3HJ8A

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
257
structure length
257
Chain Sequence
RATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 72
structure length 257
sequence length 257
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hj8A01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hj8A02
2XSRA 3PCMM 3PCBM 1YKPA 3O32A 3MI5M 3PCDM 3LKTM 3MFLA 2BUXA 2BOYA 2BUQA 1YKMA 3HJQA 1EOAA 3O5UA 3LXVM 1YKKA 2BUWA 1TMXA 3HJ8A 1YKOB 3T63A 3TH1A 3I4VA 3O6RA 1EO9A 2PCDM 4WHPB 2BUZB 4WHOB 1DMHA 3PCHM 3PCIM 3MI1M 4WHPD 2BURB 4WHOD 1S9AA 3PCMA 3PCEA 3PCKA 4WHRB 1DLMA 3PCCM 1EO2B 3PCJA 1DLQA 4WHRF 1YKOA 3LKTA 1DLTA 3PCAM 3I51A 3MV6M 2XSVA 3N9TA 3LXVA 3T67A 3PCLA 2BUVB 3PCFA 1EOBB 4WHPA 3HJSA 1YKNB 2BUZA 4WHOA 1EOCB 2BURA 2BUMB 2BUUB 2PCDA 5TD3A 3PCGM 3MFLM 3MV4M 4WHRA 4WHSB 1EO2A 3PCBA 3T63M 4WHSD 3I4YA 3MI5A 2AZQA 3PCDA 4WHQB 3PCNM 2BV0B 1YKLB 2BUVA 1EOBA 3O6JA 1YKNA 3LMXM 3PCAA 1EOCA 2BUMA 2BUUA 2XSUA 3HHYA 3PCKM 4ILVA 4WHSA 2BUYB 2BUTB 3PCJM 3PCHA 4ILTA 3PCGA 3MV4A 3PCIA 3MI1A 1YKPB 3HHXA 3T67M 4WHQA 2BUXB 3PCLM 2BV0A 1YKLA 2BUQB 3PCFM 1YKMB 1EOAB 3PCCA 3HGIA 1YKKB 2BUWB 3HKPA 1EO9B 3PCNA 3MV6A 2BUYA 3PCEM 3LMXA 2BUTA
chains in the Genus database with same CATH superfamily
4MGHA 1RU3A 2CP8A 1XMOM 3A98B 3EIHA 2F5QA 1R5LA 2XGNA 5FTMA 1ZQ9A 2L4EA 1VQ1A 3GRUA 3PNYA 4MGYE 4D80A 3O32A 3PCDM 2R0IA 2CE7A 2O5RA 1N32M 2I7PA 2Y21A 5IZ7D 3U60A 2BUXA 2BOYA 1YKMA 5FLXS 1IBKM 4IBCA 2G5GX 1SXJA 2LBCA 4IBFA 1Z59A 2XZFA 3J2PB 1E9SA 1IXSB 5LMNM 3R9XB 2K0BX 2OO9A 3SYKA 4ANRA 2DXIA 4WHPB 3H4JA 1DO0A 3U6SA 1DMHA 1TR8A 5E26A 1JR3E 1NJGA 4KHPM 4IBGA 1C1KA 2XH9A 3B7ZA 3JR4A 1Z5CA 1G8PA 2HKJA 4NSRA 4LFBM 1S9AA 3PCMA 1T3TA 5H37D 2ZBKB 1SG9A 4LFCM 3PCKA 4GIPA 2R18A 4NC6A 1DLMA 1QQWA 3ZH9B 3PCCM 1T43A 3FUVA 2QBYA 1QAQA 2ZTDA 3H4MA 4GC9A 3I04M 3VK8A 2KW0A 1QYRA 1YKOA 5C18A 2BWBA 2DAIA 1XMQM 1DLTA 2HL7A 4FWDA 4G4OA 5KPZA 3AKZA 1NO1A 1L1TA 3PCAM 2XSVA 2RRUA 3N9TA 1QDRA 1OIPA 2JNHA 3L25A 3LXVA 5IREB 3PCFA 1EOBB 3HJSA 3KP1E 3LQRA 4G3OA 2CHVA 2OOBA 2BJWA 5DNYA 2I7NA 4DR1M 4WHOA 2R6FA 2DWZB 4JN6A 3UJNA 2YQZA 4LZZA 1VEKA 2MH8A 2G8LA 3LCVB 5KQDA 4DV5M 3U6LA 4JI2M 4LGYA 1EOCB 3C9PA 5LMUM 3JR5A 2PCDA 1ZV1A 3MV4M 3GLFB 1UFZA 2RGHA 2DKLA 2J7OA 1HJPA 1PJTA 3FE3A 4FVMA 1EO2A 1L8QA 1QUTA 1DV0A 1GL6A 3GQ3A 4JI7M 3GLGB 4IBKA 3U61B 1YLAA 4OVZA 3CF6E 4AG5A 4BLCA 1ORYB 5KPRA 3AFHA 4I81A 3PCNM 3RGSA 2KA6B 3SMSA 4AI6A 3GLHB 2DHRA 3LMXM 1Z6TA 3CGWA 1NJFA 3KVWA 3GRRA 2R45A 1HNXM 4QNRA 3PCKM 5ITRA 2F4VM 1ZMUA 3T38A 5KQ8A 4M0DA 1MJGM 4DV1M 3UMMA 2BUTB 1YE9A 3GQ5A 3FYCA 4K0KM 3HX3A 3AOEC 4PDIA 3FUTA 4ILTA 1D0KA 2R44A 4A3VB 3KSXA 1OIZA 1J7KA 1P3QQ 2X4AA 3U60B 3RE8A 1TGUA 4B7HA 2BUXB 1XNRM 1IY0A 1D0MA 3PCFM 3GPUA 3SFZA 1YKMB 4GRIA 2MJ5B 1E9RA 3EIEA 2KNAA 2LHGA 3HGIA 1SXJB 1XC8A 1D0LA 2LVOC 5FTLA 1GKIA 2M60A 1E94E 3IHPA 4LJ9A 2QCUA 2HCBA 4F2LA 3U6EA 5GKNA 1QVRA 4IBEA 1PJIA 5FTJA 2LVPC 3AOEA 3KXEC 3SAVA 4DUZM 2L4FA 3L2AA 3PFIA 3KFUG 3PCEM 2JY6B 1DGHA 2YFQA 2XSRA 2Q2EB 3F92A 4I4LA 1V34A 3AOGA 4PCZA 2D7HA 1HNZM 3TWLA 1YKPA 3E21A 3IECA 4KODA 1R2ZA 4LF4M 4NXMM 1LV7A 2V1CA 3MHVC 4OU7A 4OX9M 1N78A 3M0EA 4LCBA 2QBYB 1Q3BA 3VDPA 2JZ0A 1YKOB 5EJCA 4LJAA 3O6RA 2CRUA 2L7HA 4BBAA 2JY8A 4Z8XA 2C9CA 3U5ZA 1HQCA 4AW4A 3Q8GA 1IY2A 1TH4A 4DR3M 5C1BA 1IN8A 3UGJA 2FH0A 4GITA 4DBGB 3U6QA 4WHOB 2FS1A 2ZAOA 2JY5A 5EQTA 1WR1B 4NL4H 5DYIA 4LFAM 5ITTA 4RKUF 4GKKM 2XSZA 4IBJA 4GEWA 3GPPA 4WHPD 3FTCA 2LVAA 1Z5BA 1WJ7A 2R65A 1HR0M 5KO3A 2DZLA 3IG8A 5KPTA 3W68A 1QZEA 1EFUB 3IG5A 4IIWA 4NSOB 3MJ5A 4PT5A 4XK8F 3SC3A 1EO2B 4WHRF 4OVZB 3LKTA 4L16A 4WW0A 4NRVA 1XXHA 1WGLA 4G4QA 1K82A 2UUAM 4DV7M 4AKHA 4BB9A 1V33A 2CUZA 2FFJA 3PCLA 2CWBA 1R4GA 1UM8A 4FW9A 1J5EM 2MROB 4DR5M 2CV2A 3QYBA 1H6UA 1NV8A 2WSCF 4LG2A 5EXXA 4B3MM 3CF2A 2JA2A 4FD2A 1TDZA 2BURA 1XWIA 3MK6A 2LWXA 5FTNA 4HLQA 5FTKA 4WHRA 1DGFA 3THGA 2XZUA 3HU1A 4GC5A 4L8RC 4OW0A 2P5TA 3J7AS 1IFYA 3GLFE 3C3DA 2Z4RA 2KRKA 3HWSA 3I4YA 3MI5A 4D82A 3ZC7B 1TH2A 1IBLM 2CHQA 2BUVA 3QYEA 3D8BA 3GLGE 3WHKA 2QNJA 1K3WA 1YKNA 1S3SA 3HU2A 5BR8M 1L2CA 3J81S 2WSFF 3B9PA 2KNVA 4S12A 2BUMA 1FNNA 2DAEA 3FUUA 3GRYA 4KT0F 3HHYA 3UZUA 4DV3M 4M9SA 3HHZA 3A42A 4WHSA 3GLHE 1DGHB 4I8OA 3GLIA 5F3WA 3SASA 2NQ8C 2X8AA 2WZJA 3GQ4A 3U6DA 3PCGA 3W67A 2G3QA 3MI1A 2KDLA 1YKPB 2XSZD 