4DBGB

Crystal structure of hoil-1l-ubl complexed with a hoip-uba derivative
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
b'DKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RanBP-type and C3HC4-type zinc finger-containing protein 1
publication title A non-canonical UBA-UBL interaction forms the linear-ubiquitin-chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16678 HOIP-UBA HOIP UBA domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4dbgB02
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4dbgB03
2OOBA 1IXSA 1QZEA 1DO0A 2G3QA 2LTUA 4F2LA 1NV9A 3FRIA 1P3QQ 5DFLA 1SG9A 2QSFX 3E21A 2QNJA 2DI0A 1YLAA 1ZV1A 2DNAA 1JR3E 2L4FA 2LVNC 1ZMVA 4WP2A 2RRUA 2HWJA 2L4EA 2KNZA 2LBCA 1NV8A 1MN3A 1WHCA 1VG5A 1HT2E 1KYIA 2EJSA 1DV0A 2DZLA 2JUJA 2CWBA 2MJ5B 4G3OA 2BWEA 2JZ1A 1EFUB 2DAGA 2HAKA 3LCVB 3GLGE 1OAIA 1HQYE 1E94E 1V92A 3BBZA 1WGLA 2JNHA 2KHHA 1VQ1A 2CP8A 3IHPA 1F4IA 2ZTDA 4F1IA 1G3IA 2MR9A 1A5TA 2JY5A 1TR8A 2JY6B 2DAIA 3FRHA 3T6PA 1T43A 2QHOB 2WZJA 1GO5A 2JY8A 1CUKA 2KNVA 1WIVA 1PGYA 1Y8GA 1VEJA 2LVPC 2DENA 1T6OA 1R4GA 3B89A 2BWBA 3MMPA 4Q7JA 1XXHE 1VDLA 1HJPA 2R0IA 3E46A 1OKSA 3LCUA 3K9PA 2L2DA 1G41A 2KNAA 1IM2A 2MGWA 2OO9A 1XB2B 2JY7A 1Q02A 2JZ0A 2DKLA 3GLHE 3K9OA 2DHYA 5JI2E 1TTEA 1VEKA 2MROB 1C7YA 3GLIE 3IECA 1VEGA 2EKKA 1WGNA 2DAMA 1ZMWA 4UN2B 4DBGB 4R71A 2ZTCA 2K0BX 2DAKA 2DAEA 1IFYA 3F92A 2H5XA 2EKFA 1WR1B 2LVOC 2LVQD 3GLFE 1HT1E 2B3TA 1OQYA 1G4AE 4GEWA 1AIPC 1DO2A 3H4JA 1UFZA 4HEOA 1BVSA 3FE3A 1OTRA 2O25A 1ZMUA 2K9DA 2LVAA 1WJ7A 2OOAA 2JP7A
chains in the Genus database with same CATH superfamily
2N35A 3AFHA 4I4LA 1IXSA 4DR6M 5DYIA 4LF4M 2LTUA 3PVSA 4NRWA 2YFQA 5FTMA 1N34M 3GO8A 4MH0E 1P3QQ 4G4QA 1NNJA 4AZFA 2RGHA 3I4VA 4II7A 1YLAA 1ZV1A 2KA6B 2QENA 4BB9A 3FKEA 2DNAA 1N33M 1JR3E 1XMOM 4IBDA 1N75A 1RU3A 1SXJA 1R2YA 3SARA 2DWLA 3LQQA 4B7GA 4AG5A 2L4EA 4I8OA 3TE6A 2KNZA 3CF0A 2ZBKB 3FUTA 1MJGM 2JA2A 3CTWB 1ZQ9A 2LHGA 4AI6A 2ZAMA 1VG5A 2XFTA 3HU2A 3OTOM 1HT2E 3BXWA 1DV0A 2JUJA 3AKZA 1J7KA 4G6ZA 4FWHA 3UJNA 3U6EA 2CEAA 3D8LA 1QAQA 2W82A 2F4VM 3VKGA 2JZ1A 2VQFM 1EFUB 4AW4A 2DXIA 2Y21A 3LCVB 4P17A 2V1CA 1QVRA 4LZJA 4WW0A 3TPZA 3U6MA 3AOEA 3GLHB 3FTEA 2WSEF 1NY6A 4NRVA 3U61B 2WSFF 1PRBA 1A5TA 2XGNA 3QWLA 1NHWC 5EXXA 4L15A 4D82A 2UXBM 1GO5A 1T43A 2WZJA 3E9SA 4RF1A 3W67A 1CUKA 3MJ5A 4LF5M 4P16A 4JI6M 1PGYA 1QDRA 1VEJA 4FCWA 4OVZB 1IN4A 2DENA 4DR7M 3HWSA 2I7NA 4BLCA 1R4GA 3FUUA 1N78A 3B89A 4GH9A 4Q7JA 3GPUA 1VDLA 2G5GX 3KSJA 1YE9A 4PD2A 1JR3D 2R62A 3H4MA 4NSRA 3SAWA 3LCUA 1IY1A 4FWGA 4CJ6A 2L2DA 4L4UA 1J5EM 5EXPA 4XGIA 3TWMA 1TDZA 4JXJA 4MM3B 1LTMA 2VDBB 2OO9A 3IG5A 3HHZA 1XMQM 1XB2B 2CRUA 4LJ9A 1TH3A 4LF9M 