3KVWA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2) in complex with an indirubin ligand
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
408
structure length
403
Chain Sequence
HHSGVDLGTENLYFQSMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSKGYPRYCTVTTLSDVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (DYRK2) in complex with an indirubin ligand
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
total genus 125
structure length 403
sequence length 408
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kvwA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kvwA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kvwA02
1JPAA 3BQRA 5HBEA 3RHXA 5CF4A 4OW8A 4TNDA 5LVLA 1CDKA 3PA5A 3F3UA 4WA9A 4FZ7A 4ANNA 4Z3VA 4MXOA 4BGQA 3MVHA 3EYGA 4M84A 4G1WA 4CCBA 4YPSA 3P7AA 3RAWA 4CKIA 2FYSA 3I6UA 4AZTA 4O83A 1CKJA 4KINA 4QOXA 4EK4A 5HX6A 3VUDA 2ZM1A 3TNHA 1OMWA 3FSFA 4ID7A 5D7VA 5AADA 3LJ2A 4R6VA 3CD8A 2XF0A 1QPDA 2H96A 3H4JA 4AFEA 2XUUA 2DUVA 3EN7A 4DH8A 3SLSA 1MRVA 1CTPE 4X2GA 5HD7A 4BBEA 4EH2A 5BVNA 4FG7A 4GFOA 3FI8A 2J9MA 4Z16A 4YC6A 4ANSA 3HV4A 3PY0A 4I5HA 3BU3A 2JC6A 3MB7A 4JDKA 1WBWA 1R3CA 3T3UA 4AZEA 3R9OA 1OUKA 3UQFA 4X21A 3H0ZA 4MYGA 4U81A 1ND4A 2C5OA 3BGPA 3QYWA 3D5XA 4W9XA 3R7VA 4LGDA 3FWQA 3QD2B 4IWDA 5DRBA 2ZM4A 2GS6A 4E7WA 5HLNA 3PLAE 4OTFA 5HOAA 4A9YA 5CAOA 4QMZA 4FIHA 2QKWB 3QTQA 2FSTX 4JBPA 3KMUA 4HYIA 3ZRKA 1YHVA 4AW1A 2XRWA 5TF9A 3LFAA 4LUDA 4PL5A 4CMUA 1S9JA 4CV8A 4I23A 2PU8A 4JLCA 3ANQA 4FTCA 1IR3A 1UKHA 4PDPA 2VWYA 2B7AA 3OMVA 2BFXA 1GAGA 4ANOA 2A1AB 3PY1A 2BDJA 4OT6A 4GIHA 3EQRA 4RT7A 4PPCA 2OJGA 5AM7A 4FKTA 4HNIA 1GIJA 5AP5A 4D4SA 3MBLA 4G6LA 4E6CA 4GVJA 4EJNA 3NMUF 4ZTRA 1U59A 3EKNA 3NWWA 1KE5A 5E90A 4NJ3A 1H24A 2VTNA 2BCJA 4BTMA 2JFMA 3WF7A 5CZIA 3VBTA 4QPMA 5TO8A 2ITQA 1W7HA 3UO6A 5KHWA 3OWPA 3EB0A 2R64A 3UO5A 3I4BA 4IM0A 3BE2A 1PXNA 2FUMA 2PZRA 4FT9A 5BYLA 3DKGA 3QFVA 2J90A 4GFMA 2V55A 5FXRA 3DK6A 4H1MA 2FB8A 5IA5A 1B38A 2QG7A 2RG6A 1Q5KA 4YLLA 1DS5A 1ZWSA 3KKVA 3V01A 1PXLA 3CIKA 3GCVA 2HZ4A 4DA5A 4IX4A 3H10A 4B8LA 5HLPA 3HMIA 3A4OX 1YHSA 4L8MA 4LRKA 4NTSA 4QMPA 4AW0A 2PZIA 4G16A 4EZ5A 4F1MA 3QTWA 4C7TA 1R39A 2O65A 3BCEA 3Q96A 2XRUA 2QOOA 4FT7A 4JX3A 3TTIA 1OECA 4FNXA 4RX9A 3O8PA 4BZNA 4CZYB 5LCKA 2C69A 5CXHA 5J9YA 5KKRB 3DAKA 4ZS0A 2R3FA 2CNUA 3IG7A 5AR3A 3COKA 3I5ZA 4F9YA 5HCYA 4RIWA 2A4LA 1IA8A 3KCKA 4A9UA 4FZ6A 4ZAUA 3GC8A 1W83A 1BL7A 2X39A 3MY0A 5A14A 3DKCA 3P9JA 3KRJA 3KGAA 4DEHA 3U54A 2QOQA 4J7BA 4NTTA 3TUCA 3KCFA 1RJBA 5EM5A 4O7ZA 4BCIA 2QOKA 4BTKA 3WYXA 3DTCA 3VNTA 2W1HA 4U80A 2VV9A 4PL4A 4A9SA 3FHIA 3LMIA 4ORKA 1QCFA 2F57A 4J1RA 1JBPE 1NVRA 5CU0A 4QYFA 3VS7A 5C03A 2WMBA 2P2IA 4P2KA 3ZO4A 2YABA 1YQJA 3E7VA 1FPUA 2ITVA 5A4TA 4BRXA 2WTCA 4X3FB 5M55A 4GCJA 2UW7A 3OP5A 1RQQA 3UOHA 3VBWA 4EBWA 2R3LA 3ZYAA 4DN5A 3DNEA 4YO4A 5LOHA 1DAYA 3RPSA 4O86A 3GUBA 2WO6A 3JYAA 3Q60A 4KKHA 3S4QA 3UODA 2BRHA 5AA8A 5AEPA 3QU0A 2UVXA 3NVMB 4TTHB 3OD6X 4ZTQA 3ZLXA 4G17A 3F7WA 4Z55A 1NA7A 3UYTA 2J4ZA 3F3ZA 2A27A 5TKDA 4DC2A 4G3GA 3RHKA 3IDBA 5AA9A 5T6KA 5M06A 3FY0A 3RKBA 4GKHA 4EEVA 5DT4A 4GSBA 4NUSA 4I1ZA 2GS7A 2UZWE 3OEFX 1WBNA 3HECA 3A99A 2PZPA 3QKKA 3PVUA 2ITWA 4BDJA 3BLQA 4USEA 4H3PA 4UBAA 5K3YA 2OU7A 4DEIA 1NVQA 3Q52A 4L3LA 4RLLA 2YCFA 4FSQA 3CCNA 4LOQA 4C4JA 4ZY4A 3D9VA 1H1SA 2BTSA 4I0SA 1L8TA 4M66A 4U9AA 1KSWA 3FLZA 3NAXA 4CFFA 4AE6A 4WUNA 4RWJA 1ATPE 3E87A 1OL2A 1ZRZA 4K2RA 4WBOA 5C9CA 5A4CA 2WMQA 4ZEGA 1UV5A 3NZ0A 3TUBA 2W1EA 3G33A 4IJ9A 5E1SA 3DXPA 4OTDA 4UXQA 1GZOA 1R78A 4CRLA 1FVRA 5AMNA 3WIKA 3RINA 4IZYA 4JL9A 2IZTA 4BCJA 3KRLA 2CKOA 4B6LA 4A4OA 5HG7A 3UTOA 3V8WA 3BHTA 4XRLA 3VUIA 1M17A 4YBJA 5ANGA 4A4XA 5KMNA 3IGGA 4TYHA 4MH7A 1ZYLA 4QNYA 4AT3A 3E62A 3QLGA 4O1PA 2WQMA 3TNIA 4V0GA 3D94A 5DEYA 1VYWA 5FGKA 3DLZA 4DEDA 4BTFA 2ITZA 2O63A 2OJJA 3MPTA 2R3OA 5D10A 3F7ZA 4O21A 5CZHA 5E8VA 3LIJA 1OKWA 2B1PA 3CPBA 1JKKA 3BEGA 4IVAA 3ZBFA 1IAHA 4H3BA 2V62A 4MNFA 2RSVA 1H28A 4FNZA 1ZOEA 4MEDA 3AD4A 5EYCA 3R9HA 3CQEA 3BV2A 2ITOA 3ZFMA 3SOAA 2QO2A 1FOTA 2BRNA 4LGHA 2QODA 1FVVA 2VWUA 2WMWA 2EXEA 1WBSA 4MQ1A 3GCQA 3VC4A 3F3TA 4QMLA 3VS3A 5GJFA 5IH5A 4JQ8A 4UN0C 2XKDA 1YXVA 1PMEA 5FBOA 2WNTA 4JIKA 3TIYA 1MQ4A 5M4FA 2WTJA 3UQGA 4UY9A 4GV1A 4XS2A 5EDPA 4Q9ZA 3G51A 4AW5A 3QCXA 4W9WA 5DBXA 3QC9A 3ZONA 4HPUE 1OPJA 4ZSLA 1P14A 1HCKA 4XG6A 1MUOA 2DQ7X 4BDFA 4CFWA 3IPHA 2VWVA 4HCVA 3ORXA 4IMYA 4ZZOA 4ZSEA 3QZGA 2W9FB 3ZO2A 5CF6A 4MKCA 3W2CA 2R3NA 1NXKA 4IC8A 5A4EA 2NP8A 5AWMA 3QQFA 4LG4A 4Y72A 3UVRA 3C50A 2VX1A 1E9HA 2FSLX 2JFLA 2UV2A 3AQVA 3RCDA 2PSQA 5M07A 3G0FA 4W4YA 2X9FA 4Y5QA 4GW8A 2E9OA 3NYXA 3DQXA 2OWBA 5C01A 3VS6A 2Y6MA 3FDNA 3PXRA 4LV8A 4FEQA 4EH5A 4FGRA 5CAPA 4RWKA 4YBKA 4LOPA 5ACKA 3EMGA 3BYSA 4ANQA 5HU3A 3HL7A 4YJQA 3AD6A 1KE8A 5HE0A 4AW2A 4Q2AA 4AA4A 4O0RA 4CYIA 4C0TA 4FV3A 4QPSA 2ZV9A 5D12A 3G6HA 4IVDA 2G01A 2YM7A 3PXZA 5HICA 3RCJA 3F5GA 3Q4CA 4NWMA 4YHTA 4EK6A 5I9UA 4FEXA 3EH9A 5HBJA 3E8EA 5HG9A 3KMWA 3ZSGA 1KV2A 5IU2A 2FVDA 1UA2A 1H1QA 5J8IA 3IKAA 5CT7A 1ZOGA 2HK5A 4NU1A 3EQBA 2E9VA 4XNEA 4C33A 4DGGA 