3HJ8A

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
257
structure length
257
Chain Sequence
RATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts
pubmed doi rcsb
total genus 72
structure length 257
sequence length 257
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hj8A01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hj8A02
2BURB 1YKLA 3PCKA 1S9AA 1EO9A 1YKLB 3I4VA 1EO9B 3MI5M 3N9TA 3PCIM 3I51A 2BUQA 4ILTA 3PCBM 2BUQB 3PCDM 2BUXA 2BUXB 3O5UA 3LMXM 1YKNA 2BOYA 3LKTM 3PCJM 1YKNB 3MI5A 2BUZA 3PCIA 2BUZB 2BUMA 3PCEM 2BUMB 3T67M 2AZQA 4WHOB 3LMXA 3PCJA 3PCHA 3PCCA 2BUTA 3MI1M 3T63A 2BUTB 1DLMA 2BUVA 3PCNM 1YKOA 2BUVB 1DLTA 1YKOB 3MV6A 3PCAM 4WHQA 4WHQB 3T67A 3I4YA 3HJQA 2BV0A 2BV0B 3PCMM 3HGIA 3MI1A 1YKKA 3PCBA 2BUWA 1YKKB 3PCNA 4WHSA 3LXVM 2BUWB 1EOBA 3PCDA 4WHSB 1EOBB 3PCAA 4WHOA 3HHXA 3TH1A 3LKTA 1DMHA 3PCGM 3PCFM 2BUYA 2BUYB 1EOAA 1EOAB 3O6RA 3PCEA 4WHPD 3MV4M 2XSRA 1YKMA 3MFLM 1YKMB 2BUUA 3PCFA 4ILVA 2BUUB 3PCLM 1DLQA 2PCDM 2XSUA 1EOCA 1EOCB 4WHRA 4WHRB 3O32A 5TD3A 3MV4A 3HJ8A 3HHYA 2XSVA 3HKPA 1TMXA 3MFLA 3PCKM 3PCMA 3O6JA 3PCHM 3PCCM 3PCLA 3T63M 3LXVA 4WHSD 2PCDA 1YKPA 3MV6M 1YKPB 4WHOD 3PCGA 4WHPA 1EO2A 3HJSA 4WHPB 1EO2B 4WHRF 2BURA
chains in the Genus database with same CATH superfamily
1NVMA 2QPAA 3FTCA 1PRBA 2DAEA 2R6FA 1S9AA 4MGIE 3L25A 4MH0E 2L6OA 3H4JA 1I94M 3I51A 1XB2B 3FTFA 3HWSA 4IBEA 3T63M 3TWKA 3AFHA 5EP3A 1IBKM 2R18A 1OKSA 4MGKE 4A3VB 4I4LA 2L2DA 4LJ9A 1GJSA 5ITUA 4DUYM 3TWMA 3PCJM 1JR3E 2QCUA 4LJ6A 1PJQA 1D0LA 3J7BA 5DYIA 4LFBM 3C3EA 2DENA 2MR9A 2HCBA 1NNUC 1KFVA 1OTRA 1IFYA 4NOOB 3MK6A 3VDPA 4ANRA 1QUTA 4RF0A 4X64M 3SHGB 3IHPA 2X8AA 3L28A 4IBJA 3J81S 1KYIA 1MU5A 3C58A 4JI4M 4AKHA 3T1YM 2CV2A 1IY1A 4I81A 3LMXA 3M6AA 1GO5A 3LVWA 1MX0A 4IBBA 5EP1A 3PCCA 1HJPA 2QP9X 5F3WA 4DBGB 1DLMA 2H1RA 3IG8A 3CF6E 2F5SA 2BUVA 1A5TA 2CWBA 3PFIA 4DV6M 3U6SA 4JI1M 3AOGA 2BUVB 1IN7A 2X4AA 4ZPXA 1XMOM 1WHCA 2JY8A 2WSEF 3ZCBB 4R71A 4K0KM 1AUAA 1VDLA 5FTJA 4LY6A 5E6JA 1N78A 1HT1E 2RGOA 1GJTA 5L8RF 1OIPA 1WR1B 4JI3M 2QZ4A 2V6ZM 3HGIA 2LHGA 2LVQD 2OO9A 3PNVA 4CISA 2EUCA 3MI1A 1QDTA 1PM5A 2W82A 2GNOA 4M0WA 3LXVM 3E9SA 4XK8F 3TQSA 2JUJA 3HY5A 3UJNA 3KOYE 1P3QQ 3A42A 4LJ5A 3GLFA 4RNAA 3IG5A 2XSZA 3GLFB 1JB0F 4G4QA 2R4EA 4YHHM 3W0LB 2X49A 1N77A 3J80S 2EKKA 3KOZE 4G6ZA 4AW4A 5LMUM 4JYAM 4LJAA 3TWLA 4NC6A 1QANA 4JI2M 1IM2A 1OFIA 1OFHA 3ILKA 3J27B 2N35A 1XXHE 1TH3A 4FWGA 3SMPA 3KSJA 4LJ7A 5ITQA 4BB9A 1Z5CA 2CV0A 1D0MA 3DOAA 2WSFF 2A5YB 2L4FA 4LJ8A 1SXJE 2QSFX 4M9ZA 4QNMA 5H37D 4X66M 3U6MA 3SAUA 1K3XA 1Z59A 3GLFE 1Z6TA 1QAMA 1Y8GA 2Y0TA 1TR8A 2MROB 2FNAA 1SG9A 4GKKM 2XFTA 3D8BA 4G3OA 4EIWA 2XLJA 3BXWA 3FTDA 3KP1E 4DR6M 1DLQA 1EOCA 3U60A 1EOCB 4PT5A 2D7HA 4FCWA 2Y20A 4JN6A 4OU7A 3U60B 1L1ZA 3E21A 3GRVA 2K6BA 4LFAM 4AQYM 4HLQA 3ZC7B 4FVMA 2G5GX 3R8FA 4G4NA 3B7NA 3PCCM 2C9OA 1VDDA 3SASA 2CEAA 1HT2E 4FWHA 4OVZA 3GPXA 1L2CA 4NXMM 1NHWC 1NY6A 4OVZB 1YKPA 1KSFX 1YKPB 2DVWB 4WHOD 4G4OA 5EXSA 4B3SM 1IBLM 3PNYA 5A2QS 1QYRA 2HWJA 5C1BA 4WHPA 1R5LA 1PJSA 4ITQA 4WHPB 4KLNA 2JY7A 2JY5A 4DUZM 3VK8A 3HHZA 3PCKA 1YKLA 4IBIA 1R6BX 1EO9A 2JA2A 1YKLB 3I4VA 1EO9B 4QOSA 3MI5M 3T6PA 4JI8M 2DWZB 2BUQA 3HU2A 1F4IA 2BUQB 5DFLA 1GABA 1DGHA 2R44A 4B08A 4X65M 1DGHB 1PGYA 3U6EA 1K3WA 4LGMA 2KNAA 3AJIB 4JXJA 1L2DA 1GLNA 3WHLA 4JI7M 3O5UA 2OOAA 1IY0A 1E9RA 4DV2M 2XH9A 3LCVB 4BLCA 2Z8YM 3FUTA 3BBZA 4CIZA 1J09A 2UXDM 1DO2A 3GO8A 1JR3A 3PCIA 1Q39A 5DNYA 4LZJA 1NV9A 5EP2A 2Z4SA 3PVSA 3SMSA 2MJ5B 4WW0A 3SATA 3T15A 3T67M 3T1HM 4LZZA 4JI5M 3KW6A 2F5OA 4PD2A 4DV3M 2V1CA 1TDZA 3W67A 2Z4RA 3LCUA 3KDSE 2XZUA 3FE3A 3JR4A 2DAKA 4L16A 5ITTA 1HNWM 2QBYA 1W5TA 3KP0E 1QQWA 2QBYB 1XNRM 2JNHA 3A45A 3FYDA 1R2YA 2DWLA 3MV6A 3PCAM 4WHQA 1VEJA 1IN6A 1DGBA 3M7GA 4WHQB 3L29A 2CE7A 2K0BX 3GQ5A 3B9PA 4LF5M 1VQ1A 3JR5A 1Q3BA 3AKZA 1HR0M 2H5XA 2KZUA 2L4EA 4IJFA 1RU3A 5FSWA 3HU1A 3PCBA 1GVNA 2BUWA 3H4MA 3KVWA 3PCNA 1G59A 4WHSA 2BUWB 4DR1M 4WHSB 1I4WA 3NBIA 1CUKA 2KNZA 3RFWA 1IXZA 3GRRA 4IJEA 4PDIA 1LTMA 2DAMA 4P16A 4L6V6 1VG5A 3RGSA 5FTNA 5ITXE 3DZDA 4D82A 2OOBA 1IBMM 2F4VM 3PCFM 3V76A 1G41A 4LRSA 1FNNA 2Z7JA 2O01F 3DA1A 2CV1A 3LW5F 2LVNC 1EOAA 4IBCA 1EOAB 2I7NA 2LNHC 4DR7M 2DZLA 3KOWE 4M9XA 1WIVA 3UZUA 3UGJA 4R3DA 1GL7A 4HL4A 2Z3XA 1ZMVA 1DGFA 1YSYA 4MGHA 5E26A 2L7IA 4M0DA 3L26A 