4DBGB

Crystal structure of hoil-1l-ubl complexed with a hoip-uba derivative
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
b'DKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RanBP-type and C3HC4-type zinc finger-containing protein 1
publication title A non-canonical UBA-UBL interaction forms the linear-ubiquitin-chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16678 HOIP-UBA HOIP UBA domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4dbgB02
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4dbgB03
2JY7A 2L2DA 2LVOC 2O25A 2OOAA 3FRHA 3K9PA 1IFYA 2LVPC 1SG9A 3GLFE 2EKKA 2JNHA 4G3OA 2CP8A 1R4GA 3LCUA 2DNAA 1ZMVA 2MROB 1G4AE 1ZV1A 2HAKA 3GLHE 5DFLA 2JZ0A 1NV9A 1UFZA 2G3QA 1WHCA 1DO0A 2JP7A 3FRIA 4Q7JA 1IXSA 1A5TA 1WGLA 4F1IA 2QHOB 2EJSA 2HWJA 3H4JA 2DAMA 1AIPC 1VEJA 1DO2A 1VEGA 2RRUA 4HEOA 1YLAA 3E46A 2DAEA 1WGNA 2LVQD 1T43A 2DAGA 1T6OA 2MJ5B 1EFUB 1HJPA 1V92A 2DHYA 2KNZA 2ZTDA 1C7YA 1HT1E 2JUJA 1Q02A 2EKFA 2MR9A 4WP2A 1ZMUA 2BWEA 3IHPA 1VDLA 1XXHE 2JY8A 2QSFX 3LCVB 5JI2E 2LVAA 2B3TA 2DI0A 3GLIE 1WR1B 3GLGE 2QNJA 4F2LA 1OTRA 1BVSA 4UN2B 2JY5A 2L4FA 1VG5A 1OKSA 3T6PA 1WJ7A 2LBCA 1P3QQ 1MN3A 4DBGB 2WZJA 1E94E 1G41A 2MGWA 4GEWA 2CWBA 2LVNC 3MMPA 2OOBA 1DV0A 2DAKA 3F92A 1OQYA 3E21A 2L4EA 2R0IA 4R71A 1NV8A 1Y8GA 1F4IA 1XB2B 2DZLA 1HQYE 2H5XA 2KNVA 3BBZA 2OO9A 1KYIA 2DENA 2KHHA 1JR3E 2DKLA 3K9OA 2KNAA 1G3IA 3FE3A 3IECA 2LTUA 1PGYA 1HT2E 2DAIA 1OAIA 1CUKA 1VQ1A 1TTEA 1TR8A 2K9DA 1ZMWA 2JZ1A 1VEKA 3B89A 2K0BX 1QZEA 2JY6B 1GO5A 2ZTCA 1IM2A 1WIVA 2BWBA
chains in the Genus database with same CATH superfamily
3H4MA 2JY7A 3RGPA 5ITUA 2O25A 2OOAA 3KXEC 4LF6M 3J7AS 5ITRA 2LVPC 1SG9A 3PNYA 2QENA 4G3OA 4AG5A 4LGMA 3SMPA 2DNAA 3TE6A 1ZMVA 4G6ZA 2A5YB 2CUZA 2MROB 4KO8A 4R3DA 1S3SA 3T1HM 1XNRM 4IBEA 2C9CA 2VQEM 1WHCA 4IIWA 4M9SA 4AW4A 1D0LA 4B3TM 4LFAM 2JP7A 5KQ8A 2ZM6M 1PJSA 3NBXX 2QHOB 4M0DA 3WHKA 1R2ZA 4GHLA 4JYAM 1XXHA 8CATA 4L78A 3GRUA 3AOGA 3MJ5A 5EXXA 4BBAA 1GABA 5E6JA 1DO2A 3KOWE 2Z7JA 3JAMS 4K0KM 2DWZB 1TDZA 2RRUA 1FJGM 1YLAA 3HHWA 3T15A 3GLIA 4A3VB 1Q39A 4B3MM 4NXMM 4AZFA 1G59A 3MHVC 5E26A 4D80A 1T6OA 3M0EA 4DV1M 1R6BX 5DYGA 1HJPA 3HJQA 3VDUA 4X65M 1QAMA 3M7GA 3AL0C 1IQPA 2FFJA 3KS4A 4HL4A 4PDIA 2NQ8C 2KRUA 4FCWA 5DNYA 4GITA 1NJGA 3C3EA 4XGIA 1N78A 1TH2A 3QWLA 1QDRA 1D0KA 1YSYA 1L1ZA 2UXDM 4RNAA 2FE8A 3IG5A 1LTMA 2KW0A 1KFVA 3KOYE 2DWMA 3I4VA 2WSFF 3SC3A 1OTRA 1BVSA 3UJNA 3SAVA 1DGHB 3ZC7B 1V34A 5KPTA 4BB9A 2WSEF 4R7GA 2XF3A 4MH0E 1J7KA 4I4LA 5EP2A 3SMSA 3SFZA 2R45A 2VQFM 1JB0F 2WZJA 2Y21A 2VF8A 1E94E 4LJ4A 1C1KA 1G41A 3SYKA 4AKHA 4CHTB 4II7A 2CWBA 2C5RA 1N32M 1Z5CA 1DV0A 4I81A 1XNQM 5BR8M 1OQYA 2I7NA 3FTEA 