4YR8A 2CSNA 1FMKA 4UXLA 4FV2A 1XHAA 4GL9A 5L6WL 3LFSA 4BKZA 2PVLA 2CCIA 1H26A 1PKDA 1P5EA 2R0UA 4JXFA 5F95A 4J71A 2RFDA 4KB8A 5A9UA 5CSPA 1VYZA 4JG8A 2XMYA 2V7OA 4V0GB 4YJOA 2JAVA 4IX6A 3DY7A 1XH7A 2W4KA 3BV3A 5L6PA 4L52A 4S2ZA 5BMMA 5HG8A 4AP7A 5IQGA 3EFKA 2GHGA 4G6OA 4JDJA 5CEOA 2R3JA 2X2LA 5K9IA 1JAMA 2ETRA 3VBQA 4RC2A 3PRFA 4BI1A 3A2CA 5AV4A 4TPTA 1AD5A 2UW9A 5HHWA 3DBFA 4LL5A 2VTLA 3QCYA 4DINA 4BF2A 3TT0A 4F7NA 1K3AA 2QLUA 3W16A 3QC4A 4L45A 3QQJA 2PE0A 1ZMWA 1NT2A 1PXKA 2PVFA 2YM8A 4NEUA 4XH6A 4ZJJA 3OTVA 3QAME 5CANA 3FL4A 3M2WA 3PSCA 3K3IA 4IE9A 4MBJA 3UC3A 3CSVA 3A61A 3WZEA 4PV0A 3IK3A 4U3YA 4YJSA 2XVDA 4ACCA 4DCEA 2HY81 4FIJA 1MQBA 4XBRA 1OGUA 5E8ZA 3T3VA 5CF5A 2PMIA 3CJGA 4TZRA 4V01A 2EXCX 1O9UA 1W82A 1YDTE 3COHA 1CKPA 3HEGA 4NM3A 3DNDA 4TWPA 1BLXA 3BHUA 4D1SA 2WTKC 4AN3A 4CQGA 3FZRA 4BCHA 5FTQA 3R0TA 2JEDA 3CTHA 2CGXA 2O5KA 4J99A 5CU2A 3GU7A 2B53A 2PMLX 2O0UA 3EN5A 4BWPA 3GB2A 5JGAA 3T8OA 1SVEA 3LMHA 4AN9A 2R7BA 3DTWA 2Z7QA 3V04A 1PYEA 3MSSA 2FA2A 4WD5A 2P55A 3P08A 3QLFA 2PVHA 3NGAA 3SA0A 3F2RA 3TL8A 3NYVA 4IZAA 1YXTA 3FLNC 4JOAA 2VZ6A 4NK9A 3QRKA 2BPMA 3EN9A 3NUYA 1T45A 3QQKA 3SHEA 4A06A 3S00A 4DBNA 5H2UA 4WSQA 3QD4A 4AZWA 4RA4A 3UC4A 4XRJA 3CPCA 4XG4A 2OXYA 4BIBA 3HLLA 3OVVA 4I93A 4CQEA 4FKUA 4L43A 4FNYA 4ZTMA 3PUPA 3ZO3A 2BZHB 2QC6A 4FZAB 4E20A 1IA9A 5F4NA 4HVHA 4I22A 4S33A 2UZLA 3MDYA 4LRMA 4R1VA 3TNPC 4ALVA 3BU5A 4EQCA 1ZMVA 4OT5A 2YIQA 3BRBA 4L3PA 3ZUUA 3A62A 4YLJA 4FTRA 4AS0A 5BVDA 5CNNA 5J79A 3F5UA 5EM8A 4R1YA 1WBOA 3GCSA 3KN5A 2CGUA 3FI2A 4G3CA 1SNXA 3W8LA 3EZRA 3I1AA 4JX7A 2XB7A 2YIRA 4NIFA 1VEBA 4QP8A 4RVMA 4CRSA 4F9AA 5AUTA 1QL6A 1OBGA 3IS5A 4BKJA 3VVHA 5EQPA 4W8EA 2ZDUA 3K2LA 4PNKA 3ZDUA 2G2FA 4PDOA 5ANEA 2F7ZE 4M0ZA 1OIUA 2I40A 4JT3A 5GJGA 2CGWA 5FP5A 3BGQA 4NT4A 5DPVA 3ZDIA 5DG5A 4AZSA 2HW7A 3MH1A 1YI6A 4DFBA 3AC3A 1OIQA 3QTXA 4PMSA 5EOLA 1K2PA 4DH5A 4YC3A 3QRTA 4O0SA 4JQEA 3C4ZA 3FEGA 4HJOA 5EKNA 3BBWA 3O51A 3BEAA 4JR7A 1BX6A 3Q32A 4RJ3A 2PUPA 2GPHA 2UZEA 2GNLA 3HAVA 2Y4PA 2ONLC 4ANLA 2X8EA 3HUBA 2PY3A 4IANA 4PNIA 3UG2A 2WMAA 5EFQA 2E9UA 3AC2A 4D0WA 4O7NA 5HEZA 3UYSA 2YCRA 4KBCA 3WARA 3E93A 4K77A 3OHTA 5CY3A 5CAUA 1E1XA 1L3RE 5JFVA 3O17A 3TG1A 2VTRA 4L44A 2JDRA 3T9TA 1GY3A 2BUJA 2W96B 4W4WA 4FGBA 3V5PA 3CKXA 3WIGA 3R8VA 3DCVA 3ITZA 2H6DA 2NPQA 2PTKA 2QOFA 3FQEA 4M3QA 4CG8A 1JLUE 4GT5A 4BCFA 3OW4A 3KK8A 3O7LB 5CENA 5M56A 1H07A 3CBLA 4LQMA 4P7EA 5EW8A 1O6KA 4F9BA 5AUWA 1SVGA 3QD0A 2XBAA 2J2IB 3QUDA 3MJ2A 3LJ0A 4FZFB 4G5PA 4ACMA 1E1VA 4ANBA 4TYGA 4UYNA 3L8PA 1ZZLA 2X7GA 2ZAZA 4KKEA 3WZDA 4GEOA 4RJ4A 4B0GA 2R9SA 4LMUA 2C5XA 3R7GA 5J5SA 3GEQA 4FTKA 4M97A 5DI1A 5I4NA 2I1MA 2UZTA 4GRBA 4DFZE 2IG7A 3FZTA 3VF8A 1Q8ZA 1Q8WA 4KIPA 2WIHA 3ZUTA 4Q5EA 3ULZA 3CTQA 4K1BA 4QMVA 3R7EA 2YZAA 3BX5A 5EDRA 3E92A 1H25A 4LMNA 1O6LA 2X1NA 2P3GX 2OKRA 4FKSA 5KBQA 3QX4A 3N4UA 3PVBA 4BGGA 3QZFA 4OTHA 3NYNA 4Z9LA 1QPEA 4DFYA 1XH9A 2J0LA 4HPTE 4NIFB 4QTEA 4YJPA 4JR3A 4DFLA 4BWXA 4ONAA 3Q5IA 3MIAA 5HO6A 5JQ5A 5JFWA 3UVPA 4USDA 2VO3A 3D7TA 1RDQE 2Z7LA 3P5KA 5JRSA 4RX5A 1PXOA 3O7LD 1IEPA 1OBDA 2PULA 3UZRA 3NNVA 2F9GA 5HVJA 1GIHA 5I9WA 5HIEA 4HGLA 5LVMA 2IVVA 4BCQA 5JQ8A 4EOPA 5IF1A 4MBLA 4CNHA 1F3MC 2C30A 2IW9A 5DOSA 3A7IA 4B8MA 2EB3A 4P90A 5AP0A 4C4EA 3LMGA 2FSOX 3EN6A 4II5A 5E8WA 4A7CA 3PJ3A 1OUYA 4FV0A 4ENXA 5H9BA 5L2WA 5L8JA 2I0YA 2C3KA 3QCQA 4AN2A 4CCUA 2CKQA 5JSMA 3HDMA 4EC9A 4E4NA 3R73A 4QNAA 1OL6A 3C4FA 4YTIA 2WZJA 2PUNA 2JKOA 5HBHA 2XM9A 2ZOQA 5KCVA 5LMBA 3CS9A 4BYJA 1JSVA 2W1FA 3MW1A 3R8LA 2ZVAA 2WQOA 4JIAA 4CVAA 2IVSA 3VW8A 2VTAA 3AC4A 4P4CA 3O23A 3EQCA 4OGRA 3QWKA 4V05A 4FX3A 4MD8E 3GC7A 4GMYA 4P5ZA 3L8XA 5CVHA 4DHFA 3EQFA 3HRCA 4FKJA 3FMKA 3KXXA 4YMJA 5CSHA 4J98A 5DWRA 4EH6A 1QPCA 2HZIA 2YFXA 4ZXTA 3VUTA 4O7VA 2G9XA 4RFMA 3WILA 3CC6A 3ZC6A 3ID6C 4OAUC 3ORKA 3O96A 5AAGA 3LJ1A 1DI8A 3ZMMA 1W98A 3DV3A 4C4HA 3ORMA 4D5KA 4ITIA 4L3JA 3MH3A 2NNWB 3R30A 2QVSE 3DBEA 3Q2MA 4FIEA 5E92A 1PMVA 3BWFA 1AQ1A 1J1BA 5E8SA 4B99A 4FEWA 2WTIA 5CS6A 4FG9A 3UBDA 3HA6A 3D7ZA 5DN3A 3OBJA 4WHZA 4O7YA 4TL0A 3GNIB 2CKPA 5IZFA 4IX5A 5BYZA 4GG7A 3LCDA 1V1KA 4RVLA 3TDVA 3M42A 2W17A 4I94A 4KBKA 3LQ3A 4A9RA 4DGMA 3QWJA 4KS8A 3C0HA 4L01A 2YEXA 2OH4A 4RVTA 3R8PA 4IACA 5E9EA 2W05A 4BCOA 3S0OA 1QPJA 5L2TA 2R3HA 4QTBA 4O96A 2C3IB 2Y0AA 3A8WA 3D5VA 4YHJA 4B9DA 4YURA 4U42A 4FSRA 4ZK5A 2R3MA 4DH1A 5AV0A 2GTNA 3NW6A 4QPAA 4NCTA 1B39A 1YW2A 3HZTA 3R1NA 2JGZA 3DDQA 4FR4A 4QTCA 5AR8A 2IVUA 4NL0A 5GINE 4CEGA 5A54A 5CTPA 4J97A 4DTAA 5J7HA 4IXPA 3LFBA 4EH7A 3UP2A 1J1CA 4BWKA 1H00A 4FSWA 5DH3A 3LE6A 3MY5A 4N70A 5HTBA 5IEVA 3FMLA 1M7QA 3W1FA 5IUGA 4YZBA 4FZDB 1JNKA 4DH7A 2X2KA 2VU3A 3POZA 2W7XA 4DBXA 3NRMA 4LI5A 4U5JA 4R8QA 3H0YA 3PIYA 2XCKA 4AAAA 5IA2A 4EJ7A 4WNPA 4I5CA 2ZB0A 3PSBA 1NW1A 3RJCA 3KFAA 2I7QA 1PXIA 5DT0A 4TYEA 3UJGA 5JGBA 3JUHA 2IZUA 1XH6A 2QG5A 2WTWA 3GCUA 3R2BA 2GTMA 3WF8A 5BVFA 5C1QB 3KF4A 2HW6A 2XJ0A 5CU3A 5HE1A 2BAQA 2GNFA 3BQCA 2H34A 2A2AA 2X2MA 4L46A 4IB0A 4E5BA 4FKVA 3G2FA 2DYLA 4TW9A 4O27B 5AM6A 4QO9A 3ALNA 1GZKA 4QQCA 2QO9A 4U40A 4L7FA 3G15A 4GYIA 4OTIA 4YC8A 