2XZFA 1NJFA 2FH0A 1YKMA 3MFLM 3K2LA 1XXHA 1YKMB 1V92A 1TH4A 1XXHB 3HZJA 2BUUA 1NJGA 5LMNM 2BUUB 3PCLM 2VQFM 2BWEA 1SXJA 1SXJB 4D81A 1E94E 2VQEM 1XNQM 1DGGA 2DAIA 1QZEA 2KNVA 4AG6A 3UMMA 4WHRA 3TL4X 2D7EA 4WHRB 5TD3A 1Q3CA 2DHYA 2RRUA 4DR4M 3SYLA 2QHOB 3GLIE 2BWBA 2KDLA 3MV4A 2DZOB 3HKPA 1TMXA 2ERCA 1ZMUA 1IXRC 1X37A 1UM8A 2C99A 4FD2A 2YQZA 3FYCA 3F92A 4NRVA 2DXIA 2EA0A 2K47A 1G71A 3R9XB 2HKJA 4DV0M 5EXTA 4GITA 2PCDA 3CF0A 3K92A 2DAGA 2XEPA 3TPZA 3GPUA 3MV6M 4KHPM 3GPPA 2BJWA 2VF8A 4DV1M 4F2LA 1QZMA 2XSZD 2FE8A 4OX9M 2UXCM 2XF3A 3HU3A 2LXEA 2CUZA 3LMMA 3SC3A 1MJGM 4JI6M 4B7FA 4Z6YA 2XFSA 3U61A 3KXEC 4AI6A 3N9TA 4QHSA 2ZAMA 3U61B 4HEOA 3PCBM 2BJVA 3W68A 2APLA 2KRUA 1SXJC 2LVPC 5FLXS 3CF2A 1XMQM 4B3MM 3LMXM 2CFOA 4IBGA 2CHQA 4PDGA 2BOYA 3K1JA 3MHVC 2DHRA 1ZMWA 3HHWA 3LVVA 4UN2B 1YUBA 2FOIC 3K9OA 1MN3A 4LF4M 2VIIA 1WGLA 2BUMA 1AIPC 2UUCM 4Q7JA 2BUMB 3Q8XA 4XBOA 3M0EA 4DV5M 4PCZA 2AZQA 3GLHA 1GL6A 3U5ZA 1J7KA 3GLHB 4WURA 4WHOB 1NO1A 3U5ZB 3PCJA 2DNAA 1H6UA 2ZM6M 2KW0A 1K82A 2LVOC 3DFZA 3FUVA 4GIPA 2GQFA 2ZTCA 5JI3E 5IT9S 3MI1M 3T63A 2B3TA 2C96A 2QENA 3L27A 5FTMA 2WZJA 3CTWB 4R7GA 4X62M 4B3TM 1DLTA 3RGPA 3B7ZA 2LH0A 1L8QA 4GC9A 4QNRA 1NSFA 1IN5A 3FKEA 2R0IA 3AOEA 3J2PB 1T43A 3GRUA 5EJCA 3PXGA 5JI2E 2C5RA 1ORYB 4JI0M 3C3DA 1UFZA 3HJQA 5IZ7D 2F5QA 2DI0A 4MGYE 7CATA 1VEKA 3GRYA 4GHAA 3AV0A 3GLHE 3QAUA 4LCBA 2ZBKB 1NNJA 1E9SA 1EOBA 3PCDA 2VF7A 1EOBB 5EP4A 1G8PA 3FUWA 4LRTA 3KS4A 3Q8GA 1TF0B 4IIWA 2XGNA 2DWNA 1ZQ9A 1NHGC 1OQYA 3D8LA 4XGIA 8CATA 4LF8M 3LKTA 1YLAA 3KSXA 1PJTA 2HL7A 4MM3B 3SFZA 2VDBB 1XWIA 1ZV1A 4NXNM 3U6OA 2L7HA 3T38A 1HNXM 4I5SA 5ITXA 3O6RA 1JR3D 2JXNA 3B7QA 3JAMS 1C1KA 1L2BA 3PCEA 2UU9M 1DV0A 3ZQJA 2Q2EB 3GLGE 2R62A 2P5TA 2KRKA 2G3QA 3E46A 3FRHA 2XSRA 4RKUF 1R2ZA 4CJ6A 1S3SA 3J7AS 1BVSA 2CP8A 2NQ8C 1N75A 3AOEC 1VEGA 4ILVA 1LV7A 2OQ4A 4CHTB 2DKLA 3FUXA 4NL4H 1XC8A 4KO8A 3GQ4A 2F5NA 5BPVA 4L4UA 3O32A 3VDUA 3VFDA 4I8OA 3CGWA 1QUSA 1N34M 5KQDA 1ZAEA 4LJ4A 2OPFA 2E5LM 3PCKM 3PCMA 3O6JA 4AG5A 4S12A 2C9CA 2UXBM 3U6CA 3SAVA 2KHHA 3FRIA 3GLIA 4DV4M 4DV7M 3ZH9B 2MH8A 2KZSA 1Z5AA 2J5YA 3A98B 1IN8A 4FWDA 4WP2A 3GLIB 4G4RA 4LF6M 4WHSD 1L1TA 2CRUA 4NSRA 4LG2A 4YY3M 2UUAM 2O5RA 4REZA 4IBKA 4M9SA 2R45A 3PCGA 3LQRA 3HJSA 1EO2A 2ZANA 1HQYE 3NBXX 4B3RM 4TUWA 2L09A 5C18A 1EO2B 4WHRF 2BURA 3VKGA 3L2AA 1T6OA 1N33M 2MGWA 2O25A 4CGYB 1V33A 2BURB 1TTEA 3UK6A 3OTOM 5DYGA 1D2NA 1IY2A 1JQJC 3EIHA 3PCIM 4ILTA 3GPYA 2JP7A 4GH9A 4P17A 4NRWA 4GHLA 2LHCA 3I04M 3PCDM 2LBCA 2BUXA 4L15A 3WHKA 1OAIA 4AKGA 3KS8A 2BUXB 1N36M 1FJGM 2KA6B 3PCHA 1YKNA 5EXXA 4LF9M 3LKTM 1QAOA 2UUBM 1YKNB 3LQQA 1HQCA 2LTUA 2FFJA 2RKOA 3W0FA 5ITRA 4L8RC 2YR0A 3QYEA 3BOSA 1SXJD 4QOZC 3MI5A 4IBDA 4Z8XA 2BUZA 2DZNB 2BUZB 4D80A 5KQ8A 3PCEM 2JZ1A 2R46A 4II7A 2DWMA 1GKIA 4FCVA 4B7GA 5FTLA 4MB7A 2ZTDA 2EO2A 3MJ5A 1V34A 2CHGA 2EJSA 3NWLA 1WXQA 3QWLA 4L78A 4NSOB 1G4AE 3GQ3A 1J5EM 2BUTA 2BUTB 2LWXA 2HHHM 3PCNM 1HNZM 1YKOA 1YKOB 2FS1A 1PJIA 3A46A 3HX3A 3MMPA 1NY5A 3I4YA 4GC5A 4GMQA 1IXSA 1TDHA 1EE8A 1IN4A 1OIZA 3T67A 1IXSB 2G8LA 4F1IA 2Y21A 4Y28F 2R65A 2BV0A 1E32A 2F5PA 1NV8A 2BV0B 3E4RA 1N32M 5EQTA 3C9PA 3U6DA 2QNJA 4AKIA 3PCMM 1PJJA 4KT0F 1YKKA 4GRIA 3TE6A 3U6QA 1YKKB 3AL0C 1D0KA 3I01M 5KPTA 4LF7M 1EFUB 4DR3M 3PCAA 4WHOA 1R7RA 3HHXA 4DR2M 3TH1A 3FTEA 4KODA 1WJ7A 2RGHA 4DR5M 1DMHA 2D7GA 5KPRA 3SBJA 3PCGM 1WGNA 2K9DA 2ZAOA 3QYBA 2BUYA 2LVAA 1TGUA 5KPZA 2BUYB 4B7HA 1T3TA 4LFCM 1Q02A 1IQPA 1QVRA 2V1UA 4MGZE 2CHVA 3VLFB 5BR8M 5FTKA 2BNKA 5GKNA 2R4JA 4WHPD 3SHFA 3MV4M 1TH2A 3SYKA 1OAOC 3RE8A 2J7NA 2YFQA 3B89A 1EIJA 3KOXE 3GP1A 3VKHA 3PCFA 3IECA 3FUUA 2Y0QA 2YNMD 3GLGA 2JY6B 5KO3A 1QDRA 3GLGB 4FW9A 1G3IA 3K9PA 3U6LA 1OJLA 1QAQA 2M5ZA 2PCDM 2XSUA 4RF1A 1C7YA 2KEBA 3EIEA 4OW0A 5IWAM 1YE9A 1R4GA 3B74A 2C98A 1XHBA 4BBAA 3HJ8A 3HHYA 4IBFA 2XSVA 2JZ0A 3MFLA 1DO0A 5EXPA 1Z5BA 4GEWA 2JWSA 3PCHM 2M60A 3THGA 5ITYA 3PCLA 2I7PA 1W5SA 4JV5M 3LXVA 2WSCF 3SARA 2HAKA 4QHTA 3SAWA 3K8ZA 4FCTA 3FD9A 4W5WA 2EKFA 2J7OA 2QQ8A 5IREB 4LGYA 3KFUG 3VK7A 4AZFA 2AHMA 4GKJM 3U6PA 2KXEA
chains in the Genus database with same CATH topology
