3HJ8A

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
257
structure length
257
Chain Sequence
b'RATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 72
structure length 257
sequence length 257
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hj8A01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hj8A02
1YKNB 3PCJA 2BUYA 2BUQA 4ILTA 1EOBB 1YKPA 2BURB 3MFLM 2BUZB 1EO9A 3MFLA 2PCDM 3MI1M 4WHSB 1YKKA 1YKNA 2PCDA 1YKMB 3MI1A 3PCDM 2BUVB 3TH1A 3PCDA 1EOBA 2BURA 4WHSD 3HGIA 3I4YA 3PCMM 3HHYA 2BUMA 3PCMA 4WHSA 3PCNM 1DLTA 1YKMA 1EO2A 2BUWB 3PCNA 2BUVA 3LMXM 4WHPB 3PCAM 3LMXA 1DMHA 1EOAB 3LKTA 3PCAA 3I51A 3PCHM 2BUTB 4WHPD 3PCHA 3PCGM 3N9TA 3PCGA 2BUWA 3O32A 4WHPA 1DLQA 1EOAA 1S9AA 2BUXB 4ILVA 2BUUB 2BUZA 3PCLA 4WHRB 3LKTM 3T63M 3T63A 2BUXA 1YKLB 2BUUA 2XSVA 3MV4M 3PCIM 5TD3A 3I4VA 3HJ8A 1YKOB 3O6JA 3PCEM 3MV4A 4WHOB 3PCIA 3PCEA 1DLMA 4WHRA 4WHOD 3MI5M 1TMXA 3PCKM 1YKLA 3MI5A 3PCBM 3O6RA 2BUTA 2BV0B 3PCKA 1EOCB 3PCBA 3T67M 2AZQA 1YKOA 4WHOA 3LXVM 3T67A 3LXVA 3PCLM 2BUMB 2BV0A 1EOCA 4WHQB 1EO2B 2XSUA 2XSRA 2BUYB 3HHXA 2BUQB 3O5UA 3HJSA 1YKPB 3HJQA 3PCCM 3MV6M 3PCFM 3HKPA 3PCCA 3MV6A 2BOYA 3PCFA 4WHRF 1EO9B 4WHQA 3PCJM 1YKKB
chains in the Genus database with same CATH superfamily
1IQPA 3B7NA 3T1HM 1IN4A 3HU3A 3AOEA 4RF1A 2VQFM 4DR4M 2VF7A 2R4JA 1IM2A 5ITRA 1XHBA 3FYDA 4PCZA 2APLA 2HWJA 4UN2B 1IN7A 1NY5A 1OAIA 3C9PA 2B3TA 3OTOM 2L2DA 4WHSB 1JR3E 5ITXE 2PCDA 2KZUA 2R4EA 2WZJA 1GVNA 4LJ7A 2CEAA 3IECA 2WSEF 4WHSD 4Y28F 4NXNM 3VKGA 3CF0A 4LG2A 2C98A 5FLXS 1N78A 3A42A 2FS1A 3PCMM 3EIEA 5ITQA 2FE8A 2Y0TA 2C9OA 1ZQ9A 4WHSA 2QQ8A 3KSXA 5IREB 1EO9A 3KVWA 4DV3M 1G4AE 1TH3A 2CHGA 3RGSA 3GRUA 2BJWA 4L8RC 1T43A 3FTFA 4DR3M 1ZMVA 3L29A 3PCAM 1DMHA 1EOAB 3FYCA 1QANA 2BUTB 2H1RA 1IXRC 4R71A 2F5SA 4B3TM 3PCHA 1R2YA 2F5QA 2R18A 3GLGE 1TDZA 1L1ZA 1T3TA 4GHAA 3QYBA 1IY1A 3SC3A 3V76A 3LVVA 1Q3BA 1DO2A 2CV1A 4GC5A 3SHFA 3CGWA 4FWHA 1EOAA 3JAMS 3NWLA 1NHGC 4MGZE 2BUXB 5KQ8A 4JXJA 4CISA 2DI0A 2YFQA 1QAQA 2G3QA 2F5NA 1GO5A 1IN6A 2Y20A 5ITTA 2R45A 4DR1M 1XMOM 4LJ9A 2KHHA 2XFTA 5ITUA 5GKNA 4IBFA 2K0BX 1C7YA 1PJQA 1NY6A 2DVWB 2DZNB 1HQYE 3T63A 2CHQA 3A98B 3NBIA 3MJ5A 4G4QA 4P17A 4JI5M 2BUXA 2XSVA 1I4WA 4X66M 4G4NA 1NVMA 2QNJA 3U5ZA 1D2NA 3GPUA 2CUZA 4FD2A 1NV8A 3VK8A 3MV4A 5ITYA 4AQYM 4EIWA 4IJEA 4NL4H 3FTEA 1YSYA 1TTEA 5EJCA 4MGHA 3U61B 1AUAA 3MI5M 2QBYB 4GMQA 1XXHE 3KS4A 1TMXA 4DUYM 2LWXA 1PRBA 3HZJA 4I5SA 4LJAA 1NNJA 1VEKA 4R7GA 2ZTDA 3SMPA 7CATA 2RRUA 3U6OA 4B3SM 3PCBA 1HNZM 1H6UA 1DO0A 3SYLA 3SATA 4LZZA 4LFBM 3TQSA 2JY6B 2DWMA 1EIJA 3U6PA 1QAOA 4S12A 3GLIB 1L2DA 1N33M 2JWSA 3IG8A 2QBYA 4LF4M 1IN5A 1JB0F 2C96A 4OW0A 2EO2A 2EJSA 1AIPC 2BUMB 1MJGM 4GRIA 1GL7A 1Z6TA 5EP1A 2DWNA 4WHQB 3LQRA 1GLNA 2LBCA 2CV0A 1EO2B 3KS8A 3U6MA 5BR8M 3R8FA 1JR3D 4R3DA 4NSRA 5IZ7D 4QNMA 1QQWA 5BPVA 5H37D 1N75A 1HR0M 2BUQB 1YKPB 5EP4A 1IXSB 4ZPXA 4NC6A 1R5LA 3HJQA 2O25A 3MV6M 1OTRA 3KOZE 5ITXA 4D82A 3AL0C 3PCCA 3TWKA 3PCFA 4WHRF 3UGJA 5KPZA 2FH0A 1EO9B 4WHQA 1F4IA 3PCJM 1QDRA 4NSOB 2JZ1A 4LF5M 1YKNB 2I7PA 2UUBM 3IHPA 2KA6B 4M9XA 4QHSA 2BUQA 1Q39A 3E21A 1ZMWA 4GC9A 1YKPA 1IXSA 1OAOC 3SHGB 2R6FA 1GJTA 2GQFA 2DAGA 2DWZB 2C99A 2LVOC 2M60A 2MR9A 2Z7JA 3E9SA 3K2LA 4G4OA 2XFSA 4LZJA 4DR5M 2LH0A 4LJ6A 3T15A 4AKHA 1QUTA 2EKFA 3MFLA 2LNHC 3MI1M 1YKNA 4LFCM 1TGUA 1IXZA 2G8LA 5EXXA 3C58A 3PCDM 5TD3A 1K82A 2LHGA 3B7QA 5C18A 4Q7JA 3VKHA 1X37A 3B7ZA 1GL6A 3DZDA 1P3QQ 1UFZA 2KZSA 4GIPA 1FNNA 3FD9A 3UMMA 2JZ0A 3W67A 2XSZD 1GKIA 3Q8GA 4B08A 5L8RF 2ERCA 4YHHM 4IIWA 1MX0A 4D80A 3UJNA 1VDLA 2WSCF 3KP1E 3GQ4A 4L15A 4ANRA 1K3WA 3PCNM 1DLTA 2D7EA 2EUCA 2XSZA 1NJGA 5EQTA 3LMXM 1WIVA 3L27A 3RE8A 2MH8A 3PVSA 3SAUA 1JQJC 3I51A 2UXDM 3TL4X 3GLIE 2N35A 3A45A 4GH9A 1GABA 3PCGM 2UUCM 4LRSA 3N9TA 2DZOB 1YE9A 2P5TA 3FUWA 1ZMUA 2QPAA 3O32A 3J2PB 1WR1B 2Q2EB 2VF8A 4IBCA 2I7NA 1XXHB 2OOAA 4LF6M 2KDLA 2ZANA 1L2BA 2FFJA 3M0EA 3VLFB 5KO3A 1SXJC 1SXJE 1WGNA 3MK6A 3GQ3A 4ILVA 2BUUB 2H5XA 3CF2A 2ZM6M 4LF7M 4RKUF 3HWSA 3RGPA 2JNHA 2BWBA 2JY5A 2E5LM 1VEGA 1KFVA 1R6BX 1OIPA 4RNAA 1YUBA 1LTMA 1XXHA 2QP9X 4B7GA 2ZTCA 3GLHB 2Z3XA 4B7FA 3KW6A 1ORYB 4G6ZA 2CV2A 4JI7M 3PFIA 4DV2M 3FTCA 4AKIA 3PXGA 1ZAEA 3BXWA 2BUUA 5FTMA 4AG6A 5EXPA 1OJLA 3QWLA 3F92A 1TR8A 3K9PA 3GQ5A 2OQ4A 1XC8A 4DR7M 3FUTA 1NHWC 5EXSA 3HJ8A 4PDIA 