4P16A 4FCVA 1IY2A 2YR0A 3RGSA 1I94M 2O5RA 2CHQA 4MGIE 4IBCA 4DR2M 3LW5F 2XFTA 4NXNM 3SARA 2C99A 1HQYE 5DYIA 2BJWA 2KNVA 2KHHA 2DENA 4DR4M 4BLCA 2QBYB 4DR5M 1GL6A 2FNAA 2KNAA 3FTDA 4LF7M 4DR7M 3FE3A 4LFBM 4LZJA 3IECA 4AKIA 3RE8A 1L2CA 3FUWA 1IXZA 3FKEA 1YUBA 1PGYA 3WHLA 4EIWA 4REZA 3GRYA 4KLNA 1TTEA 1GJTA 1XMOM 3VKHA 1ZMWA 4QHTA 3AOEC 1IBLM 3QYEA 3BXWA 1G71A 3SYLA 4MGZE 2JY6B 5FTJA 1E9RA 2ZTCA 4P17A 1IBKM 1IM2A 2BWBA 3U6MA 3L2AA 2C9OA 2G8LA 2L2DA 2M5ZA 4IBGA 4D81A 2LVOC 3THGA 4CGYB 3U6CA 3R9XB 2YNMD 3K9PA 4LFCM 2R4JA 3SASA 4W5WA 1TF0B 3UZUA 2JNHA 4GKKM 2L09A 2MH8A 4WW0A 3GLFA 2CP8A 3L29A 2UUAM 3U60B 1ORYB 3JR5A 2UXBM 3AFHA 3GLHE 2D7EA 1OIPA 1NJFA 4NSRA 3KVWA 5IT9S 4RKUF 1DO0A 5EP1A 1PJJA 1NSFA 2LNHC 2QP9X 4Q7JA 4TUWA 4I8OA 1WGLA 3HGIA 4F1IA 3VK8A 2GNOA 2EJSA 1DGGA 2R44A 2F4VM 3D8LA 4ANRA 2DAMA 1NNUC 4L15A 4L8RC 3U6OA 1XHBA 3HWSA 3HJ8A 3GRRA 3GPXA 1VEJA 4G4NA 4IBIA 1HNWM 1VEGA 3J27B 4HEOA 2AHMA 2XLJA 2Z8YM 2D7GA 4FWGA 1EE8A 3GQ3A 4JI6M 4NRWA 2E5LM 1T43A 3ZQJA 1Z59A 2M60A 2C98A 2XSZD 3VLFB 5KQDA 2MJ5B 4L4UA 1OFIA 2KEBA 5FTKA 3GLHB 2ZTDA 4LZZA 2JUJA 1Q02A 2YFQA 4XK8F 4CIZA 2MR9A 4LF9M 4I5SA 3TWKA 2DWLA 3ILKA 4WP2A 1YE9A 2L6OA 3IHPA 3SAUA 3FUUA 5C1BA 3DA1A 2JY8A 5FTMA 5IZ7D 3LQQA 1WXQA 3GPPA 4JI7M 5JI2E 2Z3XA 1W5SA 1GLNA 4GHAA 4LJ8A 2QNJA 4IJEA 3HZJA 2KZSA 5KO3A 4LJ6A 3KOXE 4AQYM 3E9SA 3GQ5A 2R18A 2YQZA 3HY5A 3KDSE 4G4RA 4MGKE 4M9XA 4NRVA 4DBGB 3U6QA 1G8PA 1Z5AA 1SXJA 3B9PA 5FTLA 1KSFX 4FWHA 4MGHA 5FTNA 2N35A 1IXSB 1QYRA 2Z4RA 4JN6A 2LVNC 3MMPA 5EJCA 3AV0A 3J7BA 4MB7A 4DV3M 3TL4X 2X4AA 1GJSA 3PVSA 3JR4A 5ITXA 2QPAA 2XEPA 3E4RA 1SXJC 4GKJM 3HHZA 4R71A 4B3SM 4LJ9A 1XB2B 2X49A 3HU3A 3Q8GA 4Z6YA 4DV4M 3KS8A 1XC8A 3B7NA 1KYIA 1W5TA 2DKLA 2UXCM 1PM5A 1G3IA 4DV0M 3R8FA 3VDPA 4OVZB 1JR3A 2DZOB 3W67A 5A2QS 4DUZM 4DV7M 3I51A 2J7OA 2L7IA 2DAIA 3EIHA 4QHSA 3TWLA 3GP1A 4JI8M 3LMMA 1PJIA 1TR8A 3I4YA 3FTFA 2K9DA 2FS1A 2F5SA 4B7HA 1UM8A 1VDDA 2Y0TA 4LF4M 3CF2A 1I4WA 3U5ZA 1WIVA 4JV5M 3GQ4A 3M6AA 3DZDA 1IN4A 2CEAA 1R2YA 1IFYA 3U6EA 3T38A 2APLA 3GLFE 4LY6A 4JI1M 2UU9M 1TH4A 3K2LA 4GIPA 1L8QA 1QDTA 3LCUA 4D82A 2VIIA 3AOEA 1OAOC 4GRIA 2HAKA 3UGJA 3EIEA 4XBOA 2Q2EB 5DFLA 2V6ZM 2J7NA 4S12A 5F3WA 3GPYA 2XZFA 3SATA 1A5TA 4QNRA 4RF0A 1N75A 3J2PB 3NBIA 5IREB 2OQ4A 3H4JA 3ZCBB 3K92A 2EA0A 2F5OA 4JI4M 3ZH9B 2R62A 4PD2A 1XMQM 4G4QA 2K47A 5EXSA 2HKJA 3B7ZA 1T3TA 2V1UA 5JI3E 4OX9M 4FD2A 4LJ7A 3E46A 4IBJA 2DAEA 3T1YM 1WGNA 2QBYA 2DAGA 4FWDA 1R5LA 1EIJA 1IN8A 3HJSA 4B7FA 3U6PA 2R6FA 4KODA 1C7YA 3FD9A 2EKFA 3K8ZA 3U61B 3L28A 2FOIC 2RKOA 3DFZA 4JI3M 3W0FA 5IWAM 4YHHM 1HR0M 1XXHE 1L2DA 2HHHM 1N34M 3TWMA 4L16A 3LCVB 3AJIB 2LVAA 3PNVA 3L27A 2ZANA 2B3TA 7CATA 3CGWA 