4DBGB

Crystal structure of hoil-1l-ubl complexed with a hoip-uba derivative
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
DKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RanBP-type and C3HC4-type zinc finger-containing protein 1
publication title A non-canonical UBA-UBL interaction forms the linear-ubiquitin-chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16678 HOIP-UBA HOIP UBA domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4dbgB02
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4dbgB03
2JZ0A 1T43A 2KNVA 2WZJA 1WR1B 3FE3A 2JZ1A 2JP7A 2K0BX 1XXHE 2DENA 2JY7A 4F2LA 1V92A 2HWJA 1AIPC 2KNAA 2JY6B 2LVOC 3FRIA 1OQYA 1IXSA 1TR8A 2DAGA 1R4GA 2DNAA 3IHPA 2RRUA 2EKKA 5DFLA 3GLIE 1GO5A 2B3TA 2DHYA 2KHHA 3MMPA 3GLHE 2LTUA 1VEGA 2ZTCA 3LCUA 2MJ5B 3BBZA 1WHCA 3LCVB 1SG9A 1DV0A 1A5TA 1HJPA 1NV9A 1ZMWA 2JUJA 1CUKA 2H5XA 2JNHA 2OOAA 2OOBA 1WJ7A 1VEKA 3F92A 1G3IA 4WP2A 1OAIA 1ZV1A 1TTEA 2LBCA 1UFZA 4DBGB 1OTRA 2QSFX 2JY5A 1C7YA 1XB2B 1VG5A 2MR9A 1G4AE 2DAMA 2BWEA 2G3QA 2EKFA 2L4EA 2MGWA 3K9PA 2OO9A 2MROB 1HT1E 3GLFE 1BVSA 1KYIA 3FRHA 1WGLA 1Y8GA 1PGYA 2CP8A 2KNZA 3GLGE 2DKLA 1G41A 2LVAA 1VQ1A 2QHOB 1IFYA 2DAKA 3E46A 2K9DA 1HT2E 1VEJA 4R71A 1YLAA 2L4FA 4G3OA 1DO0A 2LVNC 1ZMVA 2QNJA 3T6PA 1Q02A 1VDLA 2DI0A 3K9OA 4UN2B 2DZLA 1P3QQ 2DAIA 2DAEA 2R0IA 2EJSA 1MN3A 1ZMUA 1JR3E 3E21A 1WIVA 3H4JA 2BWBA 1E94E 2LVPC 1F4IA 2O25A 1T6OA 2HAKA 2CWBA 1QZEA 2LVQD 1HQYE 1OKSA 1EFUB 1IM2A 2L2DA 3IECA 4GEWA 4F1IA 5JI2E 4HEOA 2JY8A 1NV8A 3B89A 4Q7JA 2ZTDA 1DO2A 1WGNA
chains in the Genus database with same CATH superfamily
4FW9A 1Q39A 2F5SA 3GLIB 4LF8M 2WZJA 5H37D 4II7A 3AL0C 3FE3A 3U6DA 2JA2A 5ITUA 2ZANA 3A98B 1JR3D 3SHGB 4OVZB 2LNHC 2K0BX 4R3DA 4CHTB 4K0KM 4F2LA 1V92A 2KNAA 1AIPC 3NBXX 4GC5A 5EJCA 1KSFX 1G59A 3KFUG 1H6UA 2BJVA 1G71A 3T15A 1KFVA 4MGIE 2F5QA 4QNRA 5GKNA 2DZOB 4L15A 2DNAA 1QAMA 4LRTA 3HHXA 3U5ZA 1OIPA 3AOEC 4P16A 3GLIE 3GPYA 1OJLA 4G4NA 2DHYA 2HL7A 3CF6E 4LFCM 1NY6A 2UUAM 4JI6M 1GABA 2CUZA 1SXJA 4FWHA 4JN6A 1Z6TA 4LF5M 4KODA 3TWLA 1SG9A 4MGHA 1RU3A 1ZMWA 4GMQA 3U6MA 2QBYB 5EXXA 2JUJA 4D81A 4GHAA 4DV6M 3SAUA 4DR7M 2V6ZM 3D8LA 3KOWE 1I94M 2OQ4A 2CV1A 4LF7M 2NQ8C 4OW0A 2LXEA 2R45A 4JYAM 3PVSA 4ANRA 3F92A 4NL4H 2Z8YM 3FTFA 2ZAOA 3K92A 1ZV1A 4FCTA 4REZA 4MGZE 2A5YB 1QVRA 5A2QS 1PM5A 2LBCA 3FUVA 3RGPA 3C58A 1OTRA 2K6BA 2QSFX 3VFDA 1C7YA 2UUBM 1IY2A 2MH8A 1L1ZA 1QDRA 1QUSA 2XEPA 4HL4A 3GQ3A 1IBLM 1HQCA 3J81S 3V76A 3T1HM 4PDGA 4B3SM 3TPZA 3ZC7B 3GLFE 1BVSA 4L16A 3JR4A 2G8LA 3BXWA 3SMPA 3UJNA 2C99A 2CP8A 2KNZA 3BOSA 2DKLA 2C98A 5ITRA 3GLGE 1XXHB 1ZQ9A 4FVMA 2DAKA 4LFBM 4LGYA 1HT2E 5IZ7D 3VLFB 1IXZA 4G3OA 4NC6A 2CV0A 