4AX8A 1Q8YA 3FXZA 4ZMEA 1RW8A 5TR6A 3BKBA 4DGLC 5JZNA 3HGKA 5FUTA 3MA3A 5KMJA 5DFPA 2HELA 3ETAA 3FV8A 3TZ9A 3AGMA 4FT5A 3ZZEA 4EH8A 4MD7E 3R7OA 2WOUA 2C0OA 4CT2A 2Z7RA 1UNLA 3HX4A 3KMMA 4FUYA 5AUYA 3W8QA 4IB5A 2J0IA 3IECA 5EHLA 4UZHA 1M2RA 3DK7A 1Z57A 3KXZA 5DEWA 1FGKA 2YCQA 1OPKA 4JJRA 2HY0A 3QA0A 4S32A 5IUIA 4YUQA 2JAMA 4IIRA 1JKTA 5B2MA 2WMTA 3OXIA 3GGFA 2FGIA 3IQ7A 4EK3A 3QL8A 2WIPA 3HV6A 2A19B 5BUEA 3N4VA 3NLBA 1OPLA 1Q4LA 1TVOA 4DAWA 3ORIA 2VO0A 3GT8A 4IVBA 3OXZA 3NPCA 2EXMA 3FZPA 3LCSA 4R3PA 4UMRA 4RJ6A 3E88A 3SKCA 4L67A 5CALA 3R22A 2RKUA 4A07A 2GQRA 4ZLYA 3KVWA 4CKRA 3HMOA 1BMKA 4MF1A 2UZNA 3CQWA 4U7ZA 4A9TA 4CZTA 4NCTC 2VWBA 4IM2A 2XK6A 2BZJA 4O2PA 1Q62A 4BDKA 2WHBA 2WMSA 3COIA 3CEKA 3W10A 4AOTA 4GG5A 4CXAA 4QMOA 4QYYA 2IZRA 2EWAA 3O50A 3QTZA 1OKYA 3UPZA 3DAJA 1TQMA 2HXQA 5HZNA 3KXGA 4Z7HA 2QNJA 3ZO1A 1R1WA 2IWIA 4PUZA 3DKFA 4FTTA 4M13A 4QP4A 4XX9A 4EWQA 4O6LA 5C26A 3IW8A 1MRYA 4CFVA 3CR0A 3TNWA 5T68A 3SD0A 2GQGA 3NIEA 4NM0A 3MFTA 4EOLA 3WF5A 4ZLZA 5FTOA 3H9RA 4AUAA 2C68A 3ORPA 3LHJA 3AMAA 3PZEA 2OXDA 1Q3WA 4K0YA 2YM3A 4EKLA 4IM3A 4FC0A 3DQWA 3HNGA 4HYUA 3DT1A 1G3NA 2BAKA 3A7GA 5H8GA 3R9NA 3V5TA 4HVGA 2OICA 5DNRA 1VJYA 4XHKB 4QD6A 3OCTA 1GIIA 1I44A 4CYJA 3OWKA 1EH4A 5CSVA 3Q4ZA 4G31A 1OL7A 3R2YA 5AR4A 3RZFA 5I9YA 2C6LA 2JDSA 4GT4A 4LUEA 2PZYA 1PF8A 3HA8A 3ALOA 2Y8OA 4DG2E 3OS3A 4DTBA 3DBQA 2C6OA 2YERA 2YIYA 3D83A 4IZ7A 4ANMA 3Q3BA 2JBOA 4OTGA 3SAYA 4LGGA 2YIXA 1G8SA 4O0UA 2YDIA 2Y4IB 3U51A 3R1SA 5E4HA 3I0QA 5E1EA 4BDEA 3ZLYA 2UZUE 5JFSA 3PTGA 5KHXA 3WF6A 4WRSA 3RK9A 3EWHA 1Q97A 2C6IA 3PSDA 2C3LA 4QYGA 4F1OA 4ZZNA 3CY2A 1V0BA 2H9VA 3MWUA 4HGTA 4GVAA 5ANKA 2QHNA 2PUUA 3TWJA 4APCA 4JBQA 1PKGA 4HYSA 3TJCA 2C0IA 2EUFB 2OF4A 1U54B 5KMLA 2ZM3A 4QP7A 3F2AA 1LUFA 1SM2A 2X9EA 5GZAA 3R7YA 4F4PA 4BVUA 5CU6A 3QD3A 4YLKA 4D1ZA 1URCA 2IJMA 2W99B 1A9UA 3PDTA 3V5LA 4JS8A 3II5A 1K9AA 4NM7A 1UNHA 2BZIB 3EQHA 4ZLOA 2OW3A 3ZTXA 1YI3A 1CMKE 1PHKA 4CG9A 3PXYA 2JDTA 1YOLA 2VTHA 3KRWA 4J96A 2XIKA 3GC9A 5EQEA 4DFUA 1LEWA 4QP6A 1CM8A 4C62A 3S3IA 3UMWA 2WTKB 4RZWA 2XNEA 4FMQA 3HYHA 4MBIA 4EOSA 5C4KA 5DHJA 3VHEA 4EBVA 1JKSA 4J95A 4E5AX 4XUFA 2C5YA 2GQSA 3OCBA 4XG2A 4BCGA 2UW3A 3ZCLA 2X4FA 5EM7A 4E93A 4ZMFA 4BZDA 2R3PA 2BDWA 4DFNA 3CGOA 4G3FA 2WKMA 4ITJA 5HVKA 4BDBA 3RBWA 3RK7A 3D2IA 4PQNA 5HQ0A 2XK3A 4X0MA 3R63A 2VTOA 3PP0A 3SRVB 4U3ZA 2FO0A 3BPRA 5IMEA 3U55A 2OK1A 4F0IA 1SMHA 5AIRA 1ZMUA 3GC0A 3QKMA 5HO7A 4NM5A 4U43A 4I5PA 2GFCA 3Q6WA 3OXTA 3F3VA 5FQDC 2PVMA 5M4CA 3MFSA 2V0DA 3EQDA 3U9CA 4IJPA 3MJ1A 4CMTA 3BWJA 1XJDA 2OZAA 1Y6BA 5GHVA 3ZSIA 5A6NA 2WPAA 3KF7A 5E8TA 2YM4A 3TJDA 1T46A 4U44A 3Q5ZA 3DGKA 3PIZA 4IFCA 2OBJA 2HZNA 3CY3A 3UP7A 4J53A 2AYPA 1Y91A 4G5JA 4MXCA 3VS0A 4D2PA 3S1HA 3VS1A 5HO8A 3C0IA 3IOKA 4D2WA 3A7FA 1H08A 2OFVA 3HV5A 2SRCA 3VRZA 4YJNA 1QMZA 2C5NA 3AMBA 3V6RA 4D4YA 3EOCA 5JT2A 3QTSA 4E73A 5AP1A 4RJ8A 5IUHA 2ITUA 4O7WA 2QHMA 2VWXA 5FM3A 3V8TA 3MTLA 1XH4A 2XCHA 3TV7A 3TIZA 4FG8A 4C61A 3CGFA 3R00A 3P23A 3LAUA 4U0IA 3EIDA 5J5TA 3FLSA 4PP7A 4GH2A 1V0OA 3JVSA 4CFMA 5AR5A 3KC3A 5LQFA 3PRIA 3E3PA 4IADA 1XBAA 2XIXA 3PJ1A 3DZOA 1FQ1B 3LZBA 3RPVA 2ITXA 3IW4A 2B52A 4LYNA 3K5UA 3P7CA 4NKSA 5BVWA 3B2WA 2ZMDA 3AXWA 2C47A 3C7QA 2PYWA 4AXAA 4J8NA 4JDHA 4L42A 5DE2A 4MK0A 4R7HA 4AF3A 1Y6AA 2HENA 3I5NA 3PZHA 3W32A 2ONLA 2E9PA 1IASA 4EQMA 3O71A 4C36A 5I3OA 3ACJA 4FTMA 2GSFA 2W5BA 3L8SA 5E7RA 5ITAA 4FT3A 4CD0A 4RWIA 2F49A 4E6QA 4XYFA 5KO1A 3DPKA 4ERKA 3DU8A 3C5IA 4U45A 3PA4A 3ZEPA 1HOWA 4M7IA 2ZV7A 3VBXA 3C5UA 4PY1A 5ICPA 2BIYA 3ELJA 4KSQA 1FVTA 4X2JA 3NVKI 3R71A 4U6RA 5IKWA 3UGCA 4XEYA 4PWNA 2P4IA 3TKHA 4EUUA 2CPKE 3OT3A 3L9PA 4F7SA 5CEQA 2BIKB 4D28A 2W1CA 3OROA 5IQBA 4QQJA 3WF9A 3TKUA 4NYEA 2WGJA 4HNFA 3F5PA 3MVMA 2OIDA 5AP3A 2J5FA 4RIYB 3TV6A 2HZ0A 5C27A 3ZBXA 2X6EA 5CAVA 4MHAA 3DS6A 3PA3A 2ITNA 4RJ5A 5BNJA 3SXFA 1GZ8A 2BALA 4DEEA 3TEIA 3G9NA 3OY1A 4D9UA 4ZSAA 2UZOA 3I0OA 3TKIA 3UO4A 5A46A 4FF8A 4JQ7A 4O84A 4FTQA 5LMKA 3D4QA 4EKKA 4EHZA 3UIBA 3PJCA 4U41A 4JRVA 1MP8A 3DBCA 2REIA 4PTEA 5D41A 4D1XA 3RWQA 3GVUA 2GHLA 2WELA 3KY2A 3KRRA 3W2PA 3EFLA 2VAGA 4O7LA 3R6XA 5AR2A 2ZDTA 4QMTA 5HNBA 3ZEWA 4EORA 4H05A 3VUGA 5CF8A 1JVPP 5JK3A 4HYHA 3C4XA 2OGVA 3SQQA 2XBJA 3VBVA 3O8TA 4TYIA 3R02A 3QX2A 1JSTA 4EZ3A 2B4SB 2YM6A 3A7HA 2W5HA 3U4UA 3HP5A 4JDIA 1IRKA 1BYGA 1PXPA 4JAJA 3R7IA 3U8WA 3OY3A 4J8MA 2XM8A 5IQHA 4ZIMA 2UZBA 2ETKA 2JKQA 2OIQA 2QONA 3KQ7A 2BRGA 4ZJIA 5KMIA 2E9NA 4M14A 4EHEA 4MXZA 5HIDA 4PPAA 1ZARA 1J7LA 3DFAA 4E4MA 5EYDA 5IA1A 1SNUA 4I6QA 1Q8TA 4U8ZA 4FTUA 4B7TA 3SVVA 4R7IA 2C1BA 4M68A 5CAQA 4R3CA 4ACHA 1WFCA 3EFWA 4DEBA 2I0EA 5IG1A 3P79A 3OC1A 4BL1A 3LQ5A 1KV1A 3VRYA 3ZXZA 1TKIA 2BMCA 1YKRA 3FLYA 4KIKA 5M08A 4WUAA 2YISA 2QR7A 4LOOA 4BFMA 4Y73A 4XJ0A 4IDVA 5B2KA 1FBNA 2Z60A 3E5AA 4JAIA 4DLIA 4FI1A 4FK3A 4UMTA 4S30A 2XS0A 5AR7A 3GFEA 3GI3A 5M51A 4FV6A 4MWHA 3QALE 4L9IA 5KX8A 1KOBA 1WMKA 2PVYA 3PE1A 3B8QA 2R2PA 4PDSA 3ZZWA 5DRDA 4KD1A 2R0IA 2XIRA 3RPRA 1U4DA 3SOCA 5AFVA 4RA5A 1UNGA 2VTSA 2X7FA 3EQPA 3Q9WA 4RIXA 2C3JA 4H39A 3BZ3A 4PTCA 5HLWA 1OB3A 3FLWA 2RFNA 