2MH8A 3DFZA 2DKLA 3K9OA 3L25A 2DHYA 5JI2E 5L8RF 2D7HA 3I01M 3THGA 2MROB 4NOOB 1L2BA 2L09A 3HZJA 2OQ4A 1VEGA 3GPPA 3U6DA 1R7RA 2QPAA 1ZMWA 2F5SA 2BJWA 5EXTA 4IBGA 4CISA 1TF0B 2R4JA 2K0BX 1OJLA 3F92A 1IFYA 1TGUA 2KZUA 2CFOA 3JR5A 1ORYB 8CATA 3RGPA 4Y28F 1OIZA 3HHYA 3GQ4A 3T1HM 1FJGM 1DO2A 4QNRA 1UFZA 1BVSA 1L2DA 2FS1A 2H1RA 4L16A 1TH4A 2XH9A 2XSZD 3FYCA 5C18A 2F5NA 2LVAA 1WJ7A 3GRUA 2BNKA 3U6QA 1PJQA 2DWMA 2CHGA 2E5LM 2CV1A 5ITYA 2G3QA 3FTDA 2JXNA 4F2LA 3J27B 1NV9A 2D7GA 3TQSA 1NY5A 4LJ4A 1L2CA 1SG9A 2QNJA 4LCBA 5ITUA 4JYAM 3FTCA 3WHLA 4MGIE 1FNNA 2WSCF 2JWSA 1DGHA 3GLIA 3DOAA 2EUCA 1NHGC 1ZMVA 2V6ZM 4GKJM 2KEBA 2FFJA 4IBFA 3R9XB 1L1ZA 1XXHB 2DWNA 1MN3A 2KRKA 5ITQA 1PM5A 3FUXA 2G8LA 3PNYA 4FWDA 4KT0F 3A46A 4FW9A 2CHVA 1KYIA 3HU3A 3KOXE 1Z5BA 5KO3A 4D81A 4PCZA 2YNMD 1QQWA 2CWBA 2MJ5B 4G4RA 1E32A 1GJTA 4M0WA 3C58A 3HGIA 2DZNB 2BWEA 3U5ZB 4LY6A 4CHTB 4B08A 1I4WA 4IBBA 3GLGE 4GC5A 3NWLA 3GP1A 4DV2M 2Q2EB 4LFAM 1HQYE 1E94E 3KDSE 3ZH9B 3VKHA 2JNHA 4L6V6 1VQ1A 4JI5M 2ZTDA 4F1IA 4IJEA 1H6UA 3U60B 2XF3A 3ILKA 2APLA 3ZQJA 2I7PA 3LW5F 1IBMM 2F5OA 1SXJB 3I4YA 1Q3BA 1D0MA 5KPRA 2R46A 2RGOA 3GRVA 4NL4H 3VFDA 2QHOB 4GHAA 2LH0A 3A45A 1DGFA 1Z59A 2O5RA 4ANRA 2JY8A 3T38A 4PDIA 1PJJA 2KNVA 3SFZA 5FTJA 5KQDA 1JR3A 1XNRM 7CATA 2L7HA 2R45A 3W0LB 1GABA 4JI8M 1J09A 4KODA 3FD9A 3E4RA 1T6OA 4OU7A 1XWIA 2KDLA 2BWBA 1D2NA 1NSFA 1QZMA 4QHTA 2OPFA 2Z3XA 2KRUA 4KLNA 1YUBA 1GL6A 4FCTA 3VK8A 4FCVA 4JI4M 3DZDA 3BOSA 1OKSA 2FE8A 2Z8YM 2LHCA 2Y0TA 2XFSA 2FOIC 3K9PA 4Z8XA 3U6PA 4DV4M 3CGWA 4REZA 2KNAA 4W5WA 2C99A 4DV6M 1NJGA 1IM2A 4S12A 3C9PA 3DA1A 1GKIA 4DR5M 1AUAA 2FH0A 3GLHE 1E9RA 3ZC7B 4X64M 4NXMM 1HNZM 1TTEA 2KZSA 2Y20A 5EP2A 1L8QA 4D80A 1C7YA 3SBJA 1MU5A 1Z5CA 1GLNA 3W0FA 3LVWA 1XNQM 4DR3M 5A2QS 4DBGB 2CV2A 5KPTA 3AJIB 3KS4A 1IBKM 3FUVA 5KPZA 1QUSA 5FTLA 2B3TA 1AIPC 3B7QA 2O01F 3EIHA 4DR4M 4LRTA 4AQYM 1IN8A 3FYDA 2K6BA 3KW6A 1K3XA 3M7GA 4LG2A 3FE3A 5EJCA 1UM8A 1OTRA 2KXEA 5FTKA 3T15A 3UK6A 5IT9S 1PJIA 4IJFA 5DNYA 2CV0A 4KHPM 2OOAA 2UU9M 4GITA 4X66M 4B3MM 4B3SM 1QZEA 4X65M 4OVZA 4Z6YA 2RKOA 4L78A 2P5TA 3HX3A 2V1UA 3KOWE 3FRIA 2UXCM 2C5RA 2UUAM 3HJ8A 2DI0A 2QCUA 2CHQA 3KP0E 3LMMA 5FSWA 1IN7A 2LNHC 2QBYB 3PNVA 4XBOA 4GRIA 2M60A 2KW0A 1V34A 3B74A 3NBIA 4LJ5A 3SMSA 3VDPA 4OW0A 1W5TA 3JAMS 2EA0A 4XK8F 3K2LA 3GPYA 4MGZE 2R65A 1NV8A 1WHCA 1X37A 2Z7JA 4M9ZA 4MB7A 3HJSA 3GQ5A 4CGYB 4LFCM 4LJ8A 2DZLA 1G59A 4G3OA 1PJTA 1QANA 2XEPA 5FLXS 3VDUA 1PJSA 2DAGA 2HAKA 2R4EA 4AG6A 5BPVA 3J7BA 4TUWA 3QYEA 3SASA 3L2AA 1WGLA 2KHHA 3CF6E 1D0KA 3IHPA 1R2ZA 5LMUM 1IY2A 2ZAOA 5F3WA 1DGHB 4ITQA 3GLIB 2YQZA 5KQ8A 3W68A 2QP9X 3QAUA 2JY5A 4CIZA 3L27A 2DAIA 4M9SA 2C9CA 2R6FA 3HHWA 3T6PA 