4YHHM 4LZJA 3T6PA 3SYKA 3SBJA 4JI2M 3HU1A 3GLHA 4UN2B 3LMMA 2YFQA 1P3QQ 2DAIA 3KP1E 3AKZA 2R0IA 3KS4A 2FE8A 2I7NA 2R65A 1LTMA 3B7QA 2DXIA 4NSOB 2KZSA 1PJQA 3KOYE 4LF6M 2CHQA 3LQQA 2JXNA 2I7PA 4RF0A 1WIVA 1AUAA 4LY6A 4KHPM 4WURA 3I4YA 3SATA 4IBCA 3H4JA 4QNMA 1E94E 3HWSA 1Z5AA 3LVWA 2ZM6M 1GKIA 4AKHA 3TL4X 1HNZM 1GJTA 2CFOA 2Q2EB 1MX0A 3VK7A 2CEAA 3PXGA 3Q8GA 2D7EA 4DV1M 1HQYE 1K3WA 1QQWA 3U6PA 1PJJA 4AQYM 2DZNB 5ITXE 2L2DA 2EO2A 5BR8M 3GRRA 4F1IA 3ZCBB 1G8PA 2Z4RA 3C3DA 1V34A 1NJFA 3FUXA 4S12A 4Y28F 1OAOC 4DV4M 3M0EA 4L6V6 3W68A 2CE7A 1DGGA 4M9SA 4BBAA 4G4OA 2M5ZA 3IG8A 4CISA 2F4VM 3J7AS 2RKOA 1DGFA 3L27A 4IBBA 1WR1B 1W5TA 2QP9X 4LF9M 4DUYM 3UK6A 3AOEA 3GQ5A 4G4RA 4FWDA 4MB7A 2L09A 4JXJA 4GITA 3LQRA 2QZ4A 2M60A 2QPAA 3VDPA 2YQZA 4B7FA 3T1YM 5LMNM 1IQPA 3Q8XA 1GL6A 2CHGA 3FRIA 1IXSA 1JB0F 1D2NA 3FKEA 1E32A 4DR5M 5EXSA 2DAGA 3HKPA 1Q3BA 4DR1M 2G5GX 1JR3A 2EKKA 2L6OA 2X49A 5DFLA 3H4MA 4M0WA 3W67A 3KSJA 5FTJA 4D80A 3K1JA 4GC9A 1TDHA 2LTUA 5C1BA 3FYCA 3LCUA 2MJ5B 3VKGA 1GLNA 3LCVB 4D82A 2UXDM 1A5TA 2GQFA 4MGYE 4NRVA 1HJPA 1NV9A 3TWKA 3ZH9B 4L78A 4IBDA 1OFHA 4CGYB 1L2DA 1CUKA 2VF8A 1XC8A 5EXTA 5FLXS 2OOAA 1XWIA 1ZAEA 5EP3A 1J09A 1WJ7A 1G3IA 3T38A 4LJ6A 4FCWA 2KZUA 2CRUA 1XHBA 4L8RC 1TTEA 3GPUA 1QAOA 1UFZA 2ZBKB 3FUTA 4DUZM 2V1UA 3U6QA 4KLNA 5FTLA 1IBKM 4LCBA 2G3QA 3R9XB 2MGWA 2OO9A 1IN6A 3MHVC 2MROB 2XZUA 4BLCA 2O5RA 3I04M 3KOZE 3ILKA 3FRHA 3KVWA 2C5RA 1WGLA 1K3XA 1Y8GA 3U61A 1QZMA 1G41A 4GH9A 5EP2A 1R7RA 3E46A 1LV7A 3DA1A 1XNRM 1NHWC 2K9DA 1VEJA 1YLAA 4LJAA 3GLIA 3FD9A 1ZMVA 2H1RA 3KS8A 2DZLA 3PFIA 2C9OA 2R4EA 3EIEA 3NWLA 4I81A 2WSCF 2R46A 1PJSA 1ZMUA 2R18A 2UUCM 3RFWA 4GIPA 4IBEA 3E21A 1TDZA 1R2YA 5BPVA 3GLHB 2X8AA 4EIWA 5E26A 2RGHA 2R6FA 1IXRC 4LZZA 4ZPXA 4FCVA 4BB9A 1F4IA 4GRIA 1N77A 3EIHA 3W0FA 1HNXM 2XFSA 4W5WA 1QDTA 1FNNA 2CWBA 2WSFF 4RNAA 2FH0A 8CATA 2XZFA 2Z7JA 2D7HA 4DR2M 3UZUA 7CATA 2R4JA 1EFUB 3SAWA 5IT9S 3VDUA 1YSYA 3JR5A 5ITYA 5JI2E 1HR0M 4IBGA 2YNMD 3B89A 1T3TA 3GLFA 3FUWA 3J2PB 2C9CA 3OTOM 3HHWA 4LG2A 1N78A 2LWXA 3M6AA 2JZ0A 2L7HA 4LJ7A 3MK6A 4MM3B 4FD2A 3L25A 3GLGA 4KT0F 3HJSA 1XMOM 1GVNA 3ZQJA 2FS1A 5DNYA 2VQFM 4JI1M 1DGHB 3CF2A 4DV7M 3CF0A 3GQ4A 3AOGA 3DOAA 3KSXA 3WHLA 1XXHE 2DENA 3SASA 1HNWM 4GKKM 4AI6A 2O01F 5IREB 2D7GA 3W0LB 5FTMA 1R6BX 3CGWA 3UGJA 1Z59A 2JY6B 2F5NA 2FOIC 3L29A 4Z6YA 4GKJM 1GL7A 1OQYA 1QYRA 1NHGC 3KXEC 1TR8A 3QYBA 5FSWA 2XFTA 3PNYA 4QHSA 2Z4SA 1L1TA 2APLA 3AJIB 1EE8A 5FTKA 2GNOA 1OIZA 4DR3M 3KDSE 3A42A 1IY1A 3QWLA 1PJTA 3MJ5A 1NJGA 2KHHA 2HCBA 3MMPA 4MH0E 4NSRA 4JI0M 4CIZA 1J7KA 3FUUA 1NVMA 4FWGA 4R7GA 3SC3A 3SAVA 1JQJC 1VEGA 3U60A 2AHMA 4X64M 5IWAM 4M9ZA 1C1KA 4IJEA 3KP0E 1WHCA 3TQSA 2XSZA 