1YKOB 3PCIM 3PCEM 2YNMD 3K9OA 1KSFX 3PNVA 3LCUA 4GKJM 1PM5A 1DLMA 2NQ8C 3GLHA 4MGKE 4Z8XA 5F3WA 1HNXM 1W5SA 4DV1M 2CFOA 4PT5A 3SMSA 1Q3CA 2RGOA 1G41A 1HJPA 2R0IA 2BUTA 2BV0B 3PCKA 2QZ4A 1EOCB 3THGA 3T67M 2K9DA 3LVWA 2XLJA 1YKOA 2DNAA 2BNKA 3FRHA 3GPXA 3KOYE 2DAMA 2QHOB 1BVSA 4IBIA 1WHCA 4II7A 1S3SA 4B7HA 2XZUA 4JI6M 3PCLM 3AOGA 1WGLA 3IG5A 1XMQM 3T38A 3BOSA 3HY5A 1VEJA 3GRYA 2KNAA 5FTKA 3RFWA 2J7NA 3VDUA 5KPTA 4DV6M 1GJSA 3HHWA 3HX3A 4WP2A 5JI2E 4JI2M 1NO1A 1EOCA 2BV0A 3QYEA 2HAKA 2W82A 1IBKM 4CGYB 1DGGA 2BUYB 2KW0A 3HHXA 2DAIA 1V33A 3LXVA 3KFUG 3LW5F 3GP1A 1QZMA 2JXNA 2KEBA 3GPYA 1OQYA 3C3EA 5C1BA 4REZA 4IBEA 2LVAA 1OFIA 5DFLA 2BWEA 4X64M 1WJ7A 2X4AA 2J5YA 1J5EM 2BUYA 1QYRA 4LJ8A 1I94M 4ILTA 2VIIA 2BURB 3U61A 2K6BA 4FW9A 2LVPC 2RGHA 2X49A 2DHYA 2GNOA 2BUZB 4OVZB 3GLHE 3SYKA 2DWLA 2PCDM 1QVRA 2C5RA 3H4JA 2XEPA 4MM3B 2F5OA 2LTUA 3W68A 2F5PA 1YKMB 1XWIA 3U6EA 2BUVB 2X8AA 4DV7M 3KXEC 3GLIA 2BURA 3HU1A 1E9SA 1SXJB 3HGIA 2XZFA 4AW4A 3I4YA 2R65A 4K0KM 2OPFA 2V1UA 3WHLA 1TH2A 3WHKA 1NNUC 2BUMA 1SXJD 3D8BA 1PJSA 5FTNA 3U6QA 3PCMA 1VG5A 3FUVA 1YKMA 1NJFA 2CHVA 1EO2A 4AG5A 4DV4M 2BUVA 1L8QA 4RF0A 1CUKA 4LF9M 4WHPB 2L4EA 4DUZM 1SXJA 2ZBKB 4G4RA 2MJ5B 3LQQA 4NXMM 3PCAA 5DNYA 2MROB 4L4UA 3PCHM 1TDHA 4DV0M 4LF8M 4NRWA 4WHPD 2FOIC 4XGIA 1Z59A 1R4GA 4TUWA 3AKZA 4NOOB 1Z5BA 1IBMM 2R62A 3T1YM 4WHPA 2YQZA 3VDPA 2FNAA 1DLQA 3CTWB 4JI4M 4QHTA 5JI3E 2OOBA 1EE8A 3SAVA 4JYAM 1G3IA 2HCBA 4LGYA 4B3MM 4IBKA 3J27B 4DV5M 1QDTA 5IWAM 1FJGM 2BJVA 1UM8A 4KLNA 3AJIB 2LXEA 2YR0A 3K1JA 2DAEA 4FCWA 4NRVA 1L2CA 3SFZA 4DR2M 2DAKA 4GKKM 1OKSA 3MHVC 4CJ6A 2MGWA 2QSFX 2ZAOA 5EP2A 3VK7A 3LKTM 3PCLA 3T63M 4I4LA 4JN6A 2AHMA 1YKLB 2L6OA 2QCUA 4GEWA 4LY6A 4LJ4A 3B74A 3SAWA 2L09A 1MU5A 1PGYA 1QUSA 4P16A 4L78A 3MV4M 3I4VA 2O5RA 4WHOB 2L7HA 3E46A 3QAUA 3HHZA 2Y21A 3FUXA 3GO8A 1TH4A 3KOXE 4WHOD 4M9SA 4KODA 4FCVA 1N36M 1YKLA 4XBOA 3JR5A 1VDDA 3VFDA 3MI5A 3O6RA 3PCBM 1J09A 4IBGA 3W0FA 1N77A 3ZCBB 5LMUM 4KHPM 5E26A 3L26A 5FSWA 4WHOA 4IBBA 4BLCA 2KXEA 1KYIA 2XF3A 1XNQM 2HHHM 4JV5M 3J81S 3U6DA 3UK6A 3TWMA 2D7HA 2EKKA 1DGBA 1RU3A 4LJ5A 4QNRA 2Y0QA 3BBZA 2XH9A 1K3XA 3M6AA 2JA2A 3NBXX 2J7OA 1LV7A 3AFHA 3KSJA 2F4VM 1DGHB 3D8LA 2C9CA 4W5WA 4WW0A 3GPPA 3U60B 1Z5CA 3I01M 2JY7A 2XSRA 1D0MA 4FWDA 2KRKA 2Z4RA 4PDGA 3HJSA 3SBJA 3L25A 3O5UA 4AKGA 3PNYA 3PCCM 1DGFA 3B9PA 5DYGA 3PCFM 4F2LA 3GLFB 3FRIA 3J7AS 4MB7A 3MV6A 3J7BA 3J80S 2BOYA 3L2AA 2CE7A 4AI6A 1DGHA 2KNVA 1YKKB 1IN8A 4PD2A 1SG9A 2D7GA 3U60A 1Y8GA 4I81A 3PCJA 2JP7A 1EOBB 1WXQA 4WURA 3I04M 3GLFA 1OFHA 3MFLM 1HT1E 1Z5AA 4IJFA 4DBGB 1D0KA 1HQCA 3FE3A 4KO8A 2LVQD 2UXBM 1YKKA 2LHCA 3C3DA 2L7IA 3MI1A 5DYIA 3EIHA 3TH1A 3PCDA 1G8PA 4Z6YA 1EOBA 2JUJA 2LVNC 2V6ZM 4M0WA 5FTLA 1XNRM 1VQ1A 3AOEC 3K8ZA 4LGMA 4QOZC 3CF6E 4JI1M 2V1CA 4FVMA 3DOAA 3JR4A 3HHYA 3ZQJA 3U5ZB 4HEOA 3H4MA 4IBJA 2HKJA 4LCBA 1T6OA 2VQEM 2BUWB 4D81A 2QENA 5KQDA 3U6SA 3PCNA 2XGNA 3LMXA 4A3VB 3LKTA 2CRUA 2G5GX 3SASA 3DA1A 3E4RA 3ZH9B 2EA0A 2RKOA 2L4FA 2Z8YM 2DENA 2JY8A 3PCGA 2BUWA 1NV9A 2UU9M 3KOWE 2UXCM 4LRTA 4OX9M 5LMNM 2DXIA 1E9RA 3U6LA 4JI0M 1S9AA 4FWGA 5E6JA 4LFAM 1HNWM 4XK8F 4X65M 3DFZA 2BUZA 2CWBA 4L6V6 4OVZA 3TE6A 2DZLA 2WSFF 1D0LA 4MGIE 3GLFE 4X62M 5EP3A 4QOSA 5KPRA 2DHRA 3HU2A 5EXTA 1PJIA 4WHRB 3T6PA 5IT9S 2K47A 2OO9A 3FTDA 4OU7A 1C1KA 3SARA 1W5TA 4KT0F 4FCTA 3LCVB 1R7RA 1QZEA 3Q8XA 4BB9A 4HL4A 2CP8A 3KDSE 1HT2E 3U6CA 3O6JA 1DV0A 1NSFA 2R44A 3PCIA 1V34A 1MN3A 4IBDA 3PCEA 4MGYE 1ZV1A 8CATA 1N34M 4WHRA 1L1TA 2ZAMA 1JR3A 3GRVA 4L16A 3W0LB 4B3RM 4GHLA 3TWLA 3A46A 3PCKM 3ZC7B 4HLQA 1Q02A 3K92A 1QAMA 1IY2A 3LMMA 5A2QS 4AZFA 1G71A 3FUUA 4CHTB 4M9ZA 1EFUB 2KRUA 4CIZA 3UZUA 1IBLM 3GRRA 2AZQA 1PJTA 3LXVM 5FTJA 3T67A 2HL7A 1YLAA 4F1IA 1E94E 2A5YB 2DKLA 1XB2B 3GLGB 4MH0E 1PJJA 4BBAA 3M7GA 1TF0B 4I8OA 4ITQA 4DR6M 1IY0A 4YY3M 4G3OA 2VDBB 3L28A 1R2ZA 2XSUA 2UUAM 1E32A 2Z4SA 1G59A 3B89A 4M0DA 3ILKA 4JI8M 3FKEA 3R9XB 1J7KA 2M5ZA 3TPZA 2KNZA 3AV0A 3MMPA 1A5TA 3GLGA 1N32M 1IFYA 4JI3M 3HKPA 3KP0E 1V92A 4GITA 2O01F 2R46A 1OIZA
chains in the Genus database with same CATH topology