2B3TA 2CV0A 3HHXA 3ZQJA 2O01F 2LXEA 3L28A 3QAUA 4AZFA 4B3TM 4QNMA 2BV0A 3PCLM 1G71A 2VF8A 3FRHA 1GJTA 4DR7M 1NHGC 4GH9A 4P16A 1WIVA 2LNHC 2Z3XA 2L2DA 4LRSA 2ZAMA 1BVSA 1DGBA 2OPFA 1TDHA 4MM3B 4JI0M 3HHWA 1NSFA 1G3IA 1SXJD 1YUBA 3U5ZB 5ITXA 3DZDA 1PRBA 3L27A 2JUJA 3FUWA 5EXPA 4D81A 1SXJE 2BUYA 3I4VA 2UU9M 3PCMM 4G4NA 2GNOA 4B3SM 2UXCM 2XFTA 3Q8XA 2LH0A 3KOXE 4HL4A 1IQPA 2YR0A 4CJ6A 3TWMA 1NY6A 2MR9A 3KDSE 3MI5M 2VF7A 3MFLA 2YNMD 1D2NA 1IBMM 1ZMWA 3ILKA 2BJVA 1TTEA 2QHOB 4CISA 1EOAA 1HT2E 2C98A 3LXVM 3O5UA 1I94M 2F5PA 1CUKA 3M7GA 1NVMA 4LJ4A 1TH3A 4GMQA 4L78A 1L1ZA 2R4JA 2D7EA 1XXHB 2DVWB 4HEOA 3JAMS 2XLJA 4LF5M 2PCDM 4YHHM 4CGYB 3W0FA 8CATA 4LGMA 1Y8GA 3LVVA 3KOZE 1GABA 4IBIA 2HWJA 2R46A 3MI1M 1I4WA 4FCTA 4AKGA 1Z5AA 1ZAEA 3K9PA 4Y28F 1NNJA 2BURB 4WHOD 3QWLA 2JY7A 2OQ4A 1Q3CA 3R8FA 2W82A 2V1UA 4WHRB 3SARA 2DNAA 2C5RA 3U6PA 2UXDM 4X65M 3SAWA 3PCJA 1OFHA 4G4RA 1HNWM 4DUYM 4KLNA 2HHHM 4IJFA 1JR3A 2FE8A 1QUSA 2BNKA 1HT1E 2QPAA 5IWAM 4JYAM 2C9OA 3I51A 1WHCA 3K8ZA 1C7YA 3T67A 1G59A 2BUVB 3ZCBB 1MN3A 1PJQA 1YKNB 3T1YM 4LY6A 2BUZA 2DI0A 3LW5F 5ITQA 1NV9A 3B74A 2JXNA 1NY5A 2RGOA 3T6PA 2DWMA 1X37A 2BUMB 5TD3A 2XF3A 2L7IA 3GO8A 3TPZA 1OAOC 3VDUA 4ITQA 3MFLM 1T6OA 3V76A 1AIPC 4MGZE 4WHSB 4LF8M 1GVNA 3GLIB 1HQYE 3PCBA 3BOSA 2RKOA 2R62A 1OKSA 1KSFX 2DZNB 5JI2E 4F1IA 3KS8A 1N33M 2LVQD 3GP1A 1XHBA 2Y0TA 4QOSA 3SHGB 3LQQA 4ZPXA 3KS4A 4LJ8A 1MX0A 1W5SA 1KFVA 2BV0B 2EA0A 1YSYA 5DYGA 3VLFB 3SATA 2DAGA 2J7NA 3B7QA 4NOOB 4RF1A 2R4EA 5EP2A 2FNAA 2O25A 3PCAA 3GPYA 2KXEA 2C96A 1IN5A 3TE6A 2FOIC 2UXBM 2VQEM 2BUUA 4M9XA 4XBOA 3VKHA 2XSUA 3FTEA 3AL0C 1PJSA 4ILVA 1NNUC 4LZJA 4DV0M 2BUYB 3U6MA 2F5OA 3PCJM 5E6JA 3PVSA 1WGNA 2GQFA 3DA1A 3SHFA 5EXTA 1GO5A 4FCWA 4MH0E 3UK6A 3PCHA 2DAMA 3A46A 1PGYA 3E46A 3MV4A 3PCIA 2C99A 2EO2A 5ITUA 2QP9X 4LJ5A 2KNZA 4FCVA 3T67M 4WHQA 2OOAA 1OAIA 1YKLA 1OJLA 4LF6M 2H1RA 2J5YA 1G4AE 2DENA 4B08A 2K9DA 4X66M 4LF9M 1EOAB 5EP3A 3SBJA 1OFIA 4W5WA 2KHHA 1Q39A 2KEBA 5A2QS 1MU5A 3HKPA 3PCNA 1JR3D 3CTWB 1PJJA 1OTRA 2VDBB 1GLNA 4MGKE 5L8RF 3U6OA 4NRWA 3MV6A 3FRIA 5EP4A 1ZMVA 2L09A 4JI5M 4DR6M 3LMXA 2EKFA 2K6BA 1N75A 3SYLA 3PCBM 4NXNM 4JI8M 3AJIB 4L4UA 1EIJA 4B7GA 2LHCA 5EXSA 3VFDA 4JXJA 4RNAA 2Z7JA 3L29A 5EP1A 3PXGA 4UN2B 3TQSA 3LKTM 1QAMA 3FUXA 4M9ZA 3W0LB 2DWLA 4IBDA 2BUQA 1LTMA 3HJQA 3VK7A 1E32A 2KZSA 2QZ4A 2JZ1A 2QSFX 4R3DA 4RF0A 1YKKA 5FSWA 3HJ8A 5JI3E 1IXRC 2DZOB 4X62M 1TMXA 2BUWA 3C58A 3T63A 2UUCM 1EO9A 2F5SA 2Y20A 3DOAA 3FD9A 3I01M 4PDGA 3TL4X 2EKKA 5IT9S 4IJEA 1DGGA 1VG5A 3FTDA 3L26A 1IXZA 2CHGA 4MGIE 2A5YB 2N35A 4QHTA 4WURA 2BUZB 1F4IA 3PCHM 3PCIM 1XXHE 3U6CA 2DHYA 3NWLA 4EIWA 4X64M 4L6V6 4QHSA 4R7GA 5BPVA 7CATA 3PCEA 1R2YA 1EE8A 1Q02A 2EJSA 3M6AA 2K47A 4Q7JA 2HAKA 1OQYA 4DV2M 2VIIA 3A45A 1VDLA 4DV6M 1IN4A 3K2LA 4JI1M 4FWHA 3BXWA 2V6ZM 4AKIA 1DLQA 1PM5A 3FYDA 2ERCA 4LJ7A 3NBXX 3J27B 4G6ZA 1QANA 1TF0B 1IXSA 4JI4M 3MV6M 2KRUA 1NHWC 2D7GA 1XB2B 2ZANA 3SAUA 2XFSA 3K92A 1IN6A 4WHPA 4GHLA 2AHMA 3E4RA 4GKJM 4II7A 4R71A 3CF0A 1L2BA 3KOYE 4DR4M 1XNQM 4JV5M 3T1HM 1AUAA 2KZUA 4Z6YA 2L6OA 4DV4M 1VEJA 4DR2M 1KYIA 2BUUB 2CFOA 3VKGA 4MB7A 3PCGM 3E9SA 3GRVA 3T15A 4L15A 4KO8A 2BWEA 1K3XA 3DFZA 3RGPA 3FTFA 2LTUA 1JQJC 3B89A 4I5SA 3B7NA 2EUCA 2XEPA 3SMPA 1GJSA 2DAKA 3MMPA 3T63M 3J80S 2F5NA 3J7BA 2E5LM 4WHSD 2CV1A 5ITYA 4JI6M 4AQYM 3BBZA 2AZQA 3PCDA 4B7FA 2Z8YM 3PNVA 1FJGM 2Y0QA 4WHQB 3AV0A 4IBBA 4JI3M 3GLIE 1YKLB 4PD2A 1EOBA 1WXQA 1N36M 3LVWA 3O6JA 3FKEA 2CEAA 3KSJA 2JP7A 1IY1A 2MGWA 3HZJA 2ZTCA 1EOCA 4GHAA 1QDTA 4LRTA 3TWKA 1L2DA 3GLFA 4QOZC 1N77A 3HY5A 1VDDA 4YY3M 1V92A 2QQ8A 3TH1A 1IN7A 3K9OA 1J09A 2DWNA 4AG6A 2X49A 3GLGA 4M0WA 3U61A 4FWGA 1GL7A 2LVNC 1DO2A 4P17A 4REZA 4CIZA 2QENA 1JB0F 5ITXE 4CHTB 2Z4SA 5DFLA 3NBIA 2APLA 3K1JA 3LMMA 4XGIA 2BUQB 1QZMA 3WHLA 3HU3A 4TUWA 1R7RA 3PCCA 2UUBM 4LJ6A 3GLHA 3KW6A 3LCUA 1YKKB 1N34M 2BUWB 4B3RM 1A5TA 3RFWA 2WSEF 1VEGA 1W5TA 3C3EA 1EO9B 2JWSA 1IM2A 1R6BX 3D8LA 1SXJC 3KP0E 4LF7M 1QAOA 3KOWE 4WP2A 3GPXA 2ZM6M 2M5ZA 2VQFM 1G41A 3OTOM 2BUTA 2H5XA
chains in the Genus database with same CATH topology