1DV0A 3QYEA 5ITXA 4XGIA 3HU2A 1ORYB 3D8BA 2JNHA 2UU9M 1IY0A 3THGA 4IJFA 4RF1A 3SMSA 1N32M 1OAIA 4G4QA 4X65M 3J80S 4JI8M 1N75A 4DBGB 1MJGM 4IBIA 3HU3A 4G6ZA 3TE6A 5KPZA 2XSZD 1XB2B 2HKJA 2DWMA 2CV2A 1G4AE 4M0DA 2BWEA 2XH9A 1D0MA 4IBKA 2L4EA 3QAUA 5F3WA 5ITTA 4A3VB 4TUWA 2QQ8A 3L26A 4XBOA 1V33A 5ITQA 1KYIA 1E9SA 4LGMA 2J5YA 4LJ5A 5L8RF 4X62M 3HHZA 3U5ZB 2Y21A 1E9RA 1X37A 1Q3CA 3E4RA 4JI3M 2LVAA 1VQ1A 1D0LA 1IFYA 2DWZB 3HHYA 3GPXA 1SXJB 2QNJA 2JWSA 1Q02A 2KEBA 1VDLA 2DI0A 3K9OA 3L28A 4DV0M 2F5OA 2DAEA 4NOOB 1MN3A 1MU5A 2FNAA 5KPRA 2DVWB 4DV3M 2QENA 2R62A 1UM8A 3M7GA 3VK8A 1XNQM 3LVVA 4OU7A 3SARA 1TF0B 3B7NA 4DV5M 2O25A 4LJ8A 3B7ZA 4AKIA 4XK8F 1Z5BA 3FTEA 1SXJE 2HAKA 5EQTA 5EP4A 4NXNM 1L8QA 2LVQD 3SYLA 3HJ8A 1VDDA 3I51A 4ITQA 2V1CA 1IM2A 2L7IA 1NNJA 4HEOA 5LMUM 3RE8A 3KW6A 1NV8A 1NY5A 4Q7JA 2ZTDA 1DO2A 4QHTA 4DR4M 4OVZA 2UXCM 2WSEF 3J27B 2ZAMA 1T43A 1YE9A 2KNVA 4M9XA 1N36M 4JI4M 2DWLA 4NRWA 2Z3XA 3A45A 2DHRA 1NSFA 2JZ1A 4IBJA 2JP7A 3FYDA 3GLFB 3B9PA 1IN8A 1NNUC 2Y0QA 2JY7A 3GRVA 3I01M 1I4WA 2HWJA 5KQDA 4B3TM 4CJ6A 3GLGB 2LVOC 4QOZC 1YUBA 3U6SA 3PNVA 5EP1A 5KQ8A 1IN5A 1R4GA 3RGSA 1SXJD 3HX3A 3IHPA 2RRUA 4GHLA 2Y0TA 5DYIA 4LJ4A 3K8ZA 3DFZA 4IBFA 3NBIA 4X66M 3HGIA 4AW4A 4B3MM 1GO5A 2B3TA 3KOXE 1XMQM 4AKGA 3GLHE 3U6OA 2QBYA 2ZTCA 3LW5F 3AFHA 4RKUF 4YY3M 3BBZA 1QANA 2VF7A 4AZFA 1IBMM 3B74A 1OFIA 1TH4A 2KW0A 2LH0A 3CTWB 3FTCA 4AG5A 1L2CA 1N33M 2LHGA 4B7GA 3TWMA 4KO8A 1EIJA 2H5XA 2K47A 2VIIA 3U60B 1N34M 3HY5A 2OOBA 4Z8XA 5EXPA 2OPFA 1VEKA 2KXEA 2ERCA 2XF3A 3GRUA 4WP2A 5C18A 4IIWA 3R8FA 4PCZA 3I4VA 2DWNA 1SXJC 2JY5A 2KA6B 1NO1A 1FJGM 1GJSA 1PRBA 1VG5A 2MR9A 1K82A 2DAMA 2FFJA 3WHKA 1IXSB 2EKFA 3K9PA 2E5LM 1XXHA 5DYGA 4PD2A 2HHHM 4B3RM 2C96A 5KPTA 5JI3E 1HT1E 4B7HA 1R2ZA 2EA0A 3E9SA 3SFZA 1PGYA 3IG5A 4LRSA 4OX9M 2QHOB 2VDBB 2BJWA 2W82A 4PDIA 4P17A 1WXQA 2X4AA 4I5SA 4R71A 4LJ9A 2L4FA 2R44A 1J5EM 4WW0A 1L2BA 3VKHA 1DO0A 2EUCA 2LVNC 3HZJA 4L4UA 2P5TA 3U6CA 1IN4A 4DV2M 3J7BA 2F5PA 4JI5M 4JV5M 1TGUA 2BNKA 3U6EA 1D0KA 2YR0A 1DGHA 5E6JA 3GP1A 2EJSA 4PT5A 2QCUA 5KO3A 4JI7M 4LFAM 3A46A 3U6LA 4DR6M 1QUTA 1R5LA 1JR3E 3GRYA 4AG6A 3GO8A 3C9PA 1IN7A 3AV0A 4LF4M 4MGKE 2XLJA 1PJIA 2J7NA 2LHCA 4I4LA 2BWBA 2LVPC 3JAMS 4B08A 1TH3A 2Y20A 1T6OA 3L2AA 2CHVA 4I8OA 3GPPA 4NXMM 2UXBM 1W5SA 1QZEA 1S3SA 1OKSA 1TH2A 2KRKA 2KRUA 1Z5CA 2RGOA 3HJQA 2J7OA 3SHFA 3FTDA 1QAQA 3IECA 4GEWA 2XGNA 4QOSA 3K2LA 3U61B 5FTNA 1DGBA 2JY8A 3C3EA 2VQEM 4HLQA 2N35A 3UMMA 3DZDA 1WGNA 2KDLA
chains in the Genus database with same CATH topology