3GLIE 4LJAA 3RFWA 2LH0A 2VDBB 4KHPM 4UN2B 3SAWA 2H1RA 3HHXA 4NOOB 3GLGA 2JY5A 2L4FA 2L7HA 1VG5A 3HU1A 5BPVA 4B7GA 4RF1A 2F5QA 3T6PA 1HQCA 1WJ7A 2D7HA 2LBCA 3U60A 1P3QQ 1SXJE 2OPFA 1MN3A 4OW0A 1Q3BA 4M0WA 2RGOA 3HX3A 5EP4A 1Z6TA 3U6DA 5FSWA 2UUBM 4GH9A 3U6SA 2MGWA 2V1CA 3LQRA 3C9PA 1GL7A 1HNXM 1MX0A 2DAKA 4JI5M 2XH9A 1OIZA 4MGYE 4GC5A 5C18A 5ITXE 2BJVA 4LRSA 1XXHB 2JWSA 2L4EA 2G5GX 3GO8A 1E32A 1GVNA 2R0IA 2R4EA 4GMQA 4LF8M 1Q3CA 1TH3A 2JXNA 2W82A 5ITYA 1NV8A 3L25A 2ZAOA 2H5XA 2EO2A 3HKPA 4B3RM 3BBZA 3GLIB 4LJ5A 1IN5A 5GKNA 3SBJA 2CRUA 4X66M 5ITTA 1JR3E 1ZQ9A 2R46A 2KDLA 3J80S 5EXPA 3J81S 4FCTA 1D0MA 1SXJB 2LTUA 2Y20A 4X62M 1HT2E 2X8AA 3GLHA 3FTCA 1CUKA 3HU2A 4CISA 4AG6A 4QNMA 4IJFA 4Y28F 1K3XA 3CF0A 1IN7A 3SHGB 4YY3M 3A46A 1VEKA 2P5TA 1NY5A 2DWNA 2HL7A 3FUVA 2DZNB 3FUTA 1IN6A 1DGBA 4JI2M 1IXRC 5EQTA 3FYCA 2KRKA 3TPZA 4AKGA 1AUAA 1DGFA 3FRHA 2F5PA 2KZUA 3GRVA 5LMNM 1K3WA 3V76A 2HCBA 3QAUA 4LRTA 5EXTA 2EKKA 4LGYA 4LF5M 5KPZA 2CFOA 1R4GA 1PJQA 5KPRA 3OTOM 3A42A 3DOAA 1X37A 2ZAMA 1IY1A 1G4AE 1ZV1A 4FVMA 4QOSA 3TQSA 2CV2A 1TGUA 2JZ0A 1NV9A 1UFZA 1MU5A 2G3QA 3FUXA 2QZ4A 3UMMA 1E9SA 1GKIA 3FRIA 2F5NA 1IXSA 1QZMA 3KSXA 5LMUM 1QAQA 1XWIA 3U5ZB 2HWJA 2QQ8A 3KSJA 1ZAEA 3MK6A 5L8RF 4JI0M 1SXJD 1AIPC 2FH0A 2LWXA 4WURA 3KFUG 2UUCM 4QOZC 1HNZM 2XGNA 1R7RA 2LHCA 3C3DA 4LCBA 2O01F 2WSCF 4IBFA 2JA2A 2K6BA 3QYBA 3I01M 3W68A 1LV7A 1NO1A 1QUSA 2LVQD 4DR3M 2CV1A 4OU7A 1IY0A 2Z4SA 3CF6E 2DXIA 4G4OA 1DGHA 3PXGA 2LXEA 4OVZA 5EP3A 1EFUB 3IG8A 3AKZA 3U6LA 1V92A 2DHYA 2Y0QA 3GPUA 1NHWC 2KNZA 1HT1E 3CTWB 3B74A 4AI6A 1QUTA 4ZPXA 4IBDA 1JR3D 5ITQA 1V33A 3C58A 1PRBA 1NNJA 1ZMUA 2BWEA 3LVWA 1VDLA 3BOSA 4FW9A 3LVVA 1L1TA 2QSFX 1NY6A 3L26A 1J5EM 2GQFA 2RGHA 4NSOB 4DV2M 2DI0A 4CJ6A 3KP1E 1PJTA 1WR1B 3GLGE 4F2LA 3VK7A 4LG2A 3I04M 3PFIA 2DVWB 2I7PA 3D8BA 3GLFB 3VKGA 4PCZA 2J5YA 1OKSA 4GC9A 1QAOA 2KA6B 4IBKA 1MJGM 2LHGA 4DR1M 1Z5BA 3SHFA 4PDGA 1N77A 4NL4H 4HLQA 5H37D 2XZUA 3Q8XA 4ITQA 2ZBKB 4GEWA 1D2NA 4B08A 1RU3A 1QVRA 1NVMA 1FNNA 2OOBA 3F92A 2CE7A 1JQJC 3FYDA 1L2BA 3B7QA 2DHRA 3KW6A 1OFHA 4Z8XA 3UK6A 2KXEA 3VFDA 1TDHA 4X64M 4KT0F 1Y8GA 2XSZA 4MM3B 1OJLA 2DZLA 1H6UA 1F4IA 3A98B 2OO9A 4PT5A 3KOZE 3GLGB 1IBMM 1QQWA 4DR6M 4JXJA 3K9OA 4DUYM 4IBBA 4NC6A 2ERCA 2BNKA 3W0LB 2CHGA 2CV0A 2QCUA 2VF7A 1QANA 1N33M 4DV6M 2R65A 2C96A 1K82A 4M9ZA 1OAIA 1VQ1A 3KP0E 1N36M 3U61A 2JZ1A 4L6V6 1J09A 2CHVA 3B89A 3K1JA 2K0BX 3HHYA 1QZEA 2EUCA 5FLXS 1NHGC 3NWLA 1GO5A 2XFSA 3A45A 3E21A 4DV5M
chains in the Genus database with same CATH topology
