4DBGB

Crystal structure of hoil-1l-ubl complexed with a hoip-uba derivative
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
DKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords RanBP-type and C3HC4-type zinc finger-containing protein 1
publication title A non-canonical UBA-UBL interaction forms the linear-ubiquitin-chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16678 HOIP-UBA HOIP UBA domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4dbgB02
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4dbgB03
2KNAA 2JY6B 1Q02A 2DAIA 1OTRA 2HAKA 2ZTCA 1E94E 1P3QQ 2DAEA 2H5XA 1OAIA 1ZV1A 1VDLA 1HT2E 1A5TA 2DNAA 1XB2B 1WGNA 2EJSA 2ZTDA 1SG9A 4HEOA 2OOBA 1XXHE 3GLHE 4WP2A 2OO9A 4F2LA 2B3TA 3K9OA 2L2DA 3BBZA 1VG5A 2CP8A 1CUKA 1OKSA 1WIVA 2L4FA 4DBGB 2KHHA 1IXSA 1WHCA 3H4JA 3GLIE 1YLAA 2HWJA 1HQYE 2L4EA 1T43A 1NV9A 2EKFA 3F92A 4UN2B 3LCUA 1OQYA 2DHYA 1HT1E 3FRHA 2KNVA 2OOAA 2LTUA 2JNHA 2DENA 2LVAA 2KNZA 1G4AE 2BWEA 2LVPC 3IECA 2JY8A 3IHPA 2MJ5B 2K9DA 1IFYA 1AIPC 4F1IA 1TR8A 2JZ0A 1GO5A 2LBCA 3MMPA 2JUJA 1DO2A 1WGLA 1V92A 2DI0A 2O25A 3FRIA 3GLFE 2LVNC 4G3OA 1VEKA 1VEGA 1C7YA 2JZ1A 4GEWA 2CWBA 1Y8GA 2JY5A 2JY7A 2EKKA 1UFZA 1T6OA 2QSFX 1ZMWA 2R0IA 2K0BX 1ZMUA 1WR1B 4Q7JA 2BWBA 2QHOB 1DV0A 2MGWA 1VEJA 3B89A 1G41A 4R71A 1WJ7A 3FE3A 2DAGA 1TTEA 5JI2E 2MROB 3E46A 2MR9A 1DO0A 2RRUA 1KYIA 2WZJA 2DKLA 1HJPA 5DFLA 1F4IA 3LCVB 3GLGE 2QNJA 1ZMVA 1QZEA 3T6PA 1JR3E 3E21A 2G3QA 2JP7A 1G3IA 1IM2A 1EFUB 2DAKA 1PGYA 2DAMA 1BVSA 1VQ1A 2LVOC 2LVQD 2DZLA 1NV8A 1MN3A 1R4GA 3K9PA
chains in the Genus database with same CATH superfamily
3HZJA 2JY6B 1Q02A 3T38A 3HHZA 4JI7M 1QVRA 1VDDA 1XWIA 2Z4RA 3PNYA 4XGIA 1OTRA 1QANA 4DR5M 2UXBM 1TDHA 3KS4A 1E94E 3J80S 1P3QQ 2H5XA 4ANRA 1JB0F 4LJ8A 1PJTA 4LF5M 3HX3A 1PJQA 1NHWC 3PVSA 4MGIE 1IN6A 2GNOA 1XB2B 2XH9A 4MGYE 3PNVA 5DYIA 1N34M 3FKEA 1IBLM 5IWAM 1G71A 1GJSA 4JN6A 1N75A 3FYCA 1MX0A 3FTCA 3K9OA 5GKNA 3ZCBB 2C96A 3EIHA 2R62A 3FUXA 2GQFA 4FWDA 1I94M 1J09A 2E5LM 4IBKA 1QZMA 2G8LA 2CP8A 5E26A 4DR1M 4I5SA 3NBIA 4GIPA 1OKSA 3KOWE 4JI0M 4G4OA 5KQDA 4AKIA 2CHVA 5ITQA 4NSRA 1WHCA 2HHHM 4QNMA 4GH9A 4LRTA 2L4EA 1NV9A 3DFZA 2EKFA 3A98B 2XF3A 4IBDA 4IBFA 4UN2B 1G59A 5KPZA 2OOAA 2CE7A 5BR8M 2LTUA 4LZJA 4QOSA 2DENA 3LQQA 2X8AA 3M0EA 1MJGM 3SYLA 4JI4M 3LW5F 1G4AE 5KPTA 2LVPC 1PRBA 5C1BA 1IXZA 3UGJA 1D0KA 4MB7A 2MJ5B 3GQ3A 2F4VM 2D7GA 3FUTA 1IFYA 4BB9A 3NBXX 2JZ0A 3MJ5A 3GLHB 4QHSA 4I8OA 2LBCA 1E32A 4KHPM 4IBJA 4NC6A 4DUZM 4Z6YA 1E9SA 2L6OA 4REZA 2J7OA 3AOEC 2UXDM 3AJIB 3GPYA 2CEAA 3HU3A 4LF9M 3RGPA 1VEGA 3FUVA 1N33M 2JZ1A 2L7IA 3L26A 4X62M 2JY7A 2YR0A 3C9PA 4PDGA 2EKKA 3DZDA 5ITYA 3L27A 1XMOM 2HL7A 4DV4M 4KODA 