4DBGB

Crystal structure of hoil-1l-ubl complexed with a hoip-uba derivative
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
DKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A non-canonical UBA-UBL interaction forms the linear-ubiquitin-chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords RanBP-type and C3HC4-type zinc finger-containing protein 1
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16678 HOIP-UBA HOIP UBA domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4dbgB02
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4dbgB03
1A5TA 1VG5A 2R0IA 1ZV1A 1IM2A 3E46A 3IHPA 1GO5A 2EKFA 3F92A 3LCVB 2LVNC 2JY7A 1UFZA 3GLIE 2LVQD 1DO0A 2CP8A 2K9DA 3K9PA 1XXHE 2LBCA 2DNAA 3FRHA 3T6PA 3BBZA 2ZTDA 1VDLA 2HAKA 1JR3E 1WR1B 2KNVA 2JY5A 2JZ0A 2L4FA 1VQ1A 2QHOB 1VEGA 4WP2A 2HWJA 2OOAA 2B3TA 2LVOC 1ZMUA 2JP7A 2LVAA 4UN2B 3H4JA 4G3OA 1E94E 1HQYE 3FE3A 3IECA 1VEJA 2O25A 1OQYA 4GEWA 2DAGA 1NV9A 1EFUB 2DI0A 2EKKA 2DKLA 1YLAA 1PGYA 1G3IA 2ZTCA 1TTEA 3GLFE 5JI2E 1SG9A 1HJPA 2BWEA 2WZJA 2JNHA 2LTUA 4F1IA 1NV8A 2JY8A 1CUKA 2L2DA 1BVSA 1DO2A 2DAIA 1HT2E 1VEKA 1Q02A 2MGWA 4R71A 2KNZA 2DENA 2BWBA 1QZEA 2KHHA 1MN3A 2DAEA 1HT1E 1Y8GA 2DAKA 2EJSA 2DHYA 4F2LA 1ZMVA 2K0BX 2QSFX 4DBGB 1DV0A 5DFLA 1WJ7A 2H5XA 2L4EA 2LVPC 1IFYA 3LCUA 2MROB 1TR8A 1WIVA 3FRIA 2CWBA 2QNJA 3B89A 1IXSA 2MR9A 2OOBA 3GLGE 2JY6B 1G4AE 4HEOA 1WGLA 2G3QA 2JUJA 3E21A 1WGNA 1KYIA 1R4GA 2KNAA 1AIPC 1P3QQ 1C7YA 4Q7JA 1G41A 1OAIA 1F4IA 1ZMWA 1T6OA 1XB2B 1WHCA 1OTRA 2DZLA 2OO9A 3K9OA 2JZ1A 3GLHE 3MMPA 2RRUA 1T43A 1V92A 2DAMA 1OKSA 2MJ5B
chains in the Genus database with same CATH superfamily
2C96A 1ZV1A 1NHWC 1PJJA 5F3WA 2APLA 2JY7A 3FKEA 1UFZA 3GLIE 2XF3A 5C18A 2ZM6M 4IBGA 2WSFF 1XXHE 5IT9S 2DNAA 4MGKE 4DV1M 3VKHA 1N33M 1IN7A 2E5LM 4D80A 4JI8M 3CTWB 1R5LA 4L6V6 1Z5AA 2HAKA 3CF6E 4LJ9A 2L7IA 1JR3E 2XFSA 1IBMM 2M60A 4G6ZA 1T3TA 3B74A 3NWLA 2D7GA 2FS1A 4KLNA 3HHZA 3HU2A 1VEGA 3W0LB 1R6BX 3J7BA 1PJIA 3T15A 1DGGA 4P17A 3KXEC 3W68A 2LVOC 2LVAA 1TDHA 4WURA 4G3OA 1LV7A 3K1JA 3IG5A 3FTDA 4LGYA 2H1RA 1QVRA 2X8AA 3J80S 1NNJA 4S12A 1YSYA 1TGUA 2UXDM 1QUSA 1R7RA 2O25A 2CV2A 4JI1M 2BJWA 5ITQA 3U60A 2Z4SA 4CJ6A 4DR6M 2DI0A 2EUCA 1DGFA 3LVVA 3PVSA 3L26A 3SASA 4XBOA 5EXSA 3VDPA 4QOZC 3UMMA 2G8LA 4IJEA 4PD2A 3SATA 1XNQM 3U60B 2ZTCA 3AJIB 4RF1A 4CGYB 3MJ5A 3SAVA 3PFIA 1Z6TA 3EIEA 1HJPA 4M0WA 2Z7JA 3FTCA 4FD2A 3K2LA 4MGHA 2LTUA 1GJSA 3KOWE 1ZAEA 2ZANA 3IG8A 4LY6A 2JY8A 4PDIA 2XH9A 4DR7M 2DZOB 2DWMA 3W67A 2QBYB 4PCZA 2RGHA 1N78A 1BVSA 3U6EA 1NJGA 1Z59A 2DAIA 2MH8A 3L29A 5FSWA 1Q02A 3BOSA 2KNZA 4I5SA 2KHHA 5KPZA 4M9XA 3GLHA 2VQFM 1GLNA 3U6CA 5DNYA 4GKJM 2J7OA 4NL4H 3PXGA 1NSFA 