A 3GLGE 2VGOA 4QMSA 2XMYA 3VFDA 4O2ZA 4KA3A 2JIIA 2GHLA 2FH0A 5F20A 2VTTA 4RWJA 3Q60A 5EI8A 5J7HA 2C3LA 1OIZA 3SXFA 1XNRM 3PTGA 1FVRA 3QTSA 1CKPA 4BJJA 2Q0BA 3AMAA 4M0YA 2C6TA 3GGFA 4JDJA 2LGCA 3IDCA 3SW7A 3MH2A 1QCFA 3H4JA 3O51A 4GK2A 2LTUA 2OIDA 1SNXA 2PE2A 3PXZA 2Y7JA 3LE6A 2I1MA 4JRVA 4FCTA 4RWKA 3BOSA 4RA5A 3CSVA 4ZMFA 4C59A 1LUFA 4MGIE 3BX5A 3LJ2A 4CLIA 3QQKA 1PYXA 3R9RA 4BY9E 5IQFA 5C27A 1ZMVA 3NUNA 4YJQA 5CZIA 5D1JA 3COKA 3OW3A 3VS1A 5DR6A 3IGOA 4W4WA 5HCXA 1M2QA 3JR4A 2UVZA 3ZUUA 4R3DA 3F3ZA 2R62A 3QLFA 4R5SA 2L4FA 4ZK5A 1VR2A 2X7OA 3JVSA 3EFLA 3L8VA 4MKCA 4TW9A 5AA8A 2BHEA 2C6EA 5CYIA 4V04A 4DA5A 2X4FA 1ZYLA 2Y9QA 4QTCA 3SLSA 5F1ZA 2RGHA 5K4JA 2XEZA 1O6YA 4R1YA 4X2FA 5H2UA 5BVDA 2B1PA 4JBPA 2QOOA 3EFJA 2B54A 4QQCA 3LFSA 4Y72A 2F7EE 4MD9E 3QX4A 3PUPA 3OWLA 4USDA 4JI6M 1OVEA 2QCSA 2VTHA 4O0XA 1VDLA 2VTJA 5IUGA 5IDPA 3KCKA 4IX3A 5IQDA 3AC1A 2C6IA 3F5UA 2FNAA 1YVJA 3CS9A 3VS5A 3A99A 3POZA 1E1XA 3W16A 4KB8A 3ZZWA 4JT3A 5I3OA 3U51A 2VTPA 1NY5A 4QMWA 2F7ZE 2DAKA 4QYEA 4NL4H 4KKHA 3ILKA 3FI3A 5JH6A 4LFAM 1Q3BA 2PTKA 1BI7A 3TIZA 2A1AB 3R02A 3RTPA 5HTBA 2HK5A 4LFBM 1HOWA 1M17A 3TDWA 1G71A 4BRXA 2ZV2A 4JBQA 4C2WA 3KMUA 2CFOA 2X8IA 2CV0A 3KFUG 5AMNA 4DLIA 5L8LA 1H01A 2R6FA 3ZSHA 3TN8A 4NOOB 2C5YA 4HVHA 1BKXA 1KWPA 1VQ1A 2C1AA 4MWHA 4M69A 3H9RA 3VF8A 2M5ZA 2P2IA 2QO7A 3FYDA 4O4BB 3W0PA 2DZOB 3QC9A 4M14A 2VDBB 4IMYA 2HXQA 2YISA 4PTEA 2CRUA 4LY6A 4HGTA 3FPQA 1ST4A 5HO7A 5ANOA 2R3JA 5GZ9A 3U5ZA 4K8AA 4YUQA 4NW6A 3RPSA 3NYVA 3HRFA 4FCWA 4YNOA 3ZYAA 4CQEA 4QO9A 2O25A 3R22A 3RVGA 2CHGA 3Q3BA 3WI6A 1PRYA 2WU6A 1ZYSA 4BI2A 4D2SA 2UXCM 4D2PA 3EKNA 3I5NA 5IISA 2NNWB 3LLTA 1QAMA 4H36A 3PVSA 4L4UA 4ZPXA 4ALVA 1GZOA 4IM0A 4JI9A 4QQJA 2BWEA 5DN3A 1YDRE 3U6PA 3DJ7A 3LM0A 4FVPA 2PUUA 3KULA 2J0LA 3SD0A 3E88A 4FKRA 3QYWA 1IEPA 1NNJA 5E8XA 3KRXA 2WTVA 4IBGA 5AUUA 5DYGA 4O0YA 5K0XA 3IKAA 3PA4A 4KS8A 2V6ZM 4FR4A 