8CATA 1N32M 3JR5A 2VQFM 3SASA 4QOZC 1QAMA 4D80A 5EP1A 2BWBA 1Q3BA 2C98A 4GC9A 2XFSA 1E9RA 1SXJB 1YSYA 3QAUA 4AZFA 3KOXE 4IBCA 5KPRA 2C99A 2CFOA 3AOEA 3B89A 1R6BX 1N36M 2LNHC 2M5ZA 1G41A 2QBYB 2OQ4A 3HHYA 3TPZA 4B7HA 3WHKA 1NVMA 3E46A 4LRSA 5F3WA 1WXQA 5E6JA 3SAUA 1KYIA 1QUTA 3GRVA 3Q8XA 3JAMS 2F5NA 1NJFA 4DR7M 1GJTA 2CHGA 3T6PA 3E21A 3U6SA 1G8PA 3U5ZA 3VLFB 1PJIA 3I01M 4AG5A 5EQTA 3SFZA 2G3QA 4NXNM 3SHGB 1G3IA 2DAMA 4K0KM 1PGYA 3C3EA 3KDSE 3W0LB 3W68A 4HLQA 1NV8A 2F5SA 3I4YA 2RKOA 1LTMA 1HNZM 4XK8F 4BBAA 5EXSA 4YY3M 3L29A 2KXEA 1EIJA 2DAIA 4LJAA 4CIZA 2ZTCA 2VDBB 4KT0F 1TGUA 2LXEA 2YFQA 5EP4A 3HGIA 4JI2M 4DR6M 2DAEA 1OAIA 1NSFA 4LY6A 1XXHA 1QDRA 1TH3A 2M60A 1KFVA 2KRUA 1Z6TA 1SG9A 4HEOA 3A46A 2OOBA 1XXHE 3GLFB 3UK6A 2I7NA 3AOGA 3UMMA 2X49A 3T1HM 2OO9A 4F2LA 1R7RA 3CGWA 2K6BA 3U60B 3I04M 2ZBKB 3ZH9B 2Z7JA 3GLGB 2XFTA 2CV0A 1VG5A 1CUKA 4LF8M 2O01F 4Y28F 2FS1A 3C3DA 2UUBM 1TH2A 4NOOB 2Y20A 1K3XA 2L4FA 3KFUG 4FCWA 2A5YB 1K3WA 4GKJM 1X37A 4G6ZA 2HWJA 3LVWA 1T43A 4PD2A 3F92A 1Q39A 3KOZE 3LCUA 5DYGA 3U6OA 1HT1E 4L4UA 1R2YA 4OW0A 3R8FA 1QAOA 3I4VA 4L6V6 4PDIA 3AV0A 2JNHA 2MH8A 3HHXA 2CUZA 2JXNA 2LVAA 4II7A 2KNZA 1QQWA 5LMNM 2Z8YM 2BWEA 4NRWA 1L8QA 1D2NA 1XNQM 3IHPA 4LFAM 4Z8XA 5EJCA 4DR4M 5EXXA 2O5RA 2QENA 3DA1A 3HU1A 3KW6A 4F1IA 2XLJA 4AW4A 4RNAA 3ILKA 2F5OA 1C1KA 3MMPA 2JUJA 2XSZD 1DO2A 1WGLA 2DI0A 3CF6E 3NWLA 3R9XB 3UZUA 3OTOM 1L1TA 3GQ4A 1IN7A 4CISA 4FWGA 2LVNC 5L8RF 4G3OA 4G4QA 1VEKA 1GABA 1IN8A 3U6MA 1GLNA 2P5TA 2XSZA 1C7YA 1IBMM 3HU2A 2V1UA 2UXCM 2APLA 3SARA 2I7PA 2R45A 3B9PA 2JY5A 1GL7A 4AG6A 3KVWA 4CJ6A 3AKZA 1YUBA 4FWHA 2X4AA 1UFZA 5FTJA 4DV3M 1H6UA 1ZMWA 1DGGA 2R0IA 2VF8A 3EIEA 3THGA 3U61A 3RE8A 1WR1B 1HNXM 3TE6A 2Y0QA 3K2LA 5JI3E 4DUYM 2YNMD 1V34A 4CGYB 2C5RA 3TQSA 4OU7A 2CRUA 1KSFX 3BXWA 3FTEA 4AKHA 4P17A 1XMQM 4XBOA 1JR3D 1TDZA 1R5LA 1WJ7A 4GHAA 2DAGA 4IBGA 5ITRA 5JI2E 2MROB 2MR9A 1DO0A 2RRUA 2JA2A 4B3RM 4P16A 2XZFA 4DV6M 1JR3A 2WZJA 2DKLA 1HJPA 1F4IA 2C9OA 4ITQA 4QNRA 5ITXA 2QNJA 2VIIA 4AQYM 2G5GX 4OVZA 1Z5CA 2KEBA 3SHFA 1JR3E 1NJGA 5KQ8A 3KS8A 3K92A 4IBBA 1IY2A 3LMMA 2EA0A 3GLIB 3CF0A 5ITXE 1IY1A 4IBIA 3FTFA 4G4RA 4L78A 2DAKA 2LVQD 1IXSB 3T15A 1VQ1A 4DV7M 1Z59A 4MGKE 3SAWA 3D8LA 1R4GA 5EXTA 4L16A 2R6FA 4RKUF 3K9PA 1S3SA 2KNAA 1Z5AA 4OX9M 2L7HA 4YHHM 5IT9S 1OFIA 3CF2A 2FOIC 2D7EA 3FD9A 4GKKM 1N78A 4IJEA 1ZV1A 2DWMA 1VDLA 1IN5A 2L09A 2QBYA 2KDLA 3SC3A 1I4WA 1WGNA 2ZTDA 4M9ZA 3E4RA 3GQ5A 1FJGM 1ZQ9A 4GC5A 2KZSA 4WP2A 1YE9A 4BLCA 3LQRA 2B3TA 3VDUA 4X65M 4B7GA 1ZAEA 1DGBA 2LHCA 3BBZA 2VQEM 5DNYA 2Y21A 2WSEF 2KW0A 3J2PB 4JI5M 4FCVA 3AFHA 2WSCF 3DOAA 3QYBA 4IJFA 1OFHA 5IREB 3H4JA 2UU9M 3LVVA 4LCBA 4W5WA 1LV7A 1YLAA 1PJJA 