3U6OA 2L7HA 1ZMVA 3KSXA 5EP4A 3KS4A 4LF5M 2C5RA 4LJ8A 2OQ4A 3R9XB 3DOAA 4LRTA 3SC3A 1N77A 3U61A 2ERCA 1SXJD 2MROB 4DV7M 3AL0C 1TR8A 4IBCA 3JR4A 1NO1A 1N34M 2XSZD 1SXJE 2CWBA 4LFBM 4XK8F 4DUZM 1IXSA 3LVWA 4WW0A 4GMQA 1G4AE 5C1BA 3GQ5A 3SMPA 1WGLA 2G3QA 4P16A 5ITUA 2Y0QA 1IXSB 1WGNA 1KYIA 7CATA 2K6BA 4GC9A 4L8RC 3PNYA 3V76A 3UK6A 3L28A 1HNWM 2XEPA 3U6LA 4BLCA 2Z8YM 3HGIA 2C98A 4Q7JA 1C7YA 1OAIA 3I51A 4OVZB 1ZMWA 5IZ7D 2KZSA 1T6OA 4AG5A 3VFDA 1L1ZA 3KS8A 2F5QA 4B3RM 4MGZE 4D82A 2EA0A 1JB0F 3LQRA 2JZ1A 4FWDA 4JI2M 1N32M 3GLHE 3RGSA 3MMPA 2KRUA 4DR2M 1V92A 2DAMA 3GPYA 1OKSA 2ZAMA 3SAUA 1Z5BA 1YE9A 3M6AA 1J5EM 2UUBM 1XMQM 3AOEC 2Z3XA 3IHPA 3ZCBB 2EKFA 3F92A 3LCVB 1UM8A 4CISA 4OW0A 1NY5A 4OVZA 2F5OA 2R6FA 1DO0A 2K9DA 1G71A 1SXJA 2FOIC 2VIIA 3K9PA 5DYIA 3T1YM 4AKGA 3BBZA 5GKNA 3HU1A 1L8QA 3SYKA 2OPFA 4MGYE 3CF0A 1JQJC 2UU9M 1C1KA 4XGIA 3GLGB 1G8PA 3C3DA 3A98B 3J27B 3KDSE 5E26A 5ITYA 1FJGM 2QZ4A 1IN4A 1HNZM 3M0EA 2CV1A 2DXIA 2R44A 4JV5M 4DV0M 2HWJA 2OOAA 1QUTA 5LMUM 2B3TA 1GJTA 2CV0A 2YNMD 1E94E 1VDDA 3A45A 5EXXA 4FVMA 4NSOB 1LTMA 2Q2EB 2QCUA 1L2CA 4NRVA 1RU3A 4LCBA 3GO8A 2DAGA 1SXJC 4REZA 3Q8GA 4JI3M 3TQSA 3GP1A 3L25A 4DR3M 4GKKM 1KFVA 5JI2E 1OIZA 2F5SA 2GQFA 3T1HM 2WZJA 3QAUA 4R7GA 2XSZA 4PT5A 2D7EA 1QAQA 3GRUA 1QDTA 2F4VM 5BPVA 2WSCF 1DO2A 4MM3B 3U6SA 1QANA 2MGWA 4R71A 2CHVA 2DENA 3TWMA 1QZEA 3UJNA 4G4QA 4B3MM 4OX9M 1D0MA 2HCBA 5EQTA 3U61B 4LJ4A 2DHYA 5IWAM 2K0BX 3D8LA 4IBEA 5DFLA 3VKGA 2H5XA 4NOOB 3ZH9B 3E4RA 3AOGA 3LCUA 3RE8A 3C58A 1WIVA 3CF2A 2XLJA 4GRIA 3EIHA 5ITTA 1R2YA 4ITQA 4LF8M 4I8OA 1XXHA 3B89A 3NBXX 4II7A 2R46A 4ZPXA 1PRBA 1MJGM 4LFCM 1QAOA 2P5TA 3HU3A 3M7GA 2JUJA 3FUVA 2VDBB 5ITXA 8CATA 3KVWA 3L2AA 2XGNA 3AKZA 1EIJA 3AOEA 4QNRA 2R45A 1J7KA 4L15A 2CHQA 1X37A 4JI0M 3QWLA 1KSFX 2DZNB 2R18A 3VK7A 1JR3A 2HKJA 5BR8M 1I94M 3HJSA 4JI5M 1K3XA 3K9OA 4FWHA 5ITXE 2KA6B 4QHSA 3I04M 1EE8A 2J5YA 2RRUA 1T43A 2MJ5B 4KT0F 2I7NA 2LNHC 1N75A 3RFWA 1A5TA 1OAOC 2DHRA 2GNOA 4BBAA 1VG5A 1IY0A 2EO2A 2R0IA 2QQ8A 2LWXA 3E46A 5EP1A 3TE6A 4JN6A 4YY3M 1IN5A 4LJ6A 5KPTA 2LVNC 4HLQA 1D2NA 3HKPA 3LMMA 3A46A 3FD9A 4KODA 4FCWA 4DV3M 5EP2A 2UXBM 4GIPA 2CP8A 3FRHA 2DWLA 3E9SA 3SAWA 5L8RF 3WHLA 1K82A 1V33A 4R3DA 2ZTDA 1VDLA 4MB7A 2KNVA 2JY5A 2W82A 4IJFA 2JZ0A 2L4FA 1TH2A 1VQ1A 3SHGB 3GLIA 5EJCA 4MGIE 3KFUG 5EXPA 4WP2A 1NHGC 4PDGA 5FTMA 3ZQJA 4FCTA 4Y28F 3UGJA 3KW6A 1N36M 1ZMUA 2JA2A 2JP7A 4TUWA 2Y0TA 3H4JA 3GLIB 4QHTA 1QDRA 4IBDA 5FTKA 3SFZA 1SXJB 3SYLA 4DV4M 2UUCM 2CEAA 5KQDA 2KW0A 4GHAA 3UZUA 1IXZA 4LJAA 4QNMA 1D0KA 3KP0E 2K47A 5FTLA 4K0KM 3I4YA 1EFUB 1Z5CA 2FH0A 2DKLA 4AQYM 3FUWA 3B7ZA 1NJFA 1YLAA 2NQ8C 2CHGA 4B7HA 4G4NA 1GABA 2RGOA 5LMNM 4IBBA 4LF4M 2AHMA 