5IWAM 3SMPA 4RKUF 1XHBA 3LVVA 3GLFB 3SAVA 2QQ8A 3GRYA 4AKHA 3FUWA 1WIVA 1N36M 1NVMA 4DUYM 1IXSB 1DGBA 2C9OA 3WHKA 1Y8GA 4YHHM 1R5LA 2Z4RA 4GHLA 1ZAEA 2UUBM 4DV7M 1YSYA 4FD2A 4RF0A 3MMPA 1XXHE 5E26A 3KSXA 3I04M 2C96A 3C3DA 2R0IA 1JB0F 1Q39A 3E46A 3L29A 5EP1A 3U6SA 1MX0A 3TWKA 1EE8A 3NBXX 3SYKA 4DR2M 1Q3CA 1TH2A 1OAOC 3HY5A 3J80S 4LRSA 3RGSA 1V33A 1XXHA 3GLGA 2MGWA 2JY7A 3LQRA 1Q02A 1QUTA 2VF8A 2Z4SA 1DGGA 2L6OA 3RFWA 1VEKA 2GQFA 4MGYE 3V76A 1GL7A 4KO8A 2LXEA 1W5SA 3U5ZA 4FVMA 2EKKA 1SXJE 4PT5A 2DAMA 4M9XA 4NSOB 2ZTCA 3GRRA 3TL4X 2A5YB 2H5XA 2EKFA 2LVOC 3PXGA 4I5SA 3I51A 2F5QA 2ZM6M 4GC9A 3M6AA 4QOZC 1G8PA 1HT1E 3U60A 3J7AS 2XZUA 3EIEA 1JQJC 2C98A 4B7FA 3KXEC 4GEWA 2K9DA 1C1KA 3MK6A 3Q8GA 4HLQA 4ZPXA 1OFHA 2VQEM 4JI2M 2M5ZA 2QZ4A 4PDGA 3GPXA 2O25A 4WURA 1ZMUA 3VK7A 3HU1A 2UXDM 3TWLA 5ITTA 2JP7A 4LJ7A 2OOBA 5FTNA 2Y0QA 4DV3M 3U6OA 1DO0A 1EIJA 2DHRA 2HCBA 3ZCBB 4G4NA 3J2PB 3A42A 4IBKA 4X62M 5EP3A 1E9SA 4G4OA 1Z5AA 3PFIA 5DFLA 4DUZM 2QSFX 2R18A 4LJAA 3E21A 1KFVA 2BJVA 4LF6M 4R3DA 5H37D 5LMNM 3K8ZA 4RNAA 4OX9M 2DWZB 3GLHA 4I81A 5EP4A 4DR1M 3Q8XA 2XSZA 3KVWA 3U61A 2R44A 1OFIA 2DVWB 2L4FA 2LVNC 4M0DA 3SAUA 3U6LA 3R8FA 1N32M 1LV7A 4WP2A 1S3SA 1TDHA 1IY0A 2HWJA 2VF7A 1Z6TA 2LBCA 1IXZA 1OIPA 3IG8A 1SXJC 2EO2A 2FNAA 1QYRA 1G71A 4DV0M 3L26A 3K92A 5EQTA 3AL0C 3SC3A 3SHGB 5JI3E 1SXJD 2EJSA 4A3VB 4L8RC 2K47A 1KSFX 1IN5A 2YR0A 1HNWM 2HL7A 2J5YA 4JI7M 1D0LA 2X8AA 3FTFA 4IBJA 3UZUA 1HQCA 1GVNA 1OAIA 1QAMA 1QAOA 1V92A 3BBZA 3MHVC 4B7HA 2LWXA 3UMMA 2CP8A 1N77A 4B3TM 1F4IA 4AKIA 4AKGA 5BR8M 1G3IA 1I94M 4GIPA 3AOEC 2MR9A 4IBEA 4GMQA 4YY3M 3K1JA 4B3RM 1TR8A 1VDDA 2D7EA 2JY6B 1L1TA 4LJ6A 3FRHA 1NJFA 1HNXM 2X49A 1HR0M 4DV5M 2F5PA 4QHSA 2X4AA 5E6JA 3HJQA 4QNMA 3B7NA 3M0EA 4R7GA 4JI0M 4NC6A 3J81S 4LF7M 4LZZA 3SATA 1T3TA 1IBLM 2ZANA 3B7ZA 2VIIA 4IBCA 3L28A 3SYLA 3UGJA 3KS8A 4JV5M 1IXRC 2L7IA 3AOGA 1HJPA 2QBYA 3T1YM 5GKNA 4LFBM 3KOZE 3KOYE 1IN6A 4LF8M 3JR4A 1R6BX 1G41A 2HKJA 5IZ7D 3RE8A 5ITXE 2CE7A 3B9PA 4K0KM 1IQPA 5EXSA 2JZ0A 4BBAA 1WXQA 4GKKM 5C1BA 4DV1M 3VLFB 1K82A 4JI1M 1QDTA 4EIWA 2UUCM 1NNUC 5ITXA 3GLIE 3A98B 3IECA 2DZOB 3KP1E 1WGNA 3SHFA 2XZFA 4HL4A 4QOSA 4UN2B 4R71A 2XLJA 2DAKA 2J7NA 2DAEA 5ITRA 1GJSA 4JN6A 1WR1B 3HHXA 2LVQD 2AHMA 3GLFE 4NXNM 1OQYA 3D8BA 4LGYA 1G4AE 3KFUG 2NQ8C 1NO1A 3GQ3A 5DYGA 5IREB 3C3EA 3U6CA 4MGHA 2ERCA 2J7OA 3H4JA 4IBIA 4HEOA 1K3WA 3GLGB 4JI3M 2CUZA 3CF2A 3HKPA 3QYBA 1XC8A 4LGMA 4IIWA 4MGKE 3GLFA 2LVPC 2RRUA 2GNOA 3AV0A 2HHHM
chains in the Genus database with same CATH topology