3LXNA 3NNUA 3PVGA 3CKWA 4OR5A 4GIIA 3MGYA 3TNQB 3NIZA 1REJA 4AFJA 2WQEA 4EH9A 3PE2A 1ZXEA 3MI9A 4EOOA 4PPBA 2YLFA 3HMPA 2VWZA 2PK9A 1BI7A 3W2OA 5CSXA 3K5VA 3RNYA 2FSMX 4CZUA 2VTIA 3CE3A 4E3CA 2OLCA 1KWPA 2R5TA 5CASA 2QU6A 1R0PA 2GU8A 4OTWA 4AACA 2WTVA 3POOA 4F64A 5GIOE 4JVGA 3JXWA 3RAHA 3AC5A 4FYNA 5ANDA 3ZXTA 4N4SA 5HORA 3FI4A 4CMOA 1U54A 4L6QA 4TN6A 4ZJVA 1IAJA 1P2AA 2IZSA 2QU5A 2P33A 3VW6A 4W8DA 3DJ5A 3F2NA 4AT4A 4X2FA 4AE9A 2ZYBA 4QMSA 3GU4A 2J7TA 3Q4UA 4R3RA 4Y5HA 4FICA 3RGFA 2JBPA 4XV2A 3DXNA 4XG3A 2OH0E 4MTAA 4EHVA 4QRCA 2YJRA 3Q6UA 3D7TB 3UOKA 4EI4A 5C8KA 2X8IA 3HVCA 2EU9A 2G2IA 4X2NA 1J3HA 4DYMA 4NW5A 5M09A 3O2MA 2XEZA 4UWCA 3E8NA 1NVSA 5HVYA 3FL5A 4O38A 1XR1A 2BAJA 2G15A 3K3JA 5D1JA 3OUKA 1TQPA 4IAAA 3RAKA 3FHRA 3KVXA 4YSJA 3EJ1A 3FPMA 3ZHPC 5C4LA 1J91A 4FTLA 2RG5A 3EN4A 4FOCA 4OLIA 3DLSA 3OOMA 3IDPA 3G6GA 4G9CA 1FINA 2R3IA 2CGVA 3PPZA 3PXKA 4HZRA 4X3FA 3VN9A 5JRQA 4BIEA 2Y6OA 5L6OA 3FSKA 1M14A 2GS2A 4O0TA 4UEUA 4DEAA 4KBAA 5A6OA 5IQCA 3NCZA 4WRGA 4IWPA 4EH3A 4TWNA 4E6DA 5K4JA 1PW2A 1YXUA 3DDPA 1YWRA 3GOKA 3FC1X 2VNWA 3EL7A 4OBQA 1YHWA 4XV3A 2CLQA 3TZ7A 5L3AA 2OI4X 2VN9A 3QQUA 4YSMA 1G8AA 2R3GA 3FJQE 4IC7A 3ODZX 5KMOA 3HUCA 3E7OA 4QP3A 4EK5A 5IQIA 2OZAB 3RVGA 2O8YA 1RE8A 3MH0A 5CQWA 3V6SA 4YZDA 2VGPA 4R5YA 2BZKB 5HI2A 1UVRA 2PVNA 2V22A 2XKFA 5CXZA 3FLQA 1OL1A 5AP2A 4ZTNA 5EOBA 2PMNX 5M4UA 4D5HA 5FDPA 3KXMA 1ZAOA 3C9WA 3EYHA 2EB2A 5AP6A 3LFCA 4HVDA 2YWPA 2WU6A 5CVGA 5E91A 4DT9A 3NDMA 4XG8A 5TT7A 3LM0A 3RPOA 5AP4A 4C35A 4ASEA 4UALA 1H0VA 1FMOE 2R3RA 5AV2A 1TQIA 2JIIA 1WVWA 3I7CA 5LVOA 3FXXA 4IWQA 3TN8A 2CNVA 2YDJA 3ZOSA 4LRJA 4D0XA 2BKKA 1R0EA 5AV1A 4F9WA 4O91A 4Q5HA 4QMYA 3EL8A 4IWOA 3NUSA 3P0MA 3QRUA 4DTKA 4APPA 1XBCA 4MAOA 2OO8X 3BGZA 1A48A 5IQDA 5I9ZA 4CSVA 4I4EA 3ZS5A 4FTNA 4YHFA 5DR2A 4KRDA 2XP2A 3WBLA 3QCSA 3BHHA 2ITTA 4FK6A 3SXRA 4WSYA 1PY5A 2YZLA 3LFFA 3BYUA 4JG7A 2PMOX 4G6NA 1ERKA 5J1VA 3N9XA 4CV9A 3PY3A 3SDJA 3EKKA 2WQNA 4F08A 2XNNA 2QO7A 4G3EA 4I4FA 2ESMA 4FKLA 4K11A 3QHRA 4FKRA 2R3QA 3ZLWA 5HTCA 5L8LA 2AUHA 5LVPA 3ENMA 5FTGA 5ETIA 2UZVA 3C4CA 4IDTA 2JLDA 2VRXA 2C6MA 4HW7A 3BYOA 4IEBA 4BYIA 5CYIA 1LPUA 5CEIA 1WBTA 5M53A 2XJ2A 4F6SA 4DGOA 4F0FA 4MX9A 2YJSA 3N51A 3CXWA 3ZRMA 2Y4IC 3BU6A 4AQCA 1Z5MA 4FODA 4C37A 3AC1A 4NFNA 5HD4A 3IOPA 3VHKA 1YI4A 5EW3A 2VGOA 3LQ8A 4ZOGA 3JR1A 3V5JA 5L8KA 5HG5A 5LARA 5LMKC 2YWVA 4ASZA 5CEKA 3UG1A 4D2RA 3GP0A 5ETFA 4EZ7A 4QTDA 4GYGA 3V5QA 3KL8A 3KRXA 4JRNA 1BKXA 5M57A 3LXKA 5AAEA 5DMZA 3UZPA 1YXSA 1OM1A 4YPDA 4RG0A 4EH4A 4M69B 4N6ZA 5T3QA 5HNIX 4ZY5A 4Y85A 3FMJA 4RQVA 1PMUA 2H8HA 3UOLA 4FNWA 2G2HA 5BVKA 3VBYA 3CD3A 5J9LA 4Y83A 2ITPA 4WG5A 3BI6A 3DB8A 3VS4A 3NNWA 2HWOA 5AUXA 2JDOA 3SRVA 3NS9A 4MWIA 4ERWA 2XJ1A 4XLVA 2C0TA 4IZ5A 5L2IA 2B0QA 2J5EA 5BQ0A 2R7IA 4GT3A 4EONA 4D58A 5IA3A 4TWCA 4MQ2A 1KUTA 3N4TA 3FMHA 2WB8A 5G1XA 2XKEA 2UW0A 4XMOA 4YZCA 5J95A 2BHEA 4YGAA 2VWIA 5JGDA 5IQEA 2C4GA 3ENHA 3MPAA 4HGEA 4AWIA 3FI3A 4RRVA 2OJ9A 3IW5A 5DIAA 3R9RA 4FTAA 1Z9XA 4ZTHA 3CTJA 4TXCA 5ANJA 3S2PA 3I6WA 2XK4A 4HGSA 4L68A 3SW4A 1NY3A 4H58A 2LGCA 4HCTA 4YZNA 2FH9A 3A4PA 4FV8A 3OOGA 5IA0A 4EUTA 3WE8A 3LM5A 5HTIA 2KTYA 1REKA 3BYVA 3QA8A 4UWBA 3GU5A 4YZ9A 3VAPA 1W8CA 3R28A 4EOIA 1STCE 3UNJA 2ZJWA 3LVPA 1GNGA 3PXQA 5EKOA 2QQ7A 3OZ6A 4CTCA 4Y8DA 2B9JA 2RF9A 2XH5A 4C2WA 2OJFE 3PIXA 5CI6A 1JKLA 1Q41A 2Y9QA 1OIRA 2WU7A 3ZH8A 3OTUA 5A4QA 2Z02A 3FAAA 4K6ZA 2AC3A 4BDCA 4LL0A 5J9ZA 3UQCA 4IH8A 4D2SA 4FEUA 4WNMA 1XH8A 4EC8A 4D2VA 2W06A 3IDCA 3OEZA 3PG3A 5BYYA 5DT3A 2VWWA 4QMXA 3DAEA 4BY9E 4I21A 3NW7A 4GU9A 5EW9A 4BIDA 4TYHB 4EL9A 2V7AA 3TACA 2C1AA 4M0YA 3PPJA 1KE6A 3P78A 3M11A 4GJ2A 5I9VA 2CN5A 4ASXA 5JKGA 2X81A 2VX3A 5LWNA 5FM2A 4K18A 3LFQA 3QHWA 4F65A 3K54A 4UMUA 2GNHA 3NW5A 2XKCA 3ORZA 3OG7A 4G3DA 3W2RA 4R5SA 2YAAA 5L2QA 2J50A 4RMZA 3MVLA 5IDNA 4ASDA 3NR9A 3KULA 4FTOA 4ZSGA 4Q9SA 4E26A 4BC6A 5C8MA 4M69A 3DK3A 2PE1A 4U97A 3SC1A 2Z7SA 1J7UA 3WE4A 2W0JA 5F20A 5FEDA 3R9DA 1Q99A 4I20A 2R3KA 4G2FA 5E8YA 4G9RA 4OTPA 2WOTA 2XNMA 4I6FA 1YWVA 2UW6A 4IX3A 5BMSA 1UU3A 2B9FA 3MA6A 4RWLA 3R8MA 3GBZA 3C0GA 4BHZA 3RPYA 1Y57A 4FKQA 4FA2A 1WVYA 3D2KA 3THBA 2C6EA 3F69A 4PDYA 2XK8A 4GU6A 2PHKA 3LFNA 5CLPA 5EHYA 3ROCA 4AGWA 2GFSA 5IPJA 4DH3A 5K4IA 3G0EA 3R21A 2UW5A 2A0CX 4XG9A 4FVQA 3FC2A 3LFDA 2PWLA 3FZ1A 5HU9A 2IN6A 4M8TA 5JN2A 3FKNA 4O6EA 5K5XA 4FEVA 2DWBA 5AAFA 3PWYA 4RJ7A 2XIYA 4XCUA 3FZSA 4FL2A 3FMMA 1Q8UA 2I0VA 3FE3A 5DGZA 3RP9A 4BCNA 3F66A 2VO6A 4EQUA 4ARKA 4MVFA 3NYOA 3ULIA 2C5VA 3IO7A 4QYEA 1H1WA 4XP3A 2QR8A 2W1GA 3H3CA 4KNBA 5FRIA 4BCPA 2OXXA 2B55A 4PP9A 4DGNA 1LR4A 1OL5A 2WD1A 5KE0A 2XNBA 4GS6A 3UZTA 4V04A 4ALWA 5HE2A 1YWNA 2ZV8A 3RZBA 3MVJA 4E5WA 1W0XC 5AUUA 2B9HA 2NRUA 4F1TA 2RFEA 3GENA 3ZSHA 4MXXA 5CNOA 2JD5A 3NUAA 4KIOA 5GIPE 3BE9A 4R78A 4GUEA 4RIYA 1WAKA 1OZ1A 1VZOA 3P4KA 3WI6A 3CP9A 3AT3A 5AP7A 5IH4A 5KNJA 3ATSA 4CFNA 4BBFA 4QMQA 2UW8A 4X6QC 3ROYA 2IPXA 4IAIA 4O7TA 5FP6A 3VULA 4O0VA 4GFGA 3R1QA 5M44A 2XNOA 3QYZA 2OG8A 4RZVA 4FV7A 3UIXA 2QD9A 4AT5A 5IQAA 2RFSA 3QRIA 4BDAA 5JFXA 4BDGA 4MNEA 1YOJA 4C38A 4YU2A 4MCVA 2PE2A 2OIBA 2WEIA 3QTRA 3DKOA 4GJ3A 4PMTA 4KSPA 4DLJA 3WOWA 3MESA 2YA9A 2HIWA 3D5UA 3RI1A 1V0PA 3FYJX 4HZSA 4DE4A 2ERKA 4MNEB 2W1DA 3QUEA 4KA3A 2PPQA 5LVNA 5DR9A 3NEWA 5H8EA 2ERZE 5EM6A 3VWAA 4BHNA 2UVZA 3QGYA 1LP4A 2CCHA 3A60A 5BX0A 5FXSA 3TCPA 3U4WA 4QTAA 3WYYA 4XOZA 1OKZA 3PWDA 2Y7JA 4IB3A 3PLSA 5LMAA 1B6CB 3NUNA 4O7SA 4UZDA 4FSNA 3TTJA 5HNGA 3C4EA 4P5QA 3IW6A 4IAZA 5EK7A 3FKLA 2WTDA 3A7JA 2QOCA 3MH2A 4YTHA 4NZWB 4DT8A 1JOWB 4S34A 2CHLA 3KXHA 3GOPA 4H3QA 4I92A 4ZSJA 2IO6A 3QQLA 4S31A 3GQIA 2IVTA 1H27A 2C6KA 1WVXA 2CMWA 1OI9A 3B8RA 4RC3A 4QMUA 2YHVA 1KE7A 4DF3A 5EH0A 2CNQA 5KBRA 2KULA 2VTMA 3KXNA 3KU2A 1OVEA 4BDIA 4AZVA 3DA6A 4IFGA 2J0MB 3UNZA 3NSZA 2UUEA 4BCKA 4Z7GA 4FSTA 5ANOA 4BDDA 3UPXA 5GZ8A 1ZOHA 5EHOA 5L4QA 5CEPA 4X3FC 4M15A 4ZTLA 2EVAA 4PX6A 3U6IA 3JY9A 4N0SA 4YJUA 4KKGA 4D9TA 5FDXA 5B2LA 4FTIA 3V51A 2P2HA 3WZJA 5HX8A 1UU7A 4FKOA 3LLAA 1PMNA 3MPMA 3HMMA 3R7UA 3I7BA 4GKIA 3F82A 4QQ5A 4XP0A 3RAIA 2HWPA 3VQHA 4F7LA 4USFA 4EK8A 1W84A 1G5SA 5EI8A 3VIDA 2OZOA 3BYMA 3OBGA 4G34A 1H0WA 2W9ZB 3AC8A 4WG3A 5G6VA 3LCOA 3WZUA 4KUJA 1KOAA 3NCGA 3PFQA 1UU9A 3NUXA 5ETCA 3Q2JA 3EQGA 4WOVA 1OITA 4AGCA 3MB6A 1Y8YA 1JSUA 4O22A 2ACXA 3M1SA 4FV9A 4CTBA 1GZNA 2BR1A 3VS2A 2ZV2A 5KKRC 3TUDA 2UVYA 3Q9XA 3KULB 3TXOA 3ORNA 4C59A 4HOKA 3JS2A 2ETMA 5M4IA 2WMXA 4QP1A 2W4OA 4C58A 3BELA 3UOJA 2PZ5A 3JY0A 2LAVA 2ITYA 2PVKA 5EYKA 5FXQA 4AGUA 3G5DA 5GNKA 4AG8A 3H30A 3EQIA 3S95A 4DG3E 4H36A 2ZB1A 3R8ZA 4RBLA 3L8VA 4BZOA 2QOHA 4IVCA 3ORLA 3HKOA 3V8SA 1DM2A 2C6TA 1DAWA 4IB1A 4C4GA 5EI6A 4YNOA 4F7JA 3REPA 4QMNA 1WBVA 3MIYA 1XWSA 2X7OA 4GK3A 4KRCA 4FSYA 2GNIA 4J52A 4RGJA 2WMVA 3AOXA 4WNKA 4RSSA 5IMXA 3UNKA 3HRBA 4R7BA 4RPVA 4EOKA 4FKPA 2VTJA 4ITHA 5I9XA 4WT6A 4HVIA 1XQZA 3IONA 4D55A 3BLRA 3SX9A 3F6XA 5GJDA 4I6HA 4ZTSA 3KK9A 4AOJA 4O7RA 2WEVA 4NH1A 4ZY6A 3Q53A 3H9FA 2IW6A 2VX0A 3C13A 3G90X 3O0GA 3PXFA 2X8DA 5ACBC 2YCSA 2JDVA 3C51A 1H1RA 4O0YA 2I6LA 4YNEA 5DYJA 2CJMA 5IEXA 1ZYJA 2GDOA 3LKMA 3IGOA 3FYKX 3LPBA 5AX3A 1UKIA 4NSTA 1GOLA 4N57A 4RQKA 3MY1A 3VF9A 1A06A 4QP9A 3D0EA 3AT4A 4K33A 3MYGA 5CVFA 3NAYA 4F70A 5F1ZA 1FGIA 4FSMA 5J7BA 4M67A 3R83A 4F9CA 5EDQA 3DZQA 3PPKA 2F4JA 5CWZA 2ZMCA 5FLFA 2XEYA 5EI2A 4RLKA 3ANRA 4OUCA 4QMWA 1PRYA 3OT8A 4ZP5A 2GMXA 4FKGA 4L7SA 4TYJA 3ZLSA 4WKQA 4EOQA 3FQSA 5CT0A 4JBVA 3FZOA 4OBPA 5HCXA 4I0RA 4UMQA 2O2UA 2YACA 4UMPA 4ZS4A 4F0GA 3W33A 2PVRA 2VTQA 4JBOA 5A4LA 3RM7A 1P4FA 3HV7A 4FSZA 5CQUA 4FKWA 3D15A 1ZZ2A 3ET7A 5ETAA 3PYYA 3FMNA 4BTJA 1MRUA 4X2KA 1S9IA 4RIXB 3OFMA 4E6AA 1H8FA 4MD9E 4C2VA 4WO5A 2GHMA 4XBUA 3GU8A 4CKJA 4FE2A 5AV3A 4GK4A 5FG8A 5IISA 3HRFA 1O6YA 1YVJA 3RK5A 3JPVA 3QTIA 3SXSA 1YDRE 4X7QA 1DI9A 3ZFYA 1M7NA 3QTUA 2F7EE 2XNGA 2YLEA 3I79A 3O8UA 3OCGA 2BKZA 3QXOA 4EHGA 5BPYA 3VJNA 5JZJA 2VNYA 4L00A 4ACGA 3E3BX 3DXQA 3TDWA 3P1AA 4A4LA 3U6JA 5IQFA 2XYNA 3MFRA 3Q04A 2PL0A 4EOJA 2VO7A 3RNIA 4EYJA 2R4BA 4FVPA 5TOZA 1XH5A 3QKLA 4RVKA 5E8XA 3TZ8A 2OF2A 4BDHA 3A8XA 3NUPA 4BN1A 3QZIA 3IW7A 2JKMA 2GNJA 2XIZA 3ZFXA 3DJ6A 4CGAA 2YDKA 1HCLA 1IG1A 4I3ZA 4X3JA 4F99A 1YDSE 4X6RA 3Q9YA 4AOIA 4OAVB 3HV3A 4KIQA 4AGDA 4YJRA 1I09A 3PG1A 3JVRA 3F3WA 3ZC5A 3DB6A 3R04A 3L9MA 2BRMA 4TKSA 2JIUA 4Y95A 5D9HA 1H01A 5J87A 3LXLA 3E8CA 3MN3A 3DBDA 1KE9A 4YZMA 3P86A 3R01A 2YN8A 3U87A 4E1ZA 4AU8A 2JIVA 2QURA 4CLJA 4O82A 4FOBA 3MV5A 4FV4A 1BL6A 5CSWA 5LJJA 3TV4A 3LW0A 3NUUA 3Q4TA 4MF0A 2BFYA 3F61A 2RGPA 3QXPA 2J0KA 2HXLA 4PF4A 5HCZA 3E63A 3W2QA 3E64A 3QBNA 4OBOA 5CEMA 5LXMA 1J7IA 5HESA 3OCSA 4MXAA 3VUMA 3C4WA 3RM6A 3TI1A 4I41A 4AA5A 4FL1A 5KZIA 2XNPA 3T9IA 4H1JA 5IEYA 5F9EA 2PUIA 4XV1A 5KZ0A 4IBMA 2BTRA 3AGLA 5GZ9A 4UX9A 4UWYA 2QCSA 3GFWA 4FUXA 4O1OA 4TRLA 3OWJA 1U5RA 1OKVA 1WBPA 5HE3A 3ATTA 4RIWB 5BVEA 3MTFA 2XK7A 4QP2A 4C4IA 2QLQA 4EWHA 2QOIA 4FKIA 3KA0A 1M2QA 2BILB 1SVHA 5EG3A 4IQ6A 3E8DA 4R77A 3LOKA 5LCJA 1YOMA 4QYHA 5IDPA 3CLYA 5CX9A 4NW6A 3D5WA 3AD5A 3F9NA 2Q0BA 3AG9A 3HMNA 3FQHA 1ZYDA 1PXJA 5HKMA 3GXLA 3DFCB 2F7XE 2C6DA 2QKRA 2XYUA 3SV0A 4OTQA 1UWJA 2QOBA 4YTCA 4NKAA 5D11A 4GUBA 1BUHA 3VS5A 4HVSA 5KMMA 2I0HA 3ACKA 5FEQA 4C8BA 4MXYA 5B7VA 2CKEA 4DFXE 5I5ZA 4IW0A 4BICA 4RX8A 4AA0A 4BI0A 2VTTA 1YRPA 3GCPA 4IAKA 4LV5A 3EHAA 2OFUA 3W2SA 4FIIA 2BRBA 3UE4A 4ACDA 2VUWA 5K5NA 4RFZA 4BBMA 2BROA 2W5AA 4C3RA 4D4RA 4EOMA 1Q3DA 1OIYA 2CN8A 4F6WA 5EQYA 4F6UA 1SYKA 3VUHA 4RC4A 4JI9A 4CFUA 2UZDA 2XZSA 2VTPA 3ZRLA 2J6MA 1XO2B 3VQUA 2E2BA 2G1TA 3CQUA 3EZVA 3U6HA 1ZLTA 5DVRA 2WMUA 1LEZA 4U79A 4XP2A 5E8UA 4C4FA 3I81A 5K0XA 3QUPA 1H1PA 2AC5A 4PL3A 5IH6A 4WBBB 4KS7A 2GCDA 2V5QA 5AIKA 4FIFA 4NFMA 3OW3A 2YIWA 2RIOA 4D2TA 5C8NA 3HP2A 2W4JA 4I0TA 4N6YA 3VUKA 2F2UA 3ZM4A 3HAMA 5FWKK 3FUPA 3WZKA 3L1SA 3ZM9A 3BHYA 3LCTA 2O64A 4O2ZA 2BVAA 3DJ7A 1U46A 2B54A 5CU4A 5LWMA 2F2CB 5AUZA 3BLHA 3PVWA 1APME 3FY2A 5TE0A 2DS1A 4RX7A 1XKKA 2X0GA 4FTJA 4RIOA 3MFUA 2BHHA 3QGWA 4W4XA 3Q9ZA 3LCKA 2PVJA 4XOYA 3RALA 3V3VA 4KWPA 3KREA 2W1ZA 2Z8CA 2Z2WA 4I5MA 1XBBA 5A3XA 1UU8A 5BUIA 2VD5A 5B0XA 4F09A 1YXXA 1JWHA 4KAOA 3W55A 1AGWA 4PTGA 5KMKA 2X4ZA 5CI7A 3RWPA 3SGCA 4UV0A 5J1WA 4UYAA 4ALUA 4FL3A 2WFYA 1BI8A 3TZMA 4D4VA 