2JY7A 2L2DA 2LVOC 2O25A 2OOAA 3FRHA 3K9PA 1IFYA 2LVPC 1SG9A 3GLFE 2EKKA 2JNHA 4G3OA 2CP8A 1R4GA 3LCUA 2DNAA 1ZMVA 2MROB 1G4AE 1ZV1A 2HAKA 3GLHE 5DFLA 2JZ0A 1NV9A 1UFZA 2G3QA 1WHCA 1DO0A 2JP7A 3FRIA 4Q7JA 1IXSA 1A5TA 1WGLA 4F1IA 2QHOB 2EJSA 2HWJA 3H4JA 2DAMA 1AIPC 1VEJA 1DO2A 1VEGA 2RRUA 4HEOA 1YLAA 3E46A 2DAEA 1WGNA 2LVQD 1T43A 2DAGA 1T6OA 2MJ5B 1EFUB 1HJPA 1V92A 2DHYA 2KNZA 2ZTDA 1C7YA 1HT1E 2JUJA 1Q02A 2EKFA 2MR9A 4WP2A 1ZMUA 2BWEA 3IHPA 1VDLA 1XXHE 2JY8A 2QSFX 3LCVB 5JI2E 2LVAA 2B3TA 2DI0A 3GLIE 1WR1B 3GLGE 2QNJA 4F2LA 1OTRA 1BVSA 4UN2B 2JY5A 2L4FA 1VG5A 1OKSA 3T6PA 1WJ7A 2LBCA 1P3QQ 1MN3A 4DBGB 2WZJA 1E94E 1G41A 2MGWA 4GEWA 2CWBA 2LVNC 3MMPA 2OOBA 1DV0A 2DAKA 3F92A 1OQYA 3E21A 2L4EA 2R0IA 4R71A 1NV8A 1Y8GA 1F4IA 1XB2B 2DZLA 1HQYE 2H5XA 2KNVA 3BBZA 2OO9A 1KYIA 2DENA 2KHHA 1JR3E 2DKLA 3K9OA 2KNAA 1G3IA 3FE3A 3IECA 2LTUA 1PGYA 1HT2E 2DAIA 1OAIA 1CUKA 1VQ1A 1TTEA 1TR8A 2K9DA 1ZMWA 2JZ1A 1VEKA 3B89A 2K0BX 1QZEA 2JY6B 1GO5A 2ZTCA 1IM2A 1WIVA 2BWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY7 A;  2L2D A;  2LVO C;  2O25 A;  2OOA A;  3FRH A;  3K9P A;  1IFY A;  2LVP C;  1SG9 A;  3GLF E;  2EKK A;  2JNH A;  4G3O A;  2CP8 A;  1R4G A;  3LCU A;  2DNA A;  1ZMV A;  2MRO B;  1G4A E;  1ZV1 A;  2HAK A;  3GLH E;  5DFL A;  2JZ0 A;  1NV9 A;  1UFZ A;  2G3Q A;  1WHC A;  1DO0 A;  2JP7 A;  3FRI A;  4Q7J A;  1IXS A;  1A5T A;  1WGL A;  4F1I A;  2QHO B;  2EJS A;  2HWJ A;  3H4J A;  2DAM A;  1AIP C;  1VEJ A;  1DO2 A;  1VEG A;  2RRU A;  4HEO A;  1YLA A;  3E46 A;  2DAE A;  1WGN A;  2LVQ D;  1T43 A;  2DAG A;  1T6O A;  2MJ5 B;  1EFU B;  1HJP A;  1V92 A;  2DHY A;  2KNZ A;  2ZTD A;  1C7Y A;  1HT1 E;  2JUJ A;  1Q02 A;  2EKF A;  2MR9 A;  4WP2 A;  1ZMU A;  2BWE A;  3IHP A;  1VDL A;  1XXH E;  2JY8 A;  2QSF X;  3LCV B;  5JI2 E;  2LVA A;  2B3T A;  2DI0 A;  3GLI E;  1WR1 B;  3GLG E;  2QNJ A;  4F2L A;  1OTR A;  1BVS A;  4UN2 B;  2JY5 A;  2L4F A;  1VG5 A;  1OKS A;  3T6P A;  1WJ7 A;  2LBC A;  1P3Q Q;  1MN3 A;  4DBG B;  2WZJ A;  1E94 E;  1G41 A;  2MGW A;  4GEW A;  2CWB A;  2LVN C;  3MMP A;  2OOB A;  1DV0 A;  2DAK A;  3F92 A;  1OQY A;  3E21 A;  2L4E A;  2R0I A;  4R71 A;  1NV8 A;  1Y8G A;  1F4I A;  1XB2 B;  2DZL A;  1HQY E;  2H5X A;  2KNV A;  3BBZ A;  2OO9 A;  1KYI A;  2DEN A;  2KHH A;  1JR3 E;  2DKL A;  3K9O A;  2KNA A;  1G3I A;  3FE3 A;  3IEC A;  2LTU A;  1PGY A;  1HT2 E;  2DAI A;  1OAI A;  1CUK A;  1VQ1 A;  1TTE A;  1TR8 A;  2K9D A;  1ZMW A;  2JZ1 A;  1VEK A;  3B89 A;  2K0B X;  1QZE A;  2JY6 B;  1GO5 A;  2ZTC A;  1IM2 A;  1WIV A;  2BWB A; 
#chains in the Genus database with same CATH topology
