3KVWA

Crystal structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (dyrk2) in complex with an indirubin ligand
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
408
structure length
403
Chain Sequence
HHSGVDLGTENLYFQSMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSKGYPRYCTVTTLSDVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity tyrosine-phosphorylation-regulated kinase 2
publication title Crystal Structure of dual-specificity tyrosine phosphorylation regulated kinase 2 (DYRK2) in complex with an indirubin ligand
rcsb
source organism Homo sapiens
total genus 125
structure length 403
sequence length 408
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.980 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kvwA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kvwA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kvwA02
3QCYA 4NIFA 4S33A 4ZLYA 4XG2A 3DAJA 5DFPA 3TZMA 3G2FA 3PTGA 5CI7A 2ONLA 2ITYA 2JDOA 3ITZA 4U97A 3UIBA 4KWPA 2VTLA 2ZB1A 3OTVA 4QMQA 3SQQA 3FYKX 3LCOA 4PNIA 4YLKA 4EQCA 4CEGA 3HKOA 4DE4A 3QZIA 3UOHA 3ZXZA 2ZB0A 4F7SA 4M66A 4C58A 4M13A 4IAFA 2BR1A 1JOWB 3KL8A 2ZMDA 3LW0A 3NVMB 1URWA 1GNGA 3VS1A 4FVRA 1Q8TA 3SW7A 2H96A 2XK6A 5KZ0A 4D2SA 3H0ZA 3MTFA 3QQKA 3AMYA 3D9VA 3NCGA 3A7IA 4CKIA 4IZ7A 4E4LA 2PE2A 4ZY6A 3COHA 3R1QA 2Z02A 3HUCA 3BYVA 5HIDA 2Y0AA 3NGAA 2HW7A 4L43A 3R7YA 2VU3A 2J6MA 3MY0A 3NNUA 3DFAA 3MBLA 4W4VA 2VWZA 3RK9A 3PLAE 4GFMA 4CKRA 4WKQA 4RJ6A 5HD4A 1H8FA 1ZLTA 3NW5A 1CMKE 4RMZA 5DG5A 3V5JA 3Q60A 3Q32A 5CU2A 3W2SA 4G5PA 4G3CA 4IADA 3HV3A 3ROCA 4O21A 1IAHA 1XHAA 2ITWA 2C3IB 2RFEA 1Q4LA 4FKOA 3UO4A 2W17A 5I9YA 2EXCX 3MIAA 1Z57A 4P5QA 3A8WA 4MXCA 3WZDA 3O23A 4KKEA 3BYUA 3TXOA 4CYJA 3AC4A 3UMWA 3PIXA 4K77A 1PHKA 3RPYA 2VTIA 3A62A 4TXCA 3W10A 3FSKA 3OW3A 3N4TA 3C1XA 3KCKA 1CDKA 5CEKA 5M09A 4FSWA 5M08A 2F57A 2W5AA 5CT7A 4BDKA 2J5FA 3FJQE 3FMMA 4YJOA 1GZ8A 5BYLA 2XIRA 3OG7A 2QKWB 1OUYA 1Q8UA 2R3JA 1JAMA 4BYIA 3UJGA 4I5HA 1JKSA 4D2PA 2CDZA 4YO4A 3NLBA 3VBTA 1VZOA 4DFLA 4EH9A 3F82A 4XV3A 3MSSA 3PVWA 4GL9A 5E4HA 4I41A 2DWBA 3PUPA 3OOMA 3QC9A 4A07A 2NO3A 2ZJWA 1BKXA 2WEIA 2VTQA 4C3FA 4RJ5A 4IB3A 4RA4A 3ZRMA 4LI5A 2J0JA 3QQLA 2GNHA 2YFXA 3POZA 4K2RA 3PFQA 4CRLA 3FZ1A 3VULA 3NAYA 5LVLA 1U5RA 3EZVA 4PDYA 4N4SA 4DBNA 4DGNA 2O3PA 3B2WA 3CR0A 3RWPA 3SKCA 4CCBA 4DHFA 3NVKI 4X7QA 5AIRA 3Q5ZA 2PK9A 1U54A 4M14A 1HOWA 3LFBA 3LAUA 4OTIA 3UP2A 1KE6A 4DEDA 4DEHA 4ZLOA 2VTRA 1YWNA 4W9WA 5HVKA 5AUZA 1H0VA 4X2GA 3CY2A 2YITA 4DCEA 1J7IA 2UVYA 2ETKA 4DH5A 1R0PA 3QD0A 4FTLA 4J52A 5HTCA 4RG0A 1FPUA 3OWPA 2WAJA 1IEPA 2VTAA 1R39A 4LG4A 4PL4A 5A6NA 2B1PA 3ATTA 1OL2A 4QO9A 4M0ZA 4F7JA 1MRYA 1Z9XA 3QFVA 2ZAZA 4GG5A 2YDJA 2GMXA 4BCPA 3R8ZA 4PV0A 2VO0A 3ZH8A 3QD4A 4IVAA 4F63A 5J7BA 5LJJA 4R3RA 3BHHA 3ORXA 1PF8A 5EK7A 4TL0A 5EQEA 4G3FA 5F9EA 2BDJA 1YW2A 4FZ7A 4JBQA 1A48A 2Y7JA 2O2UA 4DCAA 2C6MA 3QA0A 5FEDA 2WO6A 2XUUA 5K0KA 3R28A 2BRMA 3DBFA 2E2BA 2UZUE 4O7VA 2V0DA 3ORKA 3EQPA 4XP3A 5HG7A 3UQCA 3HEGA 3NUYA 3ZUTA 4GSBA 2C6TA 5M57A 1AQ1A 1WVXA 3OT8A 3FMLA 4ZEGA 3GU7A 4UALA 4RBLA 4I4FA 1Y6BA 4EOIA 5TOZA 2UW6A 2WKMA 2ZV7A 3MTLA 5FTGA 3CE3A 4F65A 4JX3A 5D12A 3EKNA 2VWBA 4AN2A 2JGZA 4LOOA 3PRFA 2F2UA 1ZOGA 4M7IA 4AGDA 4A9UA 3HECA 5EHOA 3A61A 3DQXA 4OTFA 4DT9A 2GFSA 5L6OA 2UZOA 4WNKA 4YNEA 4EH7A 4ZJVA 1PKGA 3DAKA 4I5CA 4UMPA 1JPAA 4RZWA 4YPDA 3A7HA 3THBA 4CFMA 3GCQA 4L3PA 5KMOA 4ASDA 4BGQA 4RFMA 5JQ5A 3ZC6A 1W82A 5M4IA 4CGAA 3QRIA 4BI1A 2OF4A 3PE1A 3IQ7A 2PVNA 4WNMA 3B8QA 4BR3A 4QD6A 3HRFA 2A19B 2Z7LA 3F5UA 4JR3A 5FRIA 3GU4A 3HMNA 4IAAA 3VS6A 3CIKA 2W4KA 3P7AA 3EQGA 3QTXA 3E3PA 4NH1A 4AZSA 2JAMA 3QUPA 4XG9A 3VHEA 2WTWA 3C0GA 4K6ZA 2X1NA 3Q4ZA 3C4XA 5ITAA 4OTQA 4QTDA 3U4UA 3RGFA 2VX0A 3KN5A 4CLJA 4AFJA 4XEYA 5AV4A 4QQJA 4CT1A 4QMXA 1Y8GA 5HKMA 4AGWA 1YXUA 2B53A 3PVUA 4MAOA 1W84A 3SOCA 3NYVA 1BL6A 5FG8A 4M69A 4YSJA 4IM0A 2Y6MA 2J5EA 5CLPA 5E8VA 4DG0E 2XM8A 3OXZA 2J9MA 3MVLA 4L52A 3G33A 3PA5A 5CF6A 2XKFA 3I7CA 2IZTA 3P86A 1UWHA 2YIWA 3G0FA 3GFWA 4G6NA 1GAGA 2VD5A 2VX3A 3H4JA 2XZSA 4QNAA 5CZIA 2YZAA 5HZNA 1QPEA 4D2TA 3CKXA 2BIYA 2QO2A 2G2HA 5ANGA 1U5QA 5AP0A 1G8SA 1OKYA 2R3QA 2W1GA 4ZSLA 1FGKA 3TNPC 3IW8A 5BVDA 5AX3A 3QWKA 2JITA 3H3CA 4AZWA 1WBSA 1UWJA 4A9SA 4BY9E 4EEVA 2ZMCA 3R7OA 2WQNA 4FIHA 1OVEA 4MXOA 4AT3A 1QL6A 3CS9A 4B9DA 5AAGA 4X3FC 4F08A 3D0EA 2R0IA 4KD1A 2WHBA 1MP8A 3BGQA 3IECA 5C8MA 1DI9A 2YDKA 5AP3A 5AR8A 1UA2A 3D7TB 4X2FA 2VTMA 3HGKA 3HMOA 4AA4A 2OK1A 5EW3A 3WE4A 2VWWA 2QOOA 5L2TA 4BCMA 5JFXA 4FL3A 3NUUA 3GQIA 2W5HA 3MVHA 4WHZA 1I09A 2WB8A 3UPXA 2OXXA 4FZFB 5IH5A 5AFVA 4DEBA 2OWBA 5IH6A 4LRKA 4OTPA 4YJNA 3BU5A 3UDBA 5FBOA 4EZ3A 2Z60A 4XG6A 4L44A 3AMBA 4XG4A 4FIFA 4CG9A 3OW4A 2CGXA 2Y4PA 1YI4A 4LGGA 4FTRA 4BFMA 1BI7A 5JH6A 5I3OA 3ZEPA 2HZNA 5LMKC 4D1SA 3GVUA 2WGJA 4CTBA 1WMKA 3ZZEA 5JRQA 3PVGA 3TNWA 2QVSE 3FPQA 4IH8A 2GSFA 1M52A 1UV5A 2YM5A 4G9CA 5EKOA 5AX9A 3A8XA 4W9XA 3V5TA 2QQ7A 4HGLA 3GCVA 5AP2A 2YISA 4FIGA 4IVDA 3V8TA 4YJUA 4C8BA 2HIWA 2XIKA 4FV9A 3E88A 4ZTLA 1YQJA 4B8LA 2CSNA 4D5HA 5GZAA 4UBAA 3UYSA 3PXZA 3EN6A 2A4LA 2IJMA 2WPAA 5A14A 4HPTE 