4MGHA 1XMOM 2F5QA 3A98B 3EIHA 2XGNA 5FTMA 1ZQ9A 3GRUA 3PNYA 4MGYE 4D80A 3O32A 3PCDM 2CE7A 2O5RA 1N32M 2I7PA 2Y21A 5IZ7D 3U60A 2BUXA 2BOYA 1YKMA 5FLXS 1IBKM 4IBCA 2G5GX 1SXJA 4IBFA 1Z59A 2XZFA 3J2PB 1E9SA 1IXSB 5LMNM 3R9XB 3SYKA 2DXIA 4WHPB 1DO0A 3U6SA 1DMHA 5E26A 1NJGA 4KHPM 4IBGA 1C1KA 2XH9A 3JR4A 1Z5CA 1G8PA 2HKJA 4NSRA 4LFBM 1S9AA 3PCMA 1T3TA 5H37D 2ZBKB 4LFCM 3PCKA 4GIPA 2R18A 1DLMA 1QQWA 3ZH9B 3PCCM 2QBYA 3FUVA 1QAQA 3H4MA 4GC9A 3VK8A 1YKOA 2KW0A 1QYRA 5C18A 1XMQM 1DLTA 2HL7A 4FWDA 4G4OA 5KPZA 3AKZA 1L1TA 3PCAM 2XSVA 3N9TA 3LXVA 3L25A 5IREB 3PCFA 1EOBB 3HJSA 3KP1E 3LQRA 5DNYA 2CHVA 4WHOA 2BJWA 2I7NA 4DR1M 4JN6A 2DWZB 3UJNA 2YQZA 4LZZA 4JI2M 5KQDA 2G8LA 3U6LA 4DV5M 1EOCB 4LGYA 2PCDA 5LMUM 3JR5A 3MV4M 3GLFB 2RGHA 2J7OA 4FVMA 1EO2A 1L8QA 1GL6A 3GQ3A 4JI7M 3GLGB 4IBKA 3U61B 4OVZA 3CF6E 4AG5A 4BLCA 1ORYB 5KPRA 3AFHA 4I81A 3PCNM 3RGSA 2KA6B 3SMSA 4AI6A 3GLHB 2DHRA 3LMXM 1Z6TA 1NJFA 3KVWA 3GRRA 2R45A 1HNXM 4QNRA 3PCKM 5ITRA 2F4VM 3T38A 5KQ8A 4M0DA 4DV1M 3UMMA 2BUTB 1YE9A 3GQ5A 3FYCA 4K0KM 3AOEC 4PDIA 3FUTA 4ILTA 4A3VB 3KSXA 1J7KA 2X4AA 3U60B 3RE8A 1TGUA 4B7HA 2BUXB 1XNRM 1IY0A 3PCFM 3GPUA 3SFZA 1YKMB 4GRIA 1E9RA 3EIEA 3HGIA 1SXJB 1XC8A 5FTLA 1GKIA 2M60A 1E94E 4LJ9A 2QCUA 2HCBA 3U6EA 5GKNA 1QVRA 4IBEA 1PJIA 5FTJA 3KXEC 3AOEA 3SAVA 4DUZM 3L2AA 3PFIA 3KFUG 3PCEM 1DGHA 2YFQA 2XSRA 2Q2EB 4I4LA 4PCZA 3AOGA 2D7HA 1HNZM 3TWLA 1YKPA 4KODA 4LF4M 1R2ZA 4NXMM 1LV7A 2V1CA 3MHVC 4OU7A 4OX9M 1N78A 3M0EA 4LCBA 2QBYB 1Q3BA 3VDPA 1YKOB 5EJCA 4LJAA 3O6RA 4BBAA 2L7HA 4Z8XA 2C9CA 3U5ZA 1HQCA 4AW4A 1IY2A 1TH4A 4DR3M 5C1BA 1IN8A 3UGJA 4GITA 3U6QA 4WHOB 2ZAOA 5EQTA 5DYIA 4NL4H 4LFAM 5ITTA 4GKKM 2XSZA 4IBJA 3GPPA 4WHPD 3FTCA 1Z5BA 2R65A 1HR0M 5KO3A 3IG8A 5KPTA 3IG5A 4IIWA 4PT5A 4NSOB 3MJ5A 3SC3A 1EO2B 4WHRF 4OVZB 3LKTA 4L16A 4WW0A 4NRVA 1XXHA 1K82A 4G4QA 2UUAM 4AKHA 4DV7M 4BB9A 2CUZA 2FFJA 3PCLA 1UM8A 4FW9A 1J5EM 4DR5M 2CV2A 1H6UA 4LG2A 5EXXA 4B3MM 3CF2A 2JA2A 4FD2A 1TDZA 2BURA 1XWIA 3MK6A 2LWXA 5FTNA 4HLQA 5FTKA 4WHRA 1DGFA 3THGA 2XZUA 3HU1A 4GC5A 4L8RC 4OW0A 2P5TA 3J7AS 2Z4RA 2KRKA 3HWSA 3I4YA 3MI5A 4D82A 3ZC7B 1TH2A 1IBLM 2CHQA 2BUVA 3D8BA 1K3WA 3WHKA 1YKNA 1S3SA 3HU2A 5BR8M 1L2CA 3J81S 3B9PA 4S12A 2BUMA 1FNNA 3FUUA 3UZUA 3GRYA 3HHYA 4DV3M 4M9SA 3HHZA 3A42A 4WHSA 4I8OA 1DGHB 3GLIA 5F3WA 3SASA 2NQ8C 2X8AA 3GQ4A 3U6DA 3PCGA 3MI1A 1YKPB 2XSZD 2CV0A 3HHXA 2LXEA 3L28A 3QAUA 4AZFA 4B3TM 4QNMA 2BV0A 3PCLM 4DR7M 1NHGC 4GH9A 4P16A 2LNHC 2Z3XA 4LRSA 2ZAMA 1DGBA 2OPFA 1TDHA 4MM3B 4JI0M 3HHWA 1NSFA 1G3IA 1SXJD 1YUBA 3U5ZB 5ITXA 3DZDA 3L27A 4D81A 3FUWA 5EXPA 2BUYA 1SXJE 3PCMM 3I4VA 2UU9M 4G4NA 4B3SM 2UXCM 2XFTA 3Q8XA 2LH0A 3KOXE 4HL4A 1IQPA 2YR0A 3TWMA 1NY6A 3KDSE 3MI5M 3MFLA 2YNMD 1D2NA 1IBMM 3ILKA 2BJVA 4CISA 1EOAA 1HT2E 2C98A 3LXVM 3O5UA 1I94M 2F5PA 3M7GA 1NVMA 4LJ4A 1TH3A 4GMQA 4L78A 1L1ZA 2R4JA 2D7EA 1XXHB 2DVWB 2XLJA 3JAMS 4LF5M 2PCDM 4YHHM 4CGYB 3W0FA 8CATA 4LGMA 3LVVA 3KOZE 4IBIA 2R46A 3MI1M 1I4WA 4FCTA 4AKGA 1Z5AA 1ZAEA 1NNJA 2BURB 4WHOD 3QWLA 2OQ4A 1Q3CA 3R8FA 2W82A 2V1UA 4WHRB 3SARA 2C5RA 3U6PA 2UXDM 4X65M 3SAWA 3PCJA 1OFHA 4G4RA 1HNWM 4DUYM 4KLNA 2HHHM 4IJFA 1JR3A 2FE8A 2BNKA 1HT1E 2QPAA 5IWAM 4JYAM 2C9OA 3I51A 3K8ZA 3T67A 1G59A 2BUVB 3ZCBB 1YKNB 2BUZA 3T1YM 4LY6A 5ITQA 2DWMA 1NY5A 2RGOA 1X37A 2BUMB 5TD3A 2XF3A 2L7IA 3GO8A 3TPZA 3VDUA 4ITQA 3MFLM 4MGZE 4WHSB 4LF8M 1GVNA 3GLIB 1HQYE 3PCBA 3BOSA 2RKOA 2R62A 2DZNB 1KSFX 5JI2E 3KS8A 1N33M 3GP1A 1XHBA 2Y0TA 4QOSA 3SHGB 3LQQA 4ZPXA 3KS4A 4LJ8A 1MX0A 1W5SA 1KFVA 2BV0B 2EA0A 1YSYA 5DYGA 3VLFB 3SATA 2J7NA 4NOOB 4RF1A 2R4EA 5EP2A 2FNAA 3PCAA 3GPYA 2KXEA 2C96A 1IN5A 3TE6A 2FOIC 2UXBM 2VQEM 2BUUA 4M9XA 4XBOA 3VKHA 2XSUA 3FTEA 3AL0C 4ILVA 1NNUC 4LZJA 4DV0M 2BUYB 3U6MA 2F5OA 3PCJM 5E6JA 3PVSA 3DA1A 3SHFA 5EXTA 4FCWA 4MH0E 3UK6A 3PCHA 3A46A 3MV4A 3PCIA 2C99A 2EO2A 5ITUA 2QP9X 4LJ5A 4FCVA 3T67M 4WHQA 1YKLA 1OJLA 4LF6M 2H1RA 1G4AE 4B08A 4X66M 4LF9M 1EOAB 5EP3A 3SBJA 1OFIA 4W5WA 1Q39A 2KEBA 5A2QS 1MU5A 3HKPA 3PCNA 1JR3D 3CTWB 1PJJA 4MGKE 1GLNA 3U6OA 3MV6A 4NRWA 5EP4A 4JI5M 2L09A 4DR6M 3LMXA 1N75A 3SYLA 3PCBM 4NXNM 4JI8M 3AJIB 4L4UA 4B7GA 3VFDA 5EXSA 4JXJA 4RNAA 2Z7JA 3L29A 5EP1A 3PXGA 3TQSA 3LKTM 1QAMA 3FUXA 4M9ZA 3W0LB 2DWLA 4IBDA 2BUQA 3HJQA 3VK7A 1E32A 2KZSA 2QZ4A 4R3DA 4RF0A 1YKKA 5FSWA 3HJ8A 5JI3E 1IXRC 2DZOB 4X62M 1TMXA 2BUWA 3C58A 3T63A 2UUCM 1EO9A 2F5SA 2Y20A 3DOAA 3FD9A 4PDGA 3TL4X 5IT9S 4IJEA 1DGGA 3FTDA 3L26A 2BUZB 1IXZA 2CHGA 4MGIE 2A5YB 4QHTA 4WURA 3PCHM 3PCIM 3U6CA 3NWLA 4EIWA 4X64M 4QHSA 4R7GA 5BPVA 7CATA 