3HJ8A

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
257
structure length
257
Chain Sequence
RATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
total genus 72
structure length 257
sequence length 257
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hj8A01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hj8A02
4WHQA 3O5UA 3O32A 3PCIM 3PCMM 3PCNM 4WHQB 2BUVA 1YKMB 3PCAM 3HKPA 3LKTM 3PCGM 3PCKM 3MI1M 2BUZA 2XSUA 3T67M 3PCBM 4WHPB 1EOAB 4WHOA 1YKNB 4ILVA 1YKOB 2BUTB 1EOCB 2BUYA 2BUZB 3PCLA 1S9AA 3O6JA 2BUQB 3PCHM 3PCKA 3MV6A 3PCDA 2BUWB 2BURB 2BUXB 3MV4A 2BUQA 3PCAA 2BUUB 3T67A 3HHXA 3MV6M 2BV0B 3PCIA 3PCMA 4WHPD 1DLTA 2BUMA 2XSVA 1YKKA 1YKLA 1EOAA 2XSRA 1YKNA 1TMXA 1YKPA 3MI1A 1EO9B 3PCBA 3PCHA 3PCJM 4WHSA 2BOYA 3HJSA 3PCLM 3PCDM 3MI5A 3MFLA 3TH1A 2BUWA 2BUVB 3I4VA 2PCDA 4WHPA 2PCDM 1EO9A 3HGIA 3PCNA 4WHSB 3LXVA 2BV0A 1YKOA 2BUTA 2BURA 5TD3A 1DLMA 4WHOB 4WHSD 3T63M 3PCGA 3PCFA 3LKTA 1EOBA 3HJQA 2BUMB 3HHYA 4WHOD 1DLQA 2BUYB 3LMXA 3PCFM 1YKPB 3I51A 2BUXA 4WHRF 1YKMA 1EOBB 2AZQA 3O6RA 3HJ8A 3PCEA 4WHRB 3MI5M 1DMHA 3I4YA 3PCCM 3N9TA 3MV4M 2BUUA 3MFLM 3LMXM 1EO2A 1EOCA 3T63A 4ILTA 4WHRA 1YKLB 1YKKB 3PCJA 3PCEM 1EO2B 3LXVM 3PCCA
chains in the Genus database with same CATH superfamily
4P17A 2C9CA 3KSJA 4RF1A 1YLAA 2CRUA 2L7IA 2R4JA 3KXEC 3PCIM 4IBGA 5KPTA 4MM3B 3M0EA 2QBYA 3PCMM 4D80A 4FVMA 2JUJA 1HJPA 3GPPA 4QOZC 2I7NA 3U6MA 4BBAA 1Q3BA 3H4MA 1TDZA 1QAQA 2KRUA 1YKMB 2R0IA 2F5SA 2RGOA 3VKGA 1VDDA 1R6BX 2JWSA 3B9PA 2QBYB 1XWIA 1ZAEA 1GABA 3TPZA 1GJSA 4II7A 2XSUA 3ZQJA 1J7KA 1N78A 2A5YB 2DKLA 1WR1B 1Z5BA 3T15A 5FTKA 2EA0A 3J81S 1PRBA 3HX3A 4GH9A 1QDTA 4S12A 4WHPB 1YKNB 4IJEA 1ZV1A 1Z5AA 3QYEA 3LVVA 2UXDM 4ILVA 2GNOA 1G3IA 2ZANA 4LFAM 4PDIA 2BUTB 2C98A 2I7PA 3KOYE 4R7GA 5FTLA 4DR7M 1EOCB 2BUYA 2BUZB 3U61A 3TWLA 4LFCM 4JI8M 1E32A 3O6JA 3GRUA 4I5SA 4G4RA 2JY8A 1HT2E 3PCHM 2Y20A 3GLGB 2APLA 3HU2A 3I01M 2M60A 1OAOC 3UJNA 1GVNA 1EE8A 2F4VM 3FTFA 1P3QQ 1DGBA 4MGZE 3MV6M 4DV7M 2XEPA 2UUCM 1NV9A 4I81A 2Y0TA 3C9PA 1NY6A 1DGGA 4AQYM 2F5QA 2FNAA 2CP8A 2ZAOA 1XMQM 1TGUA 2BUMA 2NQ8C 1Q3CA 4IBEA 1DGFA 4B3MM 1YKKA 5E26A 3L26A 1QQWA 4AI6A 2OQ4A 4IBKA 1YKNA 4Z8XA 5EJCA 4QNRA 4G4OA 2H1RA 3MI1A 1GJTA 2L09A 4G3OA 2DWZB 4NXMM 4F1IA 3FUXA 1TF0B 2Q2EB 2HHHM 1IBMM 1EIJA 1IQPA 4LJ9A 4JYAM 1IM2A 1MN3A 2L4FA 2YQZA 1DO2A 4B7HA 1L2CA 4GKKM 2E5LM 3MI5A 2P5TA 3JR5A 5FSWA 5ITTA 3SYKA 2JZ0A 4KLNA 3KFUG 2PCDA 4G4QA 4LRSA 3PCNA 4WHSB 2KW0A 