2JZ0A 1T43A 2KNVA 2WZJA 1WR1B 3FE3A 2JZ1A 2JP7A 2K0BX 1XXHE 2DENA 2JY7A 4F2LA 1V92A 2HWJA 1AIPC 2KNAA 2JY6B 2LVOC 3FRIA 1OQYA 1IXSA 1TR8A 2DAGA 1R4GA 2DNAA 3IHPA 2RRUA 2EKKA 5DFLA 3GLIE 1GO5A 2B3TA 2DHYA 2KHHA 3MMPA 3GLHE 2LTUA 1VEGA 2ZTCA 3LCUA 2MJ5B 3BBZA 1WHCA 3LCVB 1SG9A 1DV0A 1A5TA 1HJPA 1NV9A 1ZMWA 2JUJA 1CUKA 2H5XA 2JNHA 2OOAA 2OOBA 1WJ7A 1VEKA 3F92A 1G3IA 4WP2A 1OAIA 1ZV1A 1TTEA 2LBCA 1UFZA 4DBGB 1OTRA 2QSFX 2JY5A 1C7YA 1XB2B 1VG5A 2MR9A 1G4AE 2DAMA 2BWEA 2G3QA 2EKFA 2L4EA 2MGWA 3K9PA 2OO9A 2MROB 1HT1E 3GLFE 1BVSA 1KYIA 3FRHA 1WGLA 1Y8GA 1PGYA 2CP8A 2KNZA 3GLGE 2DKLA 1G41A 2LVAA 1VQ1A 2QHOB 1IFYA 2DAKA 3E46A 2K9DA 1HT2E 1VEJA 4R71A 1YLAA 2L4FA 4G3OA 1DO0A 2LVNC 1ZMVA 2QNJA 3T6PA 1Q02A 1VDLA 2DI0A 3K9OA 4UN2B 2DZLA 1P3QQ 2DAIA 2DAEA 2R0IA 2EJSA 1MN3A 1ZMUA 1JR3E 3E21A 1WIVA 3H4JA 2BWBA 1E94E 2LVPC 1F4IA 2O25A 1T6OA 2HAKA 2CWBA 1QZEA 2LVQD 1HQYE 1OKSA 1EFUB 1IM2A 2L2DA 3IECA 4GEWA 4F1IA 5JI2E 4HEOA 2JY8A 1NV8A 3B89A 4Q7JA 2ZTDA 1DO2A 1WGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZ0 A;  1T43 A;  2KNV A;  2WZJ A;  1WR1 B;  3FE3 A;  2JZ1 A;  2JP7 A;  2K0B X;  1XXH E;  2DEN A;  2JY7 A;  4F2L A;  1V92 A;  2HWJ A;  1AIP C;  2KNA A;  2JY6 B;  2LVO C;  3FRI A;  1OQY A;  1IXS A;  1TR8 A;  2DAG A;  1R4G A;  2DNA A;  3IHP A;  2RRU A;  2EKK A;  5DFL A;  3GLI E;  1GO5 A;  2B3T A;  2DHY A;  2KHH A;  3MMP A;  3GLH E;  2LTU A;  1VEG A;  2ZTC A;  3LCU A;  2MJ5 B;  3BBZ A;  1WHC A;  3LCV B;  1SG9 A;  1DV0 A;  1A5T A;  1HJP A;  1NV9 A;  1ZMW A;  2JUJ A;  1CUK A;  2H5X A;  2JNH A;  2OOA A;  2OOB A;  1WJ7 A;  1VEK A;  3F92 A;  1G3I A;  4WP2 A;  1OAI A;  1ZV1 A;  1TTE A;  2LBC A;  1UFZ A;  4DBG B;  1OTR A;  2QSF X;  2JY5 A;  1C7Y A;  1XB2 B;  1VG5 A;  2MR9 A;  1G4A E;  2DAM A;  2BWE A;  2G3Q A;  2EKF A;  2L4E A;  2MGW A;  3K9P A;  2OO9 A;  2MRO B;  1HT1 E;  3GLF E;  1BVS A;  1KYI A;  3FRH A;  1WGL A;  1Y8G A;  1PGY A;  2CP8 A;  2KNZ A;  3GLG E;  2DKL A;  1G41 A;  2LVA A;  1VQ1 A;  2QHO B;  1IFY A;  2DAK A;  3E46 A;  2K9D A;  1HT2 E;  1VEJ A;  4R71 A;  1YLA A;  2L4F A;  4G3O A;  1DO0 A;  2LVN C;  1ZMV A;  2QNJ A;  3T6P A;  1Q02 A;  1VDL A;  2DI0 A;  3K9O A;  4UN2 B;  2DZL A;  1P3Q Q;  2DAI A;  2DAE A;  2R0I A;  2EJS A;  1MN3 A;  1ZMU A;  1JR3 E;  3E21 A;  1WIV A;  3H4J A;  2BWB A;  1E94 E;  2LVP C;  1F4I A;  2O25 A;  1T6O A;  2HAK A;  2CWB A;  1QZE A;  2LVQ D;  1HQY E;  1OKS A;  1EFU B;  1IM2 A;  2L2D A;  3IEC A;  4GEW A;  4F1I A;  5JI2 E;  4HEO A;  2JY8 A;  1NV8 A;  3B89 A;  4Q7J A;  2ZTD A;  1DO2 A;  1WGN A; 
#chains in the Genus database with same CATH topology