4BBMA 3SAYA 4AZVA 3F61A 5I0BA 4DLIA 3RJCA 2V7OA 1L8TA 3ZLYA 3S4QA 3OTUA 3IDCA 5HG9A 5FQDC 3UIXA 3ZBFA 5AAEA 2XIYA 4I5MA 4RWIA 5HNGA 3H9OA 3QU0A 5FWKK 1Y57A 3GGFA 1YXXA 3ORLA 4GFOA 4PPBA 1AD5A 1Q8ZA 4A9TA 4CRSA 2PYWA 4XOZA 4YSMA 3UQFA 2QI8A 2XRUA 5IA4A 2YJRA 3O0GA 5B7VA 3GEQA 1PXMA 4GK2A 5K3YA 2XVDA 5CANA 2J2IB 4WRSA 3EQHA 3EHAA 3O96A 2B9IA 2GHLA 4IE9A 3WZUA 3OUKA 4E26A 3RBWA 4RIXA 1R78A 1GOLA 4BTJA 3GI3A 1B6CB 3GC0A 3PDTA 2OF2A 4FZ6A 4O0WA 3TDVA 4DTAA 1PXKA 4ENYA 4GYIA 4EZ5A 4O81A 4FTIA 3NNXA 4FSMA 2IZSA 3NAXA 4QMZA 5KX8A 4XBUA 4DH8A 3BV3A 2P2HA 3R1SA 3E8CA 5CF5A 2C5YA 4QTBA 3ZM9A 1H1PA 3ZS5A 2PPQA 4OAVB 3MIYA 3Q9ZA 5CSWA 1FVTA 1ND4A 2X8IA 3OOGA 4KKHA 2IW9A 4OT6A 4RWKA 4QQTA 5CSPA 1PXPA 2E9VA 3W16A 3EN5A 3K2LA 2BZKB 3FI8A 4TZRA 3JY0A 1TQIA 4ASZA 3KU2A 3MJ2A 3JXWA 3ATSA 1YHVA 5CYIA 3BZ3A 2G01A 3Q6UA 4TY1A 1YHWA 5KO1A 2WQEA 4KIPA 4KSQA 3NYOA 1UU3A 1ZWSA 1LUFA 3R9NA 4ITIA 1OIYA 2OIQA 1X8BA 3ORTA 5LVNA 4JX7A 4D1XA 4YJVA 4EOSA 3ANRA 2YACA 3MA6A 3ZMMA 5GIPE 2VX1A 3FL5A 3SD0A 2BZIB 3LFDA 4N6YA 5L4QA 1OL1A 4J98A 4C02A 1OL5A 1YVJA 2R3FA 4KBKA 4A9RA 4ANNA 5CEMA 5IQDA 4D2VA 3ACJA 5H8BA 4AT5A 1OPKA 3E87A 5IF1A 2PMOX 3BLRA 4F1OA 2XNPA 4AZFA 1TVOA 3HA6A 2BCJA 3SRVA 4BDDA 4L00A 5E90A 5EM6A 2R3HA 3V8SA 3MS9A 4R3PA 4FNYA 3IPHA 1BLXA 3EQIA 3QTIA 4AUAA 5EH0A 3KGAA 4CYIA 4RGJA 3VW8A 4PTGA 4AS0A 4L53A 4Y46A 4BBFA 2JAVA 4WG3A 2RF9A 3FMKA 4BCQA 5I9ZA 5KE0A 4EOKA 4V04A 4DYMA 3R71A 5DYJA 1G3NA 4UWYA 4EJ7A 5AP4A 4AAAA 4CCUA 4FV5A 1VR2A 1H24A 4MF0A 3EYGA 5EKNA 3AGLA 3V5PA 1W98A 4JJRA 2X6EA 1URCA 3F7WA 5DN3A 3OUNB 3CTQA 2XCKA 4O91A 4RSSA 4GV1A 3T9TA 4QP1A 4XG8A 3CPBA 2BMCA 5GHVA 3BHYA 1NVQA 4FT9A 3O51A 2GNFA 4WOVA 4X2JA 5CXHA 3ZM4A 5HD7A 2VZ6A 4ANLA 1Y6AA 2O65A 4ZMFA 3W8QA 3BEGA 1BL7A 1DS5A 3FWQA 1ZRZA 4ACDA 4TNBA 4CFFA 3ETAA 5H3QA 5AUYA 4I24A 3P7BA 4X3FA 1J7LA 4WUAA 2ITTA 4FTAA 3W2CA 4Z16A 2CKQA 3IS5A 3QTUA 3E92A 4KRCA 4RJ4A 4BWXA 3MJ1A 4LV8A 4FV7A 3MPAA 4YJPA 5JGBA 3LKMA 4F7LA 4FUYA 3PWDA 3ORIA 2XBJA 4U0IA 1YXVA 4BKZA 3DCVA 4FTOA 3PXFA 2BFYA 3RP9A 3KULB 3LXNA 4N6ZA 3S3IA 3FHIA 4HVDA 3R7UA 2JKOA 2GS2A 4ASXA 5F1ZA 3D5UA 4CQGA 4ANSA 3GP0A 5DNRA 1ZY5A 4NZWB 4TYHB 5J7HA 1M7NA 4UN0C 3FKOA 2ITUA 4OW8A 4TYEA 4AFEA 4L6QA 3HX4A 4ZXTA 3GXLA 1IRKA 4LUEA 2GTMA 2HY81 2WELA 2C69A 2UZTA 2X39A 2G2IA 3FHRA 5LMKA 4PP7A 3LPBA 4AW0A 1PXOA 3NUXA 5AM6A 2HELA 3KMMA 3QKLA 3D2KA 3O17A 3ET7A 4RQVA 3W8LA 4XH6A 4YHFA 5IPJA 4TTHB 5L6PA 4PX6A 3W2QA 2OFVA 4APPA 4D9UA 3COMA 3MH2A 3AD5A 5B2KA 4E7WA 4W4YA 3HVCA 2ITQA 3KRLA 1FMOE 2VGPA 2WTKC 4ACGA 3QRKA 4EBVA 4XLVA 3H9RA 2E9UA 3V5LA 3FXZA 3RAWA 3PG1A 1H1QA 1U46A 2P55A 2Y4IB 3F3UA 3GB2A 2GU8A 3GC7A 3KQ7A 3P7CA 4O6EA 4EK8A 2VUWA 3OY3A 5HG5A 3R0TA 1PKDA 2IVUA 4RIWA 3TJCA 3KRWA 4D58A 4FTQA 3VBVA 1H26A 4G5JA 5EYCA 4C0TA 2JD5A 2V55A 1WBOA 3UO5A 4YZNA 3DK7A 5A6OA 4LUDA 4F70A 1IG1A 4QQ5A 4PF4A 4O86A 4IXPA 2PVYA 3Q6WA 4PWNA 1BUHA 5J9YA 2G2FA 3TJDA 5FEQA 3E7VA 4C34A 3UYTA 3EZRA 5JGAA 4ZJJA 4AN3A 1VJYA 5M4UA 2IWIA 1P5EA 1SMHA 4O38A 2BVAA 5J95A 3TM0A 4HVGA 1XWSA 5FXQA 1WAKA 4O0RA 3R8VA 3WOWA 4QMVA 1RDQE 3TT0A 4AACA 4XJ0A 5FM3A 5EOLA 3L9PA 2PE1A 4TWPA 2XK3A 2EB3A 3ZUVA 4AG8A 5CAQA 3DA6A 4GU9A 2QOHA 4HGSA 4Q5HA 3VN9A 4FIIA 1PYEA 1JKKA 4S34A 4FG8A 4YJQA 2CJMA 5AADA 5CS6A 4G34A 3LE6A 2XNGA 4MWIA 2W1IA 3HRCA 2ZM3A 3DFCB 3ZFYA 4PNKA 4CZUA 2YZLA 1OKZA 1IA9A 2GNIA 5LXMA 5CAPA 2GCDA 3EQDA 4FYOA 4H1MA 2W9FB 3L8SA 5CENA 4ALUA 2R0UA 3MYGA 5FXSA 4HZSA 4IDVA 4NTTA 5DR6A 4IC7A 2RSVA 5ANJA 4E8AA 2ITOA 1YKRA 4NUSA 2ZV9A 3C7QA 4GS6A 3JUHA 1M7QA 2CNUA 5HLPA 3U6IA 4DEIA 4MD8E 3NX8A 4AOIA 4YUQA 4K18A 4KNBA 4OTWA 3EQFA 4F9WA 4RVTA 5M4CA 3CLYA 3QL8A 3Q2MA 4U8ZA 4X6QC 2HENA 4NFNA 2CLQA 5EYDA 1XO2B 4EBWA 3FXWA 3KK9A 4FTCA 4C3PA 3OEFX 4UY9A 2WFYA 3OXIA 4NKSA 3WF8A 4C4EA 4P90A 2PY3A 3M2WA 1YOJA 2OGVA 1REJA 3TKHA 2Y8OA 5CAOA 4HGTA 3PG3A 3E8NA 2YA9A 5C01A 4GT5A 5A4EA 4GW8A 4RIYB 2XNEA 3CKWA 1OZ1A 3ZUUA 2QLQA 4EI4A 4KUJA 2CLXA 2B0QA 4KIOA 3DKGA 1WFCA 5FUTA 2JIIA 4MH7A 4QMNA 4OTGA 3OCGA 3AT3A 4DT8A 3NZ0A 2OJIA 2X7OA 4DEEA 3OXTA 3MA3A 4IX5A 4FIJA 4NM5A 4GK4A 1M2RA 4W8DA 4ERKA 4W8EA 3D4QA 4YC6A 3NUNA 5HGIA 3O8TA 1O6KA 2EWAA 2I1MA 4PUZA 4GVJA 3UOLA 5J79A 3N4VA 4IVCA 4XRJA 2B4SB 3RAHA 5ICPA 1YHSA 3K5UA 4EL9A 5KKRB 1E9HA 4YJSA 5GINE 2XNNA 3HRBA 3HP5A 2B9HA 1TQPA 2XKCA 4FV1A 2BKZA 3NMUF 4QOXA 4DFNA 3R02A 4IM3A 1W83A 5HHWA 3G15A 3VUTA 3O50A 5KMKA 1U4DA 2VWXA 3ULZA 1LPUA 2OKRA 3DZOA 5HORA 2NP8A 4ZZNA 3Q2JA 3FY0A 2FA2A 5FLFA 2P3GX 2O5KA 2F9GA 4EOLA 3ALOA 3AC2A 3NIEA 2W06A 5C27A 4JXFA 3SDJA 2CPKE 1OIQA 2W9ZB 3GOKA 3LXLA 5HE2A 4TN6A 4CZTA 4F7NA 1WBVA 3ZRKA 4JVGA 4BWKA 5CT0A 2EXEA 3W18A 2QKRA 4RVMA 4H36A 4U44A 2Z7RA 3A60A 3A7GA 1PMUA 4BZNA 4B99A 4MNEA 4MD9E 4DEGA 3FUPA 3DGKA 2OIBA 3PA3A 4YR8A 3FY2A 3CCNA 3A7FA 5D11A 1ZY4A 5DI1A 3Q4CA 5C4KA 3M1SA 5AP7A 3VUDA 1XJDA 3VUKA 4QYYA 3D7ZA 3IW7A 3R2BA 4BHZA 5J87A 3A4OX 1Q24A 5BQ0A 4GH2A 5AAFA 3FLYA 3A2CA 3NNWA 3P5KA 5DRBA 5LARA 5IA2A 4M8TA 4X21A 3QA8A 1CKPA 4W4XA 2XIZA 2WMSA 3D5VA 4I1ZA 5BUEA 3E5AA 3IO7A 3QCXA 4II5A 3W55A 2JDVA 2QOIA 3K5VA 3NSZA 4HZRA 1J3HA 4NIFB 5HICA 4EOOA 2QOQA 2C0OA 