 3H4M A;  2JY7 A;  3RGP A;  5ITU A;  2O25 A;  2OOA A;  3KXE C;  4LF6 M;  3J7A S;  5ITR A;  2LVP C;  1SG9 A;  3PNY A;  2QEN A;  4G3O A;  4AG5 A;  4LGM A;  3SMP A;  2DNA A;  3TE6 A;  1ZMV A;  4G6Z A;  2A5Y B;  2CUZ A;  2MRO B;  4KO8 A;  4R3D A;  1S3S A;  3T1H M;  1XNR M;  4IBE A;  2C9C A;  2VQE M;  1WHC A;  4IIW A;  4M9S A;  4AW4 A;  1D0L A;  4B3T M;  4LFA M;  2JP7 A;  5KQ8 A;  2ZM6 M;  1PJS A;  3NBX X;  2QHO B;  4M0D A;  3WHK A;  1R2Z A;  4GHL A;  4JYA M;  1XXH A;  8CAT A;  4L78 A;  3GRU A;  3AOG A;  3MJ5 A;  5EXX A;  4BBA A;  1GAB A;  5E6J A;  1DO2 A;  3KOW E;  2Z7J A;  3JAM S;  4K0K M;  2DWZ B;  1TDZ A;  2RRU A;  1FJG M;  1YLA A;  3HHW A;  3T15 A;  3GLI A;  4A3V B;  1Q39 A;  4B3M M;  4NXM M;  4AZF A;  1G59 A;  3MHV C;  5E26 A;  4D80 A;  1T6O A;  3M0E A;  4DV1 M;  1R6B X;  5DYG A;  1HJP A;  3HJQ A;  3VDU A;  4X65 M;  1QAM A;  3M7G A;  3AL0 C;  1IQP A;  2FFJ A;  3KS4 A;  4HL4 A;  4PDI A;  2NQ8 C;  2KRU A;  4FCW A;  5DNY A;  4GIT A;  1NJG A;  3C3E A;  4XGI A;  1N78 A;  1TH2 A;  3QWL A;  1QDR A;  1D0K A;  1YSY A;  1L1Z A;  2UXD M;  4RNA A;  2FE8 A;  3IG5 A;  1LTM A;  2KW0 A;  1KFV A;  3KOY E;  2DWM A;  3I4V A;  2WSF F;  3SC3 A;  1OTR A;  1BVS A;  3UJN A;  3SAV A;  1DGH B;  3ZC7 B;  1V34 A;  5KPT A;  4BB9 A;  2WSE F;  4R7G A;  2XF3 A;  4MH0 E;  1J7K A;  4I4L A;  5EP2 A;  3SMS A;  3SFZ A;  2R45 A;  2VQF M;  1JB0 F;  2WZJ A;  2Y21 A;  2VF8 A;  1E94 E;  4LJ4 A;  1C1K A;  1G41 A;  3SYK A;  4AKH A;  4CHT B;  4II7 A;  2CWB A;  2C5R A;  1N32 M;  1Z5C A;  1DV0 A;  4I81 A;  1XNQ M;  5BR8 M;  1OQY A;  2I7N A;  3FTE A;  4P16 A;  4FCV A;  1IY2 A;  2YR0 A;  3RGS A;  1I94 M;  2O5R A;  2CHQ A;  4MGI E;  4IBC A;  4DR2 M;  3LW5 F;  2XFT A;  4NXN M;  3SAR A;  2C99 A;  1HQY E;  5DYI A;  2BJW A;  2KNV A;  2KHH A;  2DEN A;  4DR4 M;  4BLC A;  2QBY B;  4DR5 M;  1GL6 A;  2FNA A;  2KNA A;  3FTD A;  4LF7 M;  4DR7 M;  3FE3 A;  4LFB M;  4LZJ A;  3IEC A;  4AKI A;  3RE8 A;  1L2C A;  3FUW A;  1IXZ A;  3FKE A;  1YUB A;  1PGY A;  3WHL A;  4EIW A;  4REZ A;  3GRY A;  4KLN A;  1TTE A;  1GJT A;  1XMO M;  3VKH A;  1ZMW A;  4QHT A;  3AOE C;  1IBL M;  3QYE A;  3BXW A;  1G71 A;  3SYL A;  4MGZ E;  2JY6 B;  5FTJ A;  1E9R A;  2ZTC A;  4P17 A;  1IBK M;  1IM2 A;  2BWB A;  3U6M A;  3L2A A;  2C9O A;  2G8L A;  2L2D A;  2M5Z A;  4IBG A;  4D81 A;  2LVO C;  3THG A;  4CGY B;  3U6C A;  3R9X B;  2YNM D;  3K9P A;  4LFC M;  2R4J A;  3SAS A;  4W5W A;  1TF0 B;  3UZU A;  2JNH A;  4GKK M;  2L09 A;  2MH8 A;  4WW0 A;  3GLF A;  2CP8 A;  3L29 A;  2UUA M;  3U60 B;  1ORY B;  3JR5 A;  2UXB M;  3AFH A;  3GLH E;  2D7E A;  1OIP A;  1NJF A;  4NSR A;  3KVW A;  5IT9 S;  4RKU F;  1DO0 A;  5EP1 A;  1PJJ A;  1NSF A;  2LNH C;  2QP9 X;  4Q7J A;  4TUW A;  4I8O A;  1WGL A;  3HGI A;  4F1I A;  3VK8 A;  2GNO A;  2EJS A;  1DGG A;  2R44 A;  2F4V M;  3D8L A;  4ANR A;  2DAM A;  1NNU C;  4L15 A;  4L8R C;  3U6O A;  1XHB