2OOBA 1IXSA 1QZEA 1DO0A 2G3QA 2LTUA 4F2LA 1NV9A 3FRIA 1P3QQ 5DFLA 1SG9A 2QSFX 3E21A 2QNJA 2DI0A 1YLAA 1ZV1A 2DNAA 1JR3E 2L4FA 2LVNC 1ZMVA 4WP2A 2RRUA 2HWJA 2L4EA 2KNZA 2LBCA 1NV8A 1MN3A 1WHCA 1VG5A 1HT2E 1KYIA 2EJSA 1DV0A 2DZLA 2JUJA 2CWBA 2MJ5B 4G3OA 2BWEA 2JZ1A 1EFUB 2DAGA 2HAKA 3LCVB 3GLGE 1OAIA 1HQYE 1E94E 1V92A 3BBZA 1WGLA 2JNHA 2KHHA 1VQ1A 2CP8A 3IHPA 1F4IA 2ZTDA 4F1IA 1G3IA 2MR9A 1A5TA 2JY5A 1TR8A 2JY6B 2DAIA 3FRHA 3T6PA 1T43A 2QHOB 2WZJA 1GO5A 2JY8A 1CUKA 2KNVA 1WIVA 1PGYA 1Y8GA 1VEJA 2LVPC 2DENA 1T6OA 1R4GA 3B89A 2BWBA 3MMPA 4Q7JA 1XXHE 1VDLA 1HJPA 2R0IA 3E46A 1OKSA 3LCUA 3K9PA 2L2DA 1G41A 2KNAA 1IM2A 2MGWA 2OO9A 1XB2B 2JY7A 1Q02A 2JZ0A 2DKLA 3GLHE 3K9OA 2DHYA 5JI2E 1TTEA 1VEKA 2MROB 1C7YA 3GLIE 3IECA 1VEGA 2EKKA 1WGNA 2DAMA 1ZMWA 4UN2B 4DBGB 4R71A 2ZTCA 2K0BX 2DAKA 2DAEA 1IFYA 3F92A 2H5XA 2EKFA 1WR1B 2LVOC 2LVQD 3GLFE 1HT1E 2B3TA 1OQYA 1G4AE 4GEWA 1AIPC 1DO2A 3H4JA 1UFZA 4HEOA 1BVSA 3FE3A 1OTRA 2O25A 1ZMUA 2K9DA 2LVAA 1WJ7A 2OOAA 2JP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOB A;  1IXS A;  1QZE A;  1DO0 A;  2G3Q A;  2LTU A;  4F2L A;  1NV9 A;  3FRI A;  1P3Q Q;  5DFL A;  1SG9 A;  2QSF X;  3E21 A;  2QNJ A;  2DI0 A;  1YLA A;  1ZV1 A;  2DNA A;  1JR3 E;  2L4F A;  2LVN C;  1ZMV A;  4WP2 A;  2RRU A;  2HWJ A;  2L4E A;  2KNZ A;  2LBC A;  1NV8 A;  1MN3 A;  1WHC A;  1VG5 A;  1HT2 E;  1KYI A;  2EJS A;  1DV0 A;  2DZL A;  2JUJ A;  2CWB A;  2MJ5 B;  4G3O A;  2BWE A;  2JZ1 A;  1EFU B;  2DAG A;  2HAK A;  3LCV B;  3GLG E;  1OAI A;  1HQY E;  1E94 E;  1V92 A;  3BBZ A;  1WGL A;  2JNH A;  2KHH A;  1VQ1 A;  2CP8 A;  3IHP A;  1F4I A;  2ZTD A;  4F1I A;  1G3I A;  2MR9 A;  1A5T A;  2JY5 A;  1TR8 A;  2JY6 B;  2DAI A;  3FRH A;  3T6P A;  1T43 A;  2QHO B;  2WZJ A;  1GO5 A;  2JY8 A;  1CUK A;  2KNV A;  1WIV A;  1PGY A;  1Y8G A;  1VEJ A;  2LVP C;  2DEN A;  1T6O A;  1R4G A;  3B89 A;  2BWB A;  3MMP A;  4Q7J A;  1XXH E;  1VDL A;  1HJP A;  2R0I A;  3E46 A;  1OKS A;  3LCU A;  3K9P A;  2L2D A;  1G41 A;  2KNA A;  1IM2 A;  2MGW A;  2OO9 A;  1XB2 B;  2JY7 A;  1Q02 A;  2JZ0 A;  2DKL A;  3GLH E;  3K9O A;  2DHY A;  5JI2 E;  1TTE A;  1VEK A;  2MRO B;  1C7Y A;  3GLI E;  3IEC A;  1VEG A;  2EKK A;  1WGN A;  2DAM A;  1ZMW A;  4UN2 B;  4DBG B;  4R71 A;  2ZTC A;  2K0B X;  2DAK A;  2DAE A;  1IFY A;  3F92 A;  2H5X A;  2EKF A;  1WR1 B;  2LVO C;  2LVQ D;  3GLF E;  1HT1 E;  2B3T A;  1OQY A;  1G4A E;  4GEW A;  1AIP C;  1DO2 A;  3H4J A;  1UFZ A;  4HEO A;  1BVS A;  3FE3 A;  1OTR A;  2O25 A;  1ZMU A;  2K9D A;  2LVA A;  1WJ7 A;  2OOA A;  2JP7 A; 
#chains in the Genus database with same CATH topology