 4FW9 A;  1Q39 A;  2F5S A;  3GLI B;  4LF8 M;  2WZJ A;  5H37 D;  4II7 A;  3AL0 C;  3FE3 A;  3U6D A;  2JA2 A;  5ITU A;  2ZAN A;  3A98 B;  1JR3 D;  3SHG B;  4OVZ B;  2LNH C;  2K0B X;  4R3D A;  4CHT B;  4K0K M;  4F2L A;  1V92 A;  2KNA A;  1AIP C;  3NBX X;  4GC5 A;  5EJC A;  1KSF X;  1G59 A;  3KFU G;  1H6U A;  2BJV A;  1G71 A;  3T15 A;  1KFV A;  4MGI E;  2F5Q A;  4QNR A;  5GKN A;  2DZO B;  4L15 A;  2DNA A;  1QAM A;  4LRT A;  3HHX A;  3U5Z A;  1OIP A;  3AOE C;  4P16 A;  3GLI E;  3GPY A;  1OJL A;  4G4N A;  2DHY A;  2HL7 A;  3CF6 E;  4LFC M;  1NY6 A;  2UUA M;  4JI6 M;  1GAB A;  2CUZ A;  1SXJ A;  4FWH A;  4JN6 A;  1Z6T A;  4LF5 M;  4KOD A;  3TWL A;  1SG9 A;  4MGH A;  1RU3 A;  1ZMW A;  4GMQ A;  3U6M A;  2QBY B;  5EXX A;  2JUJ A;  4D81 A;  4GHA A;  4DV6 M;  3SAU A;  4DR7 M;  2V6Z M;  3D8L A;  3KOW E;  1I94 M;  2OQ4 A;  2CV1 A;  4LF7 M;  2NQ8 C;  4OW0 A;  2LXE A;  2R45 A;  4JYA M;  3PVS A;  4ANR A;  3F92 A;  4NL4 H;  2Z8Y M;  3FTF A;  2ZAO A;  3K92 A;  1ZV1 A;  4FCT A;  4REZ A;  4MGZ E;  2A5Y B;  1QVR A;  5A2Q S;  1PM5 A;  2LBC A;  3FUV A;  3RGP A;  3C58 A;  1OTR A;  2K6B A;  2QSF X;  3VFD A;  1C7Y A;  2UUB M;  1IY2 A;  2MH8 A;  1L1Z A;  1QDR A;  1QUS A;  2XEP A;  4HL4 A;  3GQ3 A;  1IBL M;  1HQC A;  3J81 S;  3V76 A;  3T1H M;  4PDG A;  4B3S M;  3TPZ A;  3ZC7 B;  3GLF E;  1BVS A;  4L16 A;  3JR4 A;  2G8L A;  3BXW A;  3SMP A;  3UJN A;  2C99 A;  2CP8 A;  2KNZ A;  3BOS A;  2DKL A;  2C98 A;  5ITR A;  3GLG E;  1XXH B;  1ZQ9 A;  4FVM A;  2DAK A;  4LFB M;  4LGY A;  1HT2 E;  5IZ7 D;  3VLF B;  1IXZ A;  4G3O A;  4NC6 A;  2CV0 A;  4YHH M;  4LZJ A;  3T6P A;  3SYK A;  3SBJ A;  4JI2 M;  3HU1 A;  3GLH A;  4UN2 B;  3LMM A;  2YFQ A;  1P3Q Q;  2DAI A;  3KP1 E;  3AKZ A;  2R0I A;  3KS4 A;  2FE8 A;  2I7N A;  2R65 A;  1LTM A;  3B7Q A;  2DXI A;  4NSO B;  2KZS A;  1PJQ A;  3KOY E;  4LF6 M;  2CHQ A;  3LQQ A;  2JXN A;  2I7P A;  4RF0 A;  1WIV A;  1AUA A;  4LY6 A;  4KHP M;  4WUR A;  3I4Y A;  3SAT A;  4IBC A;  3H4J A;  4QNM A;  1E94 E;  3HWS A;  1Z5A A;  3LVW A;  2ZM6 M;  1GKI A;  4AKH A;  3TL4 X;  1HNZ M;  1GJT A;  2CFO A;  2Q2E B;  1MX0 A;  3VK7 A;  2CEA A;  3PXG A;  3Q8G A;  2D7E A;  4DV1 M;  1HQY E;  1K3W A;  1QQW A;  3U6P A;  1PJJ A;  4AQY M;  2DZN B;  5ITX E;  2L2D A;  2EO2 A;  5BR8 M;  3GRR A;  4F1I A;  3ZCB B;  1G8P A;  2Z4R A;  3C3D A;  1V34 A;  1NJF A;  3FUX A;  4S12 A;  4Y28 F;  1OAO C;  4DV4 M;  3M0E A;  4L6V 6;  3W68 A;  2CE7 A;  1DGG A;  4M9S A;  4BBA A;  4G4O A;  2M5Z A;  3IG8 A;  4CIS A;  2F4V M;  3J7A S;  2RKO A;  1DGF A;  3L27 A;  4IBB A;  1WR1 B;  1W5T A;  2QP9 X;  4LF9 M;  4DUY M;  3UK6 A;  3AOE A;  3GQ5 A;  4G4R A;  4FWD A;  4MB7 A;  2L09 A;  4JXJ A;  4GIT A;  3LQR A;  2QZ4 A;  2M60 A;  2QPA A;  3VDP A;  2YQZ A;  4B7F A;  3T1Y M;  5LMN M;  1IQP A;  3Q8X A;  1GL6 A;  2CHG A;  3FRI A;  1IXS A;  1JB0 F;  1D2N A;  3FKE A;  1E32 A;  4DR5 M;  5EXS A;  2DAG