2DHRA 3KP1E 4B08A 1FNNA 3SMPA 2HKJA 4D82A 1IN4A 3VDPA 1NNJA 4LF7M 3HKPA 1NY6A 1OQYA 2DHYA 3FTDA 3W0FA 4LGMA 4WURA 3J7AS 1DGHA 4LZZA 2KNVA 1XHBA 2UUCM 4G4NA 1R2ZA 4MH0E 1QYRA 3GRYA 2XEPA 4LJ4A 4X64M 3B7ZA 1DV0A 3A42A 3IECA 4NL4H 3C58A 2DZOB 3U6CA 2ZANA 4GMQA 1D0LA 1AIPC 3D8BA 3TL4X 3GLFA 3M7GA 3GRUA 1XXHB 3GRRA 1V92A 2O25A 3HJQA 4NRVA 3FRIA 3GLFE 1Z5BA 5EP2A 2W82A 1J7KA 1QUSA 1Q3CA 3J27B 1L2DA 2XZUA 4NXMM 2JWSA 1HNWM 2BNKA 3CTWB 5FTNA 1W5TA 4B7FA 3H4MA 1T6OA 3K1JA 3SATA 3AL0C 4A3VB 1NY5A 2BJWA 1ZMUA 3VFDA 3VK8A 3GPUA 5FTMA 5EP3A 2DVWB 2EO2A 3U6QA 3MHVC 3SAVA 4JYAM 4WW0A 4LFCM 2QHOB 3PFIA 3SBJA 1VEJA 2LWXA 3HJ8A 2F5PA 3VKGA 2Z3XA 1TTEA 4JI1M 4ZPXA 1OIPA 1PJSA 7CATA 1IQPA 1QAQA 5BPVA 1GVNA 2UUAM 2R18A 4B3TM 4R3DA 4DV2M 4M9SA 3HY5A 3LCVB 4MGHA 4M9XA 5H37D 3U6LA 2CHQA 1ZMVA 3SMSA 2Z4SA 4JI3M 1TH4A 3GO8A 3HHWA 4FVMA 1XNRM 3IG5A 3BOSA 1OAOC 2R44A 4NSOB 1NHGC 4DR2M 3U6DA 2JP7A 1IBKM 4I81A 5FLXS 2F5QA 1IM2A 2LVOC 3IG8A 4IBEA 3TWMA 2DZLA 4L8RC 4MGZE 2R65A 4JV5M 4HL4A 1QDTA 4LFBM 2LHGA 5LMUM 2RGHA 2HAKA 4TUWA 2N35A 3Q8GA 4KO8A 3U61B 1HT2E 1XC8A 1A5TA 2DNAA 2XGNA 3GLHA 2LH0A 5IZ7D 3QYEA 4DR3M 2V6ZM 3A45A 3KP0E 4I4LA 4LJ6A 4M0WA 5A2QS 1SXJC 2EJSA 4GITA 1GL6A 2C9CA 3V76A 4AI6A 3SYKA 3GLHE 3WHLA 3KSXA 1T3TA 3RFWA 4R7GA 2FNAA 2QQ8A 4KLNA 4DV1M 2DWLA 1JQJC 5FTLA 1HQCA 4GRIA 2L2DA 1NNUC 5KO3A 4DV5M 4S12A 4JI8M 1SXJD 3FYDA 4LF6M 3KSJA 1OIZA 3KOYE 4EIWA 3GLIA 1ORYB 3T1YM 2R46A 4GHLA 1WIVA 1V33A 2R4EA 3U6EA 4DBGB 4JXJA 3E9SA 4OVZB 2KHHA 1IXSA 5C18A 5ITUA 3JR4A 3GLIE 2DWNA 1SXJA 4RF1A 1HQYE 2DXIA 1D0MA 2Q2EB 2HCBA 3L25A 3L28A 3L2AA 3FRHA 4DV0M 2ERCA 1SXJE 3M6AA 3I51A 1AUAA 2J7NA 3MK6A 5ITTA 5FSWA 4PCZA 2JY8A 4FD2A 4B3SM 2FH0A 1IXRC 2K9DA 1PM5A 3B74A 1W5SA 4B3MM 1TR8A 2K47A 2OPFA 1GO5A 4CHTB 2V1CA 2RGOA 2EUCA 3J81S 4LG2A 2CV1A 3ZQJA 3FUWA 3GP1A 4RF0A 4IIWA 2H1RA 3B7QA 3U5ZB 4X66M 4GEWA 2CWBA 1Y8GA 3U6PA 3B7NA 3VK7A 2KRKA 4PT5A 2QSFX 2K0BX 3PXGA 1HR0M 4D81A 3HJSA 1RU3A 4Q7JA 2ZAMA 2ZM6M 2VF7A 1NO1A 2WSFF 4LF4M 2YQZA 3K8ZA 1IY0A 4MM3B 2MGWA 3ZC7B 3VKHA 3RGSA 1MU5A 2QCUA 1DGHB 4FCTA 4FW9A 1TF0B 3FE3A 4R71A 2J5YA 1GKIA 3GPPA 3U60A 2FE8A 2DWZB 2QZ4A 1L1ZA 3FUUA 1DGFA 4LJ9A 3GLGA 4AKGA 1EE8A 2KZUA 1UM8A 3KXEC 4LJ7A 3J7BA 2BJVA 5DFLA 2CV2A 2KA6B 4JI6M 2DZNB 2R4JA 1OJLA 2D7HA 3GLGE 4LJ5A 3UJNA 2QP9X 1QZEA 2QPAA 3TWLA 2FFJA 2ZAOA 1L2CA 1J5EM 3QWLA 4LGYA 5EXPA 2Y0TA 2AHMA 5FTKA 4QHTA 1EFUB 4M0DA 3TWKA 4L15A 1BVSA 1N77A 1K82A 3HWSA 3GPXA 1MN3A 3W67A 1L2BA 2NQ8C
chains in the Genus database with same CATH topology