1IQPA 3T1HM 1IN4A 3HU3A 3AOEA 4RF1A 2VQFM 4DR4M 2R4JA 1IM2A 5ITRA 1XHBA 3FYDA 4PCZA 1IN7A 1NY5A 3OTOM 4WHSB 5ITXE 2PCDA 2KZUA 2R4EA 1GVNA 4LJ7A 2CEAA 4WHSD 4NXNM 3VKGA 3CF0A 4LG2A 2C98A 5FLXS 1N78A 3A42A 3PCMM 3EIEA 5ITQA 2FE8A 2Y0TA 2C9OA 1ZQ9A 4WHSA 3KSXA 5IREB 3KVWA 4DV3M 1G4AE 1TH3A 2CHGA 3RGSA 3GRUA 2BJWA 4L8RC 3FTFA 4DR3M 3L29A 3PCAM 1DMHA 1EOAB 3FYCA 1QANA 2BUTB 2H1RA 1IXRC 2F5SA 4B3TM 3PCHA 1R2YA 2F5QA 2R18A 1L1ZA 1TDZA 1T3TA 4GHAA 1IY1A 3SC3A 3LVVA 1Q3BA 1DO2A 2CV1A 4GC5A 3SHFA 4FWHA 1EOAA 3JAMS 3NWLA 1NHGC 4MGZE 2BUXB 5KQ8A 4JXJA 4CISA 2YFQA 1QAQA 2F5NA 1IN6A 2Y20A 5ITTA 2R45A 4DR1M 1XMOM 4LJ9A 2XFTA 5ITUA 5GKNA 4IBFA 1NY6A 2DVWB 2DZNB 1HQYE 3T63A 2CHQA 3A98B 3NBIA 3MJ5A 4G4QA 4JI5M 2BUXA 2XSVA 1I4WA 4X66M 4G4NA 1NVMA 3U5ZA 1D2NA 3GPUA 2CUZA 4FD2A 3VK8A 3MV4A 5ITYA 4EIWA 4IJEA 4NL4H 3FTEA 1YSYA 5EJCA 4MGHA 3U61B 3MI5M 2QBYB 4GMQA 3KS4A 1TMXA 4DUYM 2LWXA 4I5SA 4LJAA 1NNJA 4R7GA 3SMPA 7CATA 3U6OA 3PCBA 4B3SM 1HNZM 1H6UA 1DO0A 3SYLA 3SATA 4LZZA 4LFBM 3TQSA 2DWMA 3U6PA 1QAOA 4S12A 3GLIB 1L2DA 1N33M 3IG8A 2QBYA 4LF4M 1IN5A 2C96A 4OW0A 2EO2A 2BUMB 4GRIA 1GL7A 1Z6TA 5EP1A 2DWNA 4WHQB 3LQRA 1GLNA 2CV0A 1EO2B 3KS8A 3U6MA 5BR8M 3R8FA 1JR3D 4R3DA 4NSRA 5IZ7D 4QNMA 1QQWA 5BPVA 5H37D 1N75A 1HR0M 2BUQB 1YKPB 5EP4A 1IXSB 4ZPXA 3HJQA 3MV6M 3KOZE 5ITXA 4D82A 3AL0C 3PCCA 3TWKA 3PCFA 4WHRF 3UGJA 5KPZA 1EO9B 4WHQA 3PCJM 4NSOB 4LF5M 1YKNB 2I7PA 2UUBM 2KA6B 4M9XA 4QHSA 2BUQA 1Q39A 1YKPA 4GC9A 3SHGB 2DWZB 2M60A 2Z7JA 3E9SA 2C99A 4II7A 4G4OA 3K2LA 1EO9A 4DR5M 2XFSA 4LZJA 4AKHA 2LH0A 4LJ6A 3T15A 3MFLA 3MI1M 2LNHC 1YKNA 4LFCM 1TGUA 1IXZA 2G8LA 5EXXA 3C58A 3PCDM 1K82A 5C18A 3VKHA 1X37A 1GL6A 3DZDA 2KZSA 4GIPA 3UMMA 4AQYM 1FNNA 3FD9A 4B08A 2XSZD 1GKIA 4YHHM 2ERCA 4IIWA 1MX0A 4D80A 3UJNA 3KP1E 3GQ4A 4L15A 1K3WA 3PCNM 1DLTA 2D7EA 2EUCA 2XSZA 1NJGA 5EQTA 3LMXM 3L27A 3RE8A 3PVSA 3SAUA 1JQJC 3I51A 2UXDM 3TL4X 3A45A 4GH9A 3PCGM 2UUCM 4LRSA 3N9TA 2DZOB 1YE9A 2P5TA 3FUWA 2QPAA 3O32A 3J2PB 4IBCA 2Q2EB 2I7NA 1XXHB 4LF6M 2ZANA 1L2BA 2FFJA 3M0EA 3VLFB 5KO3A 1SXJC 1SXJE 3MK6A 3GQ3A 4ILVA 2BUUB 3CF2A 2ZM6M 4LF7M 3RGPA 3HWSA 2E5LM 1KFVA 1R6BX 4RNAA 1YUBA 1XXHA 2QP9X 4B7GA 3GLHB 2Z3XA 4B7FA 3KW6A 1ORYB 4G6ZA 2CV2A 4JI7M 3PFIA 4DV2M 3FTCA 3PXGA 1ZAEA 2BUUA 5FTMA 4AG6A 5EXPA 1OJLA 3QWLA 3GQ5A 4DR7M 1XC8A 2OQ4A 3FUTA 1NHWC 5EXSA 3HJ8A 4PDIA 1YKOB 3PCIM 3PCEM 2YNMD 5TD3A 1KSFX 3PNVA 4GKJM 1PM5A 1DLMA 2NQ8C 3GLHA 4MGKE 4Z8XA 5F3WA 1HNXM 1W5SA 4DV1M 2CFOA 4PT5A 3SMSA 1Q3CA 2RGOA 1G41A 2BUTA 2BV0B 3PCKA 2QZ4A 1EOCB 3THGA 3T67M 2XLJA 3LVWA 1YKOA 2BNKA 3GPXA 3KOYE 4B7HA 2XZUA 3LXVA 4IBIA 4JI6M 1S3SA 3PCLM 3AOGA 3IG5A 1XMQM 3T38A 3BOSA 3GRYA 5FTKA 3RFWA 2J7NA 3VDUA 5KPTA 4DV6M 2BV0A 3HHWA 4JI2M 5JI2E 1EOCA 2W82A 1IBKM 4CGYB 1DGGA 2BUYB 2KW0A 3HHXA 3KFUG 3GP1A 1QZMA 2KEBA 3GPYA 4X64M 4K0KM 5C1BA 4REZA 4IBEA 4AKIA 1OFIA 2X4AA 2BUYA 1J5EM 1QYRA 4LJ8A 1I94M 4ILTA 2VIIA 2BURB 3U61A 4FW9A 2RGHA 2X49A 2BUZB 4OVZB 3SYKA 2DWLA 2PCDM 1QVRA 2C5RA 4MM3B 2XEPA 2F5OA 2F5PA 1YKMB 1XWIA 3U6EA 2BUVB 2X8AA 4DV7M 3KXEC 3GLIA 2BURA 3HU1A 1E9SA 1SXJB 3HGIA 2XZFA 4AW4A 3I4YA 2R65A 2OPFA 2V1UA 3WHLA 1TH2A 3WHKA 1NNUC 2BUMA 1SXJD 3D8BA 5FTNA 3PCMA 3U6QA 3FUVA 1YKMA 1NJFA 2CHVA 1EO2A 4AG5A 4DV4M 2BUVA 1L8QA 4RF0A 4LF9M 4WHPB 4DUZM 1SXJA 2ZBKB 4G4RA 3LQQA 4NXMM 3PCAA 5DNYA 4L4UA 3PCHM 1TDHA 4DV0M 4LF8M 4NRWA 4WHPD 2FOIC 4XGIA 1Z59A 4TUWA 3AKZA 4NOOB 1Z5BA 1IBMM 2R62A 3T1YM 4WHPA 2YQZA 3VDPA 2FNAA 1DLQA 3CTWB 4JI4M 4QHTA 5JI3E 1EE8A 3SAVA 4JYAM 1G3IA 2HCBA 4LGYA 4B3MM 4IBKA 3J27B 4DV5M 5IWAM 1FJGM 2BJVA 1UM8A 4KLNA 3AJIB 2LXEA 2YR0A 3K1JA 4FCWA 4NRVA 1L2CA 3SFZA 4DR2M 4GKKM 3MHVC 2ZAOA 3VK7A 5EP2A 3PCLA 3LKTM 3T63M 4I4LA 4JN6A 2AHMA 1YKLB 2L6OA 2QCUA 4LY6A 4LJ4A 3SAWA 2L09A 1MU5A 4P16A 4L78A 3MV4M 3I4VA 2O5RA 4WHOB 2L7HA 3QAUA 3HHZA 2Y21A 3FUXA 3GO8A 1TH4A 3KOXE 4WHOD 4M9SA 4KODA 4FCVA 1N36M 1YKLA 4XBOA 3JR5A 1VDDA 3VFDA 3MI5A 3O6RA 3PCBM 1J09A 4IBGA 3W0FA 1N77A 3ZCBB 5LMUM 4KHPM 5E26A 3L26A 5FSWA 4WHOA 4IBBA 4BLCA 2KXEA 1KYIA 2XF3A 1XNQM 2HHHM 4JV5M 3J81S 3U6DA 3UK6A 3TWMA 2D7HA 1DGBA 4LJ5A 4QNRA 2Y0QA 2XH9A 1K3XA 3M6AA 2JA2A 2J7OA 1LV7A 3AFHA 3KSJA 2F4VM 1DGHB 3D8LA 2C9CA 4W5WA 4WW0A 3GPPA 3U60B 1Z5CA 2XSRA 3SBJA 4FWDA 2KRKA 2Z4RA 4PDGA 3HJSA 3L25A 3O5UA 4AKGA 3PNYA 3PCCM 1DGFA 3B9PA 5DYGA 3PCFM 3GLFB 3J7AS 4MB7A 3MV6A 3J7BA 3J80S 2BOYA 3L2AA 2CE7A 4AI6A 1DGHA 1YKKB 1IN8A 4PD2A 2D7GA 3U60A 4I81A 3PCJA 1EOBB 1WXQA 4WURA 3GLFA 1OFHA 3MFLM 1HT1E 1Z5AA 4IJFA 1HQCA 4KO8A 2UXBM 1YKKA 2L7IA 3MI1A 5DYIA 