A;  3HKP A;  1Q3B A;  4DR1 M;  2G5G X;  1JR3 A;  2EKK A;  2L6O A;  2X49 A;  5DFL A;  3H4M A;  4M0W A;  3W67 A;  3KSJ A;  5FTJ A;  4D80 A;  3K1J A;  4GC9 A;  1TDH A;  2LTU A;  5C1B A;  3FYC A;  3LCU A;  2MJ5 B;  3VKG A;  1GLN A;  3LCV B;  4D82 A;  2UXD M;  1A5T A;  2GQF A;  4MGY E;  4NRV A;  1HJP A;  1NV9 A;  3TWK A;  3ZH9 B;  4L78 A;  4IBD A;  1OFH A;  4CGY B;  1L2D A;  1CUK A;  2VF8 A;  1XC8 A;  5EXT A;  5FLX S;  2OOA A;  1XWI A;  1ZAE A;  5EP3 A;  1J09 A;  1WJ7 A;  1G3I A;  3T38 A;  4LJ6 A;  4FCW A;  2KZU A;  2CRU A;  1XHB A;  4L8R C;  1TTE A;  3GPU A;  1QAO A;  1UFZ A;  2ZBK B;  3FUT A;  4DUZ M;  2V1U A;  3U6Q A;  4KLN A;  5FTL A;  1IBK M;  4LCB A;  2G3Q A;  3R9X B;  2MGW A;  2OO9 A;  1IN6 A;  3MHV C;  2MRO B;  2XZU A;  4BLC A;  2O5R A;  3I04 M;  3KOZ E;  3ILK A;  3FRH A;  3KVW A;  2C5R A;  1WGL A;  1K3X A;  1Y8G A;  3U61 A;  1QZM A;  1G41 A;  4GH9 A;  5EP2 A;  1R7R A;  3E46 A;  1LV7 A;  3DA1 A;  1XNR M;  1NHW C;  2K9D A;  1VEJ A;  1YLA A;  4LJA A;  3GLI A;  3FD9 A;  1ZMV A;  2H1R A;  3KS8 A;  2DZL A;  3PFI A;  2C9O A;  2R4E A;  3EIE A;  3NWL A;  4I81 A;  2WSC F;  2R46 A;  1PJS A;  1ZMU A;  2R18 A;  2UUC M;  3RFW A;  4GIP A;  4IBE A;  3E21 A;  1TDZ A;  1R2Y A;  5BPV A;  3GLH B;  2X8A A;  4EIW A;  5E26 A;  2RGH A;  2R6F A;  1IXR C;  4LZZ A;  4ZPX A;  4FCV A;  4BB9 A;  1F4I A;  4GRI A;  1N77 A;  3EIH A;  3W0F A;  1HNX M;  2XFS A;  4W5W A;  1QDT A;  1FNN A;  2CWB A;  2WSF F;  4RNA A;  2FH0 A;  8CAT A;  2XZF A;  2Z7J A;  2D7H A;  4DR2 M;  3UZU A;  7CAT A;  2R4J A;  1EFU B;  3SAW A;  5IT9 S;  3VDU A;  1YSY A;  3JR5 A;  5ITY A;  5JI2 E;  1HR0 M;  4IBG A;  2YNM D;  3B89 A;  1T3T A;  3GLF A;  3FUW A;  3J2P B;  2C9C A;  3OTO M;  3HHW A;  4LG2 A;  1N78 A;  2LWX A;  3M6A A;  2JZ0 A;  2L7H A;  4LJ7 A;  3MK6 A;  4MM3 B;  4FD2 A;  3L25 A;  3GLG A;  4KT0 F;  3HJS A;  1XMO M;  1GVN A;  3ZQJ A;  2FS1 A;  5DNY A;  2VQF M;  4JI1 M;  1DGH B;  3CF2 A;  4DV7 M;  3CF0 A;  3GQ4 A;  3AOG A;  3DOA A;  3KSX A;  3WHL A;  1XXH E;  2DEN A;  3SAS A;  1HNW M;  4GKK M;  4AI6 A;  2O01 F;  5IRE B;  2D7G A;  3W0L B;  5FTM A;  1R6B X;  3CGW A;  3UGJ A;  1Z59 A;  2JY6 B;  2F5N A;  2FOI C;  3L29 A;  4Z6Y A;  4GKJ M;  1GL7 A;  1OQY A;  1QYR A;  1NHG C;  3KXE C;  1TR8 A;  3QYB A;  5FSW A;  2XFT A;  3PNY A;  4QHS A;  2Z4S A;  1L1T A;  2APL A;  3AJI B;  1EE8 A;  5FTK A;  2GNO A;  1OIZ A;  4DR3 M;  3KDS E;  3A42 A;  1IY1 A;  3QWL A;  1PJT A;  3MJ5 A;  1NJG A;  2KHH A;  2HCB A;  3MMP A;  4MH0 E;  4NSR A;  4JI0 M;  4CIZ A;  1J7K A;  3FUU A;  1NVM A;  4FWG A;  4R7G A;  3SC3 A;  3SAV A;  1JQJ C;  1VEG A;  3U60 A;  2AHM A;  4X64 M;  5IWA M;  4M9Z A;  1C1K A;  4IJE A;  