2KNAA 2JY6B 1Q02A 2DAIA 1OTRA 2HAKA 2ZTCA 1E94E 1P3QQ 2DAEA 2H5XA 1OAIA 1ZV1A 1VDLA 1HT2E 1A5TA 2DNAA 1XB2B 1WGNA 2EJSA 2ZTDA 1SG9A 4HEOA 2OOBA 1XXHE 3GLHE 4WP2A 2OO9A 4F2LA 2B3TA 3K9OA 2L2DA 3BBZA 1VG5A 2CP8A 1CUKA 1OKSA 1WIVA 2L4FA 4DBGB 2KHHA 1IXSA 1WHCA 3H4JA 3GLIE 1YLAA 2HWJA 1HQYE 2L4EA 1T43A 1NV9A 2EKFA 3F92A 4UN2B 3LCUA 1OQYA 2DHYA 1HT1E 3FRHA 2KNVA 2OOAA 2LTUA 2JNHA 2DENA 2LVAA 2KNZA 1G4AE 2BWEA 2LVPC 3IECA 2JY8A 3IHPA 2MJ5B 2K9DA 1IFYA 1AIPC 4F1IA 1TR8A 2JZ0A 1GO5A 2LBCA 3MMPA 2JUJA 1DO2A 1WGLA 1V92A 2DI0A 2O25A 3FRIA 3GLFE 2LVNC 4G3OA 1VEKA 1VEGA 1C7YA 2JZ1A 4GEWA 2CWBA 1Y8GA 2JY5A 2JY7A 2EKKA 1UFZA 1T6OA 2QSFX 1ZMWA 2R0IA 2K0BX 1ZMUA 1WR1B 4Q7JA 2BWBA 2QHOB 1DV0A 2MGWA 1VEJA 3B89A 1G41A 4R71A 1WJ7A 3FE3A 2DAGA 1TTEA 5JI2E 2MROB 3E46A 2MR9A 1DO0A 2RRUA 1KYIA 2WZJA 2DKLA 1HJPA 5DFLA 1F4IA 3LCVB 3GLGE 2QNJA 1ZMVA 1QZEA 3T6PA 1JR3E 3E21A 2G3QA 2JP7A 1G3IA 1IM2A 1EFUB 2DAKA 1PGYA 2DAMA 1BVSA 1VQ1A 2LVOC 2LVQD 2DZLA 1NV8A 1MN3A 1R4GA 3K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNA A;  2JY6 B;  1Q02 A;  2DAI A;  1OTR A;  2HAK A;  2ZTC A;  1E94 E;  1P3Q Q;  2DAE A;  2H5X A;  1OAI A;  1ZV1 A;  1VDL A;  1HT2 E;  1A5T A;  2DNA A;  1XB2 B;  1WGN A;  2EJS A;  2ZTD A;  1SG9 A;  4HEO A;  2OOB A;  1XXH E;  3GLH E;  4WP2 A;  2OO9 A;  4F2L A;  2B3T A;  3K9O A;  2L2D A;  3BBZ A;  1VG5 A;  2CP8 A;  1CUK A;  1OKS A;  1WIV A;  2L4F A;  4DBG B;  2KHH A;  1IXS A;  1WHC A;  3H4J A;  3GLI E;  1YLA A;  2HWJ A;  1HQY E;  2L4E A;  1T43 A;  1NV9 A;  2EKF A;  3F92 A;  4UN2 B;  3LCU A;  1OQY A;  2DHY A;  1HT1 E;  3FRH A;  2KNV A;  2OOA A;  2LTU A;  2JNH A;  2DEN A;  2LVA A;  2KNZ A;  1G4A E;  2BWE A;  2LVP C;  3IEC A;  2JY8 A;  3IHP A;  2MJ5 B;  2K9D A;  1IFY A;  1AIP C;  4F1I A;  1TR8 A;  2JZ0 A;  1GO5 A;  2LBC A;  3MMP A;  2JUJ A;  1DO2 A;  1WGL A;  1V92 A;  2DI0 A;  2O25 A;  3FRI A;  3GLF E;  2LVN C;  4G3O A;  1VEK A;  1VEG A;  1C7Y A;  2JZ1 A;  4GEW A;  2CWB A;  1Y8G A;  2JY5 A;  2JY7 A;  2EKK A;  1UFZ A;  1T6O A;  2QSF X;  1ZMW A;  2R0I A;  2K0B X;  1ZMU A;  1WR1 B;  4Q7J A;  2BWB A;  2QHO B;  1DV0 A;  2MGW A;  1VEJ A;  3B89 A;  1G41 A;  4R71 A;  1WJ7 A;  3FE3 A;  2DAG A;  1TTE A;  5JI2 E;  2MRO B;  3E46 A;  2MR9 A;  1DO0 A;  2RRU A;  1KYI A;  2WZJ A;  2DKL A;  1HJP A;  5DFL A;  1F4I A;  3LCV B;  3GLG E;  2QNJ A;  1ZMV A;  1QZE A;  3T6P A;  1JR3 E;  3E21 A;  2G3Q A;  2JP7 A;  1G3I A;  1IM2 A;  1EFU B;  2DAK A;  1PGY A;  2DAM A;  1BVS A;  1VQ1 A;  2LVO C;  2LVQ D;  2DZL A;  1NV8 A;  1MN3 A;  1R4G A;  3K9P A; 
#chains in the Genus database with same CATH topology