1NVMA 2QPAA 3FTCA 1S9AA 4MGIE 3L25A 4MH0E 2L6OA 1I94M 3I51A 3FTFA 3HWSA 4IBEA 3T63M 3TWKA 3AFHA 5EP3A 1IBKM 2R18A 4MGKE 4A3VB 4I4LA 4LJ9A 5ITUA 4DUYM 3TWMA 3PCJM 2QCUA 4LJ6A 3J7BA 5DYIA 4LFBM 2HCBA 1NNUC 1KFVA 4NOOB 3MK6A 3VDPA 4RF0A 4X64M 3SHGB 2X8AA 3L28A 4IBJA 3J81S 1KYIA 1MU5A 3C58A 4JI4M 4AKHA 3T1YM 2CV2A 1IY1A 4I81A 3LMXA 3M6AA 3LVWA 1MX0A 4IBBA 5EP1A 3PCCA 2QP9X 5F3WA 1DLMA 2H1RA 3IG8A 3CF6E 2F5SA 2BUVA 3U6SA 3PFIA 4DV6M 4JI1M 2BUVB 3AOGA 1IN7A 2X4AA 4ZPXA 1XMOM 3ZCBB 4K0KM 5FTJA 4LY6A 5E6JA 1N78A 1HT1E 2RGOA 4JI3M 2QZ4A 2V6ZM 3HGIA 4CISA 3PNVA 3MI1A 2EUCA 1PM5A 2W82A 4M0WA 3LXVM 3E9SA 3TQSA 3UJNA 3KOYE 3A42A 4LJ5A 3GLFA 4RNAA 3IG5A 2XSZA 3GLFB 4G4QA 2R4EA 4YHHM 3W0LB 2X49A 1N77A 3J80S 3KOZE 4G6ZA 4AW4A 5LMUM 4JYAM 4LJAA 3TWLA 1QANA 4JI2M 1IM2A 1OFHA 1OFIA 3ILKA 3J27B 1TH3A 4FWGA 3SMPA 3KSJA 4LJ7A 5ITQA 4BB9A 1Z5CA 2CV0A 3DOAA 2A5YB 4M9ZA 4LJ8A 1SXJE 4QNMA 5H37D 3U6MA 4X66M 3SAUA 1K3XA 1Z59A 1Z6TA 1QAMA 2Y0TA 2FNAA 4GKKM 2XFTA 3D8BA 4EIWA 2XLJA 4DR6M 3FTDA 3KP1E 1DLQA 1EOCA 1EOCB 3U60A 4PT5A 2D7HA 4FCWA 2Y20A 4JN6A 4OU7A 3U60B 1L1ZA 3GRVA 4LFAM 4AQYM 4HLQA 3ZC7B 4FVMA 2G5GX 3R8FA 4G4NA 3PCCM 2C9OA 1VDDA 3SASA 2CEAA 1HT2E 4FWHA 4OVZA 3GPXA 1L2CA 4NXMM 1NHWC 1NY6A 4OVZB 1YKPA 1KSFX 1YKPB 2DVWB 4WHOD 4G4OA 5EXSA 4B3SM 1IBLM 3PNYA 5A2QS 1QYRA 4WHPA 5C1BA 4ITQA 4WHPB 4KLNA 4DUZM 3VK8A 3HHZA 3PCKA 1YKLA 4IBIA 1R6BX 1EO9A 2JA2A 1YKLB 3I4VA 1EO9B 4QOSA 3MI5M 4JI8M 2DWZB 2BUQA 3HU2A 2BUQB 1DGHA 4B08A 4X65M 1DGHB 3U6EA 1K3WA 4LGMA 3AJIB 4JXJA 1L2DA 1GLNA 3WHLA 4JI7M 3O5UA 1IY0A 1E9RA 4DV2M 2XH9A 4BLCA 3FUTA 2UXDM 1J09A 1DO2A 3GO8A 1JR3A 3PCIA 1Q39A 5DNYA 4LZJA 5EP2A 2Z4SA 3PVSA 3SMSA 3SATA 4WW0A 3T15A 3T67M 3T1HM 4LZZA 4JI5M 3KW6A 2F5OA 4PD2A 4DV3M 2V1CA 1TDZA 2Z4RA 3KDSE 2XZUA 3JR4A 4L16A 5ITTA 1HNWM 2QBYA 1W5TA 3KP0E 1QQWA 2QBYB 1XNRM 3MV6A 3A45A 3FYDA 1R2YA 2DWLA 3PCAM 4WHQA 1IN6A 1DGBA 3M7GA 4WHQB 3L29A 2CE7A 3GQ5A 3B9PA 4LF5M 3JR5A 1Q3BA 3AKZA 1HR0M 2KZUA 4IJFA 5FSWA 3HU1A 3PCBA 1GVNA 2BUWA 3H4MA 3KVWA 3PCNA 1G59A 4WHSA 2BUWB 4DR1M 4WHSB 1I4WA 3NBIA 3RFWA 1IXZA 3GRRA 4IJEA 4PDIA 4P16A 3RGSA 5ITXE 5FTNA 3DZDA 4D82A 1IBMM 2F4VM 3PCFM 1G41A 4LRSA 1FNNA 2Z7JA 3DA1A 2CV1A 1EOAA 4IBCA 1EOAB 2I7NA 2LNHC 4DR7M 3KOWE 4M9XA 3UZUA 3UGJA 4R3DA 1GL7A 4HL4A 2Z3XA 1DGFA 1YSYA 4MGHA 5E26A 2L7IA 4M0DA 3L26A 2XZFA 1NJFA 1YKMA 3MFLM 3K2LA 1XXHA 1YKMB 2BUUA 1TH4A 1XXHB 1NJGA 5LMNM 2BUUB 3PCLM 2VQFM 1SXJA 1SXJB 4D81A 1E94E 2VQEM 1XNQM 1DGGA 4AG6A 3UMMA 4WHRA 3TL4X 2D7EA 4WHRB 5TD3A 1Q3CA 3MV4A 4DR4M 3SYLA 2DZOB 3HKPA 1TMXA 2ERCA 1IXRC 1X37A 1UM8A 2C99A 4FD2A 2YQZA 3FYCA 4NRVA 2DXIA 3R9XB 2EA0A 2K47A 2HKJA 4DV0M 5EXTA 4GITA 2PCDA 3CF0A 3K92A 2XEPA 3TPZA 3GPUA 3MV6M 4KHPM 3GPPA 2BJWA 4DV1M 1QZMA 2XSZD 2FE8A 4OX9M 2UXCM 2XF3A 3HU3A 2LXEA 2CUZA 3LMMA 3SC3A 4JI6M 4B7FA 4Z6YA 2XFSA 3U61A 3KXEC 4AI6A 3N9TA 4QHSA 2ZAMA 3U61B 3PCBM 2BJVA 2KRUA 1SXJC 5FLXS 3CF2A 1XMQM 4B3MM 3LMXM 2CFOA 4IBGA 2CHQA 4PDGA 2BOYA 3K1JA 3MHVC 2DHRA 3HHWA 3LVVA 1YUBA 2FOIC 4LF4M 2VIIA 2BUMA 2UUCM 2BUMB 3Q8XA 4XBOA 3M0EA 4DV5M 4PCZA 2AZQA 3GLHA 1GL6A 3U5ZA 1J7KA 3GLHB 4WURA 4WHOB 3PCJA 3U5ZB 1K82A 1H6UA 2ZM6M 2KW0A 3DFZA 3FUVA 4GIPA 5JI3E 5IT9S 3MI1M 3T63A 2C96A 2QENA 3L27A 5FTMA 4X62M 3CTWB 4R7GA 1DLTA 4B3TM 3RGPA 2LH0A 1L8QA 4GC9A 4QNRA 1NSFA 1IN5A 3FKEA 5EJCA 3AOEA 3J2PB 3GRUA 2C5RA 5JI2E 3PXGA 1ORYB 4JI0M 3HJQA 5IZ7D 2F5QA 4MGYE 7CATA 3GRYA 4GHAA 3AV0A 3QAUA 4LCBA 2ZBKB 1NNJA 1E9SA 1EOBA 3PCDA 1EOBB 5EP4A 1G8PA 3FUWA 4LRTA 3KS4A 2DWNA 4IIWA 2XGNA 1ZQ9A 1NHGC 3D8LA 4XGIA 8CATA 4LF8M 3LKTA 3KSXA 2HL7A 3SFZA 4MM3B 1XWIA 4NXNM 3U6OA 2L7HA 3T38A 1HNXM 4I5SA 5ITXA 3O6RA 1JR3D 3JAMS 3PCEA 1C1KA 1L2BA 2UU9M 2Q2EB 2R62A 2P5TA 2KRKA 2XSRA 1R2ZA 3J7AS 1S3SA 3AOEC 2NQ8C 1N75A 4ILVA 1LV7A 2OQ4A 4CHTB 1XC8A 3FUXA 4NL4H 4KO8A 3GQ4A 2F5NA 5BPVA 4L4UA 3O32A 3VDUA 3VFDA 4I8OA 1N34M 5KQDA 1ZAEA 4LJ4A 2OPFA 2E5LM 3PCKM 3PCMA 3O6JA 4AG5A 4S12A 2C9CA 2UXBM 3U6CA 3SAVA 3GLIA 4DV4M 4DV7M 3ZH9B 3A98B 2KZSA 1Z5AA 4FWDA 3GLIB 1IN8A 4G4RA 4LF6M 4WHSD 1L1TA 4NSRA 4LG2A 4YY3M 2UUAM 2O5RA 4REZA 4IBKA 4M9SA 2R45A 3PCGA 3LQRA 3HJSA 1EO2A 2ZANA 1HQYE 4B3RM 4TUWA 1EO2B 2L09A 5C18A 4WHRF 2BURA 3VKGA 3L2AA 1N33M 2BURB 4CGYB 3UK6A 3OTOM 5DYGA 1D2NA 1IY2A 1JQJC 3EIHA 3PCIM 4ILTA 3GPYA 4GH9A 4NRWA 4GHLA 3PCDM 2BUXA 4L15A 3WHKA 4AKGA 3KS8A 2BUXB 1N36M 1FJGM 2KA6B 3PCHA 1YKNA 5EXXA 4LF9M 3LKTM 1QAOA 2UUBM 1YKNB 3LQQA 1HQCA 2RKOA 2FFJA 3W0FA 5ITRA 4L8RC 2YR0A 3BOSA 1SXJD 4QOZC 3MI5A 4IBDA 4Z8XA 2BUZA 