 2N35 A;  3AFH A;  4I4L A;  1IXS A;  4DR6 M;  5DYI A;  4LF4 M;  2LTU A;  3PVS A;  4NRW A;  2YFQ A;  5FTM A;  1N34 M;  3GO8 A;  4MH0 E;  1P3Q Q;  4G4Q A;  1NNJ A;  4AZF A;  2RGH A;  3I4V A;  4II7 A;  1YLA A;  1ZV1 A;  2KA6 B;  2QEN A;  4BB9 A;  3FKE A;  2DNA A;  1N33 M;  1JR3 E;  1XMO M;  4IBD A;  1N75 A;  1RU3 A;  1SXJ A;  1R2Y A;  3SAR A;  2DWL A;  3LQQ A;  4B7G A;  4AG5 A;  2L4E A;  4I8O A;  3TE6 A;  2KNZ A;  3CF0 A;  2ZBK B;  3FUT A;  1MJG M;  2JA2 A;  3CTW B;  1ZQ9 A;  2LHG A;  4AI6 A;  2ZAM A;  1VG5 A;  2XFT A;  3HU2 A;  3OTO M;  1HT2 E;  3BXW A;  1DV0 A;  2JUJ A;  3AKZ A;  1J7K A;  4G6Z A;  4FWH A;  3UJN A;  3U6E A;  2CEA A;  3D8L A;  1QAQ A;  2W82 A;  2F4V M;  3VKG A;  2JZ1 A;  2VQF M;  1EFU B;  4AW4 A;  2DXI A;  2Y21 A;  3LCV B;  4P17 A;  2V1C A;  1QVR A;  4LZJ A;  4WW0 A;  3TPZ A;  3U6M A;  3AOE A;  3GLH B;  3FTE A;  2WSE F;  1NY6 A;  4NRV A;  3U61 B;  2WSF F;  1PRB A;  1A5T A;  2XGN A;  3QWL A;  1NHW C;  5EXX A;  4L15 A;  4D82 A;  2UXB M;  1GO5 A;  1T43 A;  2WZJ A;  3E9S A;  4RF1 A;  3W67 A;  1CUK A;  3MJ5 A;  4LF5 M;  4P16 A;  4JI6 M;  1PGY A;  1QDR A;  1VEJ A;  4FCW A;  4OVZ B;  1IN4 A;  2DEN A;  4DR7 M;  3HWS A;  2I7N A;  4BLC A;  1R4G A;  3FUU A;  1N78 A;  3B89 A;  4GH9 A;  4Q7J A;  3GPU A;  1VDL A;  2G5G X;  3KSJ A;  1YE9 A;  4PD2 A;  1JR3 D;  2R62 A;  3H4M A;  4NSR A;  3SAW A;  3LCU A;  1IY1 A;  4FWG A;  4CJ6 A;  2L2D A;  4L4U A;  1J5E M;  5EXP A;  4XGI A;  3TWM A;  1TDZ A;  4JXJ A;  4MM3 B;  1LTM A;  2VDB B;  2OO9 A;  3IG5 A;  3HHZ A;  1XMQ M;  1XB2 B;  2CRU A;  4LJ9 A;  1TH3 A;  4LF9 M;  2MH8 A;  3DFZ A;  2DKL A;  3K9O A;  3L25 A;  2DHY A;  5JI2 E;  5L8R F;  2D7H A;  3I01 M;  3THG A;  2MRO B;  4NOO B;  1L2B A;  2L09 A;  3HZJ A;  2OQ4 A;  1VEG A;  3GPP A;  3U6D A;  1R7R A;  2QPA A;  1ZMW A;  2F5S A;  2BJW A;  5EXT A;  4IBG A;  4CIS A;  1TF0 B;  2R4J A;  2K0B X;  1OJL A;  3F92 A;  1IFY A;  1TGU A;  2KZU A;  2CFO A;  3JR5 A;  1ORY B;  8CAT A;  3RGP A;  4Y28 F;  1OIZ A;  3HHY A;  3GQ4 A;  3T1H M;  1FJG M;  1DO2 A;  4QNR A;  1UFZ A;  1BVS A;  1L2D A;  2FS1 A;  2H1R A;  4L16 A;  1TH4 A;  2XH9 A;  2XSZ D;  3FYC A;  5C18 A;  2F5N A;  2LVA A;  1WJ7 A;  3GRU A;  2BNK A;  3U6Q A;  1PJQ A;  2DWM A;  2CHG A;  2E5L M;  2CV1 A;  5ITY A;  2G3Q A;  3FTD A;  2JXN A;  4F2L A;  3J27 B;  1NV9 A;  2D7G A;  3TQS A;  1NY5 A;  4LJ4 A;  1L2C A;  1SG9 A;  2QNJ A;  4LCB A;  5ITU A;  4JYA M;  3FTC A;  3WHL A;  4MGI E;  1FNN A;  2WSC F;  2JWS A;  1DGH A;  3GLI A;  3DOA A;  2EUC A;  1NHG C;  1ZMV A;  2V6Z M;  4GKJ M;  2KEB A;  2FFJ A;  4IBF A;  3R9X B;  1L1Z A;  1XXH B;  2DWN A;  1MN3 A;  2KRK A;  5ITQ A;  1PM5 A;  3FUX A;  2G8L A;  3PNY A;  4FWD A;  4KT0 F;  3A46 A;  4FW9 A;  2CHV A;  1KYI A;  3HU3 A;  3KOX E;  1Z5B A;  5KO3 A;  4D81 A;  4PCZ A;  2YNM D;  1QQW A;  2CWB A;  2MJ5 B;  4G4R A;  1E32 A;  1GJT A;  4M0W A;  3C58 A;  3HGI A;  2DZN