2BWEA 3J2PB 1IY2A 3LQQA 2M5ZA 4DUYM 1PM5A 1XMOM 2DVWB 1DGBA 3B9PA 4L16A 1CUKA 2L2DA 3TWKA 4FCVA 2FFJA 1XXHB 1Q39A 1HT2E 1IBKM 3H4MA 2KXEA 4D81A 4FWGA 5FTNA 4X66M 1QQWA 4IBFA 3QYBA 1FNNA 4RKUF 3U6MA 2DAEA 1HT1E 1I4WA 1Y8GA 2DAKA 3GLHB 4JXJA 4LZZA 5DYGA 4NXNM 1K3WA 3J7AS 1L2BA 2QSFX 1TH3A 2L09A 2LHGA 4DBGB 2HHHM 2QENA 4B3SM 1IQPA 1E9SA 1WJ7A 3R8FA 2L4EA 4L4UA 4LJ5A 2LVPC 1IXRC 4Z6YA 5IREB 4B08A 1IFYA 3RGPA 2QP9X 3QYEA 3U6QA 3VK8A 4JYAM 4RF0A 1YUBA 2MR9A 4LF9M 5JI3E 3LW5F 3GLGE 2UXCM 2JY6B 1R2ZA 2L6OA 3Q8XA 3MK6A 3TWLA 3FTEA 4FW9A 3KOXE 3I01M 3ILKA 3FTFA 3JAMS 2LHCA 4BB9A 1R4GA 4DR5M 2V1CA 1P3QQ 3HY5A 4NXMM 3HHYA 4LFAM 3K8ZA 2FNAA 2HL7A 3SARA 1GL7A 1QYRA 2R4JA 4Z8XA 3TPZA 2F5PA 1XB2B 1GL6A 1PJTA 4IBIA 1WHCA 2VF7A 3AFHA 4KO8A 4LGMA 3U5ZA 2CUZA 2OO9A 4AKIA 4NSRA 3DA1A 1ORYB 5EP3A 2O01F 4DR1M 1AUAA 4LRSA 4GH9A 3VDUA 5A2QS 1QZMA 2ZAOA 3GRVA 4ANRA 5E6JA 4CIZA 4YHHM 2QPAA 5H37D 1OJLA 4QOSA 1GKIA 4AZFA 2F5NA 1IM2A 3GRRA 3NBIA 1ZQ9A 1GO5A 4M9SA 5KPRA 3ZC7B 2O5RA 1NNUC 2A5YB 1MU5A 2Y20A 2LVQD 3MHVC 2YR0A 2Z4RA 4KHPM 4LF7M 2LBCA 3FYCA 1DGHA 3SBJA 1IBLM 4L78A 3T6PA 1J09A 1GVNA 4LG2A 2G5GX 3WHKA 3GPXA 2BNKA 3A42A 5EXTA 4AW4A 2QBYA 3TL4X 4JI6M 2R65A 4HL4A 1WR1B 1DGHB 3KOZE 4IBKA 1OFHA 3JR5A 2KRKA 1WXQA 2LXEA 1Q3BA 2QHOB 2V1UA 4B7GA 1HQCA 4W5WA 2LH0A 1W5SA 2KDLA 2XFTA 4X65M 5ITRA 3GLFB 4UN2B 1E9RA 4B3TM 2N35A 4EIWA 4B7FA 1QAMA 1HQYE 3FE3A 3IECA 4NC6A 1L2DA 1G59A 2WSEF 3GQ3A 3GLFA 1VEJA 4DV5M 1D0LA 4RNAA 1OQYA 3HJ8A 4GEWA 1S3SA 1NV9A 3HWSA 2EKKA 1Q3CA 3B7QA 2R62A 4I81A 1TF0B 1W5TA 1PGYA 2CE7A 3OTOM 1G3IA 1MX0A 1TH4A 2BJVA 1TTEA 5KO3A 4CHTB 3GLFE 1PJSA 1SG9A 2DWNA 4GHLA 2JWSA 2JNHA 3FUXA 2V6ZM 3HJQA 3KOYE 4F1IA 1NV8A 4LJ7A 3I4VA 3T38A 4AKHA 2C9OA 3THGA 3U6PA 3U5ZB 1NVMA 4IIWA 1E32A 1HR0M 1VEKA 2KEBA 2X4AA 3HHXA 4A3VB 1OIPA 2JXNA 3GLGA 2BWBA 2YQZA 1MN3A 1XWIA 1OFIA 2EJSA 3BXWA 3FYDA 1L1TA 1XC8A 3HHWA 2I7PA 4I4LA 4JI7M 4LF6M 4F2LA 5KQ8A 1DV0A 3DZDA 4NRWA 2DWZB 4GC5A 4DR4M 2CRUA 3DFZA 3GRYA 2KZUA 2ZBKB 1IN8A 3SHFA 3VLFB 3CGWA 3FUTA 1IY1A 3HX3A 3FRIA 1JR3D 4GITA 4IBJA 4MH0E 2QNJA 3GPPA 2YFQA 3GQ4A 2XZUA 1TDZA 2OOBA 4DV2M 3SMSA 1NY6A 2J7NA 3GPUA 5FLXS 4LZJA 2FE8A 3FUUA 4HEOA 5FTJA 3U6DA 3E21A 3AV0A 4G4RA 4G4OA 2C99A 3J81S 2D7HA 2KNAA 1XNRM 1AIPC 4AG6A 2C9CA 2Y21A 2XZFA 1G41A 2CFOA 3B7NA 1F4IA 4M0DA 3W0FA 3KP1E 4AI6A 2VQEM 2RKOA 3K92A 1HNXM 3C3EA 1H6UA 1IN6A 1OTRA 2DZLA 2VF8A 4OU7A 4DV6M 3L27A 1V34A 1XHBA 2R4EA 3KSJA 3PNVA 3D8BA 3HZJA 4JI4M 2X49A 4M9ZA 4X64M 1PJQA 2UUAM 3C9PA 4X62M
chains in the Genus database with same CATH topology