 3HZJ A;  2JY6 B;  1Q02 A;  3T38 A;  3HHZ A;  4JI7 M;  1QVR A;  1VDD A;  1XWI A;  2Z4R A;  3PNY A;  4XGI A;  1OTR A;  1QAN A;  4DR5 M;  2UXB M;  1TDH A;  3KS4 A;  1E94 E;  3J80 S;  1P3Q Q;  2H5X A;  4ANR A;  1JB0 F;  4LJ8 A;  1PJT A;  4LF5 M;  3HX3 A;  1PJQ A;  1NHW C;  3PVS A;  4MGI E;  1IN6 A;  2GNO A;  1XB2 B;  2XH9 A;  4MGY E;  3PNV A;  5DYI A;  1N34 M;  3FKE A;  1IBL M;  5IWA M;  1G71 A;  1GJS A;  4JN6 A;  1N75 A;  3FYC A;  1MX0 A;  3FTC A;  3K9O A;  5GKN A;  3ZCB B;  2C96 A;  3EIH A;  2R62 A;  3FUX A;  2GQF A;  4FWD A;  1I94 M;  1J09 A;  2E5L M;  4IBK A;  1QZM A;  2G8L A;  2CP8 A;  5E26 A;  4DR1 M;  4I5S A;  3NBI A;  4GIP A;  1OKS A;  3KOW E;  4JI0 M;  4G4O A;  5KQD A;  4AKI A;  2CHV A;  5ITQ A;  4NSR A;  1WHC A;  2HHH M;  4QNM A;  4GH9 A;  4LRT A;  2L4E A;  1NV9 A;  3DFZ A;  2EKF A;  3A98 B;  2XF3 A;  4IBD A;  4IBF A;  4UN2 B;  1G59 A;  5KPZ A;  2OOA A;  2CE7 A;  5BR8 M;  2LTU A;  4LZJ A;  4QOS A;  2DEN A;  3LQQ A;  2X8A A;  3M0E A;  1MJG M;  3SYL A;  4JI4 M;  3LW5 F;  1G4A E;  5KPT A;  2LVP C;  1PRB A;  5C1B A;  1IXZ A;  3UGJ A;  1D0K A;  4MB7 A;  2MJ5 B;  3GQ3 A;  2F4V M;  2D7G A;  3FUT A;  1IFY A;  4BB9 A;  3NBX X;  2JZ0 A;  3MJ5 A;  3GLH B;  4QHS A;  4I8O A;  2LBC A;  1E32 A;  4KHP M;  4IBJ A;  4NC6 A;  4DUZ M;  4Z6Y A;  1E9S A;  2L6O A;  4REZ A;  2J7O A;  3AOE C;  2UXD M;  3AJI B;  3GPY A;  2CEA A;  3HU3 A;  4LF9 M;  3RGP A;  1VEG A;  3FUV A;  1N33 M;  2JZ1 A;  2L7I A;  3L26 A;  4X62 M;  2JY7 A;  2YR0 A;  3C9P A;  4PDG A;  2EKK A;  3DZD A;  5ITY A;  3L27 A;  1XMO M;  2HL7 A;  4DV4 M;  4KOD A;  8CAT A;  1N32 M;  3JR5 A;  2VQF M;  3SAS A;  4QOZ C;  1QAM A;  4D80 A;  5EP1 A;  2BWB A;  1Q3B A;  2C98 A;  4GC9 A;  2XFS A;  1E9R A;  1SXJ B;  1YSY A;  3QAU A;  4AZF A;  3KOX E;  4IBC A;  5KPR A;  2C99 A;  2CFO A;  3AOE A;  3B89 A;  1R6B X;  1N36 M;  2LNH C;  2M5Z A;  1G41 A;  2QBY B;  2OQ4 A;  3HHY A;  3TPZ A;  4B7H A;  3WHK A;  1NVM A;  3E46 A;  4LRS A;  5F3W A;  1WXQ A;  5E6J A;  3SAU A;  1KYI A;  1QUT A;  3GRV A;  3Q8X A;  3JAM S;  2F5N A;  1NJF A;  4DR7 M;  1GJT A;  2CHG A;  3T6P A;  3E21 A;  3U6S A;  1G8P A;  3U5Z A;  3VLF B;  1PJI A;  3I01 M;  4AG5 A;  5EQT A;  3SFZ A;  2G3Q A;  4NXN M;  3SHG B;  1G3I A;  2DAM A;  4K0K M;  1PGY A;  3C3E A;  3KDS E;  3W0L B;  3W68 A;  4HLQ A;  1NV8 A;  2F5S A;  3I4Y A;  2RKO A;  1LTM A;  1HNZ M;  4XK8 F;  4BBA A;  5EXS A;  4YY3 M;  3L29 A;  2KXE A;  1EIJ A;  2DAI A;  4LJA A;  4CIZ A;  2ZTC A;  2VDB B;  4KT0 F;  1TGU A;  2LXE A;  2YFQ A;  5EP4 A;  3HGI A;  4JI2 M;  4DR6 M;  2DAE A;  1OAI A;  1NSF A;  4LY6 A;  1XXH A;  1QDR A;  1TH3 A;  2M60 A;  1KFV A;  2KRU A;  1Z6T A;  1SG9 A;  4HEO A;  3A46 A;  2OOB A;  1XXH E;  3GLF B;  3UK6 A;  2I7N A;  3AOG A;  3UMM A;  2X49 A;  3T1H M;  2OO9 A;  4F2L A;  1R7R A;  3CGW A;  2K6B A;  3U60 B;  3I04 M;  2ZBK B;  3ZH9 B;  2Z7J A;  3GLG B;  2XFT A;  2CV0 