B;  2BWE A;  3U5Z B;  4LY6 A;  4CHT B;  4B08 A;  1I4W A;  4IBB A;  3GLG E;  4GC5 A;  3NWL A;  3GP1 A;  4DV2 M;  2Q2E B;  4LFA M;  1HQY E;  1E94 E;  3KDS E;  3ZH9 B;  3VKH A;  2JNH A;  4L6V 6;  1VQ1 A;  4JI5 M;  2ZTD A;  4F1I A;  4IJE A;  1H6U A;  3U60 B;  2XF3 A;  3ILK A;  2APL A;  3ZQJ A;  2I7P A;  3LW5 F;  1IBM M;  2F5O A;  1SXJ B;  3I4Y A;  1Q3B A;  1D0M A;  5KPR A;  2R46 A;  2RGO A;  3GRV A;  4NL4 H;  3VFD A;  2QHO B;  4GHA A;  2LH0 A;  3A45 A;  1DGF A;  1Z59 A;  2O5R A;  4ANR A;  2JY8 A;  3T38 A;  4PDI A;  1PJJ A;  2KNV A;  3SFZ A;  5FTJ A;  5KQD A;  1JR3 A;  1XNR M;  7CAT A;  2L7H A;  2R45 A;  3W0L B;  1GAB A;  4JI8 M;  1J09 A;  4KOD A;  3FD9 A;  3E4R A;  1T6O A;  4OU7 A;  1XWI A;  2KDL A;  2BWB A;  1D2N A;  1NSF A;  1QZM A;  4QHT A;  2OPF A;  2Z3X A;  2KRU A;  4KLN A;  1YUB A;  1GL6 A;  4FCT A;  3VK8 A;  4FCV A;  4JI4 M;  3DZD A;  3BOS A;  1OKS A;  2FE8 A;  2Z8Y M;  2LHC A;  2Y0T A;  2XFS A;  2FOI C;  3K9P A;  4Z8X A;  3U6P A;  4DV4 M;  3CGW A;  4REZ A;  2KNA A;  4W5W A;  2C99 A;  4DV6 M;  1NJG A;  1IM2 A;  4S12 A;  3C9P A;  3DA1 A;  1GKI A;  4DR5 M;  1AUA A;  2FH0 A;  3GLH E;  1E9R A;  3ZC7 B;  4X64 M;  4NXM M;  1HNZ M;  1TTE A;  2KZS A;  2Y20 A;  5EP2 A;  1L8Q A;  4D80 A;  1C7Y A;  3SBJ A;  1MU5 A;  1Z5C A;  1GLN A;  3W0F A;  3LVW A;  1XNQ M;  4DR3 M;  5A2Q S;  4DBG B;  2CV2 A;  5KPT A;  3AJI B;  3KS4 A;  1IBK M;  3FUV A;  5KPZ A;  1QUS A;  5FTL A;  2B3T A;  1AIP C;  3B7Q A;  2O01 F;  3EIH A;  4DR4 M;  4LRT A;  4AQY M;  1IN8 A;  3FYD A;  2K6B A;  3KW6 A;  1K3X A;  3M7G A;  4LG2 A;  3FE3 A;  5EJC A;  1UM8 A;  1OTR A;  2KXE A;  5FTK A;  3T15 A;  3UK6 A;  5IT9 S;  1PJI A;  4IJF A;  5DNY A;  2CV0 A;  4KHP M;  2OOA A;  2UU9 M;  4GIT A;  4X66 M;  4B3M M;  4B3S M;  1QZE A;  4X65 M;  4OVZ A;  4Z6Y A;  2RKO A;  4L78 A;  2P5T A;  3HX3 A;  2V1U A;  3KOW E;  3FRI A;  2UXC M;  2C5R A;  2UUA M;  3HJ8 A;  2DI0 A;  2QCU A;  2CHQ A;  3KP0 E;  3LMM A;  5FSW A;  1IN7 A;  2LNH C;  2QBY B;  3PNV A;  4XBO A;  4GRI A;  2M60 A;  2KW0 A;  1V34 A;  3B74 A;  3NBI A;  4LJ5 A;  3SMS A;  3VDP A;  4OW0 A;  1W5T A;  3JAM S;  2EA0 A;  4XK8 F;  3K2L A;  3GPY A;  4MGZ E;  2R65 A;  1NV8 A;  1WHC A;  1X37 A;  2Z7J A;  4M9Z A;  4MB7 A;  3HJS A;  3GQ5 A;  4CGY B;  4LFC M;  4LJ8 A;  2DZL A;  1G59 A;  4G3O A;  1PJT A;  1QAN A;  2XEP A;  5FLX S;  3VDU A;  1PJS A;  2DAG A;  2HAK A;  2R4E A;  4AG6 A;  5BPV A;  3J7B A;  4TUW A;  3QYE A;  3SAS A;  3L2A A;  1WGL A;  2KHH A;  3CF6 E;  1D0K A;  3IHP A;  1R2Z A;  5LMU M;  1IY2 A;  2ZAO A;  5F3W A;  1DGH B;  4ITQ A;  3GLI B;  2YQZ A;  5KQ8 A;  3W68 A;  2QP9 X;  3QAU A;  2JY5 A;  4CIZ A;  3L27 A;  2DAI A;  4M9S A;  