1A5TA 1VG5A 2R0IA 1ZV1A 1IM2A 3E46A 3IHPA 1GO5A 2EKFA 3F92A 3LCVB 2LVNC 2JY7A 1UFZA 3GLIE 2LVQD 1DO0A 2CP8A 2K9DA 3K9PA 1XXHE 2LBCA 2DNAA 3FRHA 3T6PA 3BBZA 2ZTDA 1VDLA 2HAKA 1JR3E 1WR1B 2KNVA 2JY5A 2JZ0A 2L4FA 1VQ1A 2QHOB 1VEGA 4WP2A 2HWJA 2OOAA 2B3TA 2LVOC 1ZMUA 2JP7A 2LVAA 4UN2B 3H4JA 4G3OA 1E94E 1HQYE 3FE3A 3IECA 1VEJA 2O25A 1OQYA 4GEWA 2DAGA 1NV9A 1EFUB 2DI0A 2EKKA 2DKLA 1YLAA 1PGYA 1G3IA 2ZTCA 1TTEA 3GLFE 5JI2E 1SG9A 1HJPA 2BWEA 2WZJA 2JNHA 2LTUA 4F1IA 1NV8A 2JY8A 1CUKA 2L2DA 1BVSA 1DO2A 2DAIA 1HT2E 1VEKA 1Q02A 2MGWA 4R71A 2KNZA 2DENA 2BWBA 1QZEA 2KHHA 1MN3A 2DAEA 1HT1E 1Y8GA 2DAKA 2EJSA 2DHYA 4F2LA 1ZMVA 2K0BX 2QSFX 4DBGB 1DV0A 5DFLA 1WJ7A 2H5XA 2L4EA 2LVPC 1IFYA 3LCUA 2MROB 1TR8A 1WIVA 3FRIA 2CWBA 2QNJA 3B89A 1IXSA 2MR9A 2OOBA 3GLGE 2JY6B 1G4AE 4HEOA 1WGLA 2G3QA 2JUJA 3E21A 1WGNA 1KYIA 1R4GA 2KNAA 1AIPC 1P3QQ 1C7YA 4Q7JA 1G41A 1OAIA 1F4IA 1ZMWA 1T6OA 1XB2B 1WHCA 1OTRA 2DZLA 2OO9A 3K9OA 2JZ1A 3GLHE 3MMPA 2RRUA 1T43A 1V92A 2DAMA 1OKSA 2MJ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5T A;  1VG5 A;  2R0I A;  1ZV1 A;  1IM2 A;  3E46 A;  3IHP A;  1GO5 A;  2EKF A;  3F92 A;  3LCV B;  2LVN C;  2JY7 A;  1UFZ A;  3GLI E;  2LVQ D;  1DO0 A;  2CP8 A;  2K9D A;  3K9P A;  1XXH E;  2LBC A;  2DNA A;  3FRH A;  3T6P A;  3BBZ A;  2ZTD A;  1VDL A;  2HAK A;  1JR3 E;  1WR1 B;  2KNV A;  2JY5 A;  2JZ0 A;  2L4F A;  1VQ1 A;  2QHO B;  1VEG A;  4WP2 A;  2HWJ A;  2OOA A;  2B3T A;  2LVO C;  1ZMU A;  2JP7 A;  2LVA A;  4UN2 B;  3H4J A;  4G3O A;  1E94 E;  1HQY E;  3FE3 A;  3IEC A;  1VEJ A;  2O25 A;  1OQY A;  4GEW A;  2DAG A;  1NV9 A;  1EFU B;  2DI0 A;  2EKK A;  2DKL A;  1YLA A;  1PGY A;  1G3I A;  2ZTC A;  1TTE A;  3GLF E;  5JI2 E;  1SG9 A;  1HJP A;  2BWE A;  2WZJ A;  2JNH A;  2LTU A;  4F1I A;  1NV8 A;  2JY8 A;  1CUK A;  2L2D A;  1BVS A;  1DO2 A;  2DAI A;  1HT2 E;  1VEK A;  1Q02 A;  2MGW A;  4R71 A;  2KNZ A;  2DEN A;  2BWB A;  1QZE A;  2KHH A;  1MN3 A;  2DAE A;  1HT1 E;  1Y8G A;  2DAK A;  2EJS A;  2DHY A;  4F2L A;  1ZMV A;  2K0B X;  2QSF X;  4DBG B;  1DV0 A;  5DFL A;  1WJ7 A;  2H5X A;  2L4E A;  2LVP C;  1IFY A;  3LCU A;  2MRO B;  1TR8 A;  1WIV A;  3FRI A;  2CWB A;  2QNJ A;  3B89 A;  1IXS A;  2MR9 A;  2OOB A;  3GLG E;  2JY6 B;  1G4A E;  4HEO A;  1WGL A;  2G3Q A;  2JUJ A;  3E21 A;  1WGN A;  1KYI A;  1R4G A;  2KNA A;  1AIP C;  1P3Q Q;  1C7Y A;  4Q7J A;  1G41 A;  1OAI A;  1F4I A;  1ZMW A;  1T6O A;  1XB2 B;  1WHC A;  1OTR A;  2DZL A;  2OO9 A;  3K9O A;  2JZ1 A;  3GLH E;  3MMP A;  2RRU A;  1T43 A;  1V92 A;  2DAM A;  1OKS A;  2MJ5 B; 
#chains in the Genus database with same CATH topology