2DZNB 2BUZB 4D80A 5KQ8A 3PCEM 2R46A 4II7A 2DWMA 1GKIA 4FCVA 4B7GA 5FTLA 4MB7A 2EO2A 3MJ5A 2CHGA 3QWLA 4L78A 3NWLA 1WXQA 3GQ3A 1J5EM 4NSOB 1G4AE 2BUTA 2BUTB 2LWXA 2HHHM 3PCNM 1HNZM 1YKOA 1YKOB 1PJIA 3A46A 1NY5A 3I4YA 4GC5A 4GMQA 1TDHA 3T67A 1EE8A 1IN4A 1IXSB 2G8LA 2Y21A 2R65A 2BV0A 1E32A 2F5PA 2BV0B 3E4RA 1N32M 5EQTA 3U6DA 4AKIA 3PCMM 1PJJA 1YKKA 4GRIA 3TE6A 3U6QA 1YKKB 3AL0C 4LF7M 5KPTA 4DR3M 3PCAA 4WHOA 1R7RA 3HHXA 4DR2M 3TH1A 3FTEA 4KODA 1DMHA 2RGHA 4DR5M 2D7GA 5KPRA 3SBJA 3PCGM 2ZAOA 2BUYA 1TGUA 5KPZA 2BUYB 4B7HA 1T3TA 4LFCM 1IQPA 1QVRA 2V1UA 4MGZE 2CHVA 3VLFB 5BR8M 5FTKA 2BNKA 5GKNA 2R4JA 4WHPD 3SHFA 3MV4M 1TH2A 3SYKA 3RE8A 2J7NA 2YFQA 3KOXE 3GP1A 3VKHA 3PCFA 3FUUA 2Y0QA 2YNMD 3GLGA 5KO3A 3GLGB 4FW9A 1G3IA 3U6LA 1OJLA 1QAQA 2M5ZA 2PCDM 2XSUA 4RF1A 2KEBA 3EIEA 4OW0A 5IWAM 1YE9A 2C98A 1XHBA 4BBAA 3HJ8A 3HHYA 4IBFA 2XSVA 3MFLA 1DO0A 5EXPA 1Z5BA 3PCHM 2M60A 3THGA 5ITYA 3PCLA 2I7PA 1W5SA 4JV5M 3LXVA 3SARA 4QHTA 3SAWA 3K8ZA 4FCTA 3FD9A 4W5WA 2J7OA 5IREB 4LGYA 3KFUG 3VK7A 4AZFA 2AHMA 4GKJM 3U6PA 2KXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUR B;  1YKL A;  3PCK A;  1S9A A;  1EO9 A;  1YKL B;  3I4V A;  1EO9 B;  3MI5 M;  3N9T A;  3PCI M;  3I51 A;  2BUQ A;  4ILT A;  3PCB M;  2BUQ B;  3PCD M;  2BUX A;  2BUX B;  3O5U A;  3LMX M;  1YKN A;  2BOY A;  3LKT M;  3PCJ M;  1YKN B;  3MI5 A;  2BUZ A;  3PCI A;  2BUZ B;  2BUM A;  3PCE M;  2BUM B;  3T67 M;  2AZQ A;  4WHO B;  3LMX A;  3PCJ A;  3PCH A;  3PCC A;  2BUT A;  3MI1 M;  3T63 A;  2BUT B;  1DLM A;  2BUV A;  3PCN M;  1YKO A;  2BUV B;  1DLT A;  1YKO B;  3MV6 A;  3PCA M;  4WHQ A;  4WHQ B;  3T67 A;  3I4Y A;  3HJQ A;  2BV0 A;  2BV0 B;  3PCM M;  3HGI A;  3MI1 A;  1YKK A;  3PCB A;  2BUW A;  1YKK B;  3PCN A;  4WHS A;  3LXV M;  2BUW B;  1EOB A;  3PCD A;  4WHS B;  1EOB B;  3PCA A;  4WHO A;  3HHX A;  3TH1 A;  3LKT A;  1DMH A;  3PCG M;  3PCF M;  2BUY A;  2BUY B;  1EOA A;  1EOA B;  3O6R A;  3PCE A;  4WHP D;  3MV4 M;  2XSR A;  1YKM A;  3MFL M;  1YKM B;  2BUU A;  3PCF A;  4ILV A;  2BUU B;  3PCL M;  1DLQ A;  2PCD M;  2XSU A;  1EOC A;  1EOC B;  4WHR A;  4WHR B;  3O32 A;  5TD3 A;  3MV4 A;  3HJ8 A;  3HHY A;  2XSV A;  3HKP A;  1TMX A;  3MFL A;  3PCK M;  3PCM A;  3O6J A;  3PCH M;  3PCC M;  3PCL A;  3T63 M;  3LXV A;  4WHS D;  2PCD A;  1YKP A;  3MV6 M;  1YKP B;  4WHO D;  3PCG A;  4WHP A;  1EO2 A;  3HJS A;  4WHP B;  1EO2 B;  4WHR F;  2BUR A; 
#chains in the Genus database with same CATH topology
 1NVM A;  2QPA A;  3FTC A;  1PRB A;  2DAE A;  2R6F A;  1S9A A;  4MGI E;  3L25 A;  4MH0 E;  2L6O A;  3H4J A;  1I94 M;  3I51 A;  1XB2 B;  3FTF A;  3HWS A;  4IBE A;  3T63 M;  3TWK A;  3AFH A;  5EP3 A;  1IBK M;  2R18 A;  1OKS A;  4MGK E;  4A3V B;  4I4L A;  2L2D A;  4LJ9 A;  1GJS A;  5ITU A;  4DUY M;  3TWM A;  3PCJ M;  1JR3 E;  2QCU A;  4LJ6 A;  1PJQ A;  1D0L A;  3J7B A;  5DYI A;  4LFB M;  3C3E A;  2DEN A;  2MR9 A;  2HCB A;  1NNU C;  1KFV A;  1OTR A;  1IFY A;  4NOO B;  3MK6 A;  3VDP A;  4ANR A;  1QUT A;  4RF0 A;  4X64 M;  3SHG B;  3IHP A;  2X8A A;  3L28 A;  4IBJ A;  3J81 S;  1KYI A;  1MU5 A;  3C58 A;  4JI4 M;  4AKH A;  3T1Y M;  2CV2 A;  1IY1 A;  4I81 A;  3LMX A;  3M6A A;  1GO5 A;  3LVW A;  1MX0 A;  4IBB A;  5EP1 A;  3PCC A;  1HJP A;  2QP9 X;  5F3W A;  4DBG B;  1DLM A;  2H1R A;  3IG8 A;  3CF6 E;  2F5S A;  2BUV A;  1A5T A;  2CWB A;  3PFI A;  4DV6 M;  3U6S A;  4JI1 M;  3AOG A;  2BUV B;  1IN7 A;  2X4A A;  4ZPX A;  1XMO M;  1WHC A;  2JY8 A;  2WSE F;  3ZCB B;  4R71 A;  4K0K M;  1AUA A;  1VDL A;  5FTJ A;  4LY6 A;  5E6J A;  1N78 A;  1HT1 E;  2RGO A;  1GJT A;  5L8R F;  1OIP A;  1WR1 B;  4JI3 M;  2QZ4 A;  2V6Z M;  3HGI A;  2LHG A;  2LVQ D;  2OO9 A;  3PNV A;  4CIS A;  2EUC A;  3MI1 A;  1QDT A;  1PM5 A;  2W82 A;  2GNO A;  4M0W A;  3LXV M;  3E9S A;  4XK8 F;  3TQS A;  2JUJ A;  3HY5 A;  3UJN A;  3KOY E;  1P3Q Q;  3A42 A;  4LJ5 A;  3GLF A;  4RNA A;  3IG5 A;  2XSZ A;  3GLF B;  1JB0 F;  4G4Q A;  2R4E A;  4YHH M;  3W0L B;  2X49 A;  1N77 A;  3J80 S;  2EKK A;  3KOZ E;  4G6Z A;  4AW4 A;  5LMU M;  4JYA M;  4LJA A;  3TWL A;  4NC6 A;  1QAN A;  4JI2 M;  1IM2 A;  1OFI A;  1OFH A;  3ILK A;  3J27 B;  2N35 A;  1XXH E;  1TH3 A;  4FWG A;  3SMP A;  3KSJ A;  4LJ7 A;  5ITQ A;  4BB9 A;  1Z5C A;  2CV0 A;  1D0M A;  3DOA A;  2WSF F;  2A5Y B;  2L4F A;  4LJ8 