1A06A 2PVLA 2UW8A 1PMVA 4BIEA 4FEWA 1YI6A 4EONA 3MW1A 4LOQA 2XYUA 3PZEA 4DAWA 2UZEA 4WA9A 4ZOGA 4R78A 4HOKA 3NPCA 3VQHA 2YLEA 4OTHA 2ZV8A 3HAVA 5JSMA 1MUOA 2BHEA 4CSVA 1PXJA 1OKWA 1UKHA 5AM7A 3U51A 1NT2A 2R64A 4RX7A 1CTPE 3UNZA 3L1SA 2R4BA 3DKFA 2XK4A 1J91A 5EW8A 1WVWA 4E3CA 2I0VA 2XB7A 1WZYA 3C0HA 3EYHA 4KAOA 3EL7A 3GU5A 5E8TA 4WG5A 3WE8A 3KMWA 4PPCA 3Q3BA 3TTIA 2XS0A 2OH0E 2XF0A 3FBVA 4O82A 3GCSA 2GQRA 4S32A 3FXXA 3OT3A 3ZSIA 4IZYA 2EUFB 2G1TA 4M15A 4QMMA 1FQ1B 4FVPA 2RGPA 1SYKA 3FAAA 4PL5A 1O6YA 3AMAA 2HWPA 5IQGA 4IFCA 3HV6A 4JG8A 4DH7A 5D1JA 2JDTA 3UC3A 1DAYA 3MESA 3W1FA 3QHRA 4ALVA 4BGGA 2WQOA 2OJFE 5DT4A 2IVTA 4MWHA 5FTOA 3R2YA 3DJ5A 3PWYA 2B7AA 3ZRLA 2WTJA 5ACKA 4DH3A 5K4IA 5KBRA 4EWQA 4G2FA 4IEBA 1M17A 1ZMWA 4L01A 1OBGA 3LM0A 3FL4A 1H1RA 3BCEA 3UGCA 3ODYX 2HZ0A 2PZRA 4DGOA 3UNKA 2C47A 3TN8A 3UVRA 3E8EA 2UZBA 2XJ0A 4EKLA 4BCNA 2WTKB 4O1PA 5A4CA 2PE0A 1SNUA 4YTIA 2WTIA 2H9VA 2PZPA 2QU5A 3ZTXA 5I3RA 4IW0A 2UUEA 3PP0A 5JMSA 3F2NA 2B52A 2R7BA 3DB8A 3RPRA 2FUMA 3QUDA 3AC5A 4JRNA 3DKOA 4A4OA 4GT3A 3FMNA 3KXHA 4XP0A 3CD8A 4WBOA 4Z3VA 3LFAA 4C2WA 2X2LA 2HYYA 4QPSA 2NNWB 2WMRA 2RL5A 3OMVA 1WBTA 3RCJA 4JIKA 3VJOA 2V22A 3R73A 2BTRA 1WVYA 4FSRA 4IVBA 3LIJA 1V1KA 4M0YA 3OFMA 4WT6A 1UNGA 4BBEA 3TWJA 2PU8A 2Q0BA 4NTSA 1SVHA 3DJ7A 2G9XA 3HLLA 5GNKA 5HCXA 3TUCA 5AUTA 2CCIA 3ZONA 3QQHA 1LR4A 3LQ8A 3DTCA 4GRBA 3R7EA 4S2ZA 3QZGA 5CI6A 1T46A 3V3VA 1U54B 2R9SA 3AD4A 4C33A 5K5XA 5KMLA 4BTKA 2UZDA 4C57A 4C4JA 4IAYA 3ZSGA 1FINA 3CJGA 3CY3A 4IAKA 1Q99A 2A2AA 3R8MA 3MB7A 4QRCA 1WBNA 4NM7A 2XBAA 3NYXA 4QYGA 5A54A 1SVGA 2DS1A 4C36A 4QNYA 4DF3A 2JLDA 4Y85A 3KXGA 5CU3A 5LCJA 1OPJA 4FV6A 4DC2A 3C4EA 3F3ZA 2Y9QA 3IW4A 3DBEA 5FBNC 1WBWA 4LQMA 1SM2A 4CFXA 1H25A 3LCKA 1RE8A 1LEWA 1JNKA 3PSBA 5BVEA 4DFZE 3AG9A 3KREA 3PYYA 4PDOA 4MEDA 4UXQA 3JR1A 1Q5KA 4K11A 4C2VA 1UNHA 2ITVA 2EB2A 3RHXA 3UZRA 2OSCA 2UVZA 3VIDA 4YC8A 3WF5A 3AT2A 1VEBA 1ZZ2A 4O0SA 4UMUA 3R01A 3ZCLA 4BCIA 1YXTA 2F2CB 2AC5A 4W4WA 5HE0A 5CZHA 4ZTRA 1XH9A 4NFMA 4A4XA 3O8UA 4CD0A 4FK3A 5HBJA 2PVKA 5JQ8A 5CSVA 3ZO3A 2QOFA 3C4ZA 5KNJA 1O9UA 2FO0A 4ZTMA 5HTBA 5LWMA 1UNLA 3FPMA 3SGCA 3AC8A 4BC6A 3T9IA 3K3IA 4JAJA 4O7NA 3L9MA 4EHZA 5L8LA 4GKIA 3LVPA 5LQFA 3O8PA 5HX8A 3W32A 5HE3A 4HNIA 3UOJA 5J9ZA 4H3BA 4NKAA 4O2PA 3EMGA 2QURA 5FP5A 4DFYA 3CTHA 2XJ2A 3OY1A 1GIHA 4Q5EA 2VTHA 4BICA 2C5VA 3VO3A 1XH6A 3BBTB 4DFXE 5ANOA 1J7UA 2J90A 4HVSA 5E8SA 4BYJA 4PPAA 2CMWA 2JDSA 3VUMA 2X0GA 4FT0A 4AOJA 5AP5A 3R9OA 4JIAA 4FV4A 3KB7A 1G8AA 4ID7A 2C3JA 1JSTA 3FQEA 4IBMA 4L8MA 2CGUA 3REPA 4NSTA 5KMIA 2JIUA 3CTJA 4WO5A 4K9YA 2RKUA 4E6DA 2OZAA 3CQUA 1FVRA 4CMOA 5HLWA 2WOTA 4JDKA 2BAKA 2C0IA 2OXDA 3IDPA 4FODA 4NW6A 5TF9A 3V8WA 4A7CA 3CQEA 5AR3A 4JAIA 2R7IA 3UG2A 2PUIA 5KCVA 3D2IA 4N0SA 3TUDA 3LFSA 1JSUA 4AA5A 5AUVA 3DU8A 5G1XA 3TIZA 1CSNA 2C1BA 2NRUA 3Q9YA 2W4JA 2WTCA 2YN8A 4E73A 5AEPA 4G31A 4IACA 4M69B 1H4LA 2QODA 5IA0A 3RALA 4IZAA 2PMLX 4LV5A 2LGCA 1HCKA 4NJ3A 4FGBA 4I21A 3WIKA 2QNJA 1OB3A 4FKQA 4YJRA 5E1EA 5CVGA 3NDMA 3OWJA 3RZFA 2QOCA 1ZMVA 3FZSA 2NRYA 4F1TA 4EYJA 4IIRA 3L9NA 5J9LA 4ZP5A 3HDNA 3V51A 3QTZA 3D14A 3UIMA 5JFSA 2BZJA 4AX8A 3R9HA 5LMAA 3Q4TA 5E8YA 4CT2A 2BFXA 3LFFA 3RTPA 1YOLA 2FB8A 4WNOA 4CQEA 4FKUA 2R3KA 2HXLA 5K0XA 3QXPA 4MBIA 4BTFA 4FTKA 2UW9A 4YLJA 4WG4A 5TO8A 5DPVA 2CNQA 4ANMA 3UVPA 3Q53A 3NUPA 4J96A 3ZZWA 2P2IA 5JK3A 2B9JA 4DTKA 2BRGA 3W33A 2C0TA 2RIOA 3I6WA 4XV9A 4ZJIA 2BALA 4QMSA 1DI8A 4QP2A 5ETFA 1QPDA 3BLQA 5JZNA 3RAIA 3ULIA 2GPHA 5CU0A 2IVSA 3UTOA 3DAEA 5JZJA 3OCTA 4FZDB 1UU9A 4LRJA 2GHGA 4UZHA 4JT3A 4O0VA 4XUFA 4YZCA 4L42A 2JKMA 5BVWA 4Z55A 1IAJA 4ZTQA 2JKKA 2O64A 3GCPA 4FL1A 4AZEA 4RVKA 2I40A 4MXZA 4Y72A 4XG3A 5FGKA 3NR9A 4IJPA 3MPTA 3AC3A 5IA3A 5IEYA 5AV3A 4R7IA 3WF7A 4CZYB 5CY3A 2FSTX 3C51A 4V01A 4XP2A 1B39A 1APME 1OBDA 4O7SA 1LEZA 5HBHA 2RFNA 3DOGA 4KIKA 3C4CA 4E6QA 2H8HA 3ACKA 3I0OA 2OICA 2VV9A 3LQ5A 3QTWA 3NRMA 4F9CA 4NM3A 3HAMA 2NPQA 1FMKA 3KK8A 4USDA 1JLUE 4YZMA 4WD5A 3RPSA 2CNVA 4CLIA 4D0XA 4D4YA 4M3QA 4LM5A 5HNIX 3TL8A 3MWUA 3EOCA 5M53A 2E9NA 5AUUA 3I5ZA 2C6DA 4YJTA 5FTQA 5E9EA 3KY2A 4O2ZA 3MFUA 3VWAA 4MXXA 5FP6A 4UB7A 5DGZA 4O7WA 4QP8A 2I6LA 3R04A 3VS5A 4D4VA 3LCDA 3EIDA 3C50A 4RLLA 3LHJA 2X8EA 3ENMA 3Q04A 5HVYA 1JKTA 2QG5A 4UYNA 4I92A 1PYXA 5IG1A 3ZDIA 4KBCA 2ZV2A 3QQUA 3QWJA 2PMIA 2QLUA 3FKNA 4U6RA 3TV6A 4ZTNA 3GFEA 2BDFA 5BNJA 4YTCA 5C8NA 3B8RA 5EI6A 1KOAA 4BCHA 3UQGA 1R0EA 5FXRA 4ACMA 2DYLA 4FV8A 4QQCA 5CNNA 4LFIA 5FEEA 5IA5A 3BKBA 2ESMA 2W05A 4C62A 5M4FA 1E1XA 2C4GA 2IPXA 5EQPA 2BIKB 5M51A 2CKEA 4RIXB 4QMUA 4TRLA 4XV2A 3I60A 3MH1A 4CMTA 2UW0A 4J7BA 4MBLA 5L6WL 4EOJA 4PTCA 4E5BA 5CEPA 1STCE 3PJ3A 4DINA 4GT4A 4PMTA 3P1AA 4I5PA 3ZYAA 5EM5A 3IDBA 3RK5A 4A9YA 5AWMA 4L68A 5EHLA 1Q8YA 4V0GA 4DA5A 3G6GA 5AP1A 3SXRA 5EM7A 1P2AA 4OAUC 4HVIA 3QLFA 2W1FA 4AWIA 1V0PA 2YDIA 4BCFA 2H6DA 4YHJA 2HZ4A 2W1EA 5IEVA 3G5DA 3DY7A 3LZBA 3ZLWA 5CWZA 3BU6A 2IO6A 3PE2A 5AUWA 1FVVA 4BI0A 3C0IA 4I6QA 1H07A 3AOXA 3BPRA 3MDYA 4I0RA 5DBXA 3RM7A 5KHWA 4RFYA 3QZHA 4I6FA 4R5YA 5HG8A 3KVXA 4DGMA 4F4PA 3G51A 3SLSA 2JBOA 3F3VA 3EFWA 2X4ZA 4H39A 4BTMA 