4ENYA 4JG6A 4I24A 5BVOA 5EYMA 4XV9A 4YJVA 1M52A 1SZMA 3ZU7A 5KUPA 2HAKA 3QF9A 5DA3A 1ZYCA 1JQHA 3QQGA 3AT2A 3ORTA 4C02A 4NJDA 3RMFA 4PMPA 4DEGA 3PP1A 4LM5A 4UB7A 5AJQA 3R8UA 4W4VA 2GNGA 4TY1A 1WZYA 4DCAA 5DR6A 3D14A 4CFXA 2BDFA 2JITA 2P0CA 3W18A 2YITA 4Y46A 1ZYSA 4ZZMA 5D7AA 1PYXA 4YP8A 4XG7A 3LFEA 4KABA 1Y8GA 4M12A 2W1IA 3FPQA 4YTFA 2NO3A 4K9YA 3UDBA 4FT0A 3UVQA 4CLIA 5JEBA 4BR3A 3FXWA 5DLSA 4YJTA 2WQBA 4E8AA 4KIKB 3U9NA 4I6BA 3KN6A 4GK2A 3UIMA 5L2SA 1PJKA 5AX9A 1H4LA 4E4XA 3NX8A 3BBTB 4F63A 4C57A 4DITA 5I3RA 4HCUA 3V5WA 2HOGA 4LFIA 2YAKA 3L9NA 4PMMA 4O81A 5FD2A 5IA4A 4BB4A 3VO3A 1PXMA 4O0XA 3FKOA 2JKKA 5H3QA 3OF0A 1VR2A 2Q0NA 5F94A 4TT7A 1CKIA 3DOGA 5I0BA 1ZY4A 4QQTA 2WAJA 1X8BA 2NRYA 3R1YA 4PRJA 1F0QA 3GQLA 5AUVA 4B4LA 3F88A 3TM0A 4FBXA 3EFJA 4IHPA 3VJOA 5JH6A 5K0KA 3LXPA 2RL5A 4AZFA 3RTPA 4FVRA 2O3PA 1UWHA 3B2TA 2UW4A 2CLXA 2J51A 2J0JA 2OSCA 3ERKA 3AMYA 3KB7A 2WMRA 2QOLA 3OWLA 4E4LA 2B9IA 3PJ8A 1U5QA 1WCCA 4O0WA 3ZUVA 4BCMA 3QRJA 3FMEA 2QI8A 3I60A 3OUNB 4DG0E 3SW7A 4WIHA 3H9OA 4XLIA 3SG9A 4EYMA 1URWA 3HDNA 1Q24A 4TNBA 3COMA 4QT1A 3L9LA 4YO6A 2CDZA 3G9LX 2WXVA 4FIGA 1M2PA 3UMXA 5JMSA 5H8BA 3C1XA 3F5XA 4RFYA 3ODYX 5BUJA 3FBVA 4C3PA 3QZHA 2IW8A 3P7BA 5HIBA 1P4OA 4IAFA 5FEEA 4BI2A 3BIZA 3BHVA 3MS9A 3NNXA 3QQHA 4TWOA 3GU6A 3PJ2A 5ANIA 2Q83A 4FYOA 4FSUA 4K8AA 4BKYA 3FMDA 1CSNA 4FV5A 3UIUA 2HCKA 2HYYA 1GJOA 3LLTA 1F5QA 4FV1A 4OTRA 4C34A 4BGHA 3KEXA 4IAYA 5HGIA 4CT1A 3SG8A 4WNOA 2YM5A 4QMMA 1ZY5A 2X6DA 3CJFA 2OJIA 4L53A 1Q61A 4WG4A 5FBNC 2XK9A 4C3FA 2XA4A 4JNWA
chains in the Genus database with same CATH superfamily
1JPAA 3BQRA 5HBEA 3RHXA 5CF4A 1XXHA 4OW8A 3RGSA 3SARA 4TNDA 5LVLA 1CDKA 3PA5A 3F3UA 4WA9A 4FZ7A 4ANNA 4Z3VA 3L26A 4MXOA 4BGQA 2LVPC 3MVHA 3EYGA 4M84A 4G1WA 3HHXA 1MN3A 3P7AA 4GHAA 4TUWA 4YPSA 3RAWA 4CKIA 3AKJA 2FYSA 3I6UA 4AZTA 4O83A 1CKJA 4KINA 4QOXA 4EK4A 5HX6A 3VUDA 2ZM1A 3TNHA 1OMWA 3FSFA 4ID7A 3R9XB 5D7VA 5AADA 3LJ2A 4R6VA 3CD8A 3H4JA 1QPDA 2H96A 2XF0A 4AFEA 2XUUA 2DUVA 3AOEA 3EN7A 3SLSA 1MRVA 1CTPE 4X2GA 5HD7A 4BBEA 4EH2A 5BVNA 4FG7A 4GFOA 3FI8A 2J9MA 4Z16A 4YC6A 4ANSA 2UXDM 3HV4A 3PY0A 4I5HA 3BU3A 2JC6A 3MB7A 4JDKA 1WBWA 2XEPA 1R3CA 3T3UA 4AZEA 3R9OA 1OUKA 3UQFA 4X21A 3H0ZA 4MYGA 4U81A 1ND4A 1XMLA 2C5OA 3BGPA 3QYWA 3D5XA 4W9XA 3R7VA 4LGDA 3FWQA 3QD2B 4IWDA 5DRBA 2ZM4A 2GS6A 4E7WA 5HLNA 3PLAE 4OTFA 5HOAA 4A9YA 5CAOA 2L7HA 4BBAA 1NSFA 4QMZA 4IBEA 1VEGA 4FIHA 2QKWB 4CIZA 3QTQA 2FSTX 2DNAA 4JBPA 3KMUA 2K6BA 3SC3A 4HYIA 1SXJD 1YHVA 3ZRKA 2XRWA 5TF9A 3LFAA 4LUDA 4PL5A 4CJ6A 1S9JA 4AW1A 4I23A 1XNQM 4JLCA 3ANQA 4CMUA 4CV8A 2PU8A 4FTCA 1IR3A 1UKHA 4PDPA 4LY6A 4WURA 2VWYA 2B7AA 3OMVA 2BFXA 1GAGA 4ANOA 2A1AB 3A46A 3PY1A 4Q7JA 4PDGA 1YUBA 2BDJA 2EJSA 3EQRA 4GIHA 4OT6A 2OJGA 4PPCA 4FKTA 4HNIA 1GIJA 5AM7A 3FUUA 3MBLA 4G6LA 5AP5A 2OO9A 4GVJA 4EJNA 3NMUF 4ZTRA 1U59A 3A42A 3EKNA 3NWWA 1KE5A 5E90A 4NJ3A 1H24A 2VTNA 2BCJA 4BTMA 2JFMA 3WF7A 5CZIA 3VBTA 2LBCA 4QPMA 5TO8A 2ITQA 1W7HA 3UO6A 5KHWA 3OWPA 3EB0A 2R64A 3UO5A 3I4BA 3SAWA 4IM0A 4LJAA 3BE2A 4GEWA 1PXNA 2FUMA 2PZRA 4FT9A 1JR3A 3WHLA 5BYLA 3GLHB 3DKGA 3QFVA 1J09A 4RF1A 2J90A 4GFMA 2V55A 5FXRA 3DK6A 4H1MA 2FB8A 5IA5A 1B38A 2QG7A 2RG6A 1Q5KA 4YLLA 2ZTDA 1DS5A 2N35A 1ZWSA 3GPPA 1GL7A 3KKVA 3V01A 1PXLA 3CIKA 3GCVA 2JY5A 2HZ4A 4DA5A 4IX4A 1PJSA 3PXGA 3H10A 4B8LA 5HLPA 3VONA 3HMIA 3A4OX 1YHSA 1PJJA 4L8MA 4LRKA 4NTSA 4QMPA 4AW0A 2PZIA 4G16A 4EZ5A 4F1MA 4DDGA 3QTWA 4C7TA 1R39A 3CF2A 2O65A 3BCEA 3Q96A 3GO8A 2XRUA 2QOOA 4FT7A 4JX3A 1UM8A 3TTIA 1OECA 4FNXA 4RX9A 3O8PA 4BZNA 4CZYB 5LCKA 2C69A 5CXHA 3AKKA 2R18A 1QZEA 5J9YA 1DGHB 5KKRB 3GLIB 4CISA 3DAKA 4ZS0A 2R3FA 2CNUA 3IG7A 5AR3A 3COKA 3I5ZA 4F9YA 5HCYA 4RIWA 2A4LA 1IA8A 3KCKA 4A9UA 4FZ6A 4ZAUA 3GC8A 1W83A 1BL7A 2X39A 3MY0A 5A14A 3DKCA 3P9JA 3KRJA 3KGAA 4DEHA 3U54A 2QOQA 5LMNM 3U6EA 1G59A 4J7BA 4NTTA 3TUCA 3KCFA 1LTMA 2DWMA 1RJBA 5EM5A 4O7ZA 4BCIA 2QOKA 3FYCA 3WYXA 4BTKA 3DTCA 2CRUA 4BLCA 2DVWB 3VNTA 2W1HA 4U80A 2VV9A 4PL4A 4A9SA 4OU7A 3FHIA 1N34M 3LMIA 4MUQA 3SAUA 4ORKA 1QCFA 2F57A 4J1RA 1JBPE 1NVRA 5CU0A 4QYFA 3VS7A 2H5XA 5C03A 2WMBA 2P2IA 2VIIA 4P2KA 3ZO4A 2LHGA 2YABA 1YQJA 1E9RA 1FPUA 3E7VA 2ITVA 5A4TA 4BRXA 1NY6A 3W0OA 2KRUA 3SASA 2MJ5B 3I4VA 2WTCA 4X3FB 5M55A 4GCJA 2UW7A 3OP5A 1J7KA 1RQQA 3UOHA 3VBWA 4EBWA 2R3LA 3ZYAA 4DN5A 3DNEA 4AG5A 4YO4A 1DAYA 3RPSA 5LOHA 4IJFA 1IN5A 3GUBA 2WO6A 1H6UA 1E32A 3JYAA 3Q60A 4KKHA 3S4QA 3UODA 5ITTA 2BRHA 5AA8A 5AEPA 3QU0A 2UVXA 3NVMB 4TTHB 3OD6X 4ZTQA 3ZLXA 1Z5AA 4DV7M 4G17A 3F7WA 4Z55A 1NA7A 4G6ZA 3UYTA 2J4ZA 2M5ZA 3F3ZA 1HQYE 2A27A 5TKDA 4DC2A 4G3GA 3RHKA 3IDBA 5AA9A 5T6KA 5M06A 3FY0A 3RKBA 4GKHA 4EEVA 5DT4A 4GSBA 3T15A 4I1ZA 2GS7A 4LJ5A 4NUSA 2UZWE 3OEFX 1WBNA 3HECA 3A99A 1TGUA 5E6JA 2PZPA 2F5QA 3PVUA 3QKKA 2HCBA 2CEAA 2ITWA 4BDIA 4BDJA 3BLQA 3OTOM 4USEA 4H3PA 1IXRC 4UBAA 5K3YA 2OU7A 4DEIA 2MR9A 1NVQA 3Q52A 4L3LA 2YCFA 4FSQA 3CCNA 4LOQA 4RLLA 4C4JA 4ZY4A 3W0SA 3D9VA 1H1SA 2BTSA 4I0SA 1L8TA 4REZA 4M66A 4U9AA 4IBBA 2R4EA 1Z6TA 1KSWA 3FLZA 3NAXA 4AE6A 4CFFA 4WUNA 4RWJA 1ATPE 3E87A 1OL2A 1ZRZA 4K2RA 4WBOA 5C9CA 