A;  1SXJ E;  2QSF X;  4M9Z A;  4QNM A;  5H37 D;  4X66 M;  3U6M A;  3SAU A;  1K3X A;  1Z59 A;  3GLF E;  1Z6T A;  1QAM A;  1Y8G A;  2Y0T A;  1TR8 A;  2MRO B;  2FNA A;  1SG9 A;  4GKK M;  2XFT A;  3D8B A;  4G3O A;  4EIW A;  2XLJ A;  3BXW A;  3FTD A;  3KP1 E;  4DR6 M;  1DLQ A;  1EOC A;  3U60 A;  1EOC B;  4PT5 A;  2D7H A;  4FCW A;  2Y20 A;  4JN6 A;  4OU7 A;  3U60 B;  1L1Z A;  3E21 A;  3GRV A;  2K6B A;  4LFA M;  4AQY M;  4HLQ A;  3ZC7 B;  4FVM A;  2G5G X;  3R8F A;  4G4N A;  3B7N A;  3PCC M;  2C9O A;  1VDD A;  3SAS A;  2CEA A;  1HT2 E;  4FWH A;  4OVZ A;  3GPX A;  1L2C A;  4NXM M;  1NHW C;  1NY6 A;  4OVZ B;  1YKP A;  1KSF X;  1YKP B;  2DVW B;  4WHO D;  4G4O A;  5EXS A;  4B3S M;  1IBL M;  3PNY A;  5A2Q S;  1QYR A;  2HWJ A;  5C1B A;  4WHP A;  1R5L A;  1PJS A;  4ITQ A;  4WHP B;  4KLN A;  2JY7 A;  2JY5 A;  4DUZ M;  3VK8 A;  3HHZ A;  3PCK A;  1YKL A;  4IBI A;  1R6B X;  1EO9 A;  2JA2 A;  1YKL B;  3I4V A;  1EO9 B;  4QOS A;  3MI5 M;  3T6P A;  4JI8 M;  2DWZ B;  2BUQ A;  3HU2 A;  1F4I A;  2BUQ B;  5DFL A;  1GAB A;  1DGH A;  2R44 A;  4B08 A;  4X65 M;  1DGH B;  1PGY A;  3U6E A;  1K3W A;  4LGM A;  2KNA A;  3AJI B;  4JXJ A;  1L2D A;  1GLN A;  3WHL A;  4JI7 M;  3O5U A;  2OOA A;  1IY0 A;  1E9R A;  4DV2 M;  2XH9 A;  3LCV B;  4BLC A;  2Z8Y M;  3FUT A;  3BBZ A;  4CIZ A;  1J09 A;  2UXD M;  1DO2 A;  3GO8 A;  1JR3 A;  3PCI A;  1Q39 A;  5DNY A;  4LZJ A;  1NV9 A;  5EP2 A;  2Z4S A;  3PVS A;  3SMS A;  2MJ5 B;  4WW0 A;  3SAT A;  3T15 A;  3T67 M;  3T1H M;  4LZZ A;  4JI5 M;  3KW6 A;  2F5O A;  4PD2 A;  4DV3 M;  2V1C A;  1TDZ A;  3W67 A;  2Z4R A;  3LCU A;  3KDS E;  2XZU A;  3FE3 A;  3JR4 A;  2DAK A;  4L16 A;  5ITT A;  1HNW M;  2QBY A;  1W5T A;  3KP0 E;  1QQW A;  2QBY B;  1XNR M;  2JNH A;  3A45 A;  3FYD A;  1R2Y A;  2DWL A;  3MV6 A;  3PCA M;  4WHQ A;  1VEJ A;  1IN6 A;  1DGB A;  3M7G A;  4WHQ B;  3L29 A;  2CE7 A;  2K0B X;  3GQ5 A;  3B9P A;  4LF5 M;  1VQ1 A;  3JR5 A;  1Q3B A;  3AKZ A;  1HR0 M;  2H5X A;  2KZU A;  2L4E A;  4IJF A;  1RU3 A;  5FSW A;  3HU1 A;  3PCB A;  1GVN A;  2BUW A;  3H4M A;  3KVW A;  3PCN A;  1G59 A;  4WHS A;  2BUW B;  4DR1 M;  4WHS B;  1I4W A;  3NBI A;  1CUK A;  2KNZ A;  3RFW A;  1IXZ A;  3GRR A;  4IJE A;  4PDI A;  1LTM A;  2DAM A;  4P16 A;  4L6V 6;  1VG5 A;  3RGS A;  5FTN A;  5ITX E;  3DZD A;  4D82 A;  2OOB A;  1IBM M;  2F4V M;  3PCF M;  3V76 A;  1G41 A;  4LRS A;  1FNN A;  2Z7J A;  2O01 F;  3DA1 A;  2CV1 A;  3LW5 F;  2LVN C;  1EOA A;  4IBC A;  1EOA B;  2I7N A;  2LNH C;  4DR7 M;  2DZL A;  3KOW E;  4M9X A;  1WIV A;  3UZU A;  3UGJ A;  4R3D A;  1GL7 A;  4HL4 A;  2Z3X A;  1ZMV A;  1DGF A;  1YSY A;  4MGH A;  5E26 A;  2L7I A;  4M0D A;  3L26 A;  2XZF A;  1NJF A;  2FH0 A;  1YKM A;  3MFL M;  3K2L A;  1XXH A;  1YKM B;  1V92 A;  1TH4 A;  1XXH B;  3HZJ A;  2BUU A;  1NJG A;  5LMN M;  2BUU B;  3PCL M;  2VQF M;  2BWE A;  1SXJ A;  1SXJ B;  4D81 A;  1E94 E;  2VQE M;  1XNQ M;  1DGG A;  2DAI A;  1QZE A;  2KNV A;  4AG6 A;  3UMM A;  4WHR A;  3TL4 X;  2D7E A;  4WHR B;  5TD3 A;  1Q3C A;  2DHY A;  2RRU A;  4DR4 M;  3SYL A;  2QHO B;  3GLI E;  2BWB A;  2KDL A;  3MV4 A;  2DZO B;  3HKP A;  1TMX A;  2ERC A;  1ZMU A;  1IXR C;  1X37 A;  1UM8 A;  2C99 A;  4FD2 A;  2YQZ A;  3FYC A;  3F92 A;  4NRV A;  2DXI A;  2EA0 A;  2K47 A;  1G71 A;  3R9X B;  2HKJ A;  4DV0 M;  5EXT A;  4GIT A;  2PCD A;  3CF0 A;  3K92 A;  2DAG A;  2XEP A;  3TPZ A;  3GPU A;  3MV6 M;  4KHP M;  3GPP A;  2BJW A;  2VF8 A;  4DV1 M;  4F2L A;  1QZM A;  2XSZ D;  2FE8 A;  4OX9 M;  2UXC M;  2XF3 A;  3HU3 A;  2LXE A;  2CUZ A;  3LMM A;  3SC3 A;  1MJG M;  4JI6 M;  4B7F A;  4Z6Y A;  2XFS A;  3U61 A;  3KXE C;  4AI6 A;  3N9T A;  4QHS A;  2ZAM A;  3U61 B;  4HEO A;  3PCB M;  2BJV A;  3W68 A;  2APL A;  2KRU A;  1SXJ C;  2LVP C;  5FLX S;  3CF2 A;  1XMQ M;  4B3M M;  3LMX M;  2CFO A;  4IBG A;  2CHQ A;  4PDG A;  2BOY A;  3K1J A;  3MHV C;  2DHR A;  1ZMW A;  3HHW A;  3LVV A;  4UN2 B;  1YUB A;  2FOI C;  3K9O A;  1MN3 A;  4LF4 M;  2VII A;  1WGL A;  2BUM A;  1AIP C;  2UUC M;  4Q7J A;  2BUM B;  3Q8X A;  4XBO A;  3M0E A;  4DV5 M;  4PCZ A;  2AZQ A;  3GLH A;  1GL6 A;  3U5Z A;  1J7K A;  3GLH B;  4WUR A;  4WHO B;  1NO1 A;  3U5Z B;  3PCJ A;  2DNA A;  1H6U A;  2ZM6 M;  2KW0 A;  1K82 A;  2LVO C;  3DFZ A;  3FUV A;  4GIP A;  2GQF A;  2ZTC A;  5JI3 E;  5IT9 