3PCEA 1R2YA 1EE8A 3M6AA 2K47A 4DV2M 2VIIA 3A45A 4DV6M 4AKIA 1IN4A 3K2LA 4JI1M 4FWHA 1DLQA 2V6ZM 1PM5A 3FYDA 2ERCA 4LJ7A 3J27B 4G6ZA 1QANA 3MV6M 4JI4M 2KRUA 1NHWC 2D7GA 2ZANA 3SAUA 2XFSA 3K92A 1IN6A 4WHPA 4GHLA 2AHMA 3E4RA 4GKJM 4II7A 1L2BA 3CF0A 4JV5M 3KOYE 4DR4M 1XNQM 3T1HM 2KZUA 4Z6YA 2L6OA 4DV4M 4DR2M 1KYIA 2BUUB 2CFOA 3VKGA 4MB7A 3PCGM 3E9SA 3GRVA 3T15A 4L15A 4KO8A 1K3XA 3DFZA 3RGPA 3FTFA 1JQJC 4I5SA 2EUCA 2XEPA 3SMPA 3T63M 3J80S 2F5NA 3J7BA 2E5LM 4WHSD 2CV1A 5ITYA 4JI6M 4AQYM 3PCDA 2AZQA 4B7FA 3PNVA 1FJGM 2Y0QA 4WHQB 3AV0A 4IBBA 4JI3M 1YKLB 4PD2A 1EOBA 1WXQA 1N36M 3LVWA 3O6JA 3FKEA 2CEAA 3KSJA 1IY1A 1EOCA 4GHAA 4LRTA 3TWKA 1L2DA 3GLFA 4QOZC 1N77A 1VDDA 4YY3M 3TH1A 1IN7A 1J09A 2DWNA 4AG6A 2X49A 3GLGA 4M0WA 3U61A 4FWGA 1GL7A 1DO2A 4REZA 2QENA 5ITXE 4CHTB 2Z4SA 3NBIA 3K1JA 3LMMA 4XGIA 2BUQB 1QZMA 3WHLA 3HU3A 4TUWA 1R7RA 3PCCA 2UUBM 4LJ6A 3GLHA 3KW6A 1YKKB 2BUWB 1N34M 4B3RM 3RFWA 1W5TA 1EO9B 3KP0E 1IM2A 1R6BX 3D8LA 1SXJC 4LF7M 1QAOA 3KOWE 2ZM6M 3GPXA 2M5ZA 2VQFM 1G41A 3OTOM 2BUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSR A;  3PCM M;  3PCB M;  1YKP A;  3O32 A;  3MI5 M;  3PCD M;  3LKT M;  3MFL A;  2BUX A;  2BOY A;  2BUQ A;  1YKM A;  3HJQ A;  1EOA A;  3O5U A;  3LXV M;  1YKK A;  2BUW A;  1TMX A;  3HJ8 A;  1YKO B;  3T63 A;  3TH1 A;  3I4V A;  3O6R A;  1EO9 A;  2PCD M;  4WHP B;  2BUZ B;  4WHO B;  1DMH A;  3PCH M;  3PCI M;  3MI1 M;  4WHP D;  2BUR B;  4WHO D;  1S9A A;  3PCM A;  3PCE A;  3PCK A;  4WHR B;  1DLM A;  3PCC M;  1EO2 B;  3PCJ A;  1DLQ A;  4WHR F;  1YKO A;  3LKT A;  1DLT A;  3PCA M;  3I51 A;  3MV6 M;  2XSV A;  3N9T A;  3LXV A;  3T67 A;  3PCL A;  2BUV B;  3PCF A;  1EOB B;  4WHP A;  3HJS A;  1YKN B;  2BUZ A;  4WHO A;  1EOC B;  2BUR A;  2BUM B;  2BUU B;  2PCD A;  5TD3 A;  3PCG M;  3MFL M;  3MV4 M;  4WHR A;  4WHS B;  1EO2 A;  3PCB A;  3T63 M;  4WHS D;  3I4Y A;  3MI5 A;  2AZQ A;  3PCD A;  4WHQ B;  3PCN M;  2BV0 B;  1YKL B;  2BUV A;  1EOB A;  3O6J A;  1YKN A;  3LMX M;  3PCA A;  1EOC A;  2BUM A;  2BUU A;  2XSU A;  3HHY A;  3PCK M;  4ILV A;  4WHS A;  2BUY B;  2BUT B;  3PCJ M;  3PCH A;  4ILT A;  3PCG A;  3MV4 A;  3PCI A;  3MI1 A;  1YKP B;  3HHX A;  3T67 M;  4WHQ A;  2BUX B;  3PCL M;  2BV0 A;  1YKL A;  2BUQ B;  3PCF M;  1YKM B;  1EOA B;  3PCC A;  3HGI A;  1YKK B;  2BUW B;  3HKP A;  1EO9 B;  3PCN A;  3MV6 A;  2BUY A;  3PCE M;  3LMX A;  2BUT A; 
#chains in the Genus database with same CATH topology
 4MGH A;  1RU3 A;  2CP8 A;  1XMO M;  3A98 B;  3EIH A;  2F5Q A;  1R5L A;  2XGN A;  5FTM A;  1ZQ9 A;  2L4E A;  1VQ1 A;  3GRU A;  3PNY A;  4MGY E;  4D80 A;  3O32 A;  3PCD M;  2R0I A;  2CE7 A;  2O5R A;  1N32 M;  2I7P A;  2Y21 A;  5IZ7 D;  3U60 A;  2BUX A;  2BOY A;  1YKM A;  5FLX S;  1IBK M;  4IBC A;  2G5G X;  1SXJ A;  2LBC A;  4IBF A;  1Z59 A;  2XZF A;  3J2P B;  1E9S A;  1IXS B;  5LMN M;  3R9X B;  2K0B X;  2OO9 A;  3SYK A;  4ANR A;  2DXI A;  4WHP B;  3H4J A;  1DO0 A;  3U6S A;  1DMH A;  1TR8 A;  5E26 A;  1JR3 E;  1NJG A;  4KHP M;  4IBG A;  1C1K A;  2XH9 A;  3B7Z A;  3JR4 A;  1Z5C A;  1G8P A;  2HKJ A;  4NSR A;  4LFB M;  1S9A A;  3PCM A;  1T3T A;  5H37 D;  2ZBK B;  1SG9 A;  4LFC M;  3PCK A;  4GIP A;  2R18 A;  4NC6 A;  1DLM A;  1QQW A;  3ZH9 B;  3PCC M;  1T43 A;  3FUV A;  2QBY A;  1QAQ A;  2ZTD A;  3H4M A;  4GC9 A;  3I04 M;  3VK8 A;  2KW0 A;  1QYR A;  1YKO A;  5C18 A;  2BWB A;  2DAI A;  1XMQ M;  1DLT A;  2HL7 A;  4FWD A;  4G4O A;  5KPZ A;  3AKZ A;  1NO1 A;  1L1T A;  3PCA M;  2XSV A;  2RRU A;  3N9T A;  1QDR A;  1OIP A;  2JNH A;  3L25 A;  3LXV A;  5IRE B;  3PCF A;  1EOB B;  3HJS A;  3KP1 E;  3LQR A;  4G3O A;  2CHV A;  2OOB A;  2BJW A;  5DNY A;  2I7N A;  4DR1 M;  4WHO A;  2R6F A;  2DWZ B;  4JN6 A;  3UJN A;  2YQZ A;  4LZZ A;  1VEK A;  2MH8 A;  2G8L A;  3LCV B;  5KQD A;  4DV5 M;  3U6L A;  4JI2 M;  4LGY A;  1EOC B;  3C9P A;  5LMU M;  3JR5 A;  2PCD A;  1ZV1 A;  3MV4 M;  3GLF B;  1UFZ A;  2RGH A;  2DKL A;  2J7O A;  1HJP A;  1PJT A;  3FE3 A;  4FVM A;  1EO2 A;  1L8Q A;  1QUT A;  1DV0 A;  1GL6 A;  3GQ3 A;  4JI7 M;  3GLG B;  4IBK A;  3U61 B;  1YLA A;  4OVZ A;  3CF6 E;  4AG5 A;  4BLC A;  1ORY B;  5KPR A;  3AFH A;  4I81 A;  3PCN M;  3RGS A;  2KA6 B;  3SMS A;  4AI6 A;  3GLH B;  2DHR A;  3LMX M;  1Z6T A;  3CGW A;  1NJF A;  3KVW A;  3GRR A;  2R45 A;  1HNX