5E1EA 4CKJA 4QQTA 2JUJA 3BYVA 1J7KA 2Z4SA 4U42A 3NCZA 3UG2A 3ZM9A 3FMJA 2OF4A 4ANQA 1BI8A 3E8NA 4FG7A 1IG1A 3TIYA 2WB8A 3ZZEA 2WELA 4GIIA 5IH6A 3FTEA 3P7CA 3ZLSA 4GSBA 3TTJA 3ZOSA 2MROB 1R1WA 3ZCBB 1W82A 4LFIA 3KEXA 4DDIA 5ITRA 2OW3A 4QMTA 1ZYJA 1YDTE 5FGKA 3FZTA 3UGCA 3WYYA 5M06A 4I0SA 4DEAA 1OIPA 3N51A 2AUHA 3PXKA 4U79A 5GNKA 1QUTA 3W67A 3U60A 4J52A 2XJ0A 2C3IB 3FTDA 5HX6A 3W68A 2OFVA 4R7GA 5GHVA 4EOMA 2XK8A 3JVRA 3QZFA 3R1SA 3I0QA 1WAKA 3NYNA 2OFUA 5GJDA 1Z6TA 2LVAA 3OD6X 3ZLYA 3JR1A 1XHBA 4NT4A 4F9CA 4BWKA 1NY3A 5FLXS 4GV1A 4OBOA 1XJDA 3U4UA 5E8VA 4FTKA 3FLQA 3A98B 1Q5KA 2XF3A 4Q2AA 3FXZA 5A4QA 5AWMA 5DGZA 3CEKA 3ROCA 4YGAA 3R21A 1XH5A 3JAMS 4RF1A 4MEDA 1YXTA 3E8EA 3PIZA 3RMFA 4FIJA 1H0VA 4B7FA 3PY1A 3ZUTA 2OO8X 2Z02A 2NO3A 5TT7A 3GCPA 3UO5A 4J99A 2WTDA 4GMYA 4OTHA 4GH9A 4LGMA 4XX9A 4B8LA 2R7BA 4BKZA 2RG6A 4H3BA 1MQBA 1SMHA 4FKOA 2W1IA 5EOLA 2K0BX 1WR1B 5JRSA 4GG5A 5J7BA 2XB7A 5IA5A 1TH3A 3ZO3A 3W0NA 1H25A 4BDIA 4BZOA 5HD7A 3UVPA 3QTZA 4BCNA 1GAGA 5HVYA 3DFAA 2QBYB 3GCUA 5DRBA 2PVJA 5ITXE 2NPQA 4P16A 2UUBM 4EEVA 4C4IA 3EKKA 2W5AA 4S30A 4PNKA 2ZANA 1BVSA 4P2KA 4I8OA 4EK5A 4AQKA 2JXNA 3EN6A 1WJ7A 4PMTA 4YC3A 2CN8A 5IQAA 2XNEA 4O7WA 1C7YA 2XK4A 4ZZOA 1ZWSA 4XV1A 2CEAA 2H6DA 5EM8A 4BCIA 3C9WA 3VS7A 3RK7A 2O63A 2VV9A 5BUJA 1WVXA 4Y28F 4D9UA 4QT1A 1XMOM 4LGHA 3W2QA 3TXOA 2CP8A 3CJGA 2XVDA 1B39A 4LJ4A 4WRSA 3HNGA 4EOPA 2PU8A 3OT3A 1TTEA 5AV1A 3GRVA 5EXPA 3FYCA 3BHTA 3WF5A 3SXSA 2Q0NA 4LL5A 2PZRA 3LW5F 5BVNA 4LI5A 3KP1E 4AS0A 4O7SA 2FO0A 4MQ2A 4DR7M 5L3AA 5AX3A 1FJGM 4FWDA 3HZJA 4PDOA 4G3DA 2WIPA 3C0HA 2C6KA 4DV6M 5CEOA 3I5ZA 4BIBA 1QPJA 3M0EA 4RJ6A 4O86A 4HLQA 2J0IA 1Q24A 3FMHA 4QYGA 4QMUA 2IZSA 4FTQA 3BL9A 4DEBA 3F82A 4K77A 4AA5A 4GVJA 2IW6A 4C3FA 4O2PA 3GVUA 4AXDA 3O50A 1WBPA 2YERA 3OTUA 4FV6A 3TPZA 4CKRA 3ZRMA 3PZEA 4ANMA 3Q9WA 2WO6A 3HUCA 1IXZA 4U3YA 3MH1A 4DEEA 2C9OA 3LAUA 4QD6A 2W1GA 