 2C96 A;  1ZV1 A;  1NHW C;  1PJJ A;  5F3W A;  2APL A;  2JY7 A;  3FKE A;  1UFZ A;  3GLI E;  2XF3 A;  5C18 A;  2ZM6 M;  4IBG A;  2WSF F;  1XXH E;  5IT9 S;  2DNA A;  4MGK E;  4DV1 M;  3VKH A;  1N33 M;  1IN7 A;  2E5L M;  4D80 A;  4JI8 M;  3CTW B;  1R5L A;  4L6V 6;  1Z5A A;  2HAK A;  3CF6 E;  4LJ9 A;  2L7I A;  1JR3 E;  2XFS A;  1IBM M;  2M60 A;  4G6Z A;  1T3T A;  3B74 A;  3NWL A;  2D7G A;  2FS1 A;  4KLN A;  3HHZ A;  3HU2 A;  1VEG A;  3W0L B;  1R6B X;  3J7B A;  1PJI A;  3T15 A;  1DGG A;  4P17 A;  3KXE C;  3W68 A;  2LVO C;  2LVA A;  1TDH A;  4WUR A;  4G3O A;  1LV7 A;  3K1J A;  3IG5 A;  3FTD A;  4LGY A;  2H1R A;  1QVR A;  2X8A A;  3J80 S;  1NNJ A;  4S12 A;  1YSY A;  1TGU A;  2UXD M;  1QUS A;  1R7R A;  2O25 A;  2CV2 A;  4JI1 M;  2BJW A;  5ITQ A;  3U60 A;  2Z4S A;  4CJ6 A;  4DR6 M;  2DI0 A;  2EUC A;  1DGF A;  3LVV A;  3PVS A;  3L26 A;  3SAS A;  4XBO A;  5EXS A;  3VDP A;  4QOZ C;  3UMM A;  2G8L A;  4IJE A;  4PD2 A;  3SAT A;  1XNQ M;  3U60 B;  2ZTC A;  3AJI B;  4RF1 A;  4CGY B;  3MJ5 A;  3SAV A;  3PFI A;  1Z6T A;  3EIE A;  1HJP A;  4M0W A;  2Z7J A;  3FTC A;  4FD2 A;  3K2L A;  4MGH A;  2LTU A;  1GJS A;  3KOW E;  1ZAE A;  2ZAN A;  3IG8 A;  4LY6 A;  2JY8 A;  4PDI A;  2XH9 A;  4DR7 M;  2DZO B;  2DWM A;  3W67 A;  2QBY B;  4PCZ A;  2RGH A;  1N78 A;  1BVS A;  3U6E A;  1NJG A;  1Z59 A;  2DAI A;  2MH8 A;  3L29 A;  5FSW A;  1Q02 A;  3BOS A;  2KNZ A;  4I5S A;  2KHH A;  5KPZ A;  4M9X A;  3GLH A;  2VQF M;  1GLN A;  3U6C A;  5DNY A;  4GKJ M;  2J7O A;  4NL4 H;  3PXG A;  1NSF A;  3U6O A;  2L7H A;  1ZMV A;  3KSX A;  5EP4 A;  3KS4 A;  4LF5 M;  2C5R A;  4LJ8 A;  2OQ4 A;  3R9X B;  3DOA A;  4LRT A;  3SC3 A;  1N77 A;  3U61 A;  2ERC A;  1SXJ D;  2MRO B;  4DV7 M;  3AL0 C;  1TR8 A;  4IBC A;  3JR4 A;  1NO1 A;  1N34 M;  2XSZ D;  1SXJ E;  2CWB A;  4LFB M;  4XK8 F;  4DUZ M;  1IXS A;  3LVW A;  4WW0 A;  4GMQ A;  1G4A E;  5C1B A;  3GQ5 A;  3SMP A;  1WGL A;  2G3Q A;  4P16 A;  5ITU A;  2Y0Q A;  1IXS B;  1WGN A;  1KYI A;  7CAT A;  2K6B A;  4GC9 A;  4L8R C;  3PNY A;  3V76 A;  3UK6 A;  3L28 A;  1HNW M;  2XEP A;  3U6L A;  4BLC A;  2Z8Y M;  3HGI A;  2C98 A;  4Q7J A;  1C7Y A;  1OAI A;  3I51 A;  4OVZ B;  1ZMW A;  5IZ7 D;  2KZS A;  1T6O A;  4AG5 A;  3VFD A;  1L1Z A;  3KS8 A;  2F5Q A;  4B3R M;  4MGZ E;  4D82 A;  2EA0 A;  1JB0 F;  3LQR A;  2JZ1 A;  4FWD A;  4JI2 M;  1N32 M;  3GLH E;  3RGS A;  3MMP A;  2KRU A;  4DR2 M;  1V92 A;  2DAM A;  3GPY A;  1OKS A;  2ZAM A;  3SAU A;  1Z5B A;  1YE9 A;  3M6A A;  1J5E M;  2UUB M;  1XMQ M;  3AOE C;  2Z3X A;  3IHP A;  3ZCB B;  2EKF A;  3F92 A;  3LCV B;  1UM8 A;  4CIS A;  4OW0 A;  1NY5 A;  4OVZ A;  2F5O A;  2R6F A;  1DO0 A;  2K9D A;  1G71 A;  1SXJ A;  2FOI C;  2VII A;  3K9P A;  5DYI A;  3T1Y M;  4AKG A;  3BBZ A;  5GKN A;  3HU1 A;  1L8Q A;  3SYK A;  2OPF A;  4MGY E;  3CF0 A;  1JQJ C;  2UU9 M;  1C1K A;  4XGI A;  3GLG B;  1G8P A;  3C3D A;  