M;  4QNR A;  3PCK M;  5ITR A;  2F4V M;  1ZMU A;  3T38 A;  5KQ8 A;  4M0D A;  1MJG M;  4DV1 M;  3UMM A;  2BUT B;  1YE9 A;  3GQ5 A;  3FYC A;  4K0K M;  3HX3 A;  3AOE C;  4PDI A;  3FUT A;  4ILT A;  1D0K A;  2R44 A;  4A3V B;  3KSX A;  1OIZ A;  1J7K A;  1P3Q Q;  2X4A A;  3U60 B;  3RE8 A;  1TGU A;  4B7H A;  2BUX B;  1XNR M;  1IY0 A;  1D0M A;  3PCF M;  3GPU A;  3SFZ A;  1YKM B;  4GRI A;  2MJ5 B;  1E9R A;  3EIE A;  2KNA A;  2LHG A;  3HGI A;  1SXJ B;  1XC8 A;  1D0L A;  2LVO C;  5FTL A;  1GKI A;  2M60 A;  1E94 E;  3IHP A;  4LJ9 A;  2QCU A;  2HCB A;  4F2L A;  3U6E A;  5GKN A;  1QVR A;  4IBE A;  1PJI A;  5FTJ A;  2LVP C;  3AOE A;  3KXE C;  3SAV A;  4DUZ M;  2L4F A;  3L2A A;  3PFI A;  3KFU G;  3PCE M;  2JY6 B;  1DGH A;  2YFQ A;  2XSR A;  2Q2E B;  3F92 A;  4I4L A;  1V34 A;  3AOG A;  4PCZ A;  2D7H A;  1HNZ M;  3TWL A;  1YKP A;  3E21 A;  3IEC A;  4KOD A;  1R2Z A;  4LF4 M;  4NXM M;  1LV7 A;  2V1C A;  3MHV C;  4OU7 A;  4OX9 M;  1N78 A;  3M0E A;  4LCB A;  2QBY B;  1Q3B A;  3VDP A;  2JZ0 A;  1YKO B;  5EJC A;  4LJA A;  3O6R A;  2CRU A;  2L7H A;  4BBA A;  2JY8 A;  4Z8X A;  2C9C A;  3U5Z A;  1HQC A;  4AW4 A;  3Q8G A;  1IY2 A;  1TH4 A;  4DR3 M;  5C1B A;  1IN8 A;  3UGJ A;  2FH0 A;  4GIT A;  4DBG B;  3U6Q A;  4WHO B;  2FS1 A;  2ZAO A;  2JY5 A;  5EQT A;  1WR1 B;  4NL4 H;  5DYI A;  4LFA M;  5ITT A;  4RKU F;  4GKK M;  2XSZ A;  4IBJ A;  4GEW A;  3GPP A;  4WHP D;  3FTC A;  2LVA A;  1Z5B A;  1WJ7 A;  2R65 A;  1HR0 M;  5KO3 A;  2DZL A;  3IG8 A;  5KPT A;  3W68 A;  1QZE A;  1EFU B;  3IG5 A;  4IIW A;  4NSO B;  3MJ5 A;  4PT5 A;  4XK8 F;  3SC3 A;  1EO2 B;  4WHR F;  4OVZ B;  3LKT A;  4L16 A;  4WW0 A;  4NRV A;  1XXH A;  1WGL A;  4G4Q A;  1K82 A;  2UUA M;  4DV7 M;  4AKH A;  4BB9 A;  1V33 A;  2CUZ A;  2FFJ A;  3PCL A;  2CWB A;  1R4G A;  1UM8 A;  4FW9 A;  1J5E M;  2MRO B;  4DR5 M;  2CV2 A;  3QYB A;  1H6U A;  1NV8 A;  2WSC F;  4LG2 A;  5EXX A;  4B3M M;  3CF2 A;  2JA2 A;  4FD2 A;  1TDZ A;  2BUR A;  1XWI A;  3MK6 A;  2LWX A;  5FTN A;  4HLQ A;  5FTK A;  4WHR A;  1DGF A;  3THG A;  2XZU A;  3HU1 A;  4GC5 A;  4L8R C;  4OW0 A;  2P5T A;  3J7A S;  1IFY A;  3GLF E;  3C3D A;  2Z4R A;  2KRK A;  3HWS A;  3I4Y A;  3MI5 A;  4D82 A;  3ZC7 B;  1TH2 A;  1IBL M;  2CHQ A;  2BUV A;  3QYE A;  3D8B A;  3GLG E;  3WHK A;  2QNJ A;  1K3W A;  1YKN A;  1S3S A;  3HU2 A;  5BR8 M;  1L2C A;  3J81 S;  2WSF F;  3B9P A;  2KNV A;  4S12 A;  2BUM A;  1FNN A;  2DAE A;  3FUU A;  3GRY A;  4KT0 F;  3HHY A;  3UZU A;  4DV3 M;  4M9S A;  3HHZ A;  3A42 A;  4WHS A;  3GLH E;  1DGH B;  4I8O A;  3GLI A;  5F3W A;  3SAS A;  2NQ8 C;  2X8A A;  2WZJ A;  3GQ4 A;  3U6D A;  3PCG A;  3W67 A;  2G3Q A;  3MI1 A;  2KDL A;  1YKP B;  2XSZ D;  2B3T A;  2CV0 A;  3HHX A;  3ZQJ A;  2O01 F;  2LXE A;  3L28 A;  3QAU A;  4AZF A;  4B3T M;  4QNM A;  2BV0 A;  3PCL M;  1G71 A;  2VF8 A;  3FRH A;  1GJT A;  4DR7 M;  1NHG C;  4GH9 A;  4P16 A;  1WIV A;  2LNH C;  2Z3X A;  2L2D A;  4LRS A;  2ZAM A;  1BVS A;  1DGB A;  2OPF A;  1TDH A;  4MM3 B;  4JI0 M;  3HHW A;  1NSF A;  1G3I A;  1SXJ D;  1YUB A;  3U5Z B;  5ITX A;  3DZD A;  1PRB A;  3L27 A;  2JUJ A;  3FUW A;  5EXP A;  4D81 A;  1SXJ E;  2BUY A;  3I4V A;  2UU9 M;  3PCM M;  4G4N A;  2GNO A;  4B3S M;  2UXC M;  2XFT A;  3Q8X A;  2LH0 A;  3KOX E;  4HL4 A;  1IQP A;  2YR0 A;  4CJ6 A;  3TWM A;  1NY6 A;  2MR9 A;  3KDS E;  3MI5 M;  2VF7 A;  3MFL A;  2YNM D;  1D2N A;  1IBM M;  1ZMW A;  3ILK A;  2BJV A;  1TTE A;  2QHO B;  4CIS A;  1EOA A;  1HT2 E;  2C98 A;  3LXV M;  3O5U A;  1I94 M;  2F5P A;  1CUK A;  3M7G A;  1NVM A;  4LJ4 A;  1TH3 A;  4GMQ A;  4L78 A;  1L1Z A;  2R4J A;  2D7E A;  1XXH B;  2DVW B;  4HEO A;  3JAM S;  2XLJ A;  4LF5 M;  2PCD M;  4YHH M;  4CGY B;  3W0F A;  8CAT A;  4LGM A;  1Y8G A;  3LVV A;  3KOZ E;  1GAB A;  4IBI A;  2HWJ A;  2R46 A;  3MI1 M;  1I4W A;  4FCT A;  4AKG A;  1Z5A A;  1ZAE A;  3K9P A;  4Y28 F;  1NNJ A;  2BUR B;  4WHO D;  3QWL A;  2JY7 A;  2OQ4 A;  1Q3C A;  3R8F A;  2W82 A;  2V1U A;  4WHR B;  3SAR A;  2DNA A;  2C5R A;  3U6P A;  2UXD M;  4X65 M;  3SAW A;  3PCJ A;  1OFH A;  4G4R A;  1HNW M;  4DUY M;  4KLN A;  2HHH M;  4IJF A;  1JR3 A;  2FE8 A;  1QUS A;  2BNK A;  1HT1 E;  2QPA A;  5IWA M;  4JYA M;  2C9O A;  3I51 A;  1WHC A;  3K8Z A;  1C7Y A;  3T67 A;  1G59 A;  2BUV B;  3ZCB B;  1MN3 A;  1PJQ A;  1YKN B;  3T1Y M;  4LY6 A;  2BUZ A;  2DI0 A;  3LW5 F;  5ITQ A;  1NV9 A;  3B74 A;  2JXN A;  1NY5 A;  2RGO A;  3T6P A;  2DWM A;  1X37 A;  2BUM B;  5TD3 A;  2XF3 A;  2L7I A;  3GO8 A;  3TPZ A;  1OAO C;  3VDU A;  4ITQ A;  3MFL M;  1T6O A;  3V76 A;  1AIP C;  4MGZ E;  4WHS B;  4LF8 M;  1GVN A;  3GLI B;  1HQY E;  3PCB A;  3BOS A;  2RKO A;  2R62 A;  1OKS A;  1KSF X;  2DZN B;  5JI2 E;  4F1I A;  3KS8 A;  1N33 M;  2LVQ D;  3GP1 A;  1XHB A;  2Y0T A;  4QOS A;  3SHG B;  3LQQ A;  4ZPX A;  3KS4 A;  4LJ8 A;  1MX0 A;  1W5S A;  1KFV A;  2BV0 B;  2EA0 A;  1YSY A;  5DYG A;  3VLF B;  3SAT A;  2DAG A;  2J7N A;  3B7Q A;  4NOO B;  4RF1 A;  2R4E A;  5EP2 A;  2FNA A;  2O25 A;  3PCA A;  3GPY A;  2KXE A;  2C96 A;  1IN5 A;  3TE6 A;  2FOI C;  2UXB M;  2VQE M;  2BUU A;  4M9X A;  4XBO A;  3VKH A;  2XSU A;  3FTE A;  3AL0 C;  1PJS A;  4ILV A;  1NNU C;  4LZJ A;  4DV0 M;  2BUY B;  3U6M A;  2F5O A;  3PCJ M;  5E6J A;  3PVS A;  1WGN A;  2GQF A;  3DA1 A;  3SHF A;  5EXT A;  1GO5 A;  4FCW A;  4MH0 E;  3UK6 A;  3PCH A;  2DAM A;  3A46 A;  1PGY A;  3E46 A;  3MV4 A;  3PCI A;  2C99 A;  2EO2 A;  5ITU A;  2QP9 X;  4LJ5 A;  2KNZ A;  4FCV A;  3T67 M;  4WHQ A;  2OOA A;  1OAI A;  1YKL A;  1OJL A;  4LF6 M;  2H1R A;  2J5Y A;  1G4A E;  2DEN A;  4B08 A;  2K9D A;  4X66 M;  4LF9 M;  1EOA B;  5EP3 A;  3SBJ A;  1OFI A;  4W5W A;  2KHH A;  1Q39 A;  2KEB A;  5A2Q S;  1MU5 A;  3HKP A;  3PCN A;  1JR3 D;  3CTW B;  1PJJ A;  1OTR A;  2VDB B;  1GLN A;  4MGK E;  5L8R F;  3U6O A;  4NRW A;  3MV6 A;  3FRI A;  5EP4 A;  1ZMV A;  2L09 A;  4JI5 M;  4DR6 M;  3LMX A;  2EKF A;  2K6B A;  1N75 A;  3SYL A;  3PCB M;  4NXN M;  4JI8 M;  3AJI B;  4L4U A;  1EIJ A;  4B7G A;  2LHC A;  5EXS A;  3VFD A;  4JXJ A;  4RNA A;  2Z7J A;  3L29 A;  5EP1 A;  3PXG A;  4UN2 B;  3TQS A;  3LKT M;  1QAM A;  3FUX A;  4M9Z A;  3W0L B;  2DWL A;  4IBD A;  2BUQ A;  1LTM A;  3HJQ A;  3VK7 A;  1E32 A;  2KZS A;  2QZ4 A;  2JZ1 A;  2QSF X;  4R3D A;  4RF0 A;  1YKK A;  5FSW A;  3HJ8 A;  5JI3 E;  1IXR C;  2DZO B;  4X62 M;  1TMX A;  2BUW A;  3C58 A;  3T63 A;  2UUC M;  1EO9 A;  2F5S A;  2Y20 A;  3DOA A;  3FD9 A;  3I01 M;  4PDG A;  3TL4 X;  2EKK A;  5IT9 S;  4IJE A;  1DGG A;  1VG5 A;  3FTD A;  3L26 A;  1IXZ A;  2CHG A;  4MGI E;  2A5Y B;  2N35 A;  4QHT A;  4WUR A;  2BUZ B;  1F4I A;  3PCH M;  3PCI M;  1XXH E;  3U6C A;  2DHY A;  3NWL A;  4EIW A;  4X64 M;  4L6V 6;  4QHS A;  4R7G A;  5BPV A;  7CAT A;  3PCE A;  1R2Y A;  1EE8 A;  1Q02 A;  2EJS A;  3M6A A;  2K47 A;  4Q7J A;  2HAK A;  1OQY A;  4DV2 M;  2VII A;  3A45 A;  1VDL A;  4DV6 M;  1IN4 A;  3K2L A;  4JI1 M;  4FWH A;  3BXW A;  2V6Z M;  4AKI A;  1DLQ A;  1PM5 A;  3FYD A;  2ERC A;  4LJ7 A;  3NBX X;  3J27 B;  4G6Z A;  1QAN A;  1TF0 B;  1IXS A;  4JI4 M;  3MV6 M;  2KRU A;  1NHW C;  2D7G A;  1XB2 B;  2ZAN A;  3SAU A;  2XFS A;  3K92 A;  1IN6 A;  4WHP A;  4GHL A;  2AHM A;  3E4R A;  4GKJ M;  4II7 A;  4R71 A;  3CF0 A;  1L2B A;  3KOY E;  4DR4 M;  1XNQ M;  4JV5 M;  3T1H M;  1AUA A;  2KZU A;  4Z6Y A;  2L6O A;  4DV4 M;  1VEJ A;  4DR2 M;  1KYI A;  2BUU B;  2CFO A;  3VKG A;  4MB7 A;  3PCG M;  3E9S A;  3GRV A;  3T15 A;  4L15 A;  4KO8 A;  2BWE A;  1K3X A;  3DFZ A;  3RGP A;  3FTF A;  2LTU A;  1JQJ C;  3B89 A;  4I5S A;  3B7N A;  2EUC A;  2XEP A;  3SMP A;  1GJS A;  2DAK A;  3MMP A;  3T63 M;  3J80 S;  2F5N A;  3J7B A;  2E5L M;  4WHS D;  2CV1 A;  5ITY A;  4JI6 M;  4AQY M;  3BBZ A;  2AZQ A;  3PCD A;  4B7F A;  2Z8Y M;  3PNV A;  1FJG M;  2Y0Q A;  4WHQ B;  3AV0 A;  4IBB A;  4JI3 M;  3GLI E;  1YKL B;  4PD2 A;  1EOB A;  1WXQ A;  1N36 M;  3LVW A;  3O6J A;  3FKE A;  2CEA A;  3KSJ A;  2JP7 A;  1IY1 A;  2MGW A;  3HZJ A;  2ZTC A;  1EOC A;  4GHA A;  1QDT A;  4LRT A;  3TWK A;  1L2D A;  3GLF A;  4QOZ C;  1N77 A;  3HY5 A;  1VDD A;  4YY3 M;  1V92 A;  2QQ8 A;  3TH1 A;  1IN7 A;  3K9O A;  1J09 A;  2DWN A;  4AG6 A;  2X49 A;  3GLG A;  4M0W A;  3U61 A;  4FWG A;  1GL7 A;  2LVN C;  1DO2 A;  4P17 A;  4REZ A;  4CIZ A;  2QEN A;  1JB0 F;  5ITX E;  4CHT B;  2Z4S A;  5DFL A;  3NBI A;  2APL A;  3K1J A;  3LMM A;  4XGI A;  2BUQ B;  1QZM A;  3WHL A;  3HU3 A;  4TUW A;  1R7R A;  3PCC A;  2UUB M;  4LJ6 A;  3GLH A;  3KW6 A;  3LCU A;  1YKK B;  1N34 M;  2BUW B;  4B3R M;  1A5T A;  3RFW A;  2WSE F;  1VEG A;  1W5T A;  3C3E A;  1EO9 B;  2JWS A;  1IM2 A;  1R6B X;  3D8L A;  1SXJ C;  3KP0 E;  4LF7 M;  1QAO A;  3KOW E;  4WP2 A;  3GPX A;  2ZM6 M;  2M5Z A;  2VQF M;  1G41 A;  3OTO M;  2BUT A;  2H5X A; 