3EIHA 3TH1A 3PCDA 1G8PA 4Z6YA 1EOBA 2V6ZM 4M0WA 1XNRM 5FTLA 4QOZC 3K8ZA 3AOEC 4LGMA 3CF6E 4JI1M 2V1CA 4FVMA 3DOAA 3JR4A 3HHYA 3U5ZB 3H4MA 4IBJA 2HKJA 4LCBA 2VQEM 2BUWB 4D81A 2QENA 5KQDA 3U6SA 3PCNA 2XGNA 3LMXA 4A3VB 3LKTA 2G5GX 3SASA 3DA1A 3E4RA 3ZH9B 2EA0A 2RKOA 3PCGA 2BUWA 2UU9M 3KOWE 2UXCM 4LRTA 4OX9M 5LMNM 2DXIA 1E9RA 3U6LA 4JI0M 1S9AA 4FWGA 5E6JA 4LFAM 1HNWM 4X65M 3DFZA 2BUZA 4OVZA 3TE6A 4MGIE 4X62M 5EP3A 4QOSA 5KPRA 2DHRA 3HU2A 5EXTA 1PJIA 4WHRB 5IT9S 2K47A 3FTDA 4OU7A 1C1KA 3SARA 1W5TA 4FCTA 4BB9A 1R7RA 3Q8XA 4HL4A 3KDSE 1HT2E 3U6CA 3O6JA 1NSFA 3PCIA 4IBDA 3PCEA 4MGYE 8CATA 1N34M 4WHRA 1L1TA 2ZAMA 1JR3A 3GRVA 4L16A 3W0LB 4B3RM 4GHLA 3TWLA 3A46A 3PCKM 3ZC7B 4HLQA 3K92A 3LMMA 1QAMA 1IY2A 5A2QS 4AZFA 3FUUA 4CHTB 4M9ZA 2KRUA 3UZUA 1IBLM 3GRRA 2AZQA 3LXVM 5FTJA 3T67A 2HL7A 1E94E 2A5YB 3GLGB 4MH0E 1PJJA 4BBAA 3M7GA 4ITQA 4I8OA 4DR6M 1IY0A 4YY3M 3L28A 1R2ZA 2XSUA 2UUAM 1E32A 2Z4SA 1G59A 4M0DA 3ILKA 4JI8M 3FKEA 3R9XB 1J7KA 2M5ZA 3TPZA 3GLGA 3AV0A 1N32M 4JI3M 3HKPA 3KP0E 4GITA 2R46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKN B;  3PCJ A;  2BUY A;  2BUQ A;  4ILT A;  1EOB B;  1YKP A;  2BUR B;  3MFL M;  2BUZ B;  1EO9 A;  3MFL A;  2PCD M;  3MI1 M;  4WHS B;  1YKK A;  1YKN A;  2PCD A;  1YKM B;  3MI1 A;  3PCD M;  2BUV B;  3TH1 A;  3PCD A;  1EOB A;  2BUR A;  4WHS D;  3HGI A;  3I4Y A;  3PCM M;  3HHY A;  2BUM A;  3PCM A;  4WHS A;  3PCN M;  1DLT A;  1YKM A;  1EO2 A;  2BUW B;  3PCN A;  2BUV A;  3LMX M;  4WHP B;  3PCA M;  3LMX A;  1DMH A;  1EOA B;  3LKT A;  3PCA A;  3I51 A;  3PCH M;  2BUT B;  4WHP D;  3PCH A;  3PCG M;  3N9T A;  3PCG A;  2BUW A;  3O32 A;  4WHP A;  1DLQ A;  1EOA A;  1S9A A;  2BUX B;  4ILV A;  2BUU B;  2BUZ A;  3PCL A;  4WHR B;  3LKT M;  3T63 M;  3T63 A;  2BUX A;  1YKL B;  2BUU A;  2XSV A;  3MV4 M;  3PCI M;  5TD3 A;  3I4V A;  3HJ8 A;  1YKO B;  3O6J A;  3PCE M;  3MV4 A;  4WHO B;  3PCI A;  3PCE A;  1DLM A;  4WHR A;  4WHO D;  3MI5 M;  1TMX A;  3PCK M;  1YKL A;  3MI5 A;  3PCB M;  3O6R A;  2BUT A;  2BV0 B;  3PCK A;  1EOC B;  3PCB A;  3T67 M;  2AZQ A;  1YKO A;  4WHO A;  3LXV M;  3T67 A;  3LXV A;  3PCL M;  2BUM B;  2BV0 A;  1EOC A;  4WHQ B;  1EO2 B;  2XSU A;  2XSR A;  2BUY B;  3HHX A;  2BUQ B;  3O5U A;  3HJS A;  1YKP B;  3HJQ A;  3PCC M;  3MV6 M;  3PCF M;  3HKP A;  3PCC A;  3MV6 A;  2BOY A;  3PCF A;  4WHR F;  1EO9 B;  4WHQ A;  3PCJ M;  1YKK B; 
#chains in the Genus database with same CATH topology
 1IQP A;  3B7N A;  3T1H M;  1IN4 A;  3HU3 A;  3AOE A;  4RF1 A;  2VQF M;  4DR4 M;  2VF7 A;  2R4J A;  1IM2 A;  5ITR A;  1XHB A;  3FYD A;  4PCZ A;  2APL A;  2HWJ A;  4UN2 B;  1IN7 A;  1NY5 A;  1OAI A;  3C9P A;  2B3T A;  3OTO M;  2L2D A;  4WHS B;  1JR3 E;  5ITX E;  2PCD A;  2KZU A;  2R4E A;  2WZJ A;  1GVN A;  4LJ7 A;  2CEA A;  3IEC A;  2WSE F;  4WHS D;  4Y28 F;  4NXN M;  3VKG A;  3CF0 A;  4LG2 A;  2C98 A;  5FLX S;  1N78 A;  3A42 A;  2FS1 A;  3PCM M;  3EIE A;  5ITQ A;  2FE8 A;  2Y0T A;  2C9O A;  1ZQ9 A;  4WHS A;  2QQ8 A;  3KSX A;  5IRE B;  1EO9 A;  3KVW A;  4DV3 M;  1G4A E;  1TH3 A;  2CHG A;  3RGS A;  3GRU A;  2BJW A;  4L8R C;  1T43 A;  3FTF A;  4DR3 M;  1ZMV A;  3L29 A;  3PCA M;  1DMH A;  1EOA B;  3FYC A;  1QAN A;  2BUT B;  2H1R A;  1IXR C;  4R71 A;  2F5S A;  4B3T M;  3PCH A;  1R2Y A;  2F5Q A;  2R18 A;  3GLG E;  1TDZ A;  1L1Z A;  1T3T A;  4GHA A;  3QYB A;  1IY1 A;  3SC3 A;  3V76 A;  3LVV A;  1Q3B A;  1DO2 A;  2CV1 A;  4GC5 A;  3SHF A;  3CGW A;  4FWH A;  1EOA A;  3JAM S;  3NWL A;  1NHG C;  4MGZ E;  2BUX B;  5KQ8 A;  4JXJ A;  4CIS A;  2DI0 A;  2YFQ A;  1QAQ A;  2G3Q A;  2F5N A;  1GO5 A;  1IN6 A;  2Y20 A;  5ITT A;  2R45 A;  4DR1 M;  1XMO M;  4LJ9 A;  2KHH A;  2XFT A;  5ITU A;  5GKN A;  4IBF A;  2K0B X;  1C7Y A;  1PJQ A;  1NY6 A;  2DVW B;  2DZN B;  1HQY E;  3T63 A;  2CHQ A;  3A98 B;  3NBI A;  3MJ5 A;  4G4Q A;  4P17 A;  4JI5 M;  2BUX A;  2XSV A;  1I4W A;  4X66 M;  4G4N A;  1NVM A;  2QNJ A;  3U5Z A;  1D2N A;  3GPU A;  2CUZ A;  4FD2 A;  1NV8 A;  3VK8 A;  3MV4 A;  5ITY A;  4AQY M;  4EIW A;  4IJE A;  4NL4 H;  3FTE A;  1YSY A;  1TTE A;  5EJC A;  4MGH A;  3U61 B;  1AUA A;  3MI5 M;  2QBY B;  4GMQ A;  1XXH E;  3KS4 A;  1TMX A;  4DUY M;  2LWX A;  1PRB A;  3HZJ A;  4I5S A;  4LJA A;  1NNJ A;  1VEK A;  4R7G A;  2ZTD A;  3SMP A;  7CAT A;  2RRU A;  