3A98 B;  3J27 B;  3KDS E;  5E26 A;  5ITY A;  1FJG M;  2QZ4 A;  1IN4 A;  1HNZ M;  3M0E A;  2CV1 A;  2DXI A;  2R44 A;  4JV5 M;  4DV0 M;  2HWJ A;  2OOA A;  1QUT A;  5LMU M;  2B3T A;  1GJT A;  2CV0 A;  2YNM D;  1E94 E;  1VDD A;  3A45 A;  5EXX A;  4FVM A;  4NSO B;  1LTM A;  2Q2E B;  2QCU A;  1L2C A;  4NRV A;  1RU3 A;  4LCB A;  3GO8 A;  2DAG A;  1SXJ C;  4REZ A;  3Q8G A;  4JI3 M;  3TQS A;  3GP1 A;  3L25 A;  4DR3 M;  4GKK M;  1KFV A;  5JI2 E;  1OIZ A;  2F5S A;  2GQF A;  3T1H M;  2WZJ A;  3QAU A;  4R7G A;  2XSZ A;  4PT5 A;  2D7E A;  1QAQ A;  3GRU A;  1QDT A;  2F4V M;  5BPV A;  2WSC F;  1DO2 A;  4MM3 B;  3U6S A;  1QAN A;  2MGW A;  4R71 A;  2CHV A;  2DEN A;  3TWM A;  1QZE A;  3UJN A;  4G4Q A;  4B3M M;  4OX9 M;  1D0M A;  2HCB A;  5EQT A;  3U61 B;  4LJ4 A;  2DHY A;  5IWA M;  2K0B X;  3D8L A;  4IBE A;  5DFL A;  3VKG A;  2H5X A;  4NOO B;  3ZH9 B;  3E4R A;  3AOG A;  3LCU A;  3RE8 A;  3C58 A;  1WIV A;  3CF2 A;  2XLJ A;  4GRI A;  3EIH A;  5ITT A;  1R2Y A;  4ITQ A;  4LF8 M;  4I8O A;  1XXH A;  3B89 A;  3NBX X;  4II7 A;  2R46 A;  4ZPX A;  1PRB A;  1MJG M;  4LFC M;  1QAO A;  2P5T A;  3HU3 A;  3M7G A;  2JUJ A;  3FUV A;  2VDB B;  5ITX A;  8CAT A;  3KVW A;  3L2A A;  2XGN A;  3AKZ A;  1EIJ A;  3AOE A;  4QNR A;  2R45 A;  1J7K A;  4L15 A;  2CHQ A;  1X37 A;  4JI0 M;  3QWL A;  1KSF X;  2DZN B;  2R18 A;  3VK7 A;  1JR3 A;  2HKJ A;  5BR8 M;  1I94 M;  3HJS A;  4JI5 M;  1K3X A;  3K9O A;  4FWH A;  5ITX E;  2KA6 B;  4QHS A;  3I04 M;  1EE8 A;  2J5Y A;  2RRU A;  1T43 A;  2MJ5 B;  4KT0 F;  2I7N A;  2LNH C;  1N75 A;  3RFW A;  1A5T A;  1OAO C;  2DHR A;  2GNO A;  4BBA A;  1VG5 A;  1IY0 A;  2EO2 A;  2R0I A;  2QQ8 A;  2LWX A;  3E46 A;  5EP1 A;  3TE6 A;  4JN6 A;  4YY3 M;  1IN5 A;  4LJ6 A;  5KPT A;  2LVN C;  4HLQ A;  1D2N A;  3HKP A;  3LMM A;  3A46 A;  3FD9 A;  4KOD A;  4FCW A;  4DV3 M;  5EP2 A;  2UXB M;  4GIP A;  2CP8 A;  3FRH A;  2DWL A;  3E9S A;  3SAW A;  5L8R F;  3WHL A;  1K82 A;  1V33 A;  4R3D A;  2ZTD A;  1VDL A;  4MB7 A;  2KNV A;  2JY5 A;  2W82 A;  4IJF A;  2JZ0 A;  2L4F A;  1TH2 A;  1VQ1 A;  3SHG B;  3GLI A;  5EJC A;  4MGI E;  3KFU G;  5EXP A;  4WP2 A;  1NHG C;  4PDG A;  5FTM A;  3ZQJ A;  4FCT A;  4Y28 F;  3UGJ A;  3KW6 A;  1N36 M;  1ZMU A;  2JA2 A;  2JP7 A;  4TUW A;  2Y0T A;  3H4J A;  3GLI B;  4QHT A;  1QDR A;  4IBD A;  5FTK A;  3SFZ A;  1SXJ B;  3SYL A;  4DV4 M;  2UUC M;  2CEA A;  5KQD A;  2KW0 A;  4GHA A;  3UZU A;  1IXZ A;  4LJA A;  4QNM A;  1D0K A;  3KP0 E;  2K47 A;  5FTL A;  4K0K M;  3I4Y A;  1EFU B;  1Z5C A;  2FH0 A;  2DKL A;  4AQY M;  3FUW A;  3B7Z A;  1NJF A;  1YLA A;  2NQ8 C;  2CHG A;  4B7H A;  4G4N A;  1GAB A;  2RGO A;  5LMN M;  4IBB A;  4LF4 M;  2AHM A;  