#chains in the Genus database with same CATH homology
 4MGH A;  1XMO M;  2F5Q A;  3A98 B;  3EIH A;  2XGN A;  5FTM A;  1ZQ9 A;  3GRU A;  3PNY A;  4MGY E;  4D80 A;  3O32 A;  3PCD M;  2CE7 A;  2O5R A;  1N32 M;  2I7P A;  2Y21 A;  5IZ7 D;  3U60 A;  2BUX A;  2BOY A;  1YKM A;  5FLX S;  1IBK M;  4IBC A;  2G5G X;  1SXJ A;  4IBF A;  1Z59 A;  2XZF A;  3J2P B;  1E9S A;  1IXS B;  5LMN M;  3R9X B;  3SYK A;  2DXI A;  4WHP B;  1DO0 A;  3U6S A;  1DMH A;  5E26 A;  1NJG A;  4KHP M;  4IBG A;  1C1K A;  2XH9 A;  3JR4 A;  1Z5C A;  1G8P A;  2HKJ A;  4NSR A;  4LFB M;  1S9A A;  3PCM A;  1T3T A;  5H37 D;  2ZBK B;  4LFC M;  3PCK A;  4GIP A;  2R18 A;  1DLM A;  1QQW A;  3ZH9 B;  3PCC M;  2QBY A;  3FUV A;  1QAQ A;  3H4M A;  4GC9 A;  3VK8 A;  1YKO A;  2KW0 A;  1QYR A;  5C18 A;  1XMQ M;  1DLT A;  2HL7 A;  4FWD A;  4G4O A;  5KPZ A;  3AKZ A;  1L1T A;  3PCA M;  2XSV A;  3N9T A;  3LXV A;  3L25 A;  5IRE B;  3PCF A;  1EOB B;  3HJS A;  3KP1 E;  3LQR A;  5DNY A;  2CHV A;  4WHO A;  2BJW A;  2I7N A;  4DR1 M;  4JN6 A;  2DWZ B;  3UJN A;  2YQZ A;  4LZZ A;  4JI2 M;  5KQD A;  2G8L A;  3U6L A;  4DV5 M;  1EOC B;  4LGY A;  2PCD A;  5LMU M;  3JR5 A;  3MV4 M;  3GLF B;  2RGH A;  2J7O A;  4FVM A;  1EO2 A;  1L8Q A;  1GL6 A;  3GQ3 A;  4JI7 M;  3GLG B;  4IBK A;  3U61 B;  4OVZ A;  3CF6 E;  4AG5 A;  4BLC A;  1ORY B;  5KPR A;  3AFH A;  4I81 A;  3PCN M;  3RGS A;  2KA6 B;  3SMS A;  4AI6 A;  3GLH B;  2DHR A;  3LMX M;  1Z6T A;  1NJF A;  3KVW A;  3GRR A;  2R45 A;  1HNX M;  4QNR A;  3PCK M;  5ITR A;  2F4V M;  3T38 A;  5KQ8 A;  4M0D A;  4DV1 M;  3UMM A;  2BUT B;  1YE9 A;  3GQ5 A;  3FYC A;  4K0K M;  3AOE C;  4PDI A;  3FUT A;  4ILT A;  4A3V B;  3KSX A;  1J7K A;  2X4A A;  3U60 B;  3RE8 A;  1TGU A;  4B7H A;  2BUX B;  1XNR M;  1IY0 A;  3PCF M;  3GPU A;  3SFZ A;  1YKM B;  4GRI A;  1E9R A;  3EIE A;  3HGI A;  1SXJ B;  1XC8 A;  5FTL A;  1GKI A;  2M60 A;  1E94 E;  4LJ9 A;  2QCU A;  2HCB A;  3U6E A;  5GKN A;  1QVR A;  4IBE A;  1PJI A;  5FTJ A;  3KXE C;  3AOE A;  3SAV A;  4DUZ M;  3L2A A;  3PFI A;  3KFU G;  3PCE M;  1DGH A;  2YFQ A;  2XSR A;  2Q2E B;  4I4L A;  4PCZ A;  3AOG A;  2D7H A;  1HNZ M;  3TWL A;  1YKP A;  4KOD A;  4LF4 M;  1R2Z A;  4NXM M;  1LV7 A;  2V1C A;  3MHV C;  4OU7 A;  4OX9 M;  1N78 A;  3M0E A;  4LCB A;  2QBY B;  1Q3B A;  3VDP A;  1YKO B;  5EJC A;  4LJA A;  3O6R A;  4BBA A;  2L7H A;  4Z8X A;  2C9C A;  3U5Z A;  1HQC A;  4AW4 A;  1IY2 A;  1TH4 A;  4DR3 M;  5C1B A;  1IN8 A;  3UGJ A;  4GIT A;  3U6Q A;  4WHO B;  2ZAO A;  5EQT A;  5DYI A;  4NL4 H;  4LFA M;  5ITT A;  4GKK M;  2XSZ A;  4IBJ A;  3GPP A;  4WHP D;  3FTC A;  1Z5B A;  2R65 A;  1HR0 M;  5KO3 A;  3IG8 A;  5KPT A;  3IG5 A;  4IIW A;  4PT5 A;  4NSO B;  3MJ5 A;  3SC3 A;  1EO2 B;  4WHR F;  4OVZ B;  3LKT A;  4L16 A;  4WW0 A;  4NRV A;  1XXH A;  1K82 A;  4G4Q A;  2UUA M;  4AKH A;  4DV7 M;  4BB9 A;  2CUZ A;  2FFJ A;  3PCL A;  1UM8 A;  4FW9 A;  1J5E M;  4DR5 M;  2CV2 A;  1H6U A;  4LG2 A;  5EXX A;  4B3M M;  3CF2 A;  2JA2 A;  4FD2 A;  1TDZ A;  2BUR A;  1XWI A;  3MK6 A;  2LWX A;  5FTN A;  4HLQ A;  5FTK A;  4WHR A;  1DGF A;  3THG A;  2XZU A;  3HU1 A;  4GC5 A;  4L8R C;  4OW0 A;  2P5T A;  3J7A S;  2Z4R A;  2KRK A;  3HWS A;  3I4Y A;  3MI5 A;  4D82 A;  3ZC7 B;  1TH2 A;  1IBL M;  2CHQ A;  2BUV A;  3D8B A;  1K3W A;  3WHK A;  1YKN A;  1S3S A;  3HU2 A;  5BR8 M;  1L2C A;  3J81 S;  3B9P A;  4S12 A;  2BUM A;  1FNN A;  3FUU A;  3UZU A;  3GRY A;  3HHY A;  4DV3 M;  4M9S A;  3HHZ A;  3A42 A;  4WHS A;  4I8O A;  1DGH B;  3GLI A;  5F3W A;  3SAS A;  2NQ8 C;  2X8A A;  3GQ4 A;  3U6D A;  3PCG A;  3MI1 A;  1YKP B;  2XSZ D;  2CV0 A;  3HHX A;  2LXE A;  3L28 A;  3QAU A;  4AZF A;  4B3T M;  4QNM A;  2BV0 A;  3PCL M;  4DR7 M;  1NHG C;  4GH9 A;  4P16 A;  2LNH C;  2Z3X A;  4LRS A;  2ZAM A;  1DGB A;  2OPF A;  1TDH A;  4MM3 B;  4JI0 M;  3HHW A;  1NSF A;  1G3I A;  1SXJ D;  1YUB A;  3U5Z B;  5ITX A;  3DZD A;  3L27 A;  4D81 A;  3FUW A;  5EXP A;  2BUY A;  1SXJ E;  3PCM M;  3I4V A;  2UU9 M;  4G4N A;  4B3S M;  2UXC M;  2XFT A;  3Q8X A;  2LH0 A;  3KOX E;  4HL4 A;  1IQP A;  2YR0 A;  3TWM A;  1NY6 A;  3KDS E;  3MI5 M;  3MFL A;  2YNM D;  1D2N A;  1IBM M;  