3U6O A;  4B3S M;  3PCB A;  1HNZ M;  1H6U A;  1DO0 A;  3SYL A;  3SAT A;  4LZZ A;  4LFB M;  3TQS A;  2JY6 B;  2DWM A;  1EIJ A;  3U6P A;  1QAO A;  4S12 A;  3GLI B;  1L2D A;  1N33 M;  2JWS A;  3IG8 A;  2QBY A;  4LF4 M;  1IN5 A;  1JB0 F;  2C96 A;  4OW0 A;  2EO2 A;  2EJS A;  1AIP C;  2BUM B;  1MJG M;  4GRI A;  1GL7 A;  1Z6T A;  5EP1 A;  2DWN A;  4WHQ B;  3LQR A;  1GLN A;  2LBC A;  2CV0 A;  1EO2 B;  3KS8 A;  3U6M A;  5BR8 M;  3R8F A;  1JR3 D;  4R3D A;  4NSR A;  5IZ7 D;  4QNM A;  1QQW A;  5BPV A;  5H37 D;  1N75 A;  1HR0 M;  2BUQ B;  1YKP B;  5EP4 A;  1IXS B;  4ZPX A;  4NC6 A;  1R5L A;  3HJQ A;  2O25 A;  3MV6 M;  1OTR A;  3KOZ E;  5ITX A;  4D82 A;  3AL0 C;  3PCC A;  3TWK A;  3PCF A;  4WHR F;  3UGJ A;  5KPZ A;  2FH0 A;  1EO9 B;  4WHQ A;  1F4I A;  3PCJ M;  1QDR A;  4NSO B;  2JZ1 A;  4LF5 M;  1YKN B;  2I7P A;  2UUB M;  3IHP A;  2KA6 B;  4M9X A;  4QHS A;  2BUQ A;  1Q39 A;  3E21 A;  1ZMW A;  4GC9 A;  1YKP A;  1IXS A;  1OAO C;  3SHG B;  2R6F A;  1GJT A;  2GQF A;  2DAG A;  2DWZ B;  2C99 A;  2LVO C;  2M60 A;  2MR9 A;  2Z7J A;  3E9S A;  3K2L A;  4G4O A;  2XFS A;  4LZJ A;  4DR5 M;  2LH0 A;  4LJ6 A;  3T15 A;  4AKH A;  1QUT A;  2EKF A;  3MFL A;  2LNH C;  3MI1 M;  1YKN A;  4LFC M;  1TGU A;  1IXZ A;  2G8L A;  5EXX A;  3C58 A;  3PCD M;  5TD3 A;  1K82 A;  2LHG A;  3B7Q A;  5C18 A;  4Q7J A;  3VKH A;  1X37 A;  3B7Z A;  1GL6 A;  3DZD A;  1P3Q Q;  1UFZ A;  2KZS A;  4GIP A;  1FNN A;  3FD9 A;  3UMM A;  2JZ0 A;  3W67 A;  2XSZ D;  1GKI A;  3Q8G A;  4B08 A;  5L8R F;  2ERC A;  4YHH M;  4IIW A;  1MX0 A;  4D80 A;  3UJN A;  1VDL A;  2WSC F;  3KP1 E;  3GQ4 A;  4L15 A;  4ANR A;  1K3W A;  3PCN M;  1DLT A;  2D7E A;  2EUC A;  2XSZ A;  1NJG A;  5EQT A;  3LMX M;  1WIV A;  3L27 A;  3RE8 A;  2MH8 A;  3PVS A;  3SAU A;  1JQJ C;  3I51 A;  2UXD M;  3TL4 X;  3GLI E;  2N35 A;  3A45 A;  4GH9 A;  1GAB A;  3PCG M;  2UUC M;  4LRS A;  3N9T A;  2DZO B;  1YE9 A;  2P5T A;  3FUW A;  1ZMU A;  2QPA A;  3O32 A;  3J2P B;  1WR1 B;  2Q2E B;  2VF8 A;  4IBC A;  2I7N A;  1XXH B;  2OOA A;  4LF6 M;  2KDL A;  2ZAN A;  1L2B A;  2FFJ A;  3M0E A;  3VLF B;  5KO3 A;  1SXJ C;  1SXJ E;  1WGN A;  3MK6 A;  3GQ3 A;  4ILV A;  2BUU B;  2H5X A;  3CF2 A;  2ZM6 M;  4LF7 M;  4RKU F;  3HWS A;  3RGP A;  2JNH A;  2BWB A;  2JY5 A;  2E5L M;  1VEG A;  1KFV A;  1R6B X;  1OIP A;  4RNA A;  1YUB A;  1LTM A;  1XXH A;  2QP9 X;  4B7G A;  2ZTC A;  3GLH B;  2Z3X A;  4B7F A;  3KW6 A;  1ORY B;  4G6Z A;  2CV2 A;  4JI7 M;  3PFI A;  4DV2 M;  3FTC A;  4AKI A;  3PXG A;  1ZAE A;  3BXW A;  2BUU A;  5FTM A;  4AG6 A;  5EXP A;  1OJL A;  3QWL A;  3F92 A;  1TR8 A;  3K9P A;  3GQ5 A;  2OQ4 A;  1XC8 A;  4DR7 M;  3FUT A;  1NHW C;  5EXS A;  3HJ8 A;  4PDI A;  1YKO B;  3PCI M;  3PCE M;  2YNM D;  3K9O A;  1KSF X;  3PNV A;  3LCU A;  4GKJ M;  1PM5 A;  1DLM A;  2NQ8 C;  3GLH A;  4MGK E;  4Z8X A;  5F3W A;  1HNX M;  1W5S A;  4DV1 M;  2CFO A;  4PT5 A;  3SMS A;  1Q3C A;  2RGO A;  1G41 A;  1HJP A;  2R0I A;  2BUT A;  2BV0 B;  3PCK A;  2QZ4 A;  1EOC B;  3THG A;  3T67 M;  2K9D A;  3LVW A;  2XLJ A;  1YKO A;  2DNA A;  2BNK A;  3FRH A;  3GPX A;  3KOY E;  2DAM A;  2QHO B;  1BVS A;  4IBI A;  1WHC A;  4II7 A;  1S3S A;  4B7H A;  2XZU A;  4JI6 M;  3PCL M;  3AOG A;  1WGL A;  3IG5 A;  1XMQ M;  3T38 A;  3BOS A;  3HY5 A;  1VEJ A;  3GRY A;  2KNA A;  5FTK A;  3RFW A;  2J7N A;  3VDU A;  5KPT A;  4DV6 M;  1GJS A;  3HHW A;  3HX3 A;  4WP2 A;  5JI2 E;  4JI2 M;  1NO1 A;  1EOC A;  2BV0 A;  3QYE A;  2HAK A;  2W82 A;  1IBK M;  4CGY B;  1DGG A;  2BUY B;  2KW0 A;  3HHX A;  2DAI A;  1V33 A;  3LXV A;  3KFU G;  3LW5 F;  3GP1 A;  1QZM A;  2JXN A;  2KEB A;  3GPY A;  1OQY A;  3C3E A;  5C1B A;  4REZ A;  4IBE A;  2LVA A;  1OFI A;  5DFL A;  2BWE A;  4X64 M;  1WJ7 A;  2X4A A;  2J5Y A;  1J5E M;  2BUY A;  1QYR A;  4LJ8 A;  1I94 M;  4ILT A;  2VII A;  2BUR B;  3U61 A;  2K6B A;  4FW9 A;  2LVP C;  2RGH A;  2X49 A;  2DHY A;  2GNO A;  2BUZ B;  4OVZ B;  3GLH E;  3SYK A;  2DWL A;  2PCD M;  1QVR A;  2C5R A;  3H4J A;  2XEP A;  4MM3 B;  2F5O A;  2LTU A;  3W68 A;  2F5P A;  1YKM B;  1XWI A;  3U6E A;  2BUV B;  2X8A A;  4DV7 M;  3KXE C;  3GLI A;  2BUR A;  3HU1 A;  1E9S A;  1SXJ B;  3HGI A;  2XZF A;  4AW4 A;  3I4Y A;  2R65 A;  4K0K M;  2OPF A;  2V1U A;  3WHL A;  1TH2 A;  3WHK A;  1NNU C;  2BUM A;  1SXJ D;  3D8B