3KP0 E;  1WHC A;  3TQS A;  2XSZ A;  1DV0 A;  3QYE A;  5ITX A;  4XGI A;  3HU2 A;  1ORY B;  3D8B A;  2JNH A;  2UU9 M;  1IY0 A;  3THG A;  4IJF A;  4RF1 A;  3SMS A;  1N32 M;  1OAI A;  4G4Q A;  4X65 M;  3J80 S;  4JI8 M;  1N75 A;  4DBG B;  1MJG M;  4IBI A;  3HU3 A;  4G6Z A;  3TE6 A;  5KPZ A;  2XSZ D;  1XB2 B;  2HKJ A;  2DWM A;  2CV2 A;  1G4A E;  4M0D A;  2BWE A;  2XH9 A;  1D0M A;  4IBK A;  2L4E A;  3QAU A;  5F3W A;  5ITT A;  4A3V B;  4TUW A;  2QQ8 A;  3L26 A;  4XBO A;  1V33 A;  5ITQ A;  1KYI A;  1E9S A;  4LGM A;  2J5Y A;  4LJ5 A;  5L8R F;  4X62 M;  3HHZ A;  3U5Z B;  2Y21 A;  1E9R A;  1X37 A;  1Q3C A;  3E4R A;  4JI3 M;  2LVA A;  1VQ1 A;  1D0L A;  1IFY A;  2DWZ B;  3HHY A;  3GPX A;  1SXJ B;  2QNJ A;  2JWS A;  1Q02 A;  2KEB A;  1VDL A;  2DI0 A;  3K9O A;  3L28 A;  4DV0 M;  2F5O A;  2DAE A;  4NOO B;  1MN3 A;  1MU5 A;  2FNA A;  5KPR A;  2DVW B;  4DV3 M;  2QEN A;  2R62 A;  1UM8 A;  3M7G A;  3VK8 A;  1XNQ M;  3LVV A;  4OU7 A;  3SAR A;  1TF0 B;  3B7N A;  4DV5 M;  2O25 A;  4LJ8 A;  3B7Z A;  4AKI A;  4XK8 F;  1Z5B A;  3FTE A;  1SXJ E;  2HAK A;  5EQT A;  5EP4 A;  4NXN M;  1L8Q A;  2LVQ D;  3SYL A;  3HJ8 A;  1VDD A;  3I51 A;  4ITQ A;  2V1C A;  1IM2 A;  2L7I A;  1NNJ A;  4HEO A;  5LMU M;  3RE8 A;  3KW6 A;  1NV8 A;  1NY5 A;  4Q7J A;  2ZTD A;  1DO2 A;  4QHT A;  4DR4 M;  4OVZ A;  2UXC M;  2WSE F;  3J27 B;  2ZAM A;  1T43 A;  1YE9 A;  2KNV A;  4M9X A;  1N36 M;  4JI4 M;  2DWL A;  4NRW A;  2Z3X A;  3A45 A;  2DHR A;  1NSF A;  2JZ1 A;  4IBJ A;  2JP7 A;  3FYD A;  3GLF B;  3B9P A;  1IN8 A;  1NNU C;  2Y0Q A;  2JY7 A;  3GRV A;  3I01 M;  1I4W A;  2HWJ A;  5KQD A;  4B3T M;  4CJ6 A;  3GLG B;  2LVO C;  4QOZ C;  1YUB A;  3U6S A;  3PNV A;  5EP1 A;  5KQ8 A;  1IN5 A;  1R4G A;  3RGS A;  1SXJ D;  3HX3 A;  3IHP A;  2RRU A;  4GHL A;  2Y0T A;  5DYI A;  4LJ4 A;  3K8Z A;  3DFZ A;  4IBF A;  3NBI A;  4X66 M;  3HGI A;  4AW4 A;  4B3M M;  1GO5 A;  2B3T A;  3KOX E;  1XMQ M;  4AKG A;  3GLH E;  3U6O A;  2QBY A;  2ZTC A;  3LW5 F;  3AFH A;  4RKU F;  4YY3 M;  3BBZ A;  1QAN A;  2VF7 A;  4AZF A;  1IBM M;  3B74 A;  1OFI A;  1TH4 A;  2KW0 A;  2LH0 A;  3CTW B;  3FTC A;  4AG5 A;  1L2C A;  1N33 M;  2LHG A;  4B7G A;  3TWM A;  4KO8 A;  1EIJ A;  2H5X A;  2K47 A;  2VII A;  3U60 B;  1N34 M;  3HY5 A;  2OOB A;  4Z8X A;  5EXP A;  2OPF A;  1VEK A;  2KXE A;  2ERC A;  2XF3 A;  3GRU A;  4WP2 A;  5C18 A;  4IIW A;  3R8F A;  4PCZ A;  3I4V A;  2DWN A;  1SXJ C;  2JY5 A;  2KA6 B;  1NO1 A;  1FJG M;  1GJS A;  1PRB A;  1VG5 A;  2MR9 A;  1K82 A;  2DAM A;  2FFJ A;  3WHK A;  1IXS B;  2EKF A;  3K9P A;  2E5L M;  1XXH A;  5DYG A;  4PD2 A;  2HHH M;  4B3R M;  2C96 A;  5KPT A;  5JI3 E;  1HT1 E;  4B7H A;  1R2Z A;  2EA0 