A;  3HWS A;  3HJ8 A;  3GRR A;  3GPX A;  1VEJ A;  4G4N A;  4IBI A;  1HNW M;  1VEG A;  3J27 B;  4HEO A;  2AHM A;  2XLJ A;  2Z8Y M;  2D7G A;  4FWG A;  1EE8 A;  3GQ3 A;  4JI6 M;  4NRW A;  2E5L M;  1T43 A;  3ZQJ A;  1Z59 A;  2M60 A;  2C98 A;  2XSZ D;  3VLF B;  5KQD A;  2MJ5 B;  4L4U A;  1OFI A;  2KEB A;  5FTK A;  3GLH B;  2ZTD A;  4LZZ A;  2JUJ A;  1Q02 A;  2YFQ A;  4XK8 F;  4CIZ A;  2MR9 A;  4LF9 M;  4I5S A;  3TWK A;  2DWL A;  3ILK A;  4WP2 A;  1YE9 A;  2L6O A;  3IHP A;  3SAU A;  3FUU A;  5C1B A;  3DA1 A;  2JY8 A;  5FTM A;  5IZ7 D;  3LQQ A;  1WXQ A;  3GPP A;  4JI7 M;  5JI2 E;  2Z3X A;  1W5S A;  1GLN A;  4GHA A;  4LJ8 A;  2QNJ A;  4IJE A;  3HZJ A;  2KZS A;  5KO3 A;  4LJ6 A;  3KOX E;  4AQY M;  3E9S A;  3GQ5 A;  2R18 A;  2YQZ A;  3HY5 A;  3KDS E;  4G4R A;  4MGK E;  4M9X A;  4NRV A;  4DBG B;  3U6Q A;  1G8P A;  1Z5A A;  1SXJ A;  3B9P A;  5FTL A;  1KSF X;  4FWH A;  4MGH A;  5FTN A;  2N35 A;  1IXS B;  1QYR A;  2Z4R A;  4JN6 A;  2LVN C;  3MMP A;  5EJC A;  3AV0 A;  3J7B A;  4MB7 A;  4DV3 M;  3TL4 X;  2X4A A;  1GJS A;  3PVS A;  3JR4 A;  5ITX A;  2QPA A;  2XEP A;  3E4R A;  1SXJ C;  4GKJ M;  3HHZ A;  4R71 A;  4B3S M;  4LJ9 A;  1XB2 B;  2X49 A;  3HU3 A;  3Q8G A;  4Z6Y A;  4DV4 M;  3KS8 A;  1XC8 A;  3B7N A;  1KYI A;  1W5T A;  2DKL A;  2UXC M;  1PM5 A;  1G3I A;  4DV0 M;  3R8F A;  3VDP A;  4OVZ B;  1JR3 A;  2DZO B;  3W67 A;  5A2Q S;  4DUZ M;  4DV7 M;  3I51 A;  2J7O A;  2L7I A;  2DAI A;  3EIH A;  4QHS A;  3TWL A;  3GP1 A;  4JI8 M;  3LMM A;  1PJI A;  1TR8 A;  3I4Y A;  3FTF A;  2K9D A;  2FS1 A;  2F5S A;  4B7H A;  1UM8 A;  1VDD A;  2Y0T A;  4LF4 M;  3CF2 A;  1I4W A;  3U5Z A;  1WIV A;  4JV5 M;  3GQ4 A;  3M6A A;  3DZD A;  1IN4 A;  2CEA A;  1R2Y A;  1IFY A;  3U6E A;  3T38 A;  2APL A;  3GLF E;  4LY6 A;  4JI1 M;  2UU9 M;  1TH4 A;  3K2L A;  4GIP A;  1L8Q A;  1QDT A;  3LCU A;  4D82 A;  2VII A;  3AOE A;  1OAO C;  4GRI A;  2HAK A;  3UGJ A;  3EIE A;  4XBO A;  2Q2E B;  5DFL A;  2V6Z M;  2J7N A;  4S12 A;  5F3W A;  3GPY A;  2XZF A;  3SAT A;  1A5T A;  4QNR A;  4RF0 A;  1N75 A;  3J2P B;  3NBI A;  5IRE B;  2OQ4 A;  3H4J A;  3ZCB B;  3K92 A;  2EA0 A;  2F5O A;  4JI4 M;  3ZH9 B;  2R62 A;  4PD2 A;  1XMQ M;  4G4Q A;  2K47 A;  5EXS A;  2HKJ A;  3B7Z A;  1T3T A;  2V1U A;  5JI3 E;  4OX9 M;  4FD2 A;  4LJ7 A;  3E46 A;  4IBJ A;  2DAE A;  3T1Y M;  1WGN A;  2QBY A;  2DAG A;  4FWD A;  1R5L A;  1EIJ A;  1IN8 A;  3HJS A;  4B7F A;  3U6P A;  2R6F A;  4KOD A;  1C7Y A;  3FD9 A;  2EKF A;  3K8Z A;  3U61 B;  3L28 A;  2FOI C;  2RKO A;  3DFZ A;  4JI3 M;  3W0F A;  5IWA M;  4YHH M;  1HR0 M;  1XXH E;  1L2D A;  2HHH M;  1N34 M;  3TWM A;  4L16 A;  3LCV B;  3AJI B;  2LVA A;  3PNV A;  3L27 A;  