4DTBA 3O2MA 1Z5MA 3OBGA 4IMYA 3EKKA 3T3UA 4K0YA 1GY3A 4IANA 4JDIA 3HUBA 4AU8A 3KFAA 2IVVA 3DB6A 3OF0A 4JDHA 4R5SA 1PMEA 2AC3A 3HMMA 3ZBXA 3GNIB 5IA1A 2BROA 4EK3A 4C59A 3MI9A 3FQSA 3MH3A 2PVMA 4P2KA 5F4NA 4E6AA 4X0MA 2YAAA 5H8GA 4I94A 3SRVB 1R3CA 4FV0A 4IB1A 3QF9A 2JDRA 3OEZA 4I6HA 2R3MA 1M2QA 4J71A 3FDNA 4RWLA 4E20A 4JOAA 4ZS0A 3ZFMA 5ANKA 5F94A 5HEZA 3HYHA 3RNYA 5AR2A 4EHGA 1ZARA 4NEUA 3JS2A 2WMWA 4Y73A 2HY0A 2X7GA 3AC1A 4IX4A 1KE9A 1PW2A 2XEZA 2UZVA 4C38A 2B55A 3ORMA 4LL0A 3BI6A 4BDCA 1QCFA 4EQUA 2PMNX 3KEXA 3PP1A 2OO8X 5IQIA 2GNGA 4RX9A 5GJDA 3F5PA 3LFNA 3AD6A 3QD2B 2FH9A 3K54A 5AR5A 5C4LA 1VYWA 1JSVA 4G16A 4O83A 3TV4A 4DFUA 3SW4A 2ERKA 5EW9A 3GT8A 2A1AB 4MF1A 3R7VA 2UZWE 4O84A 3V5QA 4D55A 3QTQA 3RMFA 2WMBA 4F0FA 4U42A 2YCFA 3G0EA 3WZEA 3HL7A 4PTEA 3WF6A 3SOAA 3EB0A 3TTJA 1BX6A 5CNOA 2BUJA 3BELA 5D7VA 4YNOA 2PVJA 3LXPA 1H28A 3P23A 3A7JA 4D1ZA 3NUSA 4FV2A 4BL1A 2R3IA 1MRVA 1WBPA 4HYUA 2FVDA 4L9IA 4RA5A 5BYZA 3RI1A 2IW6A 1YDTE 2W4OA 3IW5A 4X3FB 4QMWA 4S31A 2WIPA 2XA4A 2XKDA 1ZYCA 5HQ0A 2OIDA 1XBAA 4FKRA 4FGRA 3E93A 3FMHA 3BRBA 3KF4A 3LFCA 4KKGA 3UODA 3JVRA 4FSQA 2WU7A 2C6EA 4OTDA 4FSZA 4BGHA 5J5SA 2PHKA 4FG9A 2CCHA 2O8YA 5I9WA 4J8NA 4LYNA 3H10A 3MH0A 5DEWA 3PJ8A 5E1SA 5L8JA 2W5BA 2BTSA 2W99B 3HNGA 5CTPA 4L7SA 3HA8A 1F5QA 4IWQA 4FV3A 4QTAA 3FMDA 4I4EA 4AGCA 3ORZA 1PJKA 4ZSAA 4BDGA 4FSYA 5CASA 1H01A 5I9UA 5L2IA 1OGUA 3EN4A 4JL9A 4JBOA 4FG7A 4UWCA 4ERWA 3DXPA 4FR4A 3FC1X 3PSDA 5HO8A 3E8DA 3MN3A 1JBPE 4UEUA 4X6RA 2IN6A 3Q4UA 4FTJA 4U7ZA 4I6BA 3KXNA 2GNJA 4XRLA 5DHJA 4Y5HA 2J0KA 2PUNA 4OBQA 4U80A 4JR7A 3LMHA 2WMAA 4BIDA 3LJ2A 4QMLA 1XBCA 3LJ1A 4F1MA 5FD2A 4RPVA 2C6IA 1OIUA 4AE6A 4AZTA 5E7RA 4FOBA 5AV1A 2YABA 3QCQA 2YM8A 2VTOA 1K2PA 3VHKA 3W2OA 3WF9A 5BUJA 1NW1A 4J99A 4C4FA 3HZTA 3MV5A 4JG7A 3PPJA 4U3ZA 4TYIA 1Q3DA 2YM4A 5F95A 4RIWB 1CKJA 4I3ZA 3FYJX 3FKLA 3VRYA 4ORKA 4EUUA 2XRWA 4L3LA 3B2TA 1I44A 2GS7A 3F88A 1W7HA 3PVBA 4ANBA 5CXZA 4APCA 5DR9A 2YM3A 3QD3A 4WRGA 4F6SA 2BRNA 2X4FA 5HO7A 3VF9A 1Y8YA 5CF8A 2QR8A 2GFCA 4HYSA 4DLJA 5HO6A 2GDOA 2J4ZA 2VO3A 3WI6A 3IK3A 4EWHA 4FE2A 3JVSA 4I0TA 4JDJA 4IM2A 1YDRE 4G6OA 3WILA 4CFVA 4BCJA 5GIOE 1HCLA 2IG7A 2VNWA 3UMXA 4F99A 3QUEA 1S9IA 4E4MA 1OI9A 4GUBA 5C1QB 4O0XA 2FSLX 3RHKA 5BUIA 1JKLA 4YC3A 2QU6A 4EH3A 2XCHA 4FSUA 4ANOA 4QTCA 3RPVA 4YMJA 5FDPA 3PY0A 3TNQB 4BCGA 5JRSA 2WU6A 3I0QA 5K5NA 2CKPA 3UE4A 4O7RA 3NW7A 5LVMA 4FKLA 3EQBA 2IZUA 4ZSGA 4PMSA 5HBEA 4XHKB 4KS7A 3ZXTA 1OITA 3NCZA 4XG7A 3RZBA 1BYGA 2XK9A 3RINA 4XCUA 3ZLSA 4MCVA 3ROYA 2QHMA 2C5OA 2QOBA 3E3BX 3EQRA 4FT3A 4PDPA 4YU2A 5BX0A 4AXAA 4BRXA 4C35A 3PXQA 5GJGA 4EK5A 4BDAA 2QOLA 3LFEA 2BPMA 3CBLA 4I93A 3C4WA 3IGOA 5IUGA 4EH2A 2OZOA 4QMTA 2PZIA 5LMBA 3DBDA 3Q52A 3AQVA 4ALWA 5IMXA 4KRDA 4U45A 2J51A 5JKGA 4X2KA 4L67A 4EUTA 5I5ZA 5LVOA 1B38A 1M2PA 3BBWA 2J7TA 3BV2A 4F0IA 2AYPA 4FEUA 2X2MA 3FLSA 4RQKA 1OECA 2VWIA 5C26A 4FKGA 4CTCA 4RVLA 3G9NA 4FKIA 2W0JA 3DNDA 3COIA 4JQEA 5TR6A 4QYEA 4EHEA 2XYNA 4G3DA 3QRJA 4FEQA 1IR3A 2A0CX 5DWRA 4MHAA 3TUBA 3A4PA 3GU6A 4ZK5A 5AIKA 2F7EE 1KOBA 3FLNC 3FQHA 3KCFA 3QQFA 4U43A 5BVKA 4QP4A 2YCRA 4GYGA 4J8MA 5CEQA 4ZZMA 3QZFA 1PRYA 2X2KA 4FT5A 2C3LA 3UVQA 1F0QA 3LOKA 4RJ8A 3JY9A 4O7LA 1UVRA 5B0XA 4FKTA 4GEOA 3OROA 4IX6A 4AGUA 4EC9A 3ZHPC 4USEA 5HCZA 3CGFA 3UZPA 1J1BA 1YI3A 3ZEWA 4XNEA 3QBNA 2AUHA 2XIXA 3PA4A 3SC1A 3VS7A 2EXMA 5CALA 5J1WA 2JKQA 3S1HA 2Q0NA 3EN7A 2CGWA 5EDPA 3VQUA 4TYGA 4D9TA 5L8KA 3BGZA 3QGYA 3LXKA 4D4RA 4E1ZA 2BILB 3U4WA 4AN9A 3ZFXA 5DA3A 1NY3A 1UU7A 4E5AX 4MBJA 3R1NA 3E7OA 5DE2A 2ETMA 3DPKA 1KUTA 3GQLA 1DAWA 2OLCA 1KE7A 3A99A 4YO6A 3HDMA 3OZ6A 4PMPA 4R3CA 5K4JA 3UPZA 4H58A 4F9BA 4PL3A 1BMKA 2PWLA 3DLZA 5H9BA 1OL6A 5A3XA 2ZVAA 4M84A 3NS9A 5HI2A 3I7BA 3LJ0A 4KS8A 4MNEB 5CSHA 4WIHA 2SRCA 4GMYA 4FSTA 4J95A 4TW9A 5HESA 3RAKA 5DIAA 5BVOA 3AGMA 4O7TA 5AR4A 2WZJA 3MVMA 4USFA 5LCKA 3QLGA 3P78A 2QC6A 5J5TA 4NT4A 5DR2A 4FNWA 4CKJA 2XK8A 3P08A 1OM1A 5ANIA 3PXKA 4ZY5A 5IDPA 4FC0A 2VN9A 2BDWA 3AXWA 4RJ7A 3F2AA 4EH6A 5M07A 4YTHA 4RX8A 3QAME 3WZKA 5HU3A 4FEVA 5T3QA 4BDFA 4C7TA 3LM5A 4TT7A 5DVRA 3F69A 2Z7QA 4QP7A 5CEOA 1XH5A 3QX4A 4M97A 4U41A 3C5UA 3FMEA 4FL2A 3D15A 1NVRA 1R1WA 4CFNA 4C4IA 3BYMA 1Q3WA 2I0EA 5IMEA 3ELJA 3V04A 4QMYA 2WMVA 4U5JA 3SG9A 2VNYA 1J1CA 4NCTC 3GC9A 1XH8A 4N57A 3GOPA 1W8CA 4I20A 4YZ9A 4GUEA 4YBKA 4C3RA 4FTMA 3TCPA 3ERKA 4CXAA 1M14A 5A4LA 2PULA 2C6OA 1K3AA 4TKSA 5J1VA 3LQ3A 3OWLA 1RJBA 2YEXA 3C5IA 3TNHA 3ZLXA 2PUUA 3FE3A 3KN6A 5AMNA 2IW8A 3KRXA 3TEIA 2EU9A 4EJNA 4A4LA 4QPMA 3C13A 4IC8A 5JFWA 4ZLZA 4UYAA 2GTNA 4HYIA 3MY5A 4AT4A 4ASEA 2XM9A 1TKIA 3MFSA 1QMZA 3NUAA 4QYHA 3TDWA 5T68A 4K8AA 4YGAA 5E8WA 3W2RA 4FK6A 3WYYA 5DMZA 2W7XA 4J1RA 5ETCA 4R7HA 3SX9A 5D7AA 2WMTA 2JFMA 4BCKA 3ZOSA 3GC8A 4EOMA 3VS0A 3WIGA 2XH5A 3ZSHA 1ZOEA 2OI4X 4FIEA 2X81A 2YJSA 4FF8A 5KHXA 4LMNA 5DRDA 4FKSA 5AA8A 5F20A 4IWPA 4MQ2A 3U9CA 4H3QA 2DUVA 4I22A 3PIZA 4R6VA 2JBPA 4BZDA 4O6LA 5J8IA 4YURA 1IA8A 4V05A 4MX9A 2PTKA 4MK0A 4XOYA 3IGGA 2FSMX 3MFTA 5E8XA 2ITPA 3I5NA 4RC4A 4EKKA 2QO7A 3BGPA 3DDQA 4AA0A 1V0BA 3PXYA 4ZTSA 2ZDTA 4EHVA 3LLAA 3R9RA 1Q62A 4HJOA 2DQ7X 