A;  3E9S A;  3SFZ A;  1PGY A;  3IG5 A;  4LRS A;  4OX9 M;  2QHO B;  2VDB B;  2BJW A;  2W82 A;  4PDI A;  4P17 A;  1WXQ A;  2X4A A;  4I5S A;  4R71 A;  4LJ9 A;  2L4F A;  2R44 A;  1J5E M;  4WW0 A;  1L2B A;  3VKH A;  1DO0 A;  2EUC A;  2LVN C;  3HZJ A;  4L4U A;  2P5T A;  3U6C A;  1IN4 A;  4DV2 M;  3J7B A;  2F5P A;  4JI5 M;  4JV5 M;  1TGU A;  2BNK A;  3U6E A;  1D0K A;  2YR0 A;  1DGH A;  5E6J A;  3GP1 A;  2EJS A;  4PT5 A;  2QCU A;  5KO3 A;  4JI7 M;  4LFA M;  3A46 A;  3U6L A;  4DR6 M;  1QUT A;  1R5L A;  1JR3 E;  3GRY A;  4AG6 A;  3GO8 A;  3C9P A;  1IN7 A;  3AV0 A;  4LF4 M;  4MGK E;  2XLJ A;  1PJI A;  2J7N A;  2LHC A;  4I4L A;  2BWB A;  2LVP C;  3JAM S;  4B08 A;  1TH3 A;  2Y20 A;  1T6O A;  3L2A A;  2CHV A;  4I8O A;  3GPP A;  4NXM M;  2UXB M;  1W5S A;  1QZE A;  1S3S A;  1OKS A;  1TH2 A;  2KRK A;  2KRU A;  1Z5C A;  2RGO A;  3HJQ A;  2J7O A;  3SHF A;  3FTD A;  1QAQ A;  3IEC A;  4GEW A;  2XGN A;  4QOS A;  3K2L A;  3U61 B;  5FTN A;  1DGB A;  2JY8 A;  3C3E A;  2VQE M;  4HLQ A;  2N35 A;  3UMM A;  3DZD A;  1WGN A;  2KDL A; 
#chains in the Genus database with same CATH homology
 2JZ0 A;  1T43 A;  2KNV A;  2WZJ A;  1WR1 B;  3FE3 A;  2JZ1 A;  2JP7 A;  2K0B X;  1XXH E;  2DEN A;  2JY7 A;  4F2L A;  1V92 A;  2HWJ A;  1AIP C;  2KNA A;  2JY6 B;  2LVO C;  3FRI A;  1OQY A;  1IXS A;  1TR8 A;  2DAG A;  1R4G A;  2DNA A;  3IHP A;  2RRU A;  2EKK A;  5DFL A;  3GLI E;  1GO5 A;  2B3T A;  2DHY A;  2KHH A;  3MMP A;  3GLH E;  2LTU A;  1VEG A;  2ZTC A;  3LCU A;  2MJ5 B;  3BBZ A;  1WHC A;  3LCV B;  1SG9 A;  1DV0 A;  1A5T A;  1HJP A;  1NV9 A;  1ZMW A;  2JUJ A;  1CUK A;  2H5X A;  2JNH A;  2OOA A;  2OOB A;  1WJ7 A;  1VEK A;  3F92 A;  1G3I A;  4WP2 A;  1OAI A;  1ZV1 A;  1TTE A;  2LBC A;  1UFZ A;  4DBG B;  1OTR A;  2QSF X;  2JY5 A;  1C7Y A;  1XB2 B;  1VG5 A;  2MR9 A;  1G4A E;  2DAM A;  2BWE A;  2G3Q A;  2EKF A;  2L4E A;  2MGW A;  3K9P A;  2OO9 A;  2MRO B;  1HT1 E;  3GLF E;  1BVS A;  1KYI A;  3FRH A;  1WGL A;  1Y8G A;  1PGY A;  2CP8 A;  2KNZ A;  3GLG E;  2DKL A;  1G41 A;  2LVA A;  1VQ1 A;  2QHO B;  1IFY A;  2DAK A;  3E46 A;  2K9D A;  1HT2 E;  1VEJ A;  4R71 A;  1YLA A;  2L4F A;  4G3O A;  1DO0 A;  2LVN C;  1ZMV A;  2QNJ A;  3T6P A;  1Q02 A;  1VDL A;  2DI0 A;  3K9O A;  4UN2 B;  2DZL A;  1P3Q Q;  2DAI A;  2DAE A;  2R0I A;  2EJS A;  1MN3 A;  1ZMU A;  1JR3 E;  3E21 A;  1WIV A;  3H4J A;  2BWB A;  1E94 E;  2LVP C;  1F4I A;  2O25 A;  1T6O A;  2HAK A;  2CWB A;  1QZE A;  2LVQ D;  1HQY E;  1OKS A;  1EFU B;  1IM2 A;  2L2D A;  3IEC A;  4GEW A;  4F1I A;  5JI2 E;  4HEO A;  2JY8 A;  1NV8 A;  3B89 A;  4Q7J A;  2ZTD A;  1DO2 A;  1WGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...