3ILK A;  2BJV A;  4CIS A;  1EOA A;  1HT2 E;  2C98 A;  3LXV M;  3O5U A;  1I94 M;  2F5P A;  3M7G A;  1NVM A;  4LJ4 A;  1TH3 A;  4GMQ A;  4L78 A;  1L1Z A;  2R4J A;  2D7E A;  1XXH B;  2DVW B;  2XLJ A;  3JAM S;  4LF5 M;  2PCD M;  4YHH M;  4CGY B;  3W0F A;  8CAT A;  4LGM A;  3LVV A;  3KOZ E;  4IBI A;  2R46 A;  3MI1 M;  1I4W A;  4FCT A;  4AKG A;  1Z5A A;  1ZAE A;  1NNJ A;  2BUR B;  4WHO D;  3QWL A;  2OQ4 A;  1Q3C A;  3R8F A;  2W82 A;  2V1U A;  4WHR B;  3SAR A;  2C5R A;  3U6P A;  2UXD M;  4X65 M;  3SAW A;  3PCJ A;  1OFH A;  4G4R A;  1HNW M;  4DUY M;  4KLN A;  2HHH M;  4IJF A;  1JR3 A;  2FE8 A;  2BNK A;  1HT1 E;  2QPA A;  5IWA M;  4JYA M;  2C9O A;  3I51 A;  3K8Z A;  3T67 A;  1G59 A;  2BUV B;  3ZCB B;  1YKN B;  2BUZ A;  3T1Y M;  4LY6 A;  5ITQ A;  2DWM A;  1NY5 A;  2RGO A;  1X37 A;  2BUM B;  5TD3 A;  2XF3 A;  2L7I A;  3GO8 A;  3TPZ A;  3VDU A;  4ITQ A;  3MFL M;  4MGZ E;  4WHS B;  4LF8 M;  1GVN A;  3GLI B;  1HQY E;  3PCB A;  3BOS A;  2RKO A;  2R62 A;  2DZN B;  1KSF X;  5JI2 E;  3KS8 A;  1N33 M;  3GP1 A;  1XHB A;  2Y0T A;  4QOS A;  3SHG B;  3LQQ A;  4ZPX A;  3KS4 A;  4LJ8 A;  1MX0 A;  1W5S A;  1KFV A;  2BV0 B;  2EA0 A;  1YSY A;  5DYG A;  3VLF B;  3SAT A;  2J7N A;  4NOO B;  4RF1 A;  2R4E A;  5EP2 A;  2FNA A;  3PCA A;  3GPY A;  2KXE A;  2C96 A;  1IN5 A;  3TE6 A;  2FOI C;  2UXB M;  2VQE M;  2BUU A;  4M9X A;  4XBO A;  3VKH A;  2XSU A;  3FTE A;  3AL0 C;  4ILV A;  1NNU C;  4LZJ A;  4DV0 M;  2BUY B;  3U6M A;  2F5O A;  3PCJ M;  5E6J A;  3PVS A;  3DA1 A;  3SHF A;  5EXT A;  4FCW A;  4MH0 E;  3UK6 A;  3PCH A;  3A46 A;  3MV4 A;  3PCI A;  2C99 A;  2EO2 A;  5ITU A;  2QP9 X;  4LJ5 A;  4FCV A;  3T67 M;  4WHQ A;  1YKL A;  1OJL A;  4LF6 M;  2H1R A;  1G4A E;  4B08 A;  4X66 M;  4LF9 M;  1EOA B;  5EP3 A;  3SBJ A;  1OFI A;  4W5W A;  1Q39 A;  2KEB A;  5A2Q S;  1MU5 A;  3HKP A;  3PCN A;  1JR3 D;  3CTW B;  1PJJ A;  4MGK E;  1GLN A;  3U6O A;  3MV6 A;  4NRW A;  5EP4 A;  4JI5 M;  2L09 A;  4DR6 M;  3LMX A;  1N75 A;  3SYL A;  3PCB M;  4NXN M;  4JI8 M;  3AJI B;  4L4U A;  4B7G A;  3VFD A;  5EXS A;  4JXJ A;  4RNA A;  2Z7J A;  3L29 A;  5EP1 A;  3PXG A;  3TQS A;  3LKT M;  1QAM A;  3FUX A;  4M9Z A;  3W0L B;  2DWL A;  4IBD A;  2BUQ A;  3HJQ A;  3VK7 A;  1E32 A;  2KZS A;  2QZ4 A;  4R3D A;  4RF0 A;  1YKK A;  5FSW A;  3HJ8 A;  5JI3 E;  1IXR C;  2DZO B;  4X62 M;  1TMX A;  2BUW A;  3C58 A;  3T63 A;  2UUC M;  1EO9 A;  2F5S A;  2Y20 A;  3DOA A;  3FD9 A;  4PDG A;  3TL4 X;  5IT9 S;  4IJE A;  1DGG A;  3FTD A;  3L26 A;  2BUZ B;  1IXZ A;  2CHG A;  4MGI E;  2A5Y B;  4QHT A;  4WUR A;  3PCH M;  3PCI M;  3U6C A;  3NWL A;  4EIW A;  4X64 M;  4QHS A;  4R7G A;  5BPV A;  7CAT A;  3PCE A;  1R2Y A;  1EE8 A;  3M6A A;  2K47 A;  4DV2 M;  2VII A;  3A45 A;  4DV6 M;  4AKI A;  1IN4 A;  3K2L A;  4JI1 M;  4FWH A;  1DLQ A;  2V6Z M;  1PM5 A;  3FYD A;  2ERC A;  4LJ7 A;  3J27 B;  4G6Z A;  1QAN A;  3MV6 M;  4JI4 M;  2KRU A;  1NHW C;  2D7G A;  2ZAN A;  3SAU A;  2XFS A;  3K92 A;  1IN6 A;  4WHP A;  4GHL A;  2AHM A;  3E4R A;  4GKJ M;  4II7 A;  1L2B A;  3CF0 A;  4JV5 M;  3KOY E;  4DR4 M;  1XNQ M;  3T1H M;  2KZU A;  4Z6Y A;  2L6O A;  4DV4 M;  4DR2 M;  1KYI A;  2BUU B;  2CFO A;  3VKG A;  4MB7 A;  3PCG M;  3E9S A;  3GRV A;  3T15 A;  4L15 A;  4KO8 A;  1K3X A;  3DFZ A;  3RGP A;  3FTF A;  1JQJ C;  4I5S A;  2EUC A;  2XEP A;  3SMP A;  3T63 M;  3J80 S;  2F5N A;  3J7B A;  2E5L M;  4WHS D;  2CV1 A;  5ITY A;  4JI6 M;  4AQY M;  3PCD A;  2AZQ A;  4B7F A;  3PNV A;  1FJG M;  2Y0Q A;  4WHQ B;  3AV0 A;  4IBB A;  4JI3 M;  1YKL B;  4PD2 A;  1EOB A;  1WXQ A;  1N36 M;  3LVW A;  3O6J A;  3FKE A;  2CEA A;  3KSJ A;  1IY1 A;  1EOC A;  4GHA A;  4LRT A;  3TWK A;  1L2D A;  3GLF A;  4QOZ C;  1N77 A;  1VDD A;  4YY3 M;  3TH1 A;  1IN7 A;  1J09 A;  2DWN A;  4AG6 A;  2X49 A;  3GLG A;  4M0W A;  3U61 A;  4FWG A;  1GL7 A;  1DO2 A;  4REZ A;  2QEN A;  5ITX E;  4CHT B;  2Z4S A;  3NBI A;  3K1J A;  3LMM A;  4XGI A;  2BUQ B;  1QZM A;  3WHL A;  3HU3 A;  4TUW A;  1R7R A;  3PCC A;  2UUB M;  4LJ6 A;  3GLH A;  3KW6 A;  1YKK B;  2BUW B;  1N34 M;  4B3R M;  3RFW A;  1W5T A;  1EO9 B;  3KP0 E;  1IM2 A;  1R6B X;  3D8L A;  1SXJ C;  4LF7 M;  1QAO A;  3KOW E;  2ZM6 M;  3GPX A;  2M5Z A;  2VQF M;  1G41 A;  3OTO M;  2BUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...