5A4CA 3LQRA 2WMQA 4ZEGA 1UV5A 3NZ0A 3TUBA 3ZCBB 2W1EA 3G33A 4IJ9A 5E1SA 3DXPA 3PVSA 4OTDA 1GZOA 1R78A 4UXQA 4OVZB 4CRLA 1FVRA 5AMNA 3WIKA 2R4JA 3RINA 4IZYA 4JL9A 3SYKA 2IZTA 2Z7JA 1NHWC 3NBIA 4CHTB 4BCJA 3KRLA 2CKOA 4B6LA 4A4OA 5HG7A 1R2YA 3UTOA 3BHTA 4XRLA 3V8WA 2F5PA 1M17A 4YBJA 3VUIA 5ANGA 4A4XA 2BJVA 5KMNA 4AXCA 3IGGA 4TYHA 4MH7A 1ZYLA 4QNYA 4AT3A 3E62A 3QLGA 4O1PA 4DH7A 2WQMA 2R65A 1HJPA 4D1XA 3TNIA 4V0GA 4X64M 3D94A 5DEYA 1VYWA 5FGKA 3DLZA 4DEDA 4BTFA 2ITZA 2O63A 2OJJA 3MPTA 2R3OA 5D10A 3F7ZA 3LVWA 4IBDA 4O21A 5CZHA 5E8VA 3LIJA 1OKWA 3UK6A 5IT9S 4CCBA 2B1PA 3CPBA 1JKKA 3BEGA 4IVAA 3ZBFA 1IAHA 4H3BA 2V62A 4MNFA 2RSVA 5KPRA 1H28A 1ZOEA 4FNZA 4MEDA 3AD4A 5EYCA 3R9HA 3CQEA 3BV2A 2ITOA 3ZFMA 3LCVB 2QO2A 3SOAA 1FOTA 2BRNA 4LGHA 4RF0A 2QODA 1FVVA 2VWUA 2WMWA 2EXEA 1WBSA 4MQ1A 3GCQA 3VC4A 2CWBA 3F3TA 4QMLA 2Z4RA 1WXQA 3SATA 5GJFA 3VS3A 4JQ8A 4UN0C 5IH5A 2XKDA 1YXVA 1PMEA 5FBOA 3ZC7B 1FJGM 2WNTA 1MQ4A 4JIKA 2WTJA 3TIYA 3UQGA 4UY9A 4GV1A 1V34A 4XS2A 5EDPA 3CGWA 4Q9ZA 3G51A 4AW5A 3QCXA 4W9WA 1NJGA 5DBXA 3QC9A 3ZONA 3U61B 2Y20A 4HPUE 1OPJA 4ZSLA 1P14A 1HCKA 4XG6A 1MUOA 2DQ7X 4BDFA 1HT1E 4CFWA 3IPHA 2VWVA 4HCVA 3ORXA 4IMYA 4ZZOA 4ZSEA 3QZGA 2W9FB 3ZO2A 5CF6A 4MKCA 3W2CA 2R3NA 1NXKA 4IC8A 2V1UA 2NP8A 5A4EA 5AWMA 3QQFA 4LG4A 4Y72A 4L15A 3UVRA 3C50A 2VX1A 1E9HA 2FSLX 2JFLA 2UV2A 3AQVA 3RCDA 4LRSA 2PSQA 3G0FA 4W4YA 5M07A 2X9FA 2D7EA 4IBJA 4Y5QA 4GW8A 3I4YA 2CHGA 2E9OA 3NYXA 3DQXA 2OWBA 5C01A 3VS6A 2Y6MA 3FDNA 3PXRA 4G4NA 4FEQA 4LV8A 4EH5A 4FGRA 5CAPA 4RWKA 1UFZA 4LGYA 4LOPA 3EMGA 3BYSA 4YBKA 5ACKA 3VS4A 4ANQA 5HU3A 3HL7A 4YJQA 3PNVA 1KE8A 3AD6A 5HE0A 4AW2A 1IY2A 3SMSA 4GKJM 4Q2AA 4AA4A 4O0RA 4ZPXA 4CYIA 4C0TA 4FV3A 4QPSA 2ZV9A 5D12A 5M4FA 3G6HA 4IVDA 2G01A 2YM7A 3PXZA 5HICA 2ZTCA 3SHGB 3F5GA 3RCJA 3Q4CA 4NWMA 4YHTA 4EK6A 5I9UA 3NFFB 3EH9A 4FEXA 5HBJA 3E8EA 5HG9A 4UN2B 3KMWA 3ZSGA 1KV2A 5IU2A 4XBOA 1HNWM 2FVDA 1UA2A 1H1QA 4DR1M 3IKAA 5CT7A 5J8IA 4D4SA 1ZOGA 1KSFX 2HK5A 4NU1A 3EQBA 2E9VA 4XNEA 2QBYB 4C33A 4DGGA 4YR8A 2CSNA 1FMKA 4UXLA 4FV2A 1XHAA 4GL9A 5L6WL 3LFSA 4BKZA 2PVLA 2CCIA 1H26A 1PKDA 1P5EA 2R0UA 4JXFA 2FS1A 5F95A 4J71A 2RFDA 2OQ4A 4KB8A 5A9UA 5CSPA 1VYZA 5DNYA 4JG8A 2R45A 3C3DA 2XMYA 2V7OA 4V0GB 4HEOA 4YJOA 1Q02A 4GH9A 2JAVA 3HHWA 4IX6A 3DY7A 1XH7A 2W4KA 2G5GX 3BV3A 5L6PA 4L52A 1OJLA 4S2ZA 5BMMA 5HG8A 4AP7A 5IQGA 3EFKA 2GHGA 4G6OA 4EIWA 4JDJA 2RKOA 3D8BA 5CEOA 2R3JA 5EP3A 2X2LA 5K9IA 1JAMA 2ETRA 3VBQA 4RC2A 3MK6A 4PCZA 3PRFA 3QYBA 3NBXX 4BI1A 1K3WA 3A2CA 5AV4A 4TPTA 2R46A 1AD5A 2UW9A 3DBFA 4LL5A 2VTLA 3QCYA 5HHWA 4BF2A 4DINA 2D7HA 3TT0A 1VDLA 4F7NA 1K3AA 1N75A 2QLUA 3W16A 3QC4A 4L45A 3QQJA 4I81A 1KFVA 1ZMWA 2PE0A 1NT2A 1PXKA 1TH3A 3E9SA 2PVFA 2YM8A 4NEUA 3OTVA 3QAME 4XH6A 3FL4A 4ZJJA 5CANA 3M2WA 3PSCA 3K3IA 4IE9A 4MBJA 3UC3A 3CSVA 3A61A 3WZEA 4PV0A 3IK3A 1CUKA 2UXBM 4U3YA 4YJSA 2XVDA 4ACCA 4DCEA 4DV3M 3HJQA 4MGYE 2HY81 2E5LM 1MQBA 1OGUA 4FIJA 4XBRA 5E8ZA 2PMIA 3CJGA 1L8QA 4TZRA 4V01A 2EXCX 1O9UA 1W82A 4FWGA 1YDTE 1CKPA 3COHA 3HEGA 4NM3A 3DNDA 4TWPA 1BLXA 3TWLA 3BHUA 2WTKC 4D1SA 3AOGA 2KNZA 4DR5M 4AN3A 4PT5A 3FZRA 2HL7A 4BCHA 5FTQA 4CQGA 3R0TA 2JEDA 3CTHA 2CGXA 2O5KA 4J99A 5CU2A 3GU7A 2B53A 3EIEA 4LFBM 2O0UA 2PMLX 3EN5A 3GB2A 4BWPA 2Z8YM 2C9CA 3T8OA 1SVEA 3LMHA 4AN9A 2R7BA 3DTWA 2Z7QA 3V04A 1PYEA 3MSSA 4B7GA 2FA2A 4WD5A 1PJTA 2P55A 3P08A 3QLFA 2PVHA 3NGAA 3SA0A 3F2RA 3TL8A 1RU3A 3NYVA 4IZAA 3TMOA 1YXTA 3FLNC 4JOAA 2VZ6A 4NK9A 3QRKA 2BPMA 3EN9A 3NUYA 1T45A 3QAUA 3QQKA 3SHEA 4A06A 3S00A 4DBNA 5H2UA 4WSQA 3QD4A 4AZWA 1XNRM 4RA4A 3UC4A 5D41A 4XRJA 3CPCA 4XG4A 2OXYA 4BIBA 3HLLA 3OVVA 4I93A 4CQEA 4FKUA 4L43A 3M0EA 4FNYA 3PUPA 3ZO3A 3I51A 1D0LA 2BZHB 1KYIA 2QC6A 4FZAB 4E20A 1IA9A 5F4NA 4HVHA 4I22A 4S33A 2UZLA 3MDYA 4LRMA 4R1VA 3TNPC 2XF3A 3BU5A 4ALVA 4DH8A 4EQCA 1OGYA 1ZMVA 4OT5A 3GRYA 2YIQA 1L1ZA 3BRBA 4L3PA 3A62A 4YLJA 4FTRA 3ZUUA 4AS0A 5CNNA 5BVDA 3F5UA 5J79A 4AQYM 5EM8A 4R1YA 1IFYA 1WBOA 3GCSA 3KN5A 2GNOA 2CGUA 3FI2A 4G3CA 1SNXA 3W8LA 3BL7A 3EZRA 1DO2A 1C7YA 3I1AA 2XB7A 2YIRA 4JX7A 1VEBA 4NIFA 4QP8A 4RVMA 4CRSA 4F9AA 5AUTA 1QL6A 1OBGA 3O5AA 3IS5A 4BKJA 3VVHA 1WGLA 2MGWA 5EQPA 4F2LA 4W8EA 2ZDUA 3K2LA 4AKGA 1PM5A 4PNKA 3ZDUA 2G2FA 4PDOA 5ANEA 2F7ZE 3T1YM 3U6QA 1OIUA 2JY7A 2I40A 4JT3A 4M0ZA 5GJGA 2CGWA 5FP5A 3BGQA 4NT4A 5DPVA 3ZDIA 4GKKM 5DG5A 4AZSA 2HW7A 3MH1A 1YI6A 4DFBA 3AC3A 1OIQA 3QTXA 4PMSA 5EOLA 4I4LA 1K2PA 4DH5A 4YC3A 3KP1E 4M0DA 3QRTA 4O0SA 4JQEA 1T6OA 3C4ZA 3FEGA 4HJOA 5EKNA 4MH0E 3BBWA 3O51A 3BEAA 4JR7A 1BX6A 1IQPA 3Q32A 4RJ3A 2PUPA 2GPHA 4GRIA 2UZEA 2GNLA 4X65M 3HAVA 2EUCA 2ONLC 2Y4PA 2DZOB 2X8EA 3HUBA 2PY3A 3DZDA 1JR3D 4IANA 4PNIA 3UG2A 2WMAA 5EFQA 4QDEA 2E9UA 2FE8A 3TPZA 3AC2A 4D0WA 1SXJE 4O7NA 5HEZA 3UYSA 2YCRA 4KBCA 3WARA 3E93A 4K77A 3OHTA 5CY3A 5CAUA 1E1XA 4B7HA 1PRBA 1L3RE 8CATA 5JFVA 3O17A 3TG1A 2VTRA 4L44A 2JDRA 3FRIA 3T9TA 1GY3A 2BUJA 2L7IA 2W96B 4W4WA 4BJJB 4FGBA 3V5PA 1WR1B 3I01M 3CKXA 3H4MA 1IN8A 3R8VA 3WIGA 3DCVA 3ITZA 4FCWA 2DXIA 2H6DA 1PJIA 2NPQA 2PTKA 2QOFA 3FQEA 4II7A 1JLUE 4GT5A 4CG8A 4BCFA 3OW4A 2KHHA 3KK8A 3O7LB 5CENA 