2C9C A;  2R6F A;  3HHW A;  3T6P A;  5IWA M;  3SMP A;  4RKU F;  1XHB A;  3LVV A;  3GLF B;  3SAV A;  2QQ8 A;  3GRY A;  4AKH A;  3FUW A;  1WIV A;  1N36 M;  1NVM A;  4DUY M;  1IXS B;  1DGB A;  2C9O A;  3WHK A;  1Y8G A;  4YHH M;  1R5L A;  2Z4R A;  4GHL A;  1ZAE A;  2UUB M;  4DV7 M;  1YSY A;  4FD2 A;  4RF0 A;  3MMP A;  1XXH E;  5E26 A;  3KSX A;  3I04 M;  2C96 A;  3C3D A;  2R0I A;  1JB0 F;  1Q39 A;  3E46 A;  3L29 A;  5EP1 A;  3U6S A;  1MX0 A;  3TWK A;  1EE8 A;  3NBX X;  3SYK A;  4DR2 M;  1Q3C A;  1TH2 A;  1OAO C;  3HY5 A;  3J80 S;  4LRS A;  3RGS A;  1V33 A;  1XXH A;  3GLG A;  2MGW A;  2JY7 A;  3LQR A;  1Q02 A;  1QUT A;  2VF8 A;  2Z4S A;  1DGG A;  2L6O A;  3RFW A;  1VEK A;  2GQF A;  4MGY E;  3V76 A;  1GL7 A;  4KO8 A;  2LXE A;  1W5S A;  3U5Z A;  4FVM A;  2EKK A;  1SXJ E;  4PT5 A;  2DAM A;  4M9X A;  4NSO B;  2ZTC A;  3GRR A;  3TL4 X;  2A5Y B;  2H5X A;  2EKF A;  2LVO C;  3PXG A;  4I5S A;  3I51 A;  2F5Q A;  2ZM6 M;  4GC9 A;  3M6A A;  4QOZ C;  1G8P A;  1HT1 E;  3U60 A;  3J7A S;  2XZU A;  3EIE A;  1JQJ C;  2C98 A;  4B7F A;  3KXE C;  4GEW A;  2K9D A;  1C1K A;  3MK6 A;  3Q8G A;  4HLQ A;  4ZPX A;  1OFH A;  2VQE M;  4JI2 M;  2M5Z A;  2QZ4 A;  4PDG A;  3GPX A;  2O25 A;  4WUR A;  1ZMU A;  3VK7 A;  3HU1 A;  2UXD M;  3TWL A;  5ITT A;  2JP7 A;  4LJ7 A;  2OOB A;  5FTN A;  2Y0Q A;  4DV3 M;  3U6O A;  1DO0 A;  1EIJ A;  2DHR A;  2HCB A;  3ZCB B;  4G4N A;  3J2P B;  3A42 A;  4IBK A;  4X62 M;  5EP3 A;  1E9S A;  4G4O A;  1Z5A A;  3PFI A;  5DFL A;  4DUZ M;  2QSF X;  2R18 A;  4LJA A;  3E21 A;  1KFV A;  2BJV A;  4LF6 M;  4R3D A;  5H37 D;  5LMN M;  3K8Z A;  4RNA A;  4OX9 M;  2DWZ B;  3GLH A;  4I81 A;  5EP4 A;  4DR1 M;  3Q8X A;  2XSZ A;  3KVW A;  3U61 A;  2R44 A;  1OFI A;  2DVW B;  2L4F A;  2LVN C;  4M0D A;  3SAU A;  3U6L A;  3R8F A;  1N32 M;  1LV7 A;  4WP2 A;  1S3S A;  1TDH A;  1IY0 A;  2HWJ A;  2VF7 A;  1Z6T A;  2LBC A;  1IXZ A;  1OIP A;  3IG8 A;  1SXJ C;  2EO2 A;  2FNA A;  1QYR A;  1G71 A;  4DV0 M;  3L26 A;  3K92 A;  5EQT A;  3AL0 C;  3SC3 A;  3SHG B;  5JI3 E;  1SXJ D;  2EJS A;  4A3V B;  4L8R C;  2K47 A;  1KSF X;  1IN5 A;  2YR0 A;  1HNW M;  2HL7 A;  2J5Y A;  4JI7 M;  1D0L A;  2X8A A;  3FTF A;  4IBJ A;  3UZU A;  1HQC A;  1GVN A;  1OAI A;  1QAM A;  1QAO A;  1V92 A;  3BBZ A;  3MHV C;  4B7H A;  2LWX A;  3UMM A;  2CP8 A;  1N77 A;  4B3T M;  1F4I A;  4AKI A;  4AKG A;  5BR8 M;  1G3I A;  1I94 M;  4GIP A;  3AOE C;  2MR9 A;  4IBE A;  4GMQ A;  4YY3 M;  3K1J A;  4B3R M;  1TR8 A;  1VDD A;  2D7E A;  2JY6 B;  1L1T A;  4LJ6 A;  3FRH A;  1NJF A;  1HNX M;  2X49 A;  1HR0 M;  4DV5 M;  2F5P A;  4QHS A;  2X4A A;  5E6J A;  3HJQ A;  4QNM A;  3B7N A;  3M0E A;  4R7G A;  4JI0 M;  4NC6 