3QWJA 3UQGA 4F65A 2L6OA 4OT5A 3FI8A 4LJ6A 1Q3CA 3PA5A 3SQQA 1UU9A 2LVPC 3PJCA 3FY2A 4P5QA 4G3EA 5J95A 3PRIA 1WGLA 4L78A 4AW4A 4TYEA 5CSXA 2WD1A 3HDMA 4FL1A 1IN4A 3L9LA 4GU6A 2QOIA 4MYGA 2CKQA 4BCKA 4HL4A 3FZ1A 2C96A 5CQUA 3BGZA 3L26A 1G59A 3D5WA 2HW7A 3C4EA 4G5PA 4PWNA 1G8AA 1G8SA 1QPCA 3SG9A 3MHVC 3GCQA 4UMQA 3U6OA 1PJTA 2GTMA 4LGYA 2WTWA 1GIIA 3BELA 2YN8A 3SASA 5AEPA 3HRBA 3WE8A 4RX8A 3P7AA 2GNLA 4XCUA 1B38A 1DAWA 4WG3A 3P4KA 3ATSA 3KOYE 4FF8A 4HNIA 4AU8A 4FWHA 3IPHA 3ZBXA 4LRSA 1IY1A 2JP7A 4QYHA 5F4NA 4D0XA 4M69B 3GQ4A 3B8RA 1VZOA 3BGQA 3EOCA 4F9AA 1CKIA 2BAKA 2DHYA 5E6JA 1KYIA 2UXDM 4GG7A 5FTMA 3LXKA 2XK6A 4QPMA 2Y20A 2JEDA 2J6MA 4CFNA 2C3KA 3HV3A 2GCDA 4IBKA 3U5ZB 3RGPA 3DB8A 3W32A 2JDVA 3W18A 3MB6A 3FYKX 2HWJA 4E5AX 5KMKA 5EM5A 4XHKB 2PZIA 2BILB 3BE9A 1N77A 4P17A 1TQPA 3QRKA 3ENHA 2O3PA 2VQEM 3R8VA 2R3FA 2YJRA 2EXEA 2XIYA 4OR5A 2QP9X 3RAIA 2YWVA 4BC6A 2CUZA 4CT1A 2ITWA 3P78A 2R46A 4NJDA 2B9JA 4FTUA 4C3PA 2VWXA 4RX7A 3VAPA 4IWOA 3F3VA 4UB7A 3SG8A 1E9RA 4CG9A 1R6BX 3ZRLA 5F95A 2V62A 2J90A 4M9XA 2FGIA 3T3UA 2OXDA 4ACCA 4FT7A 4F2LA 4EH3A 3E87A 3KULB 5AX9A 3M6AA 2GNIA 4IB0A 2QU6A 1BLXA 4RZWA 4C36A 1IASA 4ZS4A 4DV3M 4JBVA 3FRIA 4XMOA 2YHVA 2BHHA 3EN4A 1OBDA 5DEYA 3HY5A 3E8CA 5L2IA 4MHAA 2VD5A 2VTRA 1YQJA 4O83A 4FKUA 2LHCA 2C1BA 3VRYA 5CAPA 2DYLA 2G8LA 2BDWA 4PTCA 1V0OA 3NUYA 3QD4A 3TV7A 3VBQA 5DMZA 3E62A 3S2PA 2R3PA 1GZKA 1WCCA 4NCTC 4L9IA 4BBEA 4V0GA 1M2PA 1OL5A 1P2AA 4FUYA 1O6LA 3DNEA 3EL8A 4AN9A 2QURA 4FSRA 5KMJA 4LF9M 5ANDA 3WIKA 5M51A 4YJVA 4YZDA 5LVNA 3H30A 4P90A 5FTLA 4IANA 2WMQA 3F61A 3FI2A 5KMLA 4IBMA 4G2FA 2W9ZB 2PVLA 1OMWA 3FKEA 1ZY4A 5CEKA 3ZRKA 3L9NA 4ONAA 2J5EA 1BMKA 3GLIB 4RQVA 3F6XA 1BL7A 1PMEA 1E9SA 2IO6A 1GZ8A 3K5VA 3HWSA 1OECA 5EI2A 5FEDA 1HNWM 3R71A 4L68A 5JFVA 3HV5A 5AR2A 3DK7A 5HG8A 1XWSA 1H08A 2YCRA 3AD4A 3SC3A 1OB3A 3ZSGA 4BDEA 1PXIA 1KOAA 5DEWA 3O7LD 2WQMA 3RM6A 5IKWA 