5M56A 1H07A 1W2DA 3RGPA 4LFCM 3CBLA 4LQMA 4P7EA 1O6KA 5EW8A 4F9BA 5AUWA 2XARA 1SVGA 3B74A 3QD0A 2XBAA 1OIPA 2J2IB 3QUDA 4JI8M 5DFLA 3MJ2A 3LJ0A 4FZFB 4G5PA 4ACMA 1E1VA 4ANBA 1IN7A 4TYGA 4UYNA 2VQEM 3L8PA 1ZZLA 2X7GA 2K0BX 2ZAZA 5EJCA 4KKEA 3WZDA 4O7VA 4GEOA 4RJ4A 4B0GA 2R9SA 4LMUA 2XANA 2C5XA 4LFAM 3R7GA 5J5SA 3GEQA 1K3XA 4AKHA 1WJ7A 4AXFA 4FTKA 4M97A 5DI1A 5ITXE 5I4NA 2I1MA 1TDZA 2UZTA 4GRBA 4DFZE 2IG7A 3FZTA 3VF8A 1Q8ZA 1Q8WA 4KIPA 2WIHA 3ZUTA 4Q5EA 3ULZA 2WSEF 2MROB 3CTQA 3GLHA 3Q8GA 4K1BA 1QQWA 2YZAA 3BX5A 4QMVA 3E92A 5EDRA 3R7EA 1W2CA 1NO1A 1H25A 4LMNA 1O6LA 2X1NA 3J7AS 4KO8A 2P3GX 1E9SA 2OKRA 4FKSA 5KBQA 3FTDA 3QX4A 3N4UA 3PVBA 4BGGA 3QZFA 4OTHA 3NYNA 4Z9LA 1QPEA 4DFYA 3AV0A 1XH9A 2J0LA 3KOWE 4HPTE 4NIFB 4FVMA 4YJPA 2QCUA 4JR3A 2CV2A 4ONAA 4BWXA 5ITQA 1K82A 3Q5IA 4DFLA 3MIAA 5HO6A 5JQ5A 4NC6A 5JFWA 3UVPA 3HJSA 4USDA 2VO3A 3D7TA 3U61A 1RDQE 2Z7LA 3P5KA 5JRSA 4RX5A 1PXOA 3O7LD 1IEPA 1OBDA 2PULA 4B3TM 3UZRA 2YNMD 2F9GA 3NNVA 3KOZE 5HVJA 2JP7A 4IBIA 1GIHA 4HGLA 5HIEA 2IVVA 5I9WA 3VK7A 4BCQA 5LVMA 5JQ8A 4EOPA 5IF1A 4MBLA 4O4BB 4CNHA 1F3MC 1AUAA 2C30A 2IW9A 5DOSA 1OAOC 3A7IA 4B8MA 1GJTA 3GLHE 2EB3A 4P90A 5AP0A 4C4EA 3LMGA 2FSOX 1ZAEA 3EN6A 4II5A 3T6PA 3PJ3A 1OUYA 5E8WA 4FV0A 4A7CA 5H9BA 4ENXA 5L2WA 3W0RA 5L8JA 2LVAA 2I0YA 2XH9A 2C3KA 3QCQA 4AN2A 4CCUA 2CKQA 5JSMA 3HDMA 4EC9A 4E4NA 3R73A 4QNMA 3Q8XA 1OL6A 2XLJA 4QNAA 4AXDA 3C4FA 4YTIA 2LVOC 2WZJA 2PUNA 2G3QA 5FTMA 2JKOA 2XM9A 2ZOQA 5HBHA 5KCVA 4KUJA 5LMBA 3CS9A 3C3EA 4BYJA 1JSVA 2W1FA 2JXNA 3MW1A 3R8LA 2ZVAA 2WQOA 4JIAA 4R71A 4NRVA 4CVAA 3GLGE 2IVSA 3VW8A 2VTAA 2DHRA 3FD9A 3AC4A 3FTEA 4P4CA 5EP1A 3EQCA 3O23A 4OGRA 3QWKA 4V05A 4FX3A 4MD8E 3GC7A 4GMYA 4P5ZA 3L8XA 5CVHA 4DHFA 3EQFA 3HRCA 4FKJA 3FMKA 3FUWA 3KXXA 4YMJA 5CSHA 5BV3A 3IHPA 4J98A 5DWRA 4EH6A 1QPCA 2HZIA 2XSZD 2YFXA 4ZXTA 3VUTA 2G9XA 4RFMA 3WILA 3CC6A 1IBMM 3ZC6A 3ID6C 4OAUC 4NXMM 3ORKA 1QUTA 3O96A 3LJ1A 1DI8A 3ZMMA 5AAGA 1W98A 3DV3A 4C4HA 3ORMA 2EKKA 4ITIA 4L3JA 3FRHA 1V92A 4D5KA 3MH3A 3UJNA 2NNWB 3R30A 2QVSE 3DBEA 1VG5A 3Q2MA 4FIEA 5E92A 1PMVA 3BWFA 1AQ1A 1J1BA 5E8SA 4B99A 4FEWA 2WTIA 2RRUA 4R3DA 5CS6A 4FG9A 3UBDA 3HA6A 3D7ZA 5DN3A 3OBJA 4WHZA 4O7YA 4TL0A 3GNIB 2RGHA 2CKPA 5IZFA 4IX5A 5BYZA 4GG7A 4DV1M 3LCDA 4M0WA 1V1KA 4RVLA 3KFUG 3M42A 4DR4M 2W17A 4I94A 1R4GA 4KBKA 3LQ3A 4A9RA 4DGMA 3QWJA 2X8AA 4KS8A 3C0HA 4L01A 3VKGA 4OW0A 2YEXA 2OH4A 4RVTA 3R8PA 4IACA 5E9EA 2W05A 4BCOA 4FD2A 1QPJA 5L2TA 3S0OA 2R3HA 4QTBA 1HNXM 4O96A 2C3IB 5KPTA 2Y0AA 3A8WA 4M9XA 3D5VA 4YHJA 4B9DA 4U42A 4FSRA 4YURA 4ZK5A 2R3MA 2ZFYA 4DH1A 5AV0A 2GTNA 3NW6A 4QPAA 4GC9A 4NCTA 1QDRA 1B39A 1YW2A 3HZTA 3R1NA 2JGZA 3DDQA 3GLFE 4FR4A 4QTCA 2IVUA 5AR8A 5GINE 4S12A 4CEGA 2UUBM 5FTLA 5CTPA 5A54A 3E46A 4JYAM 4J97A 5JGAA 5J7HA 4DTAA 4IXPA 3TWKA 3LFBA 3UP2A 1J1CA 4EH7A 2WSCF 3RE8A 4BWKA 3U6CA 1H00A 4FSWA 5DH3A 3LE6A 2VDBB 2X0QA 3MY5A 4N70A 5HTBA 5IEVA 3FMLA 1M7QA 3W1FA 5IUGA 2Y21A 5KO3A 1TH2A 1JNKA 2X2KA 4FZDB 2VU3A 3ILKA 3VFDA 2W7XA 3POZA 4O4CA 3NRMA 4DBXA 2OOBA 4LI5A 1IY1A 3U6OA 4U5JA 4R8QA 3H0YA 3PIYA 2XCKA 4AAAA 5IA2A 4EJ7A 4FWHA 4DR7M 4WNPA 4I5CA 4I6LA 2ZB0A 3PSBA 1NW1A 3RJCA 3KFAA 2OOAA 1PXIA 2I7QA 2HWJA 5DT0A 4TYEA 4LDTA 3UJGA 5JGBA 3JUHA 2IZUA 1XH6A 3GRVA 2QG5A 4B3SM 2WTWA 3GCUA 3R2BA 2GTMA 3WF8A 5BVFA 5C1QB 3KF4A 3BL9A 5EXPA 2HW6A 2XJ0A 5CU3A 5HE1A 2BAQA 2GNFA 2H34A 3BQCA 1DGHA 2A2AA 2X2MA 4L46A 2DENA 4IB0A 4E5BA 4FKVA 3G2FA 2DYLA 4TW9A 4O27B 4DHZA 5AM6A 4QO9A 3ALNA 1GZKA 1OTRA 2QO9A 4QQCA 4L7FA 4U40A 3G15A 4GYIA 4OTIA 1AIPC 4YC8A 1Q8YA 3FXZA 4AX8A 4ZMEA 1RW8A 5TR6A 3BKBA 4DGLC 5JZNA 3HGKA 5FUTA 3MA3A 5KMJA 5DFPA 2HELA 3ETAA 3FV8A 3TZ9A 3AGMA 4FT5A 3ZZEA 4IBKA 1NNJA 3GP1A 4EH8A 4MD7E 3R7OA 2WOUA 2C0OA 4JI6M 2Z7RA 3T1HM 1UNLA 3HX4A 3KMMA 4FUYA 4CT2A 2DWZB 5AUYA 3W8QA 4IB5A 2J0IA 3IECA 5EHLA 4UZHA 3IG5A 1M2RA 1X37A 3DK7A 1Z57A 3KXZA 5DEWA 1FGKA 1I4WA 1OPKA 2YCQA 4GHLA 4JJRA 2HY0A 3QA0A 3MJ5A 2ZAMA 4S32A 5IUIA 4YUQA 2JAMA 4IIRA 1JKTA 2EO2A 5B2MA 2WMTA 3OXIA 3GGFA 2FGIA 3IQ7A 4EK3A 3QL8A 4QHTA 2WIPA 3HV6A 2A19B 5BUEA 3N4VA 1NV8A 3NLBA 1OPLA 1Q4LA 1TVOA 4DAWA 3E21A 4D82A 3ORIA 2VO0A 2EKFA 2LNHC 4GIPA 3GT8A 4IVBA 1OQYA 3OXZA 3NPCA 2EXMA 3FZPA 3LCSA 4R3PA 4UMRA 4RJ6A 4LF6M 3E88A 3SKCA 1QAMA 4L67A 5CALA 2WSFF 3R22A 2RKUA 4A07A 2GQRA 4ZLYA 3KVWA 4CKRA 3HMOA 1BMKA 4MF1A 2UZNA 3CQWA 4U7ZA 4A9TA 4CZTA 4NCTC 2VWBA 4IM2A 2XK6A 2BZJA 4O2PA 1Q62A 4BDKA 2WHBA 2WMSA 3COIA 3CEKA 3W10A 2CV1A 4GG5A 2QBYA 4AOTA 4CXAA 4QMOA 4QYYA 2IZRA 2EWAA 3O50A 3QTZA 1OKYA 3UPZA 3DAJA 1TQMA 2HXQA 2XZUA 5HZNA 2ZM6M 3KXGA 2QNJA 3ZO1A 1R1WA 2IWIA 4PUZA 3DKFA 4FTTA 4M13A 4QP4A 4XX9A 4EWQA 4O6LA 5C26A 3W68A 3IW8A 1MRYA 4CFVA 3CR0A 3TNWA 4YZBA 5T68A 3SD0A 2GQGA 2YFQA 3NIEA 2QPAA 4NM0A 3MFTA 4EOLA 4FCVA 3WF5A 4ZLZA 5FTOA 2IEWA 3H9RA 4AUAA 2C68A 3ORPA 3LHJA 3AMAA 3PZEA 2OXDA 1Q3WA 4K0YA 2YM3A 4EKLA 1TF0B 4FC0A 3DQWA 4IM3A 3HNGA 4HYUA 3DT1A 1G3NA 2BAKA 3A7GA 5H8GA 3R9NA 3V5TA 4HVGA 2OICA 3KREA 5DNRA 1VJYA 4XHKB 4QD6A 3OCTA 1GIIA 1I44A 3K92A 4CYJA 3OWKA 1EH4A 5CSVA 3Q4ZA 4G31A 1OL7A 3R2YA 5AR4A 3RZFA 5I9YA 2C6LA