S;  3MI1 M;  3T63 A;  2B3T A;  2C96 A;  2QEN A;  3L27 A;  5FTM A;  2WZJ A;  3CTW B;  4R7G A;  4X62 M;  4B3T M;  1DLT A;  3RGP A;  3B7Z A;  2LH0 A;  1L8Q A;  4GC9 A;  4QNR A;  1NSF A;  1IN5 A;  3FKE A;  2R0I A;  3AOE A;  3J2P B;  1T43 A;  3GRU A;  5EJC A;  3PXG A;  5JI2 E;  2C5R A;  1ORY B;  4JI0 M;  3C3D A;  1UFZ A;  3HJQ A;  5IZ7 D;  2F5Q A;  2DI0 A;  4MGY E;  7CAT A;  1VEK A;  3GRY A;  4GHA A;  3AV0 A;  3GLH E;  3QAU A;  4LCB A;  2ZBK B;  1NNJ A;  1E9S A;  1EOB A;  3PCD A;  2VF7 A;  1EOB B;  5EP4 A;  1G8P A;  3FUW A;  4LRT A;  3KS4 A;  3Q8G A;  1TF0 B;  4IIW A;  2XGN A;  2DWN A;  1ZQ9 A;  1NHG C;  1OQY A;  3D8L A;  4XGI A;  8CAT A;  4LF8 M;  3LKT A;  1YLA A;  3KSX A;  1PJT A;  2HL7 A;  4MM3 B;  3SFZ A;  2VDB B;  1XWI A;  1ZV1 A;  4NXN M;  3U6O A;  2L7H A;  3T38 A;  1HNX M;  4I5S A;  5ITX A;  3O6R A;  1JR3 D;  2JXN A;  3B7Q A;  3JAM S;  1C1K A;  1L2B A;  3PCE A;  2UU9 M;  1DV0 A;  3ZQJ A;  2Q2E B;  3GLG E;  2R62 A;  2P5T A;  2KRK A;  2G3Q A;  3E46 A;  3FRH A;  2XSR A;  4RKU F;  1R2Z A;  4CJ6 A;  1S3S A;  3J7A S;  1BVS A;  2CP8 A;  2NQ8 C;  1N75 A;  3AOE C;  1VEG A;  4ILV A;  1LV7 A;  2OQ4 A;  4CHT B;  2DKL A;  3FUX A;  4NL4 H;  1XC8 A;  4KO8 A;  3GQ4 A;  2F5N A;  5BPV A;  4L4U A;  3O32 A;  3VDU A;  3VFD A;  4I8O A;  3CGW A;  1QUS A;  1N34 M;  5KQD A;  1ZAE A;  4LJ4 A;  2OPF A;  2E5L M;  3PCK M;  3PCM A;  3O6J A;  4AG5 A;  4S12 A;  2C9C A;  2UXB M;  3U6C A;  3SAV A;  2KHH A;  3FRI A;  3GLI A;  4DV4 M;  4DV7 M;  3ZH9 B;  2MH8 A;  2KZS A;  1Z5A A;  2J5Y A;  3A98 B;  1IN8 A;  4FWD A;  4WP2 A;  3GLI B;  4G4R A;  4LF6 M;  4WHS D;  1L1T A;  2CRU A;  4NSR A;  4LG2 A;  4YY3 M;  2UUA M;  2O5R A;  4REZ A;  4IBK A;  4M9S A;  2R45 A;  3PCG A;  3LQR A;  3HJS A;  1EO2 A;  2ZAN A;  1HQY E;  3NBX X;  4B3R M;  4TUW A;  2L09 A;  5C18 A;  1EO2 B;  4WHR F;  2BUR A;  3VKG A;  3L2A A;  1T6O A;  1N33 M;  2MGW A;  2O25 A;  4CGY B;  1V33 A;  2BUR B;  1TTE A;  3UK6 A;  3OTO M;  5DYG A;  1D2N A;  1IY2 A;  1JQJ C;  3EIH A;  3PCI M;  4ILT A;  3GPY A;  2JP7 A;  4GH9 A;  4P17 A;  4NRW A;  4GHL A;  2LHC A;  3I04 M;  3PCD M;  2LBC A;  2BUX A;  4L15 A;  3WHK A;  1OAI A;  4AKG A;  3KS8 A;  2BUX B;  1N36 M;  1FJG M;  2KA6 B;  3PCH A;  1YKN A;  5EXX A;  4LF9 M;  3LKT M;  1QAO A;  2UUB M;  1YKN B;  3LQQ A;  1HQC A;  2LTU A;  2FFJ A;  2RKO A;  3W0F A;  5ITR A;  4L8R C;  2YR0 A;  3QYE A;  3BOS A;  1SXJ D;  4QOZ C;  3MI5 A;  4IBD A;  4Z8X A;  2BUZ A;  2DZN B;  2BUZ B;  4D80 A;  5KQ8 A;  3PCE M;  2JZ1 A;  2R46 A;  4II7 A;  2DWM A;  1GKI A;  4FCV A;  4B7G A;  5FTL A;  4MB7 A;  2ZTD A;  2EO2 A;  3MJ5 A;  1V34 A;  2CHG A;  2EJS A;  3NWL A;  1WXQ A;  3QWL A;  4L78 A;  4NSO B;  1G4A E;  3GQ3 A;  1J5E M;  2BUT A;  2BUT B;  2LWX A;  2HHH M;  3PCN M;  1HNZ M;  1YKO A;  1YKO B;  2FS1 A;  1PJI A;  3A46 A;  3HX3 A;  3MMP A;  1NY5 A;  3I4Y A;  4GC5 A;  4GMQ A;  1IXS A;  1TDH A;  1EE8 A;  1IN4 A;  1OIZ A;  3T67 A;  1IXS B;  2G8L A;  4F1I A;  2Y21 A;  4Y28 F;  2R65 A;  2BV0 A;  1E32 A;  2F5P A;  1NV8 A;  2BV0 B;  3E4R A;  1N32 M;  5EQT A;  3C9P A;  3U6D A;  2QNJ A;  4AKI A;  3PCM M;  1PJJ A;  4KT0 F;  1YKK A;  4GRI A;  3TE6 A;  3U6Q A;  1YKK B;  3AL0 C;  1D0K A;  3I01 M;  5KPT A;  4LF7 M;  1EFU B;  4DR3 M;  3PCA A;  4WHO A;  1R7R A;  3HHX A;  4DR2 M;  3TH1 A;  3FTE A;  4KOD A;  1WJ7 A;  2RGH A;  4DR5 M;  1DMH A;  2D7G A;  5KPR A;  3SBJ A;  3PCG M;  1WGN A;  2K9D A;  2ZAO A;  3QYB A;  2BUY A;  2LVA A;  1TGU A;  5KPZ A;  2BUY B;  4B7H A;  1T3T A;  4LFC M;  1Q02 A;  1IQP A;  1QVR A;  2V1U A;  4MGZ E;  2CHV A;  3VLF B;  5BR8 M;  5FTK A;  2BNK A;  5GKN A;  2R4J A;  4WHP D;  3SHF A;  3MV4 M;  1TH2 A;  3SYK A;  1OAO C;  3RE8 A;  2J7N A;  2YFQ A;  3B89 A;  1EIJ A;  3KOX E;  3GP1 A;  3VKH A;  3PCF A;  3IEC A;  3FUU A;  2Y0Q A;  2YNM D;  3GLG A;  2JY6 B;  5KO3 A;  1QDR A;  3GLG B;  4FW9 A;  1G3I A;  3K9P A;  3U6L A;  1OJL A;  1QAQ A;  2M5Z A;  2PCD M;  2XSU A;  4RF1 A;  1C7Y A;  2KEB A;  3EIE A;  4OW0 A;  5IWA M;  1YE9 A;  1R4G A;  3B74 A;  2C98 A;  1XHB A;  4BBA A;  3HJ8 A;  3HHY A;  4IBF A;  2XSV A;  2JZ0 A;  3MFL A;  1DO0 A;  5EXP A;  1Z5B A;  4GEW A;  2JWS A;  3PCH M;  2M60 A;  3THG A;  5ITY A;  3PCL A;  2I7P A;  1W5S A;  4JV5 M;  3LXV A;  2WSC F;  3SAR A;  2HAK A;  4QHT A;  3SAW A;  3K8Z A;  4FCT A;  3FD9 A;  4W5W A;  2EKF A;  2J7O A;  2QQ8 A;  5IRE B;  4LGY A;  3KFU G;  3VK7 A;  4AZF A;  2AHM A;  4GKJ M;  3U6P A;  2KXE A; 