2ZAN A;  2B3T A;  7CAT A;  3CGW A;  3GLI E;  4LJA A;  3RFW A;  2LH0 A;  2VDB B;  4KHP M;  4UN2 B;  3SAW A;  2H1R A;  3HHX A;  4NOO B;  3GLG A;  2JY5 A;  2L4F A;  2L7H A;  1VG5 A;  3HU1 A;  5BPV A;  4B7G A;  4RF1 A;  2F5Q A;  3T6P A;  1HQC A;  1WJ7 A;  2D7H A;  2LBC A;  3U60 A;  1P3Q Q;  1SXJ E;  2OPF A;  1MN3 A;  4OW0 A;  1Q3B A;  4M0W A;  2RGO A;  3HX3 A;  5EP4 A;  1Z6T A;  3U6D A;  5FSW A;  2UUB M;  4GH9 A;  3U6S A;  2MGW A;  2V1C A;  3LQR A;  3C9P A;  1GL7 A;  1HNX M;  1MX0 A;  2DAK A;  4JI5 M;  2XH9 A;  1OIZ A;  4MGY E;  4GC5 A;  5C18 A;  5ITX E;  2BJV A;  4LRS A;  1XXH B;  2JWS A;  2L4E A;  2G5G X;  3GO8 A;  1E32 A;  1GVN A;  2R0I A;  2R4E A;  4GMQ A;  4LF8 M;  1Q3C A;  1TH3 A;  2JXN A;  2W82 A;  5ITY A;  1NV8 A;  3L25 A;  2ZAO A;  2H5X A;  2EO2 A;  3HKP A;  4B3R M;  3BBZ A;  3GLI B;  4LJ5 A;  1IN5 A;  5GKN A;  3SBJ A;  2CRU A;  4X66 M;  5ITT A;  1JR3 E;  1ZQ9 A;  2R46 A;  2KDL A;  3J80 S;  5EXP A;  3J81 S;  4FCT A;  1D0M A;  1SXJ B;  2LTU A;  2Y20 A;  4X62 M;  1HT2 E;  2X8A A;  3GLH A;  3FTC A;  1CUK A;  3HU2 A;  4CIS A;  4AG6 A;  4QNM A;  4IJF A;  4Y28 F;  1K3X A;  3CF0 A;  1IN7 A;  3SHG B;  4YY3 M;  3A46 A;  1VEK A;  2P5T A;  1NY5 A;  2DWN A;  2HL7 A;  3FUV A;  2DZN B;  3FUT A;  1IN6 A;  1DGB A;  4JI2 M;  1IXR C;  5EQT A;  3FYC A;  2KRK A;  3TPZ A;  4AKG A;  1AUA A;  1DGF A;  3FRH A;  2F5P A;  2KZU A;  3GRV A;  5LMN M;  1K3W A;  3V76 A;  2HCB A;  3QAU A;  4LRT A;  5EXT A;  2EKK A;  4LGY A;  4LF5 M;  5KPZ A;  2CFO A;  1R4G A;  1PJQ A;  5KPR A;  3OTO M;  3A42 A;  3DOA A;  1X37 A;  2ZAM A;  1IY1 A;  1G4A E;  1ZV1 A;  4FVM A;  4QOS A;  3TQS A;  2CV2 A;  1TGU A;  2JZ0 A;  1NV9 A;  1UFZ A;  1MU5 A;  2G3Q A;  3FUX A;  2QZ4 A;  3UMM A;  1E9S A;  1GKI A;  3FRI A;  2F5N A;  1IXS A;  1QZM A;  3KSX A;  5LMU M;  1QAQ A;  1XWI A;  3U5Z B;  2HWJ A;  2QQ8 A;  3KSJ A;  1ZAE A;  3MK6 A;  5L8R F;  4JI0 M;  1SXJ D;  1AIP C;  2FH0 A;  2LWX A;  4WUR A;  3KFU G;  2UUC M;  4QOZ C;  1HNZ M;  2XGN A;  1R7R A;  2LHC A;  3C3D A;  4LCB A;  2O01 F;  2WSC F;  4IBF A;  2JA2 A;  2K6B A;  3QYB A;  3I01 M;  3W68 A;  1LV7 A;  1NO1 A;  1QUS A;  2LVQ D;  4DR3 M;  2CV1 A;  4OU7 A;  1IY0 A;  2Z4S A;  3CF6 E;  2DXI A;  4G4O A;  1DGH A;  3PXG A;  2LXE A;  4OVZ A;  5EP3 A;  1EFU B;  3IG8 A;  3AKZ A;  3U6L A;  1V92 A;  2DHY A;  2Y0Q A;  3GPU A;  1NHW C;  2KNZ A;  1HT1 E;  3CTW B;  3B74 A;  4AI6 A;  1QUT A;  4ZPX A;  4IBD A;  1JR3 D;  5ITQ A;  1V33 A;  3C58 A;  1PRB A;  1NNJ A;  1ZMU A;  2BWE A;  3LVW A;  1VDL A;  3BOS A;  4FW9 A;  3LVV A;  1L1T A;  2QSF X;  1NY6 A;  3L26 A;  1J5E M;  2GQF A;  2RGH A;  4NSO B;  4DV2 M;  2DI0 A;  4CJ6 A;  3KP1 E;  1PJT A;  1WR1 