2BWE A;  3J2P B;  1IY2 A;  3LQQ A;  2M5Z A;  4DUY M;  1PM5 A;  1XMO M;  2DVW B;  1DGB A;  3B9P A;  4L16 A;  1CUK A;  2L2D A;  3TWK A;  4FCV A;  2FFJ A;  1XXH B;  1Q39 A;  1HT2 E;  1IBK M;  3H4M A;  2KXE A;  4D81 A;  4FWG A;  5FTN A;  4X66 M;  1QQW A;  4IBF A;  3QYB A;  1FNN A;  4RKU F;  3U6M A;  2DAE A;  1HT1 E;  1I4W A;  1Y8G A;  2DAK A;  3GLH B;  4JXJ A;  4LZZ A;  5DYG A;  4NXN M;  1K3W A;  3J7A S;  1L2B A;  2QSF X;  1TH3 A;  2L09 A;  2LHG A;  4DBG B;  2HHH M;  2QEN A;  4B3S M;  1IQP A;  1E9S A;  1WJ7 A;  3R8F A;  2L4E A;  4L4U A;  4LJ5 A;  2LVP C;  1IXR C;  4Z6Y A;  5IRE B;  4B08 A;  1IFY A;  3RGP A;  2QP9 X;  3QYE A;  3U6Q A;  3VK8 A;  4JYA M;  4RF0 A;  1YUB A;  2MR9 A;  4LF9 M;  5JI3 E;  3LW5 F;  3GLG E;  2UXC M;  2JY6 B;  1R2Z A;  2L6O A;  3Q8X A;  3MK6 A;  3TWL A;  3FTE A;  4FW9 A;  3KOX E;  3I01 M;  3ILK A;  3FTF A;  3JAM S;  2LHC A;  4BB9 A;  1R4G A;  4DR5 M;  2V1C A;  1P3Q Q;  3HY5 A;  4NXM M;  3HHY A;  4LFA M;  3K8Z A;  2FNA A;  2HL7 A;  3SAR A;  1GL7 A;  1QYR A;  2R4J A;  4Z8X A;  3TPZ A;  2F5P A;  1XB2 B;  1GL6 A;  1PJT A;  4IBI A;  1WHC A;  2VF7 A;  3AFH A;  4KO8 A;  4LGM A;  3U5Z A;  2CUZ A;  2OO9 A;  4AKI A;  4NSR A;  3DA1 A;  1ORY B;  5EP3 A;  2O01 F;  4DR1 M;  1AUA A;  4LRS A;  4GH9 A;  3VDU A;  5A2Q S;  1QZM A;  2ZAO A;  3GRV A;  4ANR A;  5E6J A;  4CIZ A;  4YHH M;  2QPA A;  5H37 D;  1OJL A;  4QOS A;  1GKI A;  4AZF A;  2F5N A;  1IM2 A;  3GRR A;  3NBI A;  1ZQ9 A;  1GO5 A;  4M9S A;  5KPR A;  3ZC7 B;  2O5R A;  1NNU C;  2A5Y B;  1MU5 A;  2Y20 A;  2LVQ D;  3MHV C;  2YR0 A;  2Z4R A;  4KHP M;  4LF7 M;  2LBC A;  3FYC A;  1DGH A;  3SBJ A;  1IBL M;  4L78 A;  3T6P A;  1J09 A;  1GVN A;  4LG2 A;  2G5G X;  3WHK A;  3GPX A;  2BNK A;  3A42 A;  5EXT A;  4AW4 A;  2QBY A;  3TL4 X;  4JI6 M;  2R65 A;  4HL4 A;  1WR1 B;  1DGH B;  3KOZ E;  4IBK A;  1OFH A;  3JR5 A;  2KRK A;  1WXQ A;  2LXE A;  1Q3B A;  2QHO B;  2V1U A;  4B7G A;  1HQC A;  4W5W A;  2LH0 A;  1W5S A;  2KDL A;  2XFT A;  4X65 M;  5ITR A;  3GLF B;  4UN2 B;  1E9R A;  4B3T M;  2N35 A;  4EIW A;  4B7F A;  1QAM A;  1HQY E;  3FE3 A;  3IEC A;  4NC6 A;  1L2D A;  1G59 A;  2WSE F;  3GQ3 A;  3GLF A;  1VEJ A;  4DV5 M;  1D0L A;  4RNA A;  1OQY A;  3HJ8 A;  4GEW A;  1S3S A;  1NV9 A;  3HWS A;  2EKK A;  1Q3C A;  3B7Q A;  2R62 A;  4I81 A;  1TF0 B;  1W5T A;  1PGY A;  2CE7 A;  3OTO M;  1G3I A;  1MX0 A;  1TH4 A;  2BJV A;  1TTE A;  5KO3 A;  4CHT B;  3GLF E;  1PJS A;  1SG9 A;  2DWN A;  4GHL A;  2JWS A;  2JNH A;  3FUX A;  2V6Z M;  3HJQ A;  3KOY E;  4F1I A;  1NV8 A;  4LJ7 A;  3I4V A;  3T38 A;  4AKH A;  2C9O A;  3THG A;  3U6P A;  3U5Z B;  1NVM A;  4IIW A;  1E32 A;  1HR0 M;  1VEK A;  2KEB A;  2X4A A;  