3T8OA 3CPCA 5HIBA 4NK9A 4ACCA 2C1AA 2Z7SA 3EH9A 1ZYDA 4F9YA 4F6WA 4O22A 2YLFA 4DG3E 3CC6A 3DDPA 4TWCA 1PXIA 4B8MA 3V01A 2BRBA 5KBQA 4U40A 4JS8A 4BHNA 4ZZOA 1WCCA 4F6UA 4ZSEA 4MD7E 3P79A 2FSOX 2BAQA 3MB6A 3VC4A 2QR7A 5EDRA 5JFVA 2XP2A 3HV7A 4EK4A 4O1OA 3VBQA 3VS4A 1ZZLA 1KV2A 3SV0A 3I4BA 2CN5A 3IKAA 1GJOA 4YHTA 1Q8WA 4ZSJA 4E5WA 2OW3A 3BU3A 1LP4A 5D9HA 5BVNA 1W0XC 2REIA 4FKVA 1VYZA 2WMUA 3R21A 2UW7A 3R83A 2E9PA 4MXAA 1Q97A 2VTSA 2HOGA 3UNJA 3L8PA 4JLCA 4R77A 3VVHA 1YOMA 4IDTA 4GCJA 4LRMA 3VUIA 4YP8A 3ORPA 3S00A 3K3JA 4BN1A 4WNPA 5EOBA 4O0YA 4AE9A 2WMXA 4IB5A 2GQSA 3KA0A 3Q5IA 3QCSA 5IEXA 3KF7A 3BWFA 1QPCA 4D0WA 5DT0A 1Y91A 3QC4A 5EDQA 4RFZA 2WTDA 3HP2A 3UOKA 4Y5QA 4BDHA 3BEAA 3DS6A 3HMIA 4HCVA 1KV1A 3Q9XA 5DEYA 1ZAOA 5AV0A 2C5XA 2YIRA 4RJ3A 5TT7A 3WARA 3TZ9A 5A9UA 3P0MA 4CVAA 3P9JA 3HMPA 2ZM1A 4LOPA 3NW6A 4EH8A 1RW8A 3KXXA 4XYFA 3O7LB 4X3JA 5DOSA 3M42A 5L2SA 5EHYA 2GHMA 4HPUE 3CSVA 5H2UA 1H27A 5EI2A 4O7YA 2F7ZE 2F49A 3F9NA 4B0GA 3UC4A 2J0LA 3NNVA 4ACHA 3QALE 1XKKA 1CM8A 3ZO2A 4PP9A 4AW2A 4CV9A 4RC2A 4U3YA 3VS3A 2PSQA 2YIXA 4N70A 3VUGA 3SHEA 2HAKA 2I0YA 3DBQA 3DLSA 1P4OA 2R5TA 2W96B 2B9FA 4M68A 2F4JA 2VTTA 4X2NA 5AUXA 5CEIA 4EC8A 3D7TA 4JQ8A 4P4CA 4GJ3A 4EQMA 2R2PA 2X9FA 3OC1A 4ITJA 1DM2A 3TZ8A 5KUPA 3F3TA 3QTRA 4IFGA 3TNIA 5JEBA 2YAKA 1UKIA 1KWPA 3H9FA 3VRZA 4BDIA 3GENA 3CQWA 3OBJA 3PLSA 5BMSA 5IQHA 4P7EA 2XNMA 2R3OA 3IOKA 2O0UA 2PVHA 5IUIA 4PQNA 4MYGA 2UW5A 4PY1A 4NWMA 1UU8A 5T6KA 4U9AA 4OGRA 3RPOA 2YWPA 4HCTA 5JT2A 5KZIA 1ZYSA 2CKOA 3ZU7A 3E62A 2OG8A 1YDSE 4BB4A 4KB8A 2V5QA 3R9DA 4EK6A 5IQAA 2OZAB 3D94A 4AQCA 2WXVA 3FZPA 2WIHA 3R00A 2VWYA 4IX3A 3NEWA 2X6DA 3R8LA 1AGWA 2C3KA 3FI4A 4FICA 4GKHA 2ITXA 2EVAA 2VTNA 4MQ1A 2WNTA 5C8KA 3F5GA 3VBXA 3VS2A 4HW7A 3SG8A 5A4TA 2QG7A 2JFLA 2F7XE 3U6JA 2Y4IC 4NCTA 3TI1A 5KMNA 4FA2A 3VF8A 4G3GA 1ERKA 4UX9A 4GJ2A 1OPLA 1KE8A 4CFWA 4OUCA 2ERZE 1PXLA 4CMUA 2R3LA 2WQMA 4FVQA 3RCDA 4RIOA 1G5SA 2WOUA 3ALNA 5H8EA 3RNIA 3VAPA 2ACXA 3MGYA 1F3MC 1K9AA 4D4SA 3MFRA 4WSQA 3DXQA 3GU8A 2QD9A 5E8UA 3ZC5A 4BWPA 2OBJA 4MXYA 3BQCA 4IZ5A 4F64A 5CU4A 3V6SA 5ETIA 4A06A 4Y95A 5EYKA 3MPMA 4UMRA 1PXNA 2UW4A 4L46A 2Q83A 5E8ZA 3EL8A 3C4FA 3ODZX 4JNWA 3FV8A 3KXMA 3DK3A 1ATPE 2JC6A 1H00A 3FZRA 2B54A 1V0OA 3DJ6A 1OKVA 4O0TA 3FZTA 5JGDA 2XMYA 4DGLC 1XH4A 1NXKA 1SZMA 3QQGA 4YBJA 3CGOA 3F3WA 3RM6A 3COKA 5IQBA 3N51A 3IONA 4LL5A 1ZOHA 4FX3A 4PDSA 4DG2E 3LCTA 4BKJA 4BDBA 2UVXA 3UZTA 5GJFA 4NU1A 3QTSA 4G1WA 4KINA 2VWVA 4DN5A 1GZKA 2RG6A 3Q96A 3O7LD 3R63A 3FSFA 4BKYA 4G17A 3OWKA 4ANQA 3TIYA 2C68A 5BVFA 3R22A 5BPYA 3DT1A 4HCUA 5HX6A 5I9XA 5EFQA 3JYAA 2J0MB 2I0HA 3EN9A 5D41A 3KRRA 5DH3A 3LLTA 4XX9A 5TE0A 3PSCA 4QTEA 1OUKA 2ZYBA 3I6UA 5L2QA 2R3PA 5EQYA 1FBNA 3OS3A 4EOPA 4J97A 5K9IA 3JPVA 4JQ7A 4TYJA 3NYNA 3Q9WA 4KIKB 4WBBB 2C5NA 5EYMA 5HE1A 3CJFA 5M55A 5M06A 4D5KA 3QQJA 2W1DA 3H30A 2I7QA 3QRTA 4WUNA 1YXSA 3DBCA 4IWOA 3FLQA 5M44A 2X9EA 1NA7A 4FMQA 4QP9A 5CQUA 4DBXA 2BKKA 2ZOQA 4EYMA 4YTFA 3BX5A 3U6HA 3G90X 2CN8A 2BRHA 3ENHA 1FGIA 4NJDA 4RZVA 3RKBA 2ZDUA 1OIRA 4ZY4A 2HK5A 3DXNA 3L8VA 3EQCA 3ZO4A 4MVFA 2FGIA 5IDNA 3S0OA 1RQQA 1KSWA 4IB0A 4R1YA 2YHVA 3ORNA 3BYSA 4FTUA 4ZIMA 2JEDA 2BZHB 5KMJA 5EM8A 5ETAA 5E91A 4ONAA 1L3RE 4CV8A 2PZ5A 2QOKA 5GZ9A 2C6LA 5ACBC 3FI2A 1H0WA 3II5A 1TQMA 3F5XA 4U81A 4BI2A 4CNHA 4B7TA 4FEXA 4BZOA 4GIIA 4NW5A 4UXLA 2V62A 4C37A 3QYWA 4RWJA 3KMUA 4JG6A 4XS2A 4ZAUA 4IQ6A 3S2PA 5HU9A 5KKRC 4ZTHA 3OVVA 3BLHA 2KULA 2PL0A 1H1WA 4AF3A 4PMMA 5JN2A 2Y6OA 2C30A 4TWOA 3PJ1A 4Q9SA 4BVUA 2RFSA 1CKIA 4IHPA 3R1YA 1PY5A 3BQRA 3PPKA 4FTTA 3CD3A 4F0GA 1P14A 2W1ZA 3PJ2A 4FNZA 5HTIA 4LGHA 4V0GB 3U9NA 4Y83A 5E92A 2LAVA 3FZOA 3DZQA 4RRVA 5CAUA 4K33A 4GFGA 1XBBA 3FLWA 3UP7A 3FI3A 4L45A 3KC3A 1IASA 4FYNA 2Z8CA 5C9CA 3WZJA 2FYSA 4O0UA 4RLKA 1REKA 2E9OA 4UZDA 3BWJA 2PVFA 4OLIA 3KXZA 4FUXA 3V5WA 2PUPA 3KULA 4NYEA 2CGVA 3M11A 5D10A 3N9XA 4S30A 3QGWA 5GZ8A 5IH4A 4R7BA 3DTWA 3S95A 3VBWA 4FI1A 4KABA 5CX9A 2XK7A 2R3NA 2P33A 3IW6A 4HNFA 2HWOA 4E4NA 3E64A 4TYHA 1BI8A 2ZM4A 2W1CA 5IUHA 5IKWA 5IQCA 2VO7A 1SNXA 1H1SA 3PPZA 4XMOA 4F09A 2J0IA 5DT3A 2VGOA 4MNFA 5EI8A 2YWVA 2OJJA 3BIZA 3D83A 2ONLC 4D28A 3FMJA 3UIUA 2YCSA 3IG7A 5IQEA 1ZYJA 4BIBA 2OJ9A 2KTYA 4KA3A 3CP9A 2VTJA 3LMGA 3R8UA 3TG1A 1EH4A 1OL7A 2VTPA 4GU6A 3VW6A 5CU6A 4AOTA 3NWWA 4RT7A 3DV3A 3OP5A 4EH4A 5A4QA 3DNEA 1GIJA 1ZYLA 4U79A 2Z2WA 4Y8DA 5ANEA 2IZRA 4AW1A 3POOA 1JVPP 3EJ1A 3SA0A 1ZMUA 3C9WA 3E63A 4NM0A 4RC3A 3BHVA 3W2PA 2XNOA 2OH4A 5CVHA 3VNTA 4DFBA 4Q2AA 1A9UA 4DH1A 3ID6C 5B2LA 1XQZA 4MKCA 1T45A 3BE9A 2HCKA 1O6LA 1Q41A 2G15A 5B2MA 4HVHA 3I81A 4B4LA 1GIIA 3FC2A 3HV4A 4Q9ZA 4EZ7A 3U55A 4GVAA 4E4XA 2X7FA 5C03A 4AP7A 1U59A 3F6XA 3KRJA 4ENXA 3TV7A 3BE2A 3GUBA 4PRJA 5G6VA 4M67A 5TKDA 3R30A 5IU2A 2QO9A 4OTRA 4CFUA 3CEKA 4FKWA 2PVRA 3EFLA 3BHTA 3OCSA 2YM6A 3D5WA 4AW5A 2UV2A 3RVGA 5AV2A 2OFUA 3PZHA 4ARKA 1ZXEA 2XEYA 1E1VA 3BYOA 4H3PA 2WTVA 4L3JA 4E93A 2V7AA 3QX2A 1S9JA 2GQGA 2UZLA 2QHNA 4JBVA 5BYYA 5L2WA 5M56A 4KIQA 2H34A 4JRVA 1MQBA 3TKUA 2GS6A 1JQHA 4YPSA 3LCSA 2P4IA 3R8PA 2HZIA 3RWQA 3PIYA 3TZ7A 2GNLA 4QYFA 2QCSA 4LMUA 4TNDA 3UBDA 