A;  1VG5 A;  1CUK A;  4LF8 M;  2O01 F;  4Y28 F;  2FS1 A;  3C3D A;  2UUB M;  1TH2 A;  4NOO B;  2Y20 A;  1K3X A;  2L4F A;  3KFU G;  4FCW A;  2A5Y B;  1K3W A;  4GKJ M;  1X37 A;  4G6Z A;  2HWJ A;  3LVW A;  1T43 A;  4PD2 A;  3F92 A;  1Q39 A;  3KOZ E;  3LCU A;  5DYG A;  3U6O A;  1HT1 E;  4L4U A;  1R2Y A;  4OW0 A;  3R8F A;  1QAO A;  3I4V A;  4L6V 6;  4PDI A;  3AV0 A;  2JNH A;  2MH8 A;  3HHX A;  2CUZ A;  2JXN A;  2LVA A;  4II7 A;  2KNZ A;  1QQW A;  5LMN M;  2Z8Y M;  2BWE A;  4NRW A;  1L8Q A;  1D2N A;  1XNQ M;  3IHP A;  4LFA M;  4Z8X A;  5EJC A;  4DR4 M;  5EXX A;  2O5R A;  2QEN A;  3DA1 A;  3HU1 A;  3KW6 A;  4F1I A;  2XLJ A;  4AW4 A;  4RNA A;  3ILK A;  2F5O A;  1C1K A;  3MMP A;  2JUJ A;  2XSZ D;  1DO2 A;  1WGL A;  2DI0 A;  3CF6 E;  3NWL A;  3R9X B;  3UZU A;  3OTO M;  1L1T A;  3GQ4 A;  1IN7 A;  4CIS A;  4FWG A;  2LVN C;  5L8R F;  4G3O A;  4G4Q A;  1VEK A;  1GAB A;  1IN8 A;  3U6M A;  1GLN A;  2P5T A;  2XSZ A;  1C7Y A;  1IBM M;  3HU2 A;  2V1U A;  2UXC M;  2APL A;  3SAR A;  2I7P A;  2R45 A;  3B9P A;  2JY5 A;  1GL7 A;  4AG6 A;  3KVW A;  4CJ6 A;  3AKZ A;  1YUB A;  4FWH A;  2X4A A;  1UFZ A;  5FTJ A;  4DV3 M;  1H6U A;  1ZMW A;  1DGG A;  2R0I A;  2VF8 A;  3EIE A;  3THG A;  3U61 A;  3RE8 A;  1WR1 B;  1HNX M;  3TE6 A;  2Y0Q A;  3K2L A;  5JI3 E;  4DUY M;  2YNM D;  1V34 A;  4CGY B;  2C5R A;  3TQS A;  4OU7 A;  2CRU A;  1KSF X;  3BXW A;  3FTE A;  4AKH A;  4P17 A;  1XMQ M;  4XBO A;  1JR3 D;  1TDZ A;  1R5L A;  1WJ7 A;  4GHA A;  2DAG A;  4IBG A;  5ITR A;  5JI2 E;  2MRO B;  2MR9 A;  1DO0 A;  2RRU A;  2JA2 A;  4B3R M;  4P16 A;  2XZF A;  4DV6 M;  1JR3 A;  2WZJ A;  2DKL A;  1HJP A;  1F4I A;  2C9O A;  4ITQ A;  4QNR A;  5ITX A;  2QNJ A;  2VII A;  4AQY M;  2G5G X;  4OVZ A;  1Z5C A;  2KEB A;  3SHF A;  1JR3 E;  1NJG A;  5KQ8 A;  3KS8 A;  3K92 A;  4IBB A;  1IY2 A;  3LMM A;  2EA0 A;  3GLI B;  3CF0 A;  5ITX E;  1IY1 A;  4IBI A;  3FTF A;  4G4R A;  4L78 A;  2DAK A;  2LVQ D;  1IXS B;  3T15 A;  1VQ1 A;  4DV7 M;  1Z59 A;  4MGK E;  3SAW A;  3D8L A;  1R4G A;  5EXT A;  4L16 A;  2R6F A;  4RKU F;  3K9P A;  1S3S A;  2KNA A;  1Z5A A;  4OX9 M;  2L7H A;  4YHH M;  5IT9 S;  1OFI A;  3CF2 A;  2FOI C;  2D7E A;  3FD9 A;  4GKK M;  1N78 A;  4IJE A;  1ZV1 A;  2DWM A;  1VDL A;  1IN5 A;  2L09 A;  2QBY A;  2KDL A;  3SC3 A;  1I4W A;  1WGN A;  2ZTD A;  4M9Z A;  3E4R A;  3GQ5 A;  1FJG M;  1ZQ9 A;  4GC5 A;  2KZS A;  4WP2 A;  1YE9 A;  4BLC A;  3LQR A;  2B3T A;  3VDU A;  4X65 M;  4B7G A;  1ZAE A;  1DGB A;  2LHC A;  3BBZ A;  2VQE M;  5DNY A;  2Y21 A;  2WSE F;  2KW0 A;  3J2P B;  4JI5 M;  4FCV A;  3AFH A;  2WSC F;  3DOA A;  3QYB A;  4IJF A;  1OFH A;  5IRE B;  3H4J A;  2UU9 M;  3LVV A;  4LCB A;  