B;  3GLG E;  4F2L A;  3VK7 A;  4LG2 A;  3I04 M;  3PFI A;  2DVW B;  2I7P A;  3D8B A;  3GLF B;  3VKG A;  4PCZ A;  2J5Y A;  1OKS A;  4GC9 A;  1QAO A;  2KA6 B;  4IBK A;  1MJG M;  2LHG A;  4DR1 M;  1Z5B A;  3SHF A;  4PDG A;  1N77 A;  4NL4 H;  4HLQ A;  5H37 D;  2XZU A;  3Q8X A;  4ITQ A;  2ZBK B;  4GEW A;  1D2N A;  4B08 A;  1RU3 A;  1QVR A;  1NVM A;  1FNN A;  2OOB A;  3F92 A;  2CE7 A;  1JQJ C;  3FYD A;  1L2B A;  3B7Q A;  2DHR A;  3KW6 A;  1OFH A;  4Z8X A;  3UK6 A;  2KXE A;  3VFD A;  1TDH A;  4X64 M;  4KT0 F;  1Y8G A;  2XSZ A;  4MM3 B;  1OJL A;  2DZL A;  1H6U A;  1F4I A;  3A98 B;  2OO9 A;  4PT5 A;  3KOZ E;  3GLG B;  1IBM M;  1QQW A;  4DR6 M;  4JXJ A;  3K9O A;  4DUY M;  4IBB A;  4NC6 A;  2ERC A;  2BNK A;  3W0L B;  2CHG A;  2CV0 A;  2QCU A;  2VF7 A;  1QAN A;  1N33 M;  4DV6 M;  2R65 A;  2C96 A;  1K82 A;  4M9Z A;  1OAI A;  1VQ1 A;  3KP0 E;  1N36 M;  3U61 A;  2JZ1 A;  4L6V 6;  1J09 A;  2CHV A;  3B89 A;  3K1J A;  2K0B X;  3HHY A;  1QZE A;  2EUC A;  5FLX S;  1NHG C;  3NWL A;  1GO5 A;  2XFS A;  3A45 A;  3E21 A;  4DV5 M; 
#chains in the Genus database with same CATH homology
 2JY7 A;  2L2D A;  2LVO C;  2O25 A;  2OOA A;  3FRH A;  3K9P A;  1IFY A;  2LVP C;  1SG9 A;  3GLF E;  2EKK A;  2JNH A;  4G3O A;  2CP8 A;  1R4G A;  3LCU A;  2DNA A;  1ZMV A;  2MRO B;  1G4A E;  1ZV1 A;  2HAK A;  3GLH E;  5DFL A;  2JZ0 A;  1NV9 A;  1UFZ A;  2G3Q A;  1WHC A;  1DO0 A;  2JP7 A;  3FRI A;  4Q7J A;  1IXS A;  1A5T A;  1WGL A;  4F1I A;  2QHO B;  2EJS A;  2HWJ A;  3H4J A;  2DAM A;  1AIP C;  1VEJ A;  1DO2 A;  1VEG A;  2RRU A;  4HEO A;  1YLA A;  3E46 A;  2DAE A;  1WGN A;  2LVQ D;  1T43 A;  2DAG A;  1T6O A;  2MJ5 B;  1EFU B;  1HJP A;  1V92 A;  2DHY A;  2KNZ A;  2ZTD A;  1C7Y A;  1HT1 E;  2JUJ A;  1Q02 A;  2EKF A;  2MR9 A;  4WP2 A;  1ZMU A;  2BWE A;  3IHP A;  1VDL A;  1XXH E;  2JY8 A;  2QSF X;  3LCV B;  5JI2 E;  2LVA A;  2B3T A;  2DI0 A;  3GLI E;  1WR1 B;  3GLG E;  2QNJ A;  4F2L A;  1OTR A;  1BVS A;  4UN2 B;  2JY5 A;  2L4F A;  1VG5 A;  1OKS A;  3T6P A;  1WJ7 A;  2LBC A;  1P3Q Q;  1MN3 A;  4DBG B;  2WZJ A;  1E94 E;  1G41 A;  2MGW A;  4GEW A;  2CWB A;  2LVN C;  3MMP A;  2OOB A;  1DV0 A;  2DAK A;  3F92 A;  1OQY A;  3E21 A;  2L4E A;  2R0I A;  4R71 A;  1NV8 A;  1Y8G A;  1F4I A;  1XB2 B;  2DZL A;  1HQY E;  2H5X A;  2KNV A;  3BBZ A;  2OO9 A;  1KYI A;  2DEN A;  2KHH A;  1JR3 E;  2DKL A;  3K9O A;  2KNA A;  1G3I A;  3FE3 A;  3IEC A;  2LTU A;  1PGY A;  1HT2 E;  2DAI A;  1OAI A;  1CUK A;  1VQ1 A;  1TTE A;  1TR8 A;  2K9D A;  1ZMW A;  2JZ1 A;  1VEK A;  3B89 A;  2K0B X;  1QZE A;  2JY6 B;  1GO5 A;  2ZTC A;  1IM2 A;  1WIV A;  2BWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...