4C4GA 3EWHA 4D2RA 5A46A 2BAJA 3U54A 4YZBA 5DLSA 3KKVA 2OXYA 5IZFA 4GK3A 1XR1A 4Z7GA 3TACA 5LVPA 1YRPA 5KMMA 2HW6A 1MRUA 4FZAB 3SXFA 3VUHA 3F66A 3NIZA 4BDJA 4B6LA 3FEGA 2UZNA 3V6RA 3PXRA 3PY1A 4JI9A 3U8WA 3VJNA 4RX5A 4FKPA 3GBZA 4F9AA 1OMWA 4IAIA 4OT5A 4LGDA 2O63A 4D2WA 4EH5A 3OHTA 2OU7A 3FLZA 4E6CA 3QRUA 4HGEA 3DK6A 3P4KA 3QKMA 5IISA 2XKEA 4FTNA 4DGGA 3SVVA 2UW3A 2W1HA 3LMIA 4XLIA 1MQ4A 2WEVA 2CHLA 2HXQA 3D5XA 3BHUA 1P4FA 2P0CA 5LWNA 4OR5A 4R8QA 4UV0A 3DKCA 3QXOA 4QMOA 4G3EA 4CG8A 3L9LA 3F7ZA 4J53A 5IQFA 3ZDUA 3MY1A 4MTAA 3KVWA 5LOHA 4KSPA 4G6LA 4JBPA 4NL0A 2VO6A 4RIYA 4Z7HA 2XJ1A 5HCYA 5AA9A 4QP3A 4QMPA 4WSYA 4FBXA 2J50A 2QONA 2YIQA 2ITNA 4BDEA 3PRIA 4UMQA 3F2RA 4H05A 2YCQA 5CAVA 1GZOA 1YWVA 2XNBA 3QKKA 3CXWA 3R6XA 4I0SA 4QP6A 3R7GA 4HYHA 4TWNA 4EORA 1YWRA 3U87A 4ZMEA 1XH7A 3MVJA 1GZNA 2R3RA 3L8XA 2WQBA 5I4NA 3ANQA 3OCBA 4QT1A 4YZDA 5CQWA 3SXSA 2RFDA 4G9RA 4O27B 5I9VA 4C61A 4I23A 1KE5A 3HV5A 1Q61A 3OD6X 1NVSA 4UMTA 5AP6A 5CVFA 2ITZA 4GG7A 5FDXA 5AR7A 3UG1A 5CF4A 3N4UA 4OBOA 4UWBA 4IAZA 5CSXA 5HOAA 3AT4A 3PJCA 3VBYA 2X8DA 3G9LX 2BHHA 2OJGA 2YM7A 3GCUA 3PY3A 4EOQA 3UO6A 2VWUA 4FT7A 4IJ9A 5EG3A 3ZO1A 2WMQA 3LFQA 1FOTA 2VAGA 4IWDA 5L3AA 3WYXA 5AJQA 3DQWA 3T3VA 4O96A 4DEAA 1QPJA 4FKJA 3R7IA 4M12A 5HVJA 2YIYA 1SVEA 4TPTA 3QYZA 3H0YA 3EFKA 4ITHA 4XBRA 2C6KA 5ANDA 4BCOA 3G6HA 3I1AA 4R1VA 3IOPA 5HLNA 4H1JA 4XV1A 2R3GA 4ZS4A 1PMNA 2PZYA 3WBLA 4K1BA 2ETRA 2VRXA 5FM2A 4KBAA 3I79A 4Z9LA 4BF2A 4YLLA 4C4HA 2YERA 4GIHA 4FOCA 4L7FA 4P5ZA 1H08A 2A27A 4DITA 4QPAA 3TKIA 2WD1A 3QHWA 2RG5A 4OBPA 5HIEA 5HNBA 1JWHA 3EFJA 4O7ZA 4FNXA 5BMMA 3RK7A 4FSNA 3O71A 2JIVA
chains in the Genus database with same CATH superfamily
3QCYA 1N33M 4ZLYA 3DAJA 3ITZA 4U97A 2VTLA 4QMQA 4PNIA 4EQCA 3ZXZA 2BWBA 2ZB0A 4C58A 3B74A 2BR1A 1JOWB 3KL8A 3LVVA 1GNGA 4FVRA 4D2SA 4LFAM 3MTFA 1PJQA 4IZ7A 3COHA 2Z02A 3BYVA 2Y0AA 3NGAA 3R7YA 2VU3A 3MY0A 3PLAE 3DFAA 2VWZA 4WKQA 5EJCA 4RMZA 4O21A 2ITWA 4I81A 2EXCX 2V6ZM 4P5QA 3BYUA 1QDTA 4GRIA 3UMWA 1GO5A 3RPYA 2VTIA 3C1XA 4LRTA 5CEKA 3FMMA 1GZ8A 5BYLA 2XIRA 3OG7A 2QKWB 1OUYA 2R3JA 4I5HA 3NLBA 1VZOA 3F82A 4JV5M 3MSSA 2DWBA 2WEIA 4C3FA 4LI5A 2YFXA 1PJIA 5LVLA 4N4SA 4DGNA 1OFIA 1OAOC 4X7QA 2PK9A 1U54A 4M14A 5AUZA 2XSZA 3CY2A 2KEBA 2ETKA 4NOOB 4RG0A 2WAJA 4PL4A 2B1PA 3ATTA 1OL2A 4QO9A 4M0ZA 2ZAZA 1XC8A 4BCPA 3BHHA 3ORXA 5EQEA 5F9EA 4FZ7A 4JBQA 3SAUA 2Y7JA 2C6MA 3QA0A 5FEDA 2XUUA 5K0KA 3DBFA 4G4RA 3GLGE 3W0SA 2C6TA 5M57A 4RBLA 4ITQA 5TOZA 1FNNA 3EKNA 2VWBA 4LOOA 4AGDA 1ZOGA 5L6OA 4YNEA 1PKGA 4YPDA 2R62A 3FUUA 4QOZC 1W82A 4GKJM 3PE1A 3IQ7A 2PVNA 4BR3A 3B8QA 2Z7LA 4JR3A 3GU4A 4IAAA 3CIKA 3QTXA 4NH1A 4AZSA 3E3PA 3VHEA 2MJ5B 5ITAA 4OTQA 4QTDA 3U4UA 2VX0A 4QMXA 5KQ8A 1BL6A 4F2LA 2J5EA 4RNAA 3G33A 2IZTA 1UWHA 2YIWA 1GAGA 2VD5A 4D2TA 1G8SA 2R3QA 3IW8A 3QWKA 4A9SA 3J81S 3TYKA 4FIHA 1OVEA 4KD1A 3IECA 5AR8A 1UA2A 5EW3A 3WE4A 2VWWA 2QOOA 5L2TA 2W5HA 4WHZA 1I09A 3UPXA 1J09A 1JR3D 5FBOA 4CG9A 3AMBA 3OW4A 2CGXA 1YI4A 1GJTA 2L4FA 2QVSE 3FPQA 4IH8A 1M52A 1UV5A 2YM5A 3QYEA 3V5TA 4HGLA 3GCVA 2YISA 4AI6A 2NYAA 4C8BA 2XIKA 4ZTLA 1YQJA 4DHIB 3U6CA 2IJMA 2WPAA 3W0MA 3IDCA 5IREB 3ZBFA 4GFOA 1YXXA 4PPBA 5K3YA 5CANA 2MROB 3EHAA 4E26A 4IE9A 3GI3A 1B6CB 3PDTA 3PNVA 4DTAA 5KPTA 4XBUA 3E8CA 2HWJA 5CF5A 4FW9A 5EXTA 3NBXX 2E5LM 1ND4A 2X8IA 3OOGA 1E9RA 1PXPA 4QDEA 2E9VA 3EN5A 3K2LA 4QHSA 4TZRA 1TQIA 1YHVA 2G01A 4REZA 4KIPA 4ITIA 1X8BA 3ZMMA 3FL5A 4J98A 4C02A 2R3FA 1YVJA 3OTOM 4ANNA 5CEMA 4D2VA 4AT5A 3BLRA 3VFDA 4AZFA 3HA6A 2BCJA 4L00A 4JI8M 3IPHA 3PXGA 4FJVA 2W82A 3W0NA 4BBFA 2JAVA 2RF9A 1UM8A 5KE0A 4V04A 2CWBA 1VR2A 1H24A 4MF0A 3EYGA 3U6PA 4G3OA 3F7WA 5DN3A 3T9TA 4QP1A 4FT9A 4ANLA 4X2JA 3ZM4A 5HD7A 2VZ6A 2LH0A 2O65A 3W8QA 1V92A 3SATA 5H3QA 4OVZB 4FTAA 2CKQA 4BWXA 3PFIA 4FUYA 3DCVA 3S3IA 3FHIA 3R7UA 2JKOA 4ANSA 4X65M 3SYKA 2FS1A 1JQJC 1M7NA 3FKOA 4ZXTA 2WELA 3FHRA 3HJSA 1PXOA 3NUXA 3QKLA 1OTRA 3D2KA 4PX6A 4LJ7A 5B2KA 4E7WA 4W4YA 3SHGB 2ITQA 1FMOE 2WTKC 4XLVA 3K1JA 2E9UA 1H1QA 2Y4IB 3KQ7A 4EK8A 1P3QQ 2VUWA 1PKDA 3TJCA 4FTQA 3VBVA 4G5JA 2V55A 4YZNA 4O86A 4PWNA 1BUHA 5FEQA 1GABA 4C34A 1P5EA 3TM0A 3WOWA 1WAKA 4QMVA 4AG8A 5CAQA 1PYEA 4YJQA 5CS6A 1EFUB 1IA9A 1XHBA 3AKLA 2GCDA 5CENA 4HZSA 5DR6A 5ANJA 2RSVA 3NFGB 3JUHA 3U6IA 1N36M 4AOIA 4KNBA 3RE8A 3QL8A 2K47A 3B89A 4X6QC 2CLQA 5EYDA 4EBWA 3KK9A 3HU2A 4C3PA 2WFYA 4NKSA 3M2WA 1YOJA 2LWXA 1REJA 4HGTA 4JMQA 2YA9A 4GW8A 4RIYB 1OZ1A 4KUJA 2QLQA 3DKGA 1WFCA 4QMNA 2OJIA 4O4FA 1D2NA 1M2RA 1IXSA 4YC6A 3NUNA 2EWAA 2I1MA 3N4VA 3UOLA 4IVCA 3GLHA 2XNNA 3HP5A 4LRSA 1TQPA 4QOXA 4DFNA 3G15A 3VUTA 1U4DA 4I6LA 3Q2JA 2OKRA 2FA2A 2F9GA 2W06A 4CZTA 3GOKA 1OIQA 3LXLA 2AHMA 3ZRKA 4U44A 3FUPA 3PA3A 4YR8A 3A7FA 1NHGC 3Q4CA 3VUKA 4QYYA 5J87A 2GQFA 1Q24A 5AAFA 5DRBA 5IA2A 3P5KA 4M8TA 3D5VA 3E5AA 4II5A 4GC9A 2QOIA 4EOOA 4HZRA 2QOQA 2C0OA 2PVLA 4BIEA 4EONA 3MW1A 2UZEA 4GHLA 4WA9A 3NPCA 2BHEA 1VEJA 1PXJA 1NT2A 3UNZA 1CTPE 2XK4A 2XB7A 1WZYA 3C0HA 3GU5A 4PPCA 3GCSA 2GQRA 3FXXA 4QMMA 4PL5A 5IQGA 5D1JA 2JDTA 3MESA 4ALVA 2IVTA 3DJ5A 3PWYA 5ACKA 4L8RC 3LM0A 3UGCA 2HZ0A 2UZBA 2WTKB 3ZTXA 5I3RA 4IW0A 2R7BA 