A;  1PJS A;  5FTN A;  3U6Q A;  3PCM A;  1VG5 A;  3FUV A;  1YKM A;  1NJF A;  2CHV A;  1EO2 A;  4AG5 A;  4DV4 M;  2BUV A;  1L8Q A;  4RF0 A;  1CUK A;  4LF9 M;  4WHP B;  2L4E A;  4DUZ M;  1SXJ A;  2ZBK B;  4G4R A;  2MJ5 B;  3LQQ A;  4NXM M;  3PCA A;  5DNY A;  2MRO B;  4L4U A;  3PCH M;  1TDH A;  4DV0 M;  4LF8 M;  4NRW A;  4WHP D;  2FOI C;  4XGI A;  1Z59 A;  1R4G A;  4TUW A;  3AKZ A;  4NOO B;  1Z5B A;  1IBM M;  2R62 A;  3T1Y M;  4WHP A;  2YQZ A;  3VDP A;  2FNA A;  1DLQ A;  3CTW B;  4JI4 M;  4QHT A;  5JI3 E;  2OOB A;  1EE8 A;  3SAV A;  4JYA M;  1G3I A;  2HCB A;  4LGY A;  4B3M M;  4IBK A;  3J27 B;  4DV5 M;  1QDT A;  5IWA M;  1FJG M;  2BJV A;  1UM8 A;  4KLN A;  3AJI B;  2LXE A;  2YR0 A;  3K1J A;  2DAE A;  4FCW A;  4NRV A;  1L2C A;  3SFZ A;  4DR2 M;  2DAK A;  4GKK M;  1OKS A;  3MHV C;  4CJ6 A;  2MGW A;  2QSF X;  2ZAO A;  5EP2 A;  3VK7 A;  3LKT M;  3PCL A;  3T63 M;  4I4L A;  4JN6 A;  2AHM A;  1YKL B;  2L6O A;  2QCU A;  4GEW A;  4LY6 A;  4LJ4 A;  3B74 A;  3SAW A;  2L09 A;  1MU5 A;  1PGY A;  1QUS A;  4P16 A;  4L78 A;  3MV4 M;  3I4V A;  2O5R A;  4WHO B;  2L7H A;  3E46 A;  3QAU A;  3HHZ A;  2Y21 A;  3FUX A;  3GO8 A;  1TH4 A;  3KOX E;  4WHO D;  4M9S A;  4KOD A;  4FCV A;  1N36 M;  1YKL A;  4XBO A;  3JR5 A;  1VDD A;  3VFD A;  3MI5 A;  3O6R A;  3PCB M;  1J09 A;  4IBG A;  3W0F A;  1N77 A;  3ZCB B;  5LMU M;  4KHP M;  5E26 A;  3L26 A;  5FSW A;  4WHO A;  4IBB A;  4BLC A;  2KXE A;  1KYI A;  2XF3 A;  1XNQ M;  2HHH M;  4JV5 M;  3J81 S;  3U6D A;  3UK6 A;  3TWM A;  2D7H A;  2EKK A;  1DGB A;  1RU3 A;  4LJ5 A;  4QNR A;  2Y0Q A;  3BBZ A;  2XH9 A;  1K3X A;  3M6A A;  2JA2 A;  3NBX X;  2J7O A;  1LV7 A;  3AFH A;  3KSJ A;  2F4V M;  1DGH B;  3D8L A;  2C9C A;  4W5W A;  4WW0 A;  3GPP A;  3U60 B;  1Z5C A;  3I01 M;  2JY7 A;  2XSR A;  1D0M A;  4FWD A;  2KRK A;  2Z4R A;  4PDG A;  3HJS A;  3SBJ A;  3L25 A;  3O5U A;  4AKG A;  3PNY A;  3PCC M;  1DGF A;  3B9P A;  5DYG A;  3PCF M;  4F2L A;  3GLF B;  3FRI A;  3J7A S;  4MB7 A;  3MV6 A;  3J7B A;  3J80 S;  2BOY A;  3L2A A;  2CE7 A;  4AI6 A;  1DGH A;  2KNV A;  1YKK B;  1IN8 A;  4PD2 A;  1SG9 A;  2D7G A;  3U60 A;  1Y8G A;  4I81 A;  3PCJ A;  2JP7 A;  1EOB B;  1WXQ A;  4WUR A;  3I04 M;  3GLF A;  1OFH A;  3MFL M;  1HT1 E;  1Z5A A;  4IJF A;  4DBG B;  1D0K A;  1HQC A;  3FE3 A;  4KO8 A;  2LVQ D;  2UXB M;  1YKK A;  2LHC A;  3C3D A;  2L7I A;  3MI1 A;  5DYI A;  3EIH A;  3TH1 A;  3PCD A;  1G8P A;  4Z6Y A;  1EOB A;  2JUJ A;  2LVN C;  2V6Z M;  4M0W A;  5FTL A;  1XNR M;  1VQ1 A;  3AOE C;  3K8Z A;  4LGM A;  4QOZ C;  3CF6 E;  4JI1 M;  2V1C A;  4FVM A;  3DOA A;  3JR4 A;  3HHY A;  3ZQJ A;  3U5Z B;  4HEO A;  3H4M A;  4IBJ A;  2HKJ A;  4LCB A;  1T6O A;  2VQE M;  2BUW B;  4D81 A;  2QEN A;  5KQD A;  3U6S A;  3PCN A;  2XGN A;  3LMX A;  4A3V B;  3LKT A;  2CRU A;  2G5G X;  3SAS A;  3DA1 A;  3E4R A;  3ZH9 B;  2EA0 A;  2RKO A;  2L4F A;  2Z8Y M;  2DEN A;  2JY8 A;  3PCG A;  2BUW A;  1NV9 A;  2UU9 M;  3KOW E;  2UXC M;  4LRT A;  4OX9 M;  5LMN M;  2DXI A;  1E9R A;  3U6L A;  4JI0 M;  1S9A A;  4FWG A;  5E6J A;  4LFA M;  1HNW M;  4XK8 F;  4X65 M;  3DFZ A;  2BUZ A;  2CWB A;  4L6V 6;  4OVZ A;  3TE6 A;  2DZL A;  2WSF F;  1D0L A;  4MGI E;  3GLF E;  4X62 M;  5EP3 A;  4QOS A;  5KPR A;  2DHR A;  3HU2 A;  5EXT A;  1PJI A;  4WHR B;  3T6P A;  5IT9 S;  2K47 A;  2OO9 A;  3FTD A;  4OU7 A;  1C1K A;  3SAR A;  1W5T A;  4KT0 F;  4FCT A;  3LCV B;  1R7R A;  1QZE A;  3Q8X A;  4BB9 A;  4HL4 A;  2CP8 A;  3KDS E;  1HT2 E;  3U6C A;  3O6J A;  1DV0 A;  1NSF A;  2R44 A;  3PCI A;  1V34 A;  1MN3 A;  4IBD A;  3PCE A;  4MGY E;  1ZV1 A;  8CAT A;  1N34 M;  4WHR A;  1L1T A;  2ZAM A;  1JR3 A;  3GRV A;  4L16 A;  3W0L B;  4B3R M;  4GHL A;  3TWL A;  3A46 A;  3PCK M;  3ZC7 B;  4HLQ A;  1Q02 A;  3K92 A;  1QAM A;  1IY2 A;  3LMM A;  5A2Q S;  4AZF A;  1G71 A;  3FUU A;  4CHT B;  4M9Z A;  1EFU B;  2KRU A;  4CIZ A;  3UZU A;  1IBL M;  3GRR A;  2AZQ A;  1PJT A;  3LXV M;  5FTJ A;  3T67 A;  2HL7 A;  1YLA A;  4F1I A;  1E94 E;  2A5Y B;  2DKL A;  1XB2 B;  3GLG B;  4MH0 E;  1PJJ A;  4BBA A;  3M7G A;  1TF0 B;  4I8O A;  4ITQ A;  4DR6 M;  1IY0 A;  4YY3 M;  4G3O A;  2VDB B;  3L28 A;  1R2Z A;  2XSU A;  2UUA M;  1E32 A;  2Z4S A;  1G59 A;  3B89 A;  4M0D A;  3ILK A;  4JI8 M;  3FKE A;  3R9X B;  1J7K A;  2M5Z A;  3TPZ A;  2KNZ A;  3AV0 A;  3MMP A;  1A5T A;  3GLG A;  1N32 M;  1IFY A;  4JI3 M;  3HKP A;  3KP0 E;  1V92 A;  4GIT A;  2O01 F;  2R46 A;  1OIZ A; 