3HHX A;  4A3V B;  1OIP A;  2JXN A;  3GLG A;  2BWB A;  2YQZ A;  1MN3 A;  1XWI A;  1OFI A;  2EJS A;  3BXW A;  3FYD A;  1L1T A;  1XC8 A;  3HHW A;  2I7P A;  4I4L A;  4JI7 M;  4LF6 M;  4F2L A;  5KQ8 A;  1DV0 A;  3DZD A;  4NRW A;  2DWZ B;  4GC5 A;  4DR4 M;  2CRU A;  3DFZ A;  3GRY A;  2KZU A;  2ZBK B;  1IN8 A;  3SHF A;  3VLF B;  3CGW A;  3FUT A;  1IY1 A;  3HX3 A;  3FRI A;  1JR3 D;  4GIT A;  4IBJ A;  4MH0 E;  2QNJ A;  3GPP A;  2YFQ A;  3GQ4 A;  2XZU A;  1TDZ A;  2OOB A;  4DV2 M;  3SMS A;  1NY6 A;  2J7N A;  3GPU A;  5FLX S;  4LZJ A;  2FE8 A;  3FUU A;  4HEO A;  5FTJ A;  3U6D A;  3E21 A;  3AV0 A;  4G4R A;  4G4O A;  2C99 A;  3J81 S;  2D7H A;  2KNA A;  1XNR M;  1AIP C;  4AG6 A;  2C9C A;  2Y21 A;  2XZF A;  1G41 A;  2CFO A;  3B7N A;  1F4I A;  4M0D A;  3W0F A;  3KP1 E;  4AI6 A;  2VQE M;  2RKO A;  3K92 A;  1HNX M;  3C3E A;  1H6U A;  1IN6 A;  1OTR A;  2DZL A;  2VF8 A;  4OU7 A;  4DV6 M;  3L27 A;  1V34 A;  1XHB A;  2R4E A;  3KSJ A;  3PNV A;  3D8B A;  3HZJ A;  4JI4 M;  2X49 A;  4M9Z A;  4X64 M;  1PJQ A;  2UUA M;  3C9P A;  4X62 M; 
#chains in the Genus database with same CATH homology
 1A5T A;  1VG5 A;  2R0I A;  1ZV1 A;  1IM2 A;  3E46 A;  3IHP A;  1GO5 A;  2EKF A;  3F92 A;  3LCV B;  2LVN C;  2JY7 A;  1UFZ A;  3GLI E;  2LVQ D;  1DO0 A;  2CP8 A;  2K9D A;  3K9P A;  1XXH E;  2LBC A;  2DNA A;  3FRH A;  3T6P A;  3BBZ A;  2ZTD A;  1VDL A;  2HAK A;  1JR3 E;  1WR1 B;  2KNV A;  2JY5 A;  2JZ0 A;  2L4F A;  1VQ1 A;  2QHO B;  1VEG A;  4WP2 A;  2HWJ A;  2OOA A;  2B3T A;  2LVO C;  1ZMU A;  2JP7 A;  2LVA A;  4UN2 B;  3H4J A;  4G3O A;  1E94 E;  1HQY E;  3FE3 A;  3IEC A;  1VEJ A;  2O25 A;  1OQY A;  4GEW A;  2DAG A;  1NV9 A;  1EFU B;  2DI0 A;  2EKK A;  2DKL A;  1YLA A;  1PGY A;  1G3I A;  2ZTC A;  1TTE A;  3GLF E;  5JI2 E;  1SG9 A;  1HJP A;  2BWE A;  2WZJ A;  2JNH A;  2LTU A;  4F1I A;  1NV8 A;  2JY8 A;  1CUK A;  2L2D A;  1BVS A;  1DO2 A;  2DAI A;  1HT2 E;  1VEK A;  1Q02 A;  2MGW A;  4R71 A;  2KNZ A;  2DEN A;  2BWB A;  1QZE A;  2KHH A;  1MN3 A;  2DAE A;  1HT1 E;  1Y8G A;  2DAK A;  2EJS A;  2DHY A;  4F2L A;  1ZMV A;  2K0B X;  2QSF X;  4DBG B;  1DV0 A;  5DFL A;  1WJ7 A;  2H5X A;  2L4E A;  2LVP C;  1IFY A;  3LCU A;  2MRO B;  1TR8 A;  1WIV A;  3FRI A;  2CWB A;  2QNJ A;  3B89 A;  1IXS A;  2MR9 A;  2OOB A;  3GLG E;  2JY6 B;  1G4A E;  4HEO A;  1WGL A;  2G3Q A;  2JUJ A;  3E21 A;  1WGN A;  1KYI A;  1R4G A;  2KNA A;  1AIP C;  1P3Q Q;  1C7Y A;  4Q7J A;  1G41 A;  1OAI A;  1F4I A;  1ZMW A;  1T6O A;  1XB2 B;  1WHC A;  1OTR A;  2DZL A;  2OO9 A;  3K9O A;  2JZ1 A;  3GLH E;  3MMP A;  2RRU A;  1T43 A;  1V92 A;  2DAM A;  1OKS A;  2MJ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...