#chains in the Genus database with same CATH homology
 1NVM A;  2QPA A;  3FTC A;  1S9A A;  4MGI E;  3L25 A;  4MH0 E;  2L6O A;  1I94 M;  3I51 A;  3FTF A;  3HWS A;  4IBE A;  3T63 M;  3TWK A;  3AFH A;  5EP3 A;  1IBK M;  2R18 A;  4MGK E;  4A3V B;  4I4L A;  4LJ9 A;  5ITU A;  4DUY M;  3TWM A;  3PCJ M;  2QCU A;  4LJ6 A;  3J7B A;  5DYI A;  4LFB M;  2HCB A;  1NNU C;  1KFV A;  4NOO B;  3MK6 A;  3VDP A;  4RF0 A;  4X64 M;  3SHG B;  2X8A A;  3L28 A;  4IBJ A;  3J81 S;  1KYI A;  1MU5 A;  3C58 A;  4JI4 M;  4AKH A;  3T1Y M;  2CV2 A;  1IY1 A;  4I81 A;  3LMX A;  3M6A A;  3LVW A;  1MX0 A;  4IBB A;  5EP1 A;  3PCC A;  2QP9 X;  5F3W A;  1DLM A;  2H1R A;  3IG8 A;  3CF6 E;  2F5S A;  2BUV A;  3U6S A;  3PFI A;  4DV6 M;  4JI1 M;  2BUV B;  3AOG A;  1IN7 A;  2X4A A;  4ZPX A;  1XMO M;  3ZCB B;  4K0K M;  5FTJ A;  4LY6 A;  5E6J A;  1N78 A;  1HT1 E;  2RGO A;  4JI3 M;  2QZ4 A;  2V6Z M;  3HGI A;  4CIS A;  3PNV A;  3MI1 A;  2EUC A;  1PM5 A;  2W82 A;  4M0W A;  3LXV M;  3E9S A;  3TQS A;  3UJN A;  3KOY E;  3A42 A;  4LJ5 A;  3GLF A;  4RNA A;  3IG5 A;  2XSZ A;  3GLF B;  4G4Q A;  2R4E A;  4YHH M;  3W0L B;  2X49 A;  1N77 A;  3J80 S;  3KOZ E;  4G6Z A;  4AW4 A;  5LMU M;  4JYA M;  4LJA A;  3TWL A;  1QAN A;  4JI2 M;  1IM2 A;  1OFH A;  1OFI A;  3ILK A;  3J27 B;  1TH3 A;  4FWG A;  3SMP A;  3KSJ A;  4LJ7 A;  5ITQ A;  4BB9 A;  1Z5C A;  2CV0 A;  3DOA A;  2A5Y B;  4M9Z A;  4LJ8 A;  1SXJ E;  4QNM A;  5H37 D;  3U6M A;  4X66 M;  3SAU A;  1K3X A;  1Z59 A;  1Z6T A;  1QAM A;  2Y0T A;  2FNA A;  4GKK M;  2XFT A;  3D8B A;  4EIW A;  2XLJ A;  4DR6 M;  3FTD A;  3KP1 E;  1DLQ A;  1EOC A;  1EOC B;  3U60 A;  4PT5 A;  2D7H A;  4FCW A;  2Y20 A;  4JN6 A;  4OU7 A;  3U60 B;  1L1Z A;  3GRV A;  4LFA M;  4AQY M;  4HLQ A;  3ZC7 B;  4FVM A;  2G5G X;  3R8F A;  4G4N A;  3PCC M;  2C9O A;  1VDD A;  3SAS A;  2CEA A;  1HT2 E;  4FWH A;  4OVZ A;  3GPX A;  1L2C A;  4NXM M;  1NHW C;  1NY6 A;  4OVZ B;  1YKP A;  1KSF X;  1YKP B;  2DVW B;  4WHO D;  4G4O A;  5EXS A;  4B3S M;  1IBL M;  3PNY A;  5A2Q S;  1QYR A;  4WHP A;  5C1B A;  4ITQ A;  4WHP B;  4KLN A;  4DUZ M;  3VK8 A;  3HHZ A;  3PCK A;  1YKL A;  4IBI A;  1R6B X;  1EO9 A;  2JA2 A;  1YKL B;  3I4V A;  1EO9 B;  4QOS A;  3MI5 M;  4JI8 M;  2DWZ B;  2BUQ A;  3HU2 A;  2BUQ B;  1DGH A;  4B08 A;  4X65 M;  1DGH B;  3U6E A;  1K3W A;  4LGM A;  3AJI B;  4JXJ A;  1L2D A;  1GLN A;  3WHL A;  4JI7 M;  3O5U A;  1IY0 A;  1E9R A;  4DV2 M;  2XH9 A;  4BLC A;  3FUT A;  2UXD M;  1J09 A;  1DO2 A;  3GO8 A;  1JR3 A;  3PCI A;  1Q39 A;  5DNY A;  4LZJ A;  5EP2 A;  2Z4S A;  3PVS A;  3SMS A;  3SAT A;  4WW0 A;  3T15 A;  3T67 M;  3T1H M;  4LZZ A;  4JI5 M;  3KW6 A;  2F5O A;  4PD2 A;  4DV3 M;  2V1C A;  1TDZ A;  2Z4R A;  3KDS E;  2XZU A;  3JR4 A;  4L16 A;  5ITT A;  1HNW M;  2QBY A;  1W5T A;  3KP0 E;  1QQW A;  2QBY B;  1XNR M;  3MV6 A;  3A45 A;  3FYD A;  1R2Y A;  2DWL A;  3PCA M;  4WHQ A;  1IN6 A;  1DGB A;  3M7G A;  4WHQ B;  3L29 A;  2CE7 A;  3GQ5 A;  3B9P A;  4LF5 M;  3JR5 A;  1Q3B A;  3AKZ A;  1HR0 M;  2KZU A;  4IJF A;  5FSW A;  3HU1 A;  3PCB A;  1GVN A;  2BUW A;  3H4M A;  3KVW A;  3PCN A;  1G59 A;  4WHS A;  2BUW B;  4DR1 M;  4WHS B;  1I4W A;  3NBI A;  3RFW A;  1IXZ A;  3GRR A;  4IJE A;  4PDI A;  4P16 A;  3RGS A;  5ITX E;  5FTN A;  3DZD A;  4D82 A;  1IBM M;  2F4V M;  3PCF M;  1G41 A;  4LRS A;  1FNN A;  2Z7J A;  3DA1 A;  2CV1 A;  1EOA A;  4IBC A;  1EOA B;  2I7N A;  2LNH C;  4DR7 M;  3KOW E;  4M9X A;  3UZU A;  3UGJ A;  4R3D A;  1GL7 A;  4HL4 A;  2Z3X A;  1DGF A;  1YSY A;  4MGH A;  5E26 A;  2L7I A;  4M0D A;  3L26 A;  2XZF A;  1NJF A;  1YKM A;  3MFL M;  3K2L A;  1XXH A;  1YKM B;  2BUU A;  1TH4 A;  1XXH B;  1NJG A;  5LMN M;  2BUU B;  3PCL M;  2VQF M;  1SXJ A;  1SXJ B;  4D81 A;  1E94 E;  2VQE M;  1XNQ M;  1DGG A;  4AG6 A;  3UMM A;  4WHR A;  3TL4 X;  2D7E A;  4WHR B;  5TD3 A;  1Q3C A;  3MV4 A;  4DR4 M;  3SYL A;  2DZO B;  3HKP A;  1TMX A;  2ERC A;  1IXR C;  1X37 A;  1UM8 A;  2C99 A;  4FD2 A;  2YQZ A;  3FYC A;  4NRV A;  2DXI A;  3R9X B;  2EA0 A;  2K47 A;  2HKJ A;  4DV0 M;  5EXT A;  4GIT A;  2PCD A;  3CF0 A;  3K92 A;  2XEP A;  3TPZ A;  3GPU A;  3MV6 M;  4KHP M;  3GPP A;  