#chains in the Genus database with same CATH homology
 1IQP A;  3T1H M;  1IN4 A;  3HU3 A;  3AOE A;  4RF1 A;  2VQF M;  4DR4 M;  2R4J A;  1IM2 A;  5ITR A;  1XHB A;  3FYD A;  4PCZ A;  1IN7 A;  1NY5 A;  3OTO M;  4WHS B;  5ITX E;  2PCD A;  2KZU A;  2R4E A;  1GVN A;  4LJ7 A;  2CEA A;  4WHS D;  4NXN M;  3VKG A;  3CF0 A;  4LG2 A;  2C98 A;  5FLX S;  1N78 A;  3A42 A;  3PCM M;  3EIE A;  5ITQ A;  2FE8 A;  2Y0T A;  2C9O A;  1ZQ9 A;  4WHS A;  3KSX A;  5IRE B;  3KVW A;  4DV3 M;  1G4A E;  1TH3 A;  2CHG A;  3RGS A;  3GRU A;  2BJW A;  4L8R C;  3FTF A;  4DR3 M;  3L29 A;  3PCA M;  1DMH A;  1EOA B;  3FYC A;  1QAN A;  2BUT B;  2H1R A;  1IXR C;  2F5S A;  4B3T M;  3PCH A;  1R2Y A;  2F5Q A;  2R18 A;  1L1Z A;  1TDZ A;  1T3T A;  4GHA A;  1IY1 A;  3SC3 A;  3LVV A;  1Q3B A;  1DO2 A;  2CV1 A;  4GC5 A;  3SHF A;  4FWH A;  1EOA A;  3JAM S;  3NWL A;  1NHG C;  4MGZ E;  2BUX B;  5KQ8 A;  4JXJ A;  4CIS A;  2YFQ A;  1QAQ A;  2F5N A;  1IN6 A;  2Y20 A;  5ITT A;  2R45 A;  4DR1 M;  1XMO M;  4LJ9 A;  2XFT A;  5ITU A;  5GKN A;  4IBF A;  1NY6 A;  2DVW B;  2DZN B;  1HQY E;  3T63 A;  2CHQ A;  3A98 B;  3NBI A;  3MJ5 A;  4G4Q A;  4JI5 M;  2BUX A;  2XSV A;  1I4W A;  4X66 M;  4G4N A;  1NVM A;  3U5Z A;  1D2N A;  3GPU A;  2CUZ A;  4FD2 A;  3VK8 A;  3MV4 A;  5ITY A;  4EIW A;  4IJE A;  4NL4 H;  3FTE A;  1YSY A;  5EJC A;  4MGH A;  3U61 B;  3MI5 M;  2QBY B;  4GMQ A;  3KS4 A;  1TMX A;  4DUY M;  2LWX A;  4I5S A;  4LJA A;  1NNJ A;  4R7G A;  3SMP A;  7CAT A;  3U6O A;  3PCB A;  4B3S M;  1HNZ M;  1H6U A;  1DO0 A;  3SYL A;  3SAT A;  4LZZ A;  4LFB M;  3TQS A;  2DWM A;  3U6P A;  1QAO A;  4S12 A;  3GLI B;  1L2D A;  1N33 M;  3IG8 A;  2QBY A;  4LF4 M;  1IN5 A;  2C96 A;  4OW0 A;  2EO2 A;  2BUM B;  4GRI A;  1GL7 A;  1Z6T A;  5EP1 A;  2DWN A;  4WHQ B;  3LQR A;  1GLN A;  2CV0 A;  1EO2 B;  3KS8 A;  3U6M A;  5BR8 M;  3R8F A;  1JR3 D;  4R3D A;  4NSR A;  5IZ7 D;  4QNM A;  1QQW A;  5BPV A;  5H37 D;  1N75 A;  1HR0 M;  2BUQ B;  1YKP B;  5EP4 A;  1IXS B;  4ZPX A;  3HJQ A;  3MV6 M;  3KOZ E;  5ITX A;  4D82 A;  3AL0 C;  3PCC A;  3TWK A;  3PCF A;  4WHR F;  3UGJ A;  5KPZ A;  1EO9 B;  4WHQ A;  3PCJ M;  4NSO B;  4LF5 M;  1YKN B;  2I7P A;  2UUB M;  2KA6 B;  4M9X A;  4QHS A;  2BUQ A;  1Q39 A;  1YKP A;  4GC9 A;  3SHG B;  2DWZ B;  2M60 A;  2Z7J A;  3E9S A;  2C99 A;  4II7 A;  4G4O A;  3K2L A;  1EO9 A;  4DR5 M;  2XFS A;  4LZJ A;  4AKH A;  2LH0 A;  4LJ6 A;  3T15 A;  3MFL A;  3MI1 M;  2LNH C;  1YKN A;  4LFC M;  1TGU A;  1IXZ A;  2G8L A;  5EXX A;  3C58 A;  3PCD M;  1K82 A;  5C18 A;  3VKH A;  1X37 A;  1GL6 A;  3DZD A;  2KZS A;  4GIP A;  3UMM A;  4AQY M;  1FNN A;  3FD9 A;  4B08 A;  2XSZ D;  1GKI A;  4YHH M;  2ERC A;  4IIW A;  1MX0 A;  4D80 A;  3UJN A;  3KP1 E;  3GQ4 A;  4L15 A;  1K3W A;  3PCN M;  1DLT A;  2D7E A;  2EUC A;  2XSZ A;  1NJG A;  5EQT A;  3LMX M;  3L27 A;  3RE8 A;  3PVS A;  3SAU A;  1JQJ C;  3I51 A;  2UXD M;  3TL4 X;  3A45 A;  4GH9 A;  3PCG M;  2UUC M;  4LRS A;  3N9T A;  2DZO B;  1YE9 A;  2P5T A;  3FUW A;  2QPA A;  3O32 A;  3J2P B;  4IBC A;  2Q2E B;  2I7N A;  1XXH B;  4LF6 M;  2ZAN A;  1L2B A;  2FFJ A;  3M0E A;  3VLF B;  5KO3 A;  1SXJ C;  1SXJ E;  3MK6 A;  3GQ3 A;  4ILV A;  2BUU B;  3CF2 A;  2ZM6 M;  4LF7 M;  3RGP A;  3HWS A;  2E5L M;  1KFV A;  1R6B X;  4RNA A;  1YUB A;  1XXH A;  2QP9 X;  4B7G A;  3GLH B;  2Z3X A;  4B7F A;  3KW6 A;  1ORY B;  4G6Z A;  2CV2 A;  4JI7 M;  3PFI A;  4DV2 M;  3FTC A;  3PXG A;  1ZAE A;  2BUU A;  5FTM A;  4AG6 A;  5EXP A;  1OJL A;  3QWL A;  3GQ5 A;  4DR7 M;  1XC8 A;  2OQ4 A;  3FUT A;  1NHW C;  5EXS A;  3HJ8 A;  4PDI A;  1YKO B;  3PCI M;  3PCE M;  2YNM D;  5TD3 A;  1KSF X;  3PNV A;  4GKJ M;  1PM5 A;  1DLM A;  2NQ8 C;  3GLH A;  4MGK E;  4Z8X A;  5F3W A;  1HNX M;  1W5S A;  4DV1 M;  2CFO A;  4PT5 A;  3SMS A;  1Q3C A;  2RGO A;  1G41 A;  2BUT A;  2BV0 B;  3PCK A;  2QZ4 A;  1EOC B;  3THG A;  3T67 M;  2XLJ A;  3LVW A;  1YKO A;  2BNK A;  3GPX A;  3KOY E;  4B7H A;  2XZU A;  3LXV A;  4IBI A;  4JI6 M;  1S3S A;  3PCL M;  3AOG A;  3IG5 A;  1XMQ M;  3T38 A;  3BOS A;  3GRY A;  5FTK A;  3RFW A;  2J7N A;  3VDU A;  5KPT A;  4DV6 M;  2BV0 A;  3HHW A;  4JI2 M;  5JI2 E;  1EOC