4W5W A;  1LV7 A;  1YLA A;  1PJJ A;  2DHR A;  3KP1 E;  4B08 A;  1FNN A;  3SMP A;  2HKJ A;  4D82 A;  1IN4 A;  3VDP A;  1NNJ A;  4LF7 M;  3HKP A;  1NY6 A;  1OQY A;  2DHY A;  3FTD A;  3W0F A;  4LGM A;  4WUR A;  3J7A S;  1DGH A;  4LZZ A;  2KNV A;  1XHB A;  2UUC M;  4G4N A;  1R2Z A;  4MH0 E;  1QYR A;  3GRY A;  2XEP A;  4LJ4 A;  4X64 M;  3B7Z A;  1DV0 A;  3A42 A;  3IEC A;  4NL4 H;  3C58 A;  2DZO B;  3U6C A;  2ZAN A;  4GMQ A;  1D0L A;  1AIP C;  3D8B A;  3TL4 X;  3GLF A;  3M7G A;  3GRU A;  1XXH B;  3GRR A;  1V92 A;  2O25 A;  3HJQ A;  4NRV A;  3FRI A;  3GLF E;  1Z5B A;  5EP2 A;  2W82 A;  1J7K A;  1QUS A;  1Q3C A;  3J27 B;  1L2D A;  2XZU A;  4NXM M;  2JWS A;  1HNW M;  2BNK A;  3CTW B;  5FTN A;  1W5T A;  4B7F A;  3H4M A;  1T6O A;  3K1J A;  3SAT A;  3AL0 C;  4A3V B;  1NY5 A;  2BJW A;  1ZMU A;  3VFD A;  3VK8 A;  3GPU A;  5FTM A;  5EP3 A;  2DVW B;  2EO2 A;  3U6Q A;  3MHV C;  3SAV A;  4JYA M;  4WW0 A;  4LFC M;  2QHO B;  3PFI A;  3SBJ A;  1VEJ A;  2LWX A;  3HJ8 A;  2F5P A;  3VKG A;  2Z3X A;  1TTE A;  4JI1 M;  4ZPX A;  1OIP A;  1PJS A;  7CAT A;  1IQP A;  1QAQ A;  5BPV A;  1GVN A;  2UUA M;  2R18 A;  4B3T M;  4R3D A;  4DV2 M;  4M9S A;  3HY5 A;  3LCV B;  4MGH A;  4M9X A;  5H37 D;  3U6L A;  2CHQ A;  1ZMV A;  3SMS A;  2Z4S A;  4JI3 M;  1TH4 A;  3GO8 A;  3HHW A;  4FVM A;  1XNR M;  3IG5 A;  3BOS A;  1OAO C;  2R44 A;  4NSO B;  1NHG C;  4DR2 M;  3U6D A;  2JP7 A;  1IBK M;  4I81 A;  5FLX S;  2F5Q A;  1IM2 A;  2LVO C;  3IG8 A;  4IBE A;  3TWM A;  2DZL A;  4L8R C;  4MGZ E;  2R65 A;  4JV5 M;  4HL4 A;  1QDT A;  4LFB M;  2LHG A;  5LMU M;  2RGH A;  2HAK A;  4TUW A;  2N35 A;  3Q8G A;  4KO8 A;  3U61 B;  1HT2 E;  1XC8 A;  1A5T A;  2DNA A;  2XGN A;  3GLH A;  2LH0 A;  5IZ7 D;  3QYE A;  4DR3 M;  2V6Z M;  3A45 A;  3KP0 E;  4I4L A;  4LJ6 A;  4M0W A;  5A2Q S;  1SXJ C;  2EJS A;  4GIT A;  1GL6 A;  2C9C A;  3V76 A;  4AI6 A;  3SYK A;  3GLH E;  3WHL A;  3KSX A;  1T3T A;  3RFW A;  4R7G A;  2FNA A;  2QQ8 A;  4KLN A;  4DV1 M;  2DWL A;  1JQJ C;  5FTL A;  1HQC A;  4GRI A;  2L2D A;  1NNU C;  5KO3 A;  4DV5 M;  4S12 A;  4JI8 M;  1SXJ D;  3FYD A;  4LF6 M;  3KSJ A;  1OIZ A;  3KOY E;  4EIW A;  3GLI A;  1ORY B;  3T1Y M;  2R46 A;  4GHL A;  1WIV A;  1V33 A;  2R4E A;  3U6E A;  4DBG B;  4JXJ A;  3E9S A;  4OVZ B;  2KHH A;  1IXS A;  5C18 A;  5ITU A;  3JR4 A;  3GLI E;  2DWN A;  1SXJ A;  4RF1 A;  1HQY E;  2DXI A;  1D0M A;  2Q2E B;  2HCB A;  3L25 A;  3L28 A;  3L2A A;  3FRH A;  4DV0 M;  2ERC A;  1SXJ E;  3M6A A;  3I51 A;  1AUA A;  2J7N A;  3MK6 A;  5ITT A;  5FSW A;  4PCZ A;  2JY8 A;  4FD2 A;  4B3S M;  2FH0 A;  1IXR C;  2K9D A;  1PM5 A;  3B74 A;  1W5S A;  4B3M M;  1TR8 A;  2K47 A;  2OPF A;  