3QUDA 3FMNA 4Z3VA 4WBOA 3LFAA 4QPSA 2NNWB 3OMVA 3RCJA 1WVYA 1V1KA 4WT6A 4BBEA 1UNGA 2Q0BA 4NTSA 2G9XA 3HLLA 2G8LA 1LR4A 3DTCA 3R7EA 3C3DA 5CI6A 1T46A 3V3VA 4C57A 2UZDA 4B08A 3ZSGA 3CJGA 4IAKA 3MB7A 4NM7A 3NYXA 4QYGA 5A54A 4DF3A 4NXNM 3T6PA 5LCJA 1OPJA 1OIZA 1IQPA 5FBNC 4CFXA 1JNKA 5BVEA 3AG9A 3KREA 4IIWA 4MEDA 3JR1A 2EB2A 4YC8A 3WF5A 4O0SA 3R01A 4W4WA 5HE0A 3O8UA 1XB2B 4FK3A 5ITYA 5HTBA 1UNLA 3AC8A 3T9IA 4O7NA 3L9MA 5LQFA 3O8PA 3K9OA 5HX8A 3UOJA 3EMGA 5FP5A 3OY1A 5ANOA 1J7UA 4HVSA 4BYJA 4PPAA 2X0GA 4AOJA 5AP5A 3KB7A 1Q3CA 3FQEA 4L8MA 4NSTA 2JIUA 2WOTA 2C0IA 2R7IA 5KCVA 3TUDA 3ZQJA 1JSUA 3DU8A 5G1XA 1CSNA 2NRUA 2WTCA 5IA0A 1OGYA 3RALA 4B3RM 3NDMA 3L9NA 4ZP5A 3QTZA 3UIMA 5JFSA 1AIPC 1DV0A 2BFXA 1YOLA 3U6QA 2HXLA 4BTFA 3VDPA 4WG4A 3UVPA 3Q53A 3BL9A 3ZZWA 3R8FA 3HY5A 2C0TA 4ZJIA 3Q8XA 1DI8A 4QP2A 5ETFA 1QPDA 2M60A 5JZNA 3RAIA 5M4CA 2GPHA 5JZJA 4FZDB 1UU9A 4LRJA 4O0VA 4XUFA 4L42A 2JY5A 4AZEA 5FGKA 5IEYA 3MPTA 4R7IA 3C51A 1B39A 1APME 5KQDA 1OBDA 5HBHA 4KIKA 4E6QA 1HT1E 3ACKA 1GL6A 3HAMA 1FMKA 2NPQA 4YZMA 2CNVA 4D0XA 2R65A 3MWUA 3EOCA 4MB7A 5FTQA 3KY2A 4MXXA 3U60A 4O7WA 4QP8A 3VS5A 4D4VA 3KXEC 1XMMA 4UYNA 3ZDIA 2WSFF 4KBCA 1R0EA 4P17A 4FV8A 3SBJA 4LFIA 3BKBA 2BIKB 4RIXB 4TRLA 4QMUA 4XV2A 4EOJA 3PJ3A 4PMTA 4I5PA 3IDBA 4JI1M 3SXRA 4JI7M 3SC3A 4HVIA 1V0PA 2YDIA 5IEVA 2MH8A 3BU6A 3MDYA 4I0RA 4DGMA 3KVXA 3F3VA 2F5NA 2X4ZA 4BTMA 4DTBA 3EKKA 1E9SA 1GJSA 4R5SA 3DB6A 2QHOB 3HMMA 3ZBXA 4C59A 2Y0TA 3MH3A 4E6AA 2L09A 3GLIA 3SRVB 4IB1A 1M2QA 4JOAA 1ZARA 4Y73A 2WSCF 1KE9A 2XEZA 4JI2M 2B55A 3BI6A 3PP1A 5GJDA 3AD6A 3K54A 5C4LA 1VYWA 3FRHA 4O84A 2UZWE 3V5QA 4D55A 3RMFA 4U42A 3G0EA 3SOAA 1BX6A 5CNOA 3BELA 4YNOA 3P23A 3A7JA 4FV2A 2DWZB 4L9IA 2FVDA 3RI1A 2W4OA 3IW5A 4S31A 3FTDA 5HQ0A 3E93A 3FMHA 2Z4RA 3KF4A 4KKGA 3UODA 4FSQA 2WU7A 2PHKA 4FG9A 5ITQA 2CCHA 5I9WA 4LYNA 1N78A 4L7SA 1F5QA 3L29A 3FMDA 1PJKA 2BNKA 3EN4A 2XGNA 4I6BA 4Y28F 2GNJA 4XRLA 2PUNA 4U80A 1PJJA 4RPVA 4AZTA 2YABA 3VHKA 1K2PA 4J99A 4TYIA 4RIWB 1CKJA 4I3ZA 5IZ7D 1I44A 4F6SA 2BRNA 3VF9A 1MU5A 4HYSA 5HO6A 3W67A 1GVNA 4FE2A 1HCLA 1IN6A 2FSLX 1IBLM 2QU6A 4QTCA 3PY0A 2CKPA 4O7RA 4XHKB 3ZXTA 3NCZA 1BYGA 2QHMA 4FT3A 4PDPA 4C35A 1N77A 2BPMA 5LMBA 3DBDA 4ALWA 4KRDA 2DENA 1M2PA 2J7TA 4F0IA 2X2MA 5C26A 4FKGA 4CTCA 4RVLA 3U61B 2XYNA 2A0CX 5DWRA 3FLNC 3FQHA 3KCFA 5BVKA 1NNUC 4J8MA 5CEQA 4EC9A 3CGFA 3QBNA 3PA4A 5J1WA 2JKQA 4R7GA 4D9TA 3LXKA 5DA3A 1UU7A 4E5AX 2R4JA 3GQLA 4LFBM 2OLCA 4YO6A 3HDMA 5K4JA 4F9BA 4PL3A 1BMKA 5H9BA 1OL6A 4MGYE 4JYAM 4KS8A 3LJ0A 3UK6A 4WIHA 4PDIA 5BVOA 3AGMA 3MVMA 2QC6A 5J5TA 1OM1A 4ZY5A 3L26A 4YTHA 3MHVC 4RX8A 3RGPA 5T3QA 4C7TA 5DVRA 4U41A 3C5UA 4FL2A 3TQSA 3ELJA 2HKJA 1J7KA 4U5JA 4YHHM 1J1CA 3GC9A 4N57A 3GOPA 4I20A 1K3AA 3LQ3A 2DWNA 2YEXA 3GPUA 3FE3A 5AMNA 2IW8A 3KRXA 4A4LA 4UYAA 3GPYA 3MFSA 3NUAA 4QYHA 4K8AA 4YGAA 3W2RA 5DMZA 2W7XA 3SX9A 2XH5A 1ZOEA 4FF8A 2QBYA 2DVWB 2DUVA 2JBPA 4BZDA 4YURA 3CTWB 5EQTA 4MX9A 4MK0A 4XOYA 3IGGA 2FSMX 4O4CA 1V0BA 4EHVA 2ZTDA 3HJ8A 2RGOA 2DQ7X 1ZYDA 4F6WA 4B8MA 1PXIA 2BRBA 3SFZA 4U40A 5KBQA 4F6UA 4X62M 3VC4A 5JFVA 4O1OA 1KV2A 3SV0A 5BVNA 3R83A 2E9PA 4DR4M 4IDTA 2R18A 3ORPA 4BN1A 4WNPA 4IB5A 2GQSA 5IEXA 3BWFA 5DT0A 3DS6A 3HMIA 2KHHA 3Q9XA 5DEYA 2DAGA 3KXXA 2NQ8C 4X3JA 3M42A 5L2SA 5EHYA 3F9NA 3UC4A 3NNVA 4ACHA 2YIXA 2LXEA 4X2NA 5AUXA 3D7TA 3OC1A 3TZ8A 2F5OA 3F3TA 5KUPA 3QTRA 4IFGA 5JEBA 4BDIA 3GENA 3CQWA 5BMSA 5IQHA 2XNMA 3IOKA 1DGHB 4ZPXA 4U9AA 5A2QS 5JT2A 1ZYSA 2OG8A 1YDSE 2V5QA 3HHWA 3D94A 2WXVA 3R00A 4IX3A 1AGWA 3U6DA 1IFYA 4DHZA 3UDZA 1YSYA 4NCTA 4JI3M 4I5SA 3VF8A 1ERKA 4UX9A 2ERZE 4CMUA 4FVQA 3P5JC 4G4NA 3MGYA 4WSQA 1NJGA 3ZC5A 2OBJA 2XZUA 3BQCA 5ETIA 5EYKA 3MPMA 2UXDM 3KXMA 1V0OA 4O0TA 1OKVA 3W0OA 4II7A 2XMYA 1SZMA 4AXCA 4YBJA 3IONA 4BKJA 2UVXA 4G1WA 2RG6A 2C68A 3R22A 5BPYA 3DT1A 1PJTA 1D0MA 5DH3A 3KRRA 3LLTA 3PSCA 2ZYBA 1K3XA 3Q9WA 3LCUA 3AOGA 2W1DA 3H30A 3QRTA 1YXSA 1HJPA 1G3IA 4YTFA 3ENHA 4NJDA 4RZVA 3RKBA 3ZO4A 4FCVA 2FGIA 5IDNA 3A46A 2ZAMA 3BYSA 2BZHB 4ONAA 1L3RE 4CNHA 4GIIA 4NW5A 4UXLA 4C37A 4RWJA 3KMUA 4JG6A 5HU9A 3RFWA 2PL0A 4AF3A 5JN2A 4TWOA 2C30A 2RFSA 3CD3A 1F4IA 4FNZA 4Y83A 2QCUA 5CAUA 4LG2A 3FLWA 3FI3A 1IASA 2H5XA 4DR3M 1GKIA 2FYSA 3LVWA 2OO9A 3KXZA 3V5WA 1IBKM 3KULA 2PUPA 5D10A 5IH4A 3VBWA 2XK7A 1BI8A 5IQCA 1H1SA 1VEKA 2YWVA 3D83A 4DV1M 2ZBKB 3UIUA 5A4QA 3DNEA 1GIJA 4AW1A 4JI5M 4NM0A 3BHVA 3W2PA 2XNOA 4Q2AA 5B2LA 4CJ6A 1OFHA 4QNMA 1Q41A 5B2MA 3HV4A 3U55A 4GVAA 3F6XA 3KRJA 3GUBA 4PRJA 3R30A 2QO9A 4CFUA 3BHTA 2UV2A 5AV2A 2XEYA 2M5ZA 4H3PA 2OOAA 2UZLA 4JBVA 2QHNA 5M56A 2H34A 2GS6A 4YPSA 3R8PA 2HZIA 3RWQA 4QYFA 1Z5CA 5A46A 4YZBA 5IZFA 1XR1A 1YRPA 2UZNA 3V6RA 3PXRA 3PY1A 3VJNA 4FKPA 1OMWA 4LGDA 4D2WA 3OHTA 1WR1B 2OU7A 5IISA 3SVVA 2W1HA 2HXQA 1P4FA 2JP7A 4MTAA 1VDDA 4JBPA 5HCYA 1XWIA 5AA9A 2J50A 2QONA 4H05A 3F2RA 4TWNA 3U87A 4HEOA 1XH7A 3KOZE 1GZNA 3L8XA 3SXSA 1JB0F 3KDSE 4IBCA 5CVFA 5FDXA 3N4UA 4UWBA 4IAZA 2X8DA 2BHHA 2CV1A 1IBMM 1XXHB 4IJ9A 3QWLA 4AXDA 2CV0A 5L3AA 3WYXA 4DEAA 4M12A 5FTJA 1SVEA 4XBRA 3H0YA 4ITHA 5FTKA 4R1VA 4XV1A 4K1BA 2ETRA 4B7GA 4KBAA 5KO3A 2YERA 4GIHA 