A;  2W82 A;  1IBK M;  4CGY B;  1DGG A;  2BUY B;  2KW0 A;  3HHX A;  3KFU G;  3GP1 A;  1QZM A;  2KEB A;  3GPY A;  4X64 M;  4K0K M;  5C1B A;  4REZ A;  4IBE A;  4AKI A;  1OFI A;  2X4A A;  2BUY A;  1J5E M;  1QYR A;  4LJ8 A;  1I94 M;  4ILT A;  2VII A;  2BUR B;  3U61 A;  4FW9 A;  2RGH A;  2X49 A;  2BUZ B;  4OVZ B;  3SYK A;  2DWL A;  2PCD M;  1QVR A;  2C5R A;  4MM3 B;  2XEP A;  2F5O A;  2F5P A;  1YKM B;  1XWI A;  3U6E A;  2BUV B;  2X8A A;  4DV7 M;  3KXE C;  3GLI A;  2BUR A;  3HU1 A;  1E9S A;  1SXJ B;  3HGI A;  2XZF A;  4AW4 A;  3I4Y A;  2R65 A;  2OPF A;  2V1U A;  3WHL A;  1TH2 A;  3WHK A;  1NNU C;  2BUM A;  1SXJ D;  3D8B A;  5FTN A;  3PCM A;  3U6Q A;  3FUV A;  1YKM A;  1NJF A;  2CHV A;  1EO2 A;  4AG5 A;  4DV4 M;  2BUV A;  1L8Q A;  4RF0 A;  4LF9 M;  4WHP B;  4DUZ M;  1SXJ A;  2ZBK B;  4G4R A;  3LQQ A;  4NXM M;  3PCA A;  5DNY A;  4L4U A;  3PCH M;  1TDH A;  4DV0 M;  4LF8 M;  4NRW A;  4WHP D;  2FOI C;  4XGI A;  1Z59 A;  4TUW A;  3AKZ A;  4NOO B;  1Z5B A;  1IBM M;  2R62 A;  3T1Y M;  4WHP A;  2YQZ A;  3VDP A;  2FNA A;  1DLQ A;  3CTW B;  4JI4 M;  4QHT A;  5JI3 E;  1EE8 A;  3SAV A;  4JYA M;  1G3I A;  2HCB A;  4LGY A;  4B3M M;  4IBK A;  3J27 B;  4DV5 M;  5IWA M;  1FJG M;  2BJV A;  1UM8 A;  4KLN A;  3AJI B;  2LXE A;  2YR0 A;  3K1J A;  4FCW A;  4NRV A;  1L2C A;  3SFZ A;  4DR2 M;  4GKK M;  3MHV C;  2ZAO A;  3VK7 A;  5EP2 A;  3PCL A;  3LKT M;  3T63 M;  4I4L A;  4JN6 A;  2AHM A;  1YKL B;  2L6O A;  2QCU A;  4LY6 A;  4LJ4 A;  3SAW A;  2L09 A;  1MU5 A;  4P16 A;  4L78 A;  3MV4 M;  3I4V A;  2O5R A;  4WHO B;  2L7H A;  3QAU A;  3HHZ A;  2Y21 A;  3FUX A;  3GO8 A;  1TH4 A;  3KOX E;  4WHO D;  4M9S A;  4KOD A;  4FCV A;  1N36 M;  1YKL A;  4XBO A;  3JR5 A;  1VDD A;  3VFD A;  3MI5 A;  3O6R A;  3PCB M;  1J09 A;  4IBG A;  3W0F A;  1N77 A;  3ZCB B;  5LMU M;  4KHP M;  5E26 A;  3L26 A;  5FSW A;  4WHO A;  4IBB A;  4BLC A;  2KXE A;  1KYI A;  2XF3 A;  1XNQ M;  2HHH M;  4JV5 M;  3J81 S;  3U6D A;  3UK6 A;  3TWM A;  2D7H A;  1DGB A;  4LJ5 A;  4QNR A;  2Y0Q A;  2XH9 A;  1K3X A;  3M6A A;  2JA2 A;  2J7O A;  1LV7 A;  3AFH A;  3KSJ A;  2F4V M;  1DGH B;  3D8L A;  2C9C A;  4W5W A;  4WW0 A;  3GPP A;  3U60 B;  1Z5C A;  2XSR A;  3SBJ A;  4FWD A;  2KRK A;  2Z4R A;  4PDG A;  3HJS A;  3L25 A;  3O5U A;  4AKG A;  3PNY A;  3PCC M;  1DGF A;  3B9P A;  5DYG A;  3PCF M;  3GLF B;  3J7A S;  4MB7 A;  3MV6 A;  3J7B A;  3J80 S;  2BOY A;  3L2A A;  2CE7 A;  4AI6 A;  1DGH A;  1YKK B;  1IN8 A;  4PD2 A;  2D7G A;  3U60 A;  4I81 A;  3PCJ A;  1EOB B;  1WXQ A;  4WUR A;  3GLF A;  1OFH A;  3MFL M;  1HT1 E;  1Z5A A;  4IJF A;  1HQC A;  4KO8 A;  2UXB M;  1YKK A;  2L7I A;  3MI1 A;  5DYI A;  3EIH A;  3TH1 A;  3PCD A;  1G8P A;  4Z6Y A;  1EOB A;  2V6Z M;  4M0W A;  1XNR M;  5FTL A;  4QOZ C;  3K8Z A;  3AOE C;  4LGM A;  3CF6 E;  4JI1 M;  2V1C A;  4FVM A;  3DOA A;  3JR4 A;  3HHY A;  3U5Z B;  3H4M A;  4IBJ A;  2HKJ A;  4LCB A;  2VQE M;  2BUW B;  4D81 A;  2QEN A;  5KQD A;  3U6S A;  3PCN A;  2XGN A;  3LMX A;  4A3V B;  3LKT A;  2G5G X;  3SAS A;  3DA1 A;  3E4R A;  3ZH9 B;  2EA0 A;  2RKO A;  3PCG A;  2BUW A;  2UU9 M;  3KOW E;  2UXC M;  4LRT A;  4OX9 M;  5LMN M;  2DXI A;  1E9R A;  3U6L A;  4JI0 M;  1S9A A;  4FWG A;  5E6J A;  4LFA M;  1HNW M;  4X65 M;  3DFZ A;  2BUZ A;  4OVZ A;  3TE6 A;  4MGI E;  4X62 M;  5EP3 A;  4QOS A;  5KPR A;  2DHR A;  3HU2 A;  5EXT A;  1PJI A;  4WHR B;  5IT9 S;  2K47 A;  3FTD A;  4OU7 A;  1C1K A;  3SAR A;  1W5T A;  4FCT A;  4BB9 A;  1R7R A;  3Q8X A;  4HL4 A;  3KDS E;  1HT2 E;  3U6C A;  3O6J A;  1NSF A;  3PCI A;  4IBD A;  3PCE A;  4MGY E;  8CAT A;  1N34 M;  4WHR A;  1L1T A;  2ZAM A;  1JR3 A;  3GRV A;  4L16 A;  3W0L B;  4B3R M;  4GHL A;  3TWL A;  3A46 A;  3PCK M;  3ZC7 B;  4HLQ A;  3K92 A;  3LMM A;  1QAM A;  1IY2 A;  5A2Q S;  4AZF A;  3FUU A;  4CHT B;  4M9Z A;  2KRU A;  3UZU A;  1IBL M;  3GRR A;  2AZQ A;  3LXV M;  5FTJ A;  3T67 A;  2HL7 A;  1E94 E;  2A5Y B;  3GLG B;  4MH0 E;  1PJJ A;  4BBA A;  3M7G A;  4ITQ A;  4I8O A;  4DR6 M;  1IY0 A;  4YY3 M;  3L28 A;  1R2Z A;  2XSU A;  2UUA M;  1E32 A;  2Z4S A;  1G59 A;  4M0D A;  3ILK A;  4JI8 M;  3FKE A;  3R9X B;  1J7K A;  2M5Z A;  3TPZ A;  3GLG A;  3AV0 A;  1N32 M;  4JI3 M;  3HKP A;  3KP0 E;  4GIT A;  2R46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...