1GO5 A;  4CHT B;  2V1C A;  2RGO A;  2EUC A;  3J81 S;  4LG2 A;  2CV1 A;  3ZQJ A;  3FUW A;  3GP1 A;  4RF0 A;  4IIW A;  2H1R A;  3B7Q A;  3U5Z B;  4X66 M;  4GEW A;  2CWB A;  1Y8G A;  3U6P A;  3B7N A;  3VK7 A;  2KRK A;  4PT5 A;  2QSF X;  2K0B X;  3PXG A;  1HR0 M;  4D81 A;  3HJS A;  1RU3 A;  4Q7J A;  2ZAM A;  2ZM6 M;  2VF7 A;  1NO1 A;  2WSF F;  4LF4 M;  2YQZ A;  3K8Z A;  1IY0 A;  4MM3 B;  2MGW A;  3ZC7 B;  3VKH A;  3RGS A;  1MU5 A;  2QCU A;  1DGH B;  4FCT A;  4FW9 A;  1TF0 B;  3FE3 A;  4R71 A;  2J5Y A;  1GKI A;  3GPP A;  3U60 A;  2FE8 A;  2DWZ B;  2QZ4 A;  1L1Z A;  3FUU A;  1DGF A;  4LJ9 A;  3GLG A;  4AKG A;  1EE8 A;  2KZU A;  1UM8 A;  3KXE C;  4LJ7 A;  3J7B A;  2BJV A;  5DFL A;  2CV2 A;  2KA6 B;  4JI6 M;  2DZN B;  2R4J A;  1OJL A;  2D7H A;  3GLG E;  4LJ5 A;  3UJN A;  2QP9 X;  1QZE A;  2QPA A;  3TWL A;  2FFJ A;  2ZAO A;  1L2C A;  1J5E M;  3QWL A;  4LGY A;  5EXP A;  2Y0T A;  2AHM A;  5FTK A;  4QHT A;  1EFU B;  4M0D A;  3TWK A;  4L15 A;  1BVS A;  1N77 A;  1K82 A;  3HWS A;  3GPX A;  1MN3 A;  3W67 A;  1L2B A;  2NQ8 C; 
#chains in the Genus database with same CATH homology
 2KNA A;  2JY6 B;  1Q02 A;  2DAI A;  1OTR A;  2HAK A;  2ZTC A;  1E94 E;  1P3Q Q;  2DAE A;  2H5X A;  1OAI A;  1ZV1 A;  1VDL A;  1HT2 E;  1A5T A;  2DNA A;  1XB2 B;  1WGN A;  2EJS A;  2ZTD A;  1SG9 A;  4HEO A;  2OOB A;  1XXH E;  3GLH E;  4WP2 A;  2OO9 A;  4F2L A;  2B3T A;  3K9O A;  2L2D A;  3BBZ A;  1VG5 A;  2CP8 A;  1CUK A;  1OKS A;  1WIV A;  2L4F A;  4DBG B;  2KHH A;  1IXS A;  1WHC A;  3H4J A;  3GLI E;  1YLA A;  2HWJ A;  1HQY E;  2L4E A;  1T43 A;  1NV9 A;  2EKF A;  3F92 A;  4UN2 B;  3LCU A;  1OQY A;  2DHY A;  1HT1 E;  3FRH A;  2KNV A;  2OOA A;  2LTU A;  2JNH A;  2DEN A;  2LVA A;  2KNZ A;  1G4A E;  2BWE A;  2LVP C;  3IEC A;  2JY8 A;  3IHP A;  2MJ5 B;  2K9D A;  1IFY A;  1AIP C;  4F1I A;  1TR8 A;  2JZ0 A;  1GO5 A;  2LBC A;  3MMP A;  2JUJ A;  1DO2 A;  1WGL A;  1V92 A;  2DI0 A;  2O25 A;  3FRI A;  3GLF E;  2LVN C;  4G3O A;  1VEK A;  1VEG A;  1C7Y A;  2JZ1 A;  4GEW A;  2CWB A;  1Y8G A;  2JY5 A;  2JY7 A;  2EKK A;  1UFZ A;  1T6O A;  2QSF X;  1ZMW A;  2R0I A;  2K0B X;  1ZMU A;  1WR1 B;  4Q7J A;  2BWB A;  2QHO B;  1DV0 A;  2MGW A;  1VEJ A;  3B89 A;  1G41 A;  4R71 A;  1WJ7 A;  3FE3 A;  2DAG A;  1TTE A;  5JI2 E;  2MRO B;  3E46 A;  2MR9 A;  1DO0 A;  2RRU A;  1KYI A;  2WZJ A;  2DKL A;  1HJP A;  5DFL A;  1F4I A;  3LCV B;  3GLG E;  2QNJ A;  1ZMV A;  1QZE A;  3T6P A;  1JR3 E;  3E21 A;  2G3Q A;  2JP7 A;  1G3I A;  1IM2 A;  1EFU B;  2DAK A;  1PGY A;  2DAM A;  1BVS A;  1VQ1 A;  2LVO C;  2LVQ D;  2DZL A;  1NV8 A;  1MN3 A;  1R4G A;  3K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...