2BJW A;  4DV1 M;  1QZM A;  2XSZ D;  2FE8 A;  4OX9 M;  2UXC M;  2XF3 A;  3HU3 A;  2LXE A;  2CUZ A;  3LMM A;  3SC3 A;  4JI6 M;  4B7F A;  4Z6Y A;  2XFS A;  3U61 A;  3KXE C;  4AI6 A;  3N9T A;  4QHS A;  2ZAM A;  3U61 B;  3PCB M;  2BJV A;  2KRU A;  1SXJ C;  5FLX S;  3CF2 A;  1XMQ M;  4B3M M;  3LMX M;  2CFO A;  4IBG A;  2CHQ A;  4PDG A;  2BOY A;  3K1J A;  3MHV C;  2DHR A;  3HHW A;  3LVV A;  1YUB A;  2FOI C;  4LF4 M;  2VII A;  2BUM A;  2UUC M;  2BUM B;  3Q8X A;  4XBO A;  3M0E A;  4DV5 M;  4PCZ A;  2AZQ A;  3GLH A;  1GL6 A;  3U5Z A;  1J7K A;  3GLH B;  4WUR A;  4WHO B;  3PCJ A;  3U5Z B;  1K82 A;  1H6U A;  2ZM6 M;  2KW0 A;  3DFZ A;  3FUV A;  4GIP A;  5JI3 E;  5IT9 S;  3MI1 M;  3T63 A;  2C96 A;  2QEN A;  3L27 A;  5FTM A;  4X62 M;  3CTW B;  4R7G A;  1DLT A;  4B3T M;  3RGP A;  2LH0 A;  1L8Q A;  4GC9 A;  4QNR A;  1NSF A;  1IN5 A;  3FKE A;  5EJC A;  3AOE A;  3J2P B;  3GRU A;  2C5R A;  5JI2 E;  3PXG A;  1ORY B;  4JI0 M;  3HJQ A;  5IZ7 D;  2F5Q A;  4MGY E;  7CAT A;  3GRY A;  4GHA A;  3AV0 A;  3QAU A;  4LCB A;  2ZBK B;  1NNJ A;  1E9S A;  1EOB A;  3PCD A;  1EOB B;  5EP4 A;  1G8P A;  3FUW A;  4LRT A;  3KS4 A;  2DWN A;  4IIW A;  2XGN A;  1ZQ9 A;  1NHG C;  3D8L A;  4XGI A;  8CAT A;  4LF8 M;  3LKT A;  3KSX A;  2HL7 A;  3SFZ A;  4MM3 B;  1XWI A;  4NXN M;  3U6O A;  2L7H A;  3T38 A;  1HNX M;  4I5S A;  5ITX A;  3O6R A;  1JR3 D;  3JAM S;  3PCE A;  1C1K A;  1L2B A;  2UU9 M;  2Q2E B;  2R62 A;  2P5T A;  2KRK A;  2XSR A;  1R2Z A;  3J7A S;  1S3S A;  3AOE C;  2NQ8 C;  1N75 A;  4ILV A;  1LV7 A;  2OQ4 A;  4CHT B;  1XC8 A;  3FUX A;  4NL4 H;  4KO8 A;  3GQ4 A;  2F5N A;  5BPV A;  4L4U A;  3O32 A;  3VDU A;  3VFD A;  4I8O A;  1N34 M;  5KQD A;  1ZAE A;  4LJ4 A;  2OPF A;  2E5L M;  3PCK M;  3PCM A;  3O6J A;  4AG5 A;  4S12 A;  2C9C A;  2UXB M;  3U6C A;  3SAV A;  3GLI A;  4DV4 M;  4DV7 M;  3ZH9 B;  3A98 B;  2KZS A;  1Z5A A;  4FWD A;  3GLI B;  1IN8 A;  4G4R A;  4LF6 M;  4WHS D;  1L1T A;  4NSR A;  4LG2 A;  4YY3 M;  2UUA M;  2O5R A;  4REZ A;  4IBK A;  4M9S A;  2R45 A;  3PCG A;  3LQR A;  3HJS A;  1EO2 A;  2ZAN A;  1HQY E;  4B3R M;  4TUW A;  1EO2 B;  2L09 A;  5C18 A;  4WHR F;  2BUR A;  3VKG A;  3L2A A;  1N33 M;  2BUR B;  4CGY B;  3UK6 A;  3OTO M;  5DYG A;  1D2N A;  1IY2 A;  1JQJ C;  3EIH A;  3PCI M;  4ILT A;  3GPY A;  4GH9 A;  4NRW A;  4GHL A;  3PCD M;  2BUX A;  4L15 A;  3WHK A;  4AKG A;  3KS8 A;  2BUX B;  1N36 M;  1FJG M;  2KA6 B;  3PCH A;  1YKN A;  5EXX A;  4LF9 M;  3LKT M;  1QAO A;  2UUB M;  1YKN B;  3LQQ A;  1HQC A;  2RKO A;  2FFJ A;  3W0F A;  5ITR A;  4L8R C;  2YR0 A;  3BOS A;  1SXJ D;  4QOZ C;  3MI5 A;  4IBD A;  4Z8X A;  2BUZ A;  2DZN B;  2BUZ B;  4D80 A;  5KQ8 A;  3PCE M;  2R46 A;  4II7 A;  2DWM A;  1GKI A;  4FCV A;  4B7G A;  5FTL A;  4MB7 A;  2EO2 A;  3MJ5 A;  2CHG A;  3QWL A;  4L78 A;  3NWL A;  1WXQ A;  3GQ3 A;  1J5E M;  4NSO B;  1G4A E;  2BUT A;  2BUT B;  2LWX A;  2HHH M;  3PCN M;  1HNZ M;  1YKO A;  1YKO B;  1PJI A;  3A46 A;  1NY5 A;  3I4Y A;  4GC5 A;  4GMQ A;  1TDH A;  3T67 A;  1EE8 A;  1IN4 A;  1IXS B;  2G8L A;  2Y21 A;  2R65 A;  2BV0 A;  1E32 A;  2F5P A;  2BV0 B;  3E4R A;  1N32 M;  5EQT A;  3U6D A;  4AKI A;  3PCM M;  1PJJ A;  1YKK A;  4GRI A;  3TE6 A;  3U6Q A;  1YKK B;  3AL0 C;  4LF7 M;  5KPT A;  4DR3 M;  3PCA A;  4WHO A;  1R7R A;  3HHX A;  4DR2 M;  3TH1 A;  3FTE A;  4KOD A;  1DMH A;  2RGH A;  4DR5 M;  2D7G A;  5KPR A;  3SBJ A;  3PCG M;  2ZAO A;  2BUY A;  1TGU A;  5KPZ A;  2BUY B;  4B7H A;  1T3T A;  4LFC M;  1IQP A;  1QVR A;  2V1U A;  4MGZ E;  2CHV A;  3VLF B;  5BR8 M;  5FTK A;  2BNK A;  5GKN A;  2R4J A;  4WHP D;  3SHF A;  3MV4 M;  1TH2 A;  3SYK A;  3RE8 A;  2J7N A;  2YFQ A;  3KOX E;  3GP1 A;  3VKH A;  3PCF A;  3FUU A;  2Y0Q A;  2YNM D;  3GLG A;  5KO3 A;  3GLG B;  4FW9 A;  1G3I A;  3U6L A;  1OJL A;  1QAQ A;  2M5Z A;  2PCD M;  2XSU A;  4RF1 A;  2KEB A;  3EIE A;  4OW0 A;  5IWA M;  1YE9 A;  2C98 A;  1XHB A;  4BBA A;  3HJ8 A;  3HHY A;  4IBF A;  2XSV A;  3MFL A;  1DO0 A;  5EXP A;  1Z5B A;  3PCH M;  2M60 A;  3THG A;  5ITY A;  3PCL A;  2I7P A;  1W5S A;  4JV5 M;  3LXV A;  3SAR A;  4QHT A;  3SAW A;  3K8Z A;  4FCT A;  3FD9 A;  4W5W A;  2J7O A;  5IRE B;  4LGY A;  3KFU G;  3VK7 A;  4AZF A;  2AHM A;  4GKJ M;  3U6P A;  2KXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...