A;  3J81 S;  4LF7 M;  4LZZ A;  3SAT A;  1T3T A;  1IBL M;  2ZAN A;  3B7Z A;  2VII A;  4IBC A;  3L28 A;  3SYL A;  3UGJ A;  3KS8 A;  4JV5 M;  1IXR C;  2L7I A;  3AOG A;  1HJP A;  2QBY A;  3T1Y M;  5GKN A;  4LFB M;  3KOZ E;  3KOY E;  1IN6 A;  4LF8 M;  3JR4 A;  1R6B X;  1G41 A;  2HKJ A;  5IZ7 D;  3RE8 A;  5ITX E;  2CE7 A;  3B9P A;  4K0K M;  1IQP A;  5EXS A;  2JZ0 A;  4BBA A;  1WXQ A;  4GKK M;  5C1B A;  4DV1 M;  3VLF B;  1K82 A;  4JI1 M;  1QDT A;  4EIW A;  2UUC M;  1NNU C;  5ITX A;  3GLI E;  3A98 B;  3IEC A;  2DZO B;  3KP1 E;  1WGN A;  3SHF A;  2XZF A;  4HL4 A;  4QOS A;  4UN2 B;  4R71 A;  2XLJ A;  2DAK A;  2J7N A;  2DAE A;  5ITR A;  1GJS A;  4JN6 A;  1WR1 B;  3HHX A;  2LVQ D;  2AHM A;  3GLF E;  4NXN M;  1OQY A;  3D8B A;  4LGY A;  1G4A E;  3KFU G;  2NQ8 C;  1NO1 A;  3GQ3 A;  5DYG A;  5IRE B;  3C3E A;  3U6C A;  4MGH A;  2ERC A;  2J7O A;  3H4J A;  4IBI A;  4HEO A;  1K3W A;  3GLG B;  4JI3 M;  2CUZ A;  3CF2 A;  3HKP A;  3QYB A;  1XC8 A;  4LGM A;  4IIW A;  4MGK E;  3GLF A;  2LVP C;  2RRU A;  2GNO A;  3AV0 A;  2HHH M; 
#chains in the Genus database with same CATH homology
 2OOB A;  1IXS A;  1QZE A;  1DO0 A;  2G3Q A;  2LTU A;  4F2L A;  1NV9 A;  3FRI A;  1P3Q Q;  5DFL A;  1SG9 A;  2QSF X;  3E21 A;  2QNJ A;  2DI0 A;  1YLA A;  1ZV1 A;  2DNA A;  1JR3 E;  2L4F A;  2LVN C;  1ZMV A;  4WP2 A;  2RRU A;  2HWJ A;  2L4E A;  2KNZ A;  2LBC A;  1NV8 A;  1MN3 A;  1WHC A;  1VG5 A;  1HT2 E;  1KYI A;  2EJS A;  1DV0 A;  2DZL A;  2JUJ A;  2CWB A;  2MJ5 B;  4G3O A;  2BWE A;  2JZ1 A;  1EFU B;  2DAG A;  2HAK A;  3LCV B;  3GLG E;  1OAI A;  1HQY E;  1E94 E;  1V92 A;  3BBZ A;  1WGL A;  2JNH A;  2KHH A;  1VQ1 A;  2CP8 A;  3IHP A;  1F4I A;  2ZTD A;  4F1I A;  1G3I A;  2MR9 A;  1A5T A;  2JY5 A;  1TR8 A;  2JY6 B;  2DAI A;  3FRH A;  3T6P A;  1T43 A;  2QHO B;  2WZJ A;  1GO5 A;  2JY8 A;  1CUK A;  2KNV A;  1WIV A;  1PGY A;  1Y8G A;  1VEJ A;  2LVP C;  2DEN A;  1T6O A;  1R4G A;  3B89 A;  2BWB A;  3MMP A;  4Q7J A;  1XXH E;  1VDL A;  1HJP A;  2R0I A;  3E46 A;  1OKS A;  3LCU A;  3K9P A;  2L2D A;  1G41 A;  2KNA A;  1IM2 A;  2MGW A;  2OO9 A;  1XB2 B;  2JY7 A;  1Q02 A;  2JZ0 A;  2DKL A;  3GLH E;  3K9O A;  2DHY A;  5JI2 E;  1TTE A;  1VEK A;  2MRO B;  1C7Y A;  3GLI E;  3IEC A;  1VEG A;  2EKK A;  1WGN A;  2DAM A;  1ZMW A;  4UN2 B;  4DBG B;  4R71 A;  2ZTC A;  2K0B X;  2DAK A;  2DAE A;  1IFY A;  3F92 A;  2H5X A;  2EKF A;  1WR1 B;  2LVO C;  2LVQ D;  3GLF E;  1HT1 E;  2B3T A;  1OQY A;  1G4A E;  4GEW A;  1AIP C;  1DO2 A;  3H4J A;  1UFZ A;  4HEO A;  1BVS A;  3FE3 A;  1OTR A;  2O25 A;  1ZMU A;  2K9D A;  2LVA A;  1WJ7 A;  2OOA A;  2JP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...