4FOCA 1H08A 2A27A 3TKIA 2DI0A 5BMMA 3RK7A 3O71A 4C4JA 2JIVA 2Z3XA 4NIFA 3PTGA 2JDOA 3FYKX 4DE4A 3UOHA 4M66A 3V76A 4IAFA 2ZMDA 3NVMB 1URWA 1Q8TA 5KZ0A 3VLFB 3D9VA 3A7IA 4ZY6A 1KYIA 2HW7A 2J6MA 3MBLA 4GFMA 4RJ6A 1H8FA 3NW5A 5DG5A 4G3CA 1IAHA 2C3IB 3A8WA 4MXCA 3W0RA 4KKEA 3TXOA 4L78A 3A62A 3FSKA 1YLAA 3N4TA 3KCKA 4FSWA 2F57A 5CT7A 3U5ZA 2J5FA 3FJQE 4YJOA 1JAMA 1JKSA 2CDZA 3VBTA 4DFLA 4MH0E 5E4HA 3PUPA 3QC9A 3OOMA 4A07A 2ZJWA 2XANA 1BKXA 4IB3A 4RA4A 2J0JA 3POZA 4K2RA 1U5RA 3EZVA 3RWPA 1VEGA 3CF2A 5AIRA 3QAUA 3CF6E 1HOWA 3LFBA 1KE6A 4DEHA 4Z8XA 2VTRA 4W9WA 5HVKA 4DCEA 4DH5A 2HL7A 3QD0A 1SXJA 3OWPA 5A6NA 4F7JA 1Z9XA 2VO0A 5EK7A 4G3FA 2BDJA 4DCAA 3EQPA 3UQCA 2VF8A 3FMLA 4ZEGA 4UALA 4I4FA 4EOIA 3CE3A 1HQCA 4AN2A 2JGZA 4M7IA 3PRFA 4A9UA 3A61A 2GFSA 4WNKA 2KZSA 3DAKA 4I5CA 4UMPA 1JPAA 3QRIA 2OF4A 3HRFA 5FRIA 4XG9A 3J7BA 1WGNA 5AV4A 4CT1A 4AGWA 1YXUA 3NYVA 2Y6MA 4NSRA 5CLPA 2XM8A 4L52A 5CF6A 3HGIA 2XKFA 3GFWA 3CKXA 1U5QA 3AV0A 4W5WA 2W1GA 3TNPC 1FGKA 5BVDA 3H3CA 1WBSA 1UWJA 4BY9E 3R7OA 3CS9A 5AAGA 4X3FC 3W0QA 3DOAA 2YDKA 5AP3A 4AKIA 3HGKA 3HMOA 3NUUA 1Q3BA 5IH5A 5AFVA 4OTPA 3FUXA 3GLFB 4XG6A 2Y4PA 2QPAA 1BI7A 3UDSA 5I3OA 4CTBA 3ZZEA 5JRQA 3PVGA 3TNWA 1QANA 5EKOA 5AX9A 5ITUA 3TWMA 1HNWM 4FIGA 3V8TA 4YJUA 3PXZA 2A4LA 3SAYA 5I0BA 2CHQA 3S4QA 5FQDC 5AAEA 4RWIA 3H9OA 5FWKK 1Y57A 4CRSA 4XOZA 3UQFA 1PXMA 4WRSA 3O96A 2B9IA 4QOSA 2LVAA 1L1ZA 3GC0A 2OF2A 4FZ6A 4GYIA 3NNXA 4FSMA 2IZSA 3NAXA 4DH8A 2P2HA 2C5YA 1H1PA 3Q9ZA 1FVTA 4RWKA 3W16A 3JY0A 4ASZA 3JXWA 5CYIA 1YHWA 5KO1A 2WQEA 3KW6A 2OIQA 3ORTA 5LVNA 4JX7A 4D1XA 4YJVA 4EOSA 4KODA 3ACJA 5IF1A 1OPKA 2PMOX 4F1OA 2XNPA 1TVOA 1G41A 4BDDA 5E90A 2R3HA 2DAIA 4R3PA 3QTIA 3EQIA 4CYIA 4RGJA 3VW8A 3FMKA 4BCQA 5I9ZA 4EOKA 4BB9A 5DYJA 3MK6A 1G3NA 4CCUA 2BJWA 5EKNA 1URCA 2LVNC 2EJSA 4GV1A 3L25A 1NVQA 4WOVA 4GMQA 1Y6AA 4ZMFA 3HHZA 1ZRZA 1ZV1A 3ETAA 4R71A 1J7LA 4WUAA 4Z16A 3QTUA 4F7LA 4BKZA 3PXFA 5E6JA 4N6ZA 4CQGA 4RF1A 5DNRA 4TYHB 5J7HA 2ITUA 4AFEA 4LUEA 1IRKA 2HY81 2X39A 4IBBA 4PP7A 3LPBA 4AW0A 5AM6A 2HELA 3KMMA 3ET7A 4TTHB 3W2QA 4D9UA 3AD5A 3HVCA 3KRLA 3QRKA 3JR5A 3H9RA 3FXZA 1U46A 3GB2A 5TE0A 3F3UA 3GC7A 5HG5A 3R0TA 3A42A 2BJVA 1H26A 3DK7A 5A6OA 4F70A 4IXPA 3TJDA 3UYTA 4ZJJA 3I04M 2BVAA 1TH2A 1XWSA 1RDQE 3TT0A 4XJ0A 5EOLA 3L9PA 2PE1A 2X0OA 4TWPA 2EB3A 4Q5HA 4JXJA 3VN9A 4HGSA 5EP3A 5BPVA 2CJMA 5AADA 4G34A 3LE6A 2XNGA 3DFCB 3ZFYA 4CZUA 2LHGA 1OKZA 2GNIA 5CAPA 3EQDA 4NTTA 4NUSA 3C7QA 4YUQA 4OTWA 5FLXS 3CLYA 2LVOC 5C18A 2HENA 4FTCA 3OXIA 3WF8A 4GIPA 5CAOA 4GT5A 2XARA 3ZUUA 3CKWA 4EI4A 2B0QA 4KIOA 1IY2A 4MH7A 4DT8A 4DEEA 2R6FA 4IX5A 4GEWA 4W8EA 4PUZA 2DAKA 4XRJA 2B4SB 4EL9A 2B9HA 4FV1A 2BKZA 3R02A 1W83A 2WSEF 2NP8A 4ZZNA 3FY0A 5FLFA 2C5RA 3AC2A 3SDJA 5LMNM 4TN6A 1WBVA 4JVGA 4BWKA 4H36A 4BZNA 4MNEA 4MD9E 3DGKA 2OIBA 3C9PA 5C4KA 3M1SA 1XJDA 3R2BA 4BHZA 3A4OX 5BQ0A 2Y21A 4X21A 3QA8A 4W4XA 2WMSA 3HKPA 3IO7A 3K5VA 3NSZA 1J3HA 3D8LA 1XMOM 1PMVA 3E4RA 1YI6A 4LOQA 2XYUA 3PZEA 4DAWA 4S12A 2YLEA 3HAVA 5JSMA 4CSVA 1OKWA 3U51A 5AM7A 2R4BA 1J91A 4O4EA 5EW8A 4E3CA 4KAOA 3EYHA 4DV6M 3WE8A 4JI4M 2ZM6M 2XF0A 4O82A 4R3DA 4S32A 3OT3A 2EUFB 3AMAA 4IFCA 4JG8A 4DH7A 4DR2M 1H6UA 1DAYA 4BGGA 2WQOA 5DT4A 5FTOA 3ZRLA 2B7AA 2WTJA 4IEBA 1ZMWA 3BCEA 3ODYX 4DGOA 3UNKA 2C47A 4BCNA 4O1PA 1XNQM 1SNUA 2PZPA 3DB8A 4GT3A 4C2WA 1LTMA 4JIKA 3R73A 4RF0A 4FSRA 4IVBA 3LIJA 3TWJA 1SVHA 3TUCA 1VDLA 3ZONA 3LQ8A 4GRBA 2LHCA 1XXHE 5FSWA 3QZGA 1U54B 2R9SA 3AD4A 5KMLA 4IAYA 3CY3A 1Q99A 4QRCA 4QNYA 3KXGA 4FV6A 3F3ZA 2Y9QA 3IW4A 3LCKA 1RE8A 1QAMA 3PSBA 4UXQA 1UNHA 3HHYA 3AT2A 4UMUA 3ZCLA 4BCIA 1YXTA 2F2CB 2AC5A 4L16A 4NFMA 2PVKA 5JQ8A 5CSVA 5KNJA 4JAJA 5L8LA 4EHZA 3W32A 1GL7A 4AKHA 5J9ZA 4DFYA 2CHVA 1GIHA 2VTHA 3EIEA 1Z59A 1XH6A 4FCWA 5E8SA 2JDSA 4FT0A 2CGUA 3CTJA 2BAKA 5TF9A 2OXDA 4NW6A 5AR3A 3D2IA 4N0SA 4AA5A 5AUVA 4LF8M 4PT5A 3Q9YA 2W4JA 4E73A 4G31A 2QODA 4IZAA 2LGCA 3WIKA 4YJRA 3RZFA 4EYJA 4IIRA 2UXBM 2D7GA 3HDNA 4L15A 4NSOB 4AX8A 3R9HA 5LMAA 3Q4TA 4CT2A 3RTPA 4WNOA 5K0XA 4MBIA 4FTKA 4J96A 2P2IA 3A98B 2RIOA 4QMSA 2IVSA 3OCTA 2JKMA 4Z55A 3GCPA 4RVKA 4CZYB 4F1IA 4O7SA 2RFNA 3DOGA 3LQ5A 2VV9A 4F9CA 3UDTA 3B7ZA 3KK8A 4USDA 1JLUE 4M3QA 4LM5A 5HNIX 3TL8A 4YJTA 5E9EA 4D80A 3NFFB 5FP6A 3LCDA 3EIDA 3C50A 2X8EA 5HVYA 1JKTA 4I92A 3TV6A 3B8RA 4ACMA 2DYLA 4QQCA 2ESMA 4C62A 2IPXA 1E1XA 5ITXE 2CKEA 3I60A 3MH1A 4CMTA 4MBLA 1ZQ9A 5CEPA 4E5BA 4DINA 3ZYAA 5EHLA 1Q8YA 4V0GA 4DA5A 1P2AA 3SMSA 3QLFA 4AWIA 2I7NA 2W1EA 3G5DA 3DY7A 3ZLWA 5CWZA 3PE2A 2IO6A 4BI0A 4LCBA 3C0IA 4I6QA 3AOXA 4DUYM 4OU7A 5DBXA 5KHWA 3G51A 1D0KA 4K0YA 1GY3A 4JDHA 5FTNA 1PMEA 3GNIB 3FQSA 4X0MA 5ITTA 5H8GA 3OEZA 4I6HA 2R3MA 4E20A 4ZS0A 3HYHA 3GLFE 3JS2A 3GO8A 2HY0A 2X7GA 3AC1A 4F1MA 1PW2A 3O5AA 4C38A 2UZVA 4BDCA 1QCFA 2PMNX 5IQIA 3F5PA 3QD2B 1JSVA 4G16A 4B3MM 3GT8A 2A1AB 4MF1A 3R7VA 2A5YB 4F0FA 3QTQA 2YCFA 3HL7A 4AQKA 3EB0A 2BUJA 5D7VA 3LXPA 4D1ZA 4BL1A 1MRVA 5BYZA 1Q39A 4QMWA 1MN3A 1ZYCA 4WW0A 3LFCA 3VK8A 1E94E 5J5SA 5L8JA 3IG8A 5DEWA 3PJ8A 5E1SA 2W5BA 4LV7A 4IWQA 4FV3A 3HZJA 4I4EA 4AGCA 3ORZA 5CASA 1H01A 5I9UA 4JL9A 1QZMA 3FC1X 3PSDA 5HO8A 3MN3A