4O7RA 4G6NA 5EYMA 2PL0A 4U7ZA 3OG7A 1Q8UA 3NNWA 1ERKA 3QRTA 4JQ8A 2V5QA 5JMSA 4YLJA 3DTWA 4E1ZA 3UZTA 1OIRA 1WVWA 3R9DA 3CJFA 1OFHA 3VUTA 5EKOA 4F78A 4K18A 3OTVA 4O91A 4GT4A 4PY1A 4F6SA 3L8PA 3GQ5A 4NTSA 1PXLA 2HOGA 5TO8A 3RJCA 2XH9A 2RFNA 5L8RF 4RC4A 1VEJA 4I5HA 3DXPA 3LCSA 5L6WL 4IW0A 2BJWA 3UODA 3AOEC 3LVPA 5HIBA 3OOMA 5IQBA 3MIAA 2GTNA 3U6CA 2YEXA 4EL9A 4ZP5A 1GL6A 4BFMA 3QQUA 2BZKB 2V7AA 3DAKA 3KKVA 4RBLA 5KMNA 1PKDA 2R3HA 4LMNA 2XARA 3J81S 3F92A 2KEBA 1UU7A 1XMQM 4BBAA 1R4GA 3F5PA 3TL4X 4BDGA 3D5UA 3ZDUA 2O2UA 3PSDA 3CD8A 5C4KA 4X3FC 3V5LA 4CFXA 4G5JA 2WKMA 4UMUA 4X0MA 2UW6A 2BCJA 3VS0A 2L09A 1ATPE 3FC1X 2AYPA 4EH9A 1Q39A 3IECA 4IEBA 3L9PA 3FKNA 4KD1A 4FI1A 1APME 1R2YA 4QOXA 5EQYA 4HYSA 2JDSA 3WE4A 2YIWA 3IOPA 4DUZM 4MWIA 3BU6A 5E9EA 2VQFM 3GLHA 3AG9A 3G33A 2OJ9A 1KV1A 5ITYA 5IWAM 4FV0A 4CFWA 1CKJA 4IB3A 4G3OA 1IXSA 2YIQA 3RGFA 3QLGA 4BKJA 4O7VA 4RJ7A 4AP7A 4IX5A 4CGAA 2X8DA 4HJOA 2ZM4A 3JUHA 1TR8A 3CQWA 1JLUE 4IC8A 4OBPA 3A7JA 4EKKA 2OI4X 5K0KA 2ZFYA 3Q8GA 2R3KA 2GNGA 2J0MB 1U5RA 3PRFA 4DFLA 2WOUA 4U6RA 3UG1A 2X1NA 3KN5A 5IA2A 3GLGA 3DKOA 5M4IA 2C3JA 5J9ZA 4IBBA 3VS4A 1GLNA 1TQIA 2LVNC 2IW9A 2O64A 3DKCA 3GQ3A 4I20A 4NSOB 4KAOA 1Y8YA 2FOIC 4BCOA 3UDBA 3U9CA 2QO2A 4XUFA 4DH1A 4CFFA 4QP2A 2F49A 4M0WA 2V0DA 3KVWA 3L8XA 4RVTA 2W1ZA 4PUZA 4IWPA 1QANA 3ORPA 2E9NA 4IAKA 3V5JA 4FNYA 2HENA 5DE2A 4BHNA 4RC3A 4NRWA 4G3CA 5F94A 4BZDA 4Q9SA 1OL2A 4NCTA 3CC6A 2VRXA 3H0ZA 1ZOEA 4ZTQA 2LNHC 3GLFA 4EORA 2QLQA 3NLBA 4UN2B 3C4WA 3CY2A 3SOAA 5LMKC 3FKOA 5DNRA 4I0RA 4UZDA 4EZ7A 5A4LA 4G6ZA 2W1EA 3K1JA 4QOSA 4UXQA 2KRUA 4H1JA 1OGUA 4F9YA 2XK3A 5AIKA 3OT8A 1DGBA 2L7IA 3KCFA 2F57A 2BAJA 4XP3A 4FODA 5I5ZA 1PGYA 3CGFA 3T15A 3WF9A 4HVIA 3KL8A 3TG1A 3MV5A 3O8UA 3NWLA 3IONA 5G1XA 1F5QA 5EDPA 2DAEA 3S95A 4EBVA 4O0WA 1ZXEA 4UYAA 3QCSA 4GK3A 4YTIA 5IMEA 3MSSA 2W7XA 3O7LB 1K82A 3TEIA 1DV0A 3G9LX 3ORTA 2DAIA 5FBOA