2XSZD 4NRWA 2FS1A 1YKOA 5EXTA 4D81A 2CWBA 3PCEM 4IIWA 2VDBB 4GKJM 1OFIA 1IY2A 4M9ZA 3J80S 3TWMA 4LF4M 3L2AA 4WHSD 3PCFA 2L4EA 3QAUA 3AOEA 4RNAA 5FTNA 1NNUC 1N36M 1WGNA 5FLXS 3LW5F 3HJQA 3V76A 3HHYA 4OU7A 2BUMB 2XFTA 1DLQA 2EUCA 1OQYA 4IBJA 3U6EA 1D0LA 3FTDA 4X65M 1HNZM 2BUXA 3FUUA 2LWXA 1QANA 3AKZA 1IXSA 2BJWA 4LJ5A 4JI5M 2AZQA 4B08A 4LF6M 1R2YA 1X37A 4Y28F 4WHRB 3GLGA 1WJ7A 2BNKA 1DMHA 3I4YA 2LHCA 2CUZA 1OTRA 4CGYB 3CF0A 1E9RA 1HT1E 4M0WA 1EO2A 1EOCA 3E21A 2DXIA 2BWEA 4RF0A 4MGKE 3UZUA 3ZCBB 3FD9A 5LMNM 3U6SA 1YKLB 3FKEA 3LVWA 5FTMA 3VK8A 3KS4A 1EO2B 4NXNM 3U6LA 2QENA 2F5NA 3LXVM 3GLIE 1IXZA 2UXBM 3O5UA 3KOXE 2QHOB 3GQ3A 4PT5A 1PJTA 3CF6E 4IBDA 3E4RA 3HHZA 1I4WA 3Q8GA 3GLHA 1IFYA 3AJIB 1MX0A 4WHQB 3SASA 2BUVA 3KDSE 1G59A 3SAVA 3LKTM 4B7GA 3FRHA 3B89A 3L29A 4PDGA 5F3WA 3VFDA 3ILKA 2BUZA 2QPAA 2KZUA 4DV6M 3T67M 2JNHA 2BJVA 2R65A 3KP0E 4JI6M 3LCUA 1R2ZA 4WHOA 2AHMA 1SXJB 3DFZA 1NHGC 3T1HM 2QQ8A 1XB2B 3SBJA 3LCVB 2N35A 4HL4A 1PJIA 1YKOB 2B3TA 4JV5M 5JI3E 4NRVA 4B3TM 2ZBKB 2LVQD 3R8FA 1XXHB 1QUSA 1ZMWA 2HWJA 2KA6B 4AZFA 1NNJA 4REZA 1TTEA 3GRYA 3J27B 4NOOB 1K82A 4LF9M 1S9AA 1V34A 4KT0F 5L8RF 3FRIA 3LQRA 4DBGB 2EO2A 1SXJE 3KW6A 4LGMA 1QZMA 1XXHE 2KRKA 2JP7A 4LZJA 2BUXB 2V6ZM 3PCAA 2K9DA 3FTEA 3IG5A 2CE7A 3GLHE 2VQFM 1KYIA 3SFZA 1GO5A 1OJLA 8CATA 3HZJA 3PCIA 3PCMA 4OW0A 2LXEA 3L28A 1DLTA 1RU3A 3ZC7B 2OPFA 3FYCA 4LJ6A 4Q7JA 3GLFA 2FH0A 1HNXM 3K1JA 1PJJA 4MGYE 2QZ4A 2XSRA 3KOWE 1SXJA 3U5ZA 3LQQA 2R62A 1E9SA 2R45A 2O5RA 3C58A 2L7HA 4DUZM 3VK7A 3PCJM 3HJSA 3SHFA 3HHWA 1UM8A 3PCLM 3PCJA 2LBCA 2XZUA 3H4JA 1IY0A 2MH8A 2WSFF 2Z4RA 3AFHA 3IG8A 5DFLA 5JI2E 3RGPA 4NL4H 4BLCA 1G71A 2X49A 2HL7A 3VKHA 2XSZA 2BUVB 1VQ1A 2XLJA 2R6FA 1EO9A 1A5TA 2EKKA 3LXVA 3SAWA 2OOBA 5DYGA 1SXJC 5TD3A 3W67A 2G5GX 2DAIA 3L27A 2DWMA 3DA1A 2JY5A 4DR5M 3W0FA 3PCGA 4P16A 4BB9A 1EOBA 4CIZA 2QNJA 5C1BA 3M7GA 1L1TA 4JI3M 4LCBA 3M6AA 3FUWA 3PCFM 3IECA 3U6CA 1ORYB 4DR1M 4LF5M 3MMPA 1XNQM 3AOEC 4Z6YA 4UN2B 4R71A 3O6RA 2FE8A 3PCEA 3VDPA 1TH3A 3BOSA 4LRTA 5IREB 2KXEA 2JY7A 1QYRA 1JB0F 1C7YA 2XH9A 3FUTA 1OFHA 3B7NA 5KPRA 3N9TA 1MU5A 2XFSA 1QZEA 1QVRA 2XF3A 3SARA 1L1ZA 4MGHA 1AIPC 1DGHB 1Z6TA 4GMQA 5ITXE 1N75A 5ITUA 2CHVA 4FWDA 1NO1A 1V92A 4R3DA 3K8ZA 4JN6A 4LFBM 1D0KA 3PCCA 4WHQA 3SC3A 4IBFA 5LMUM 3O32A 2Z7JA 1V33A 3PCNM 3HU3A 4B7FA 1VEKA 1G8PA 4MGIE 5ITYA 1ZMUA 1W5SA 2DVWB 3A98B 2DHRA 2CV0A 3PCAM 1NY5A 5ITRA 4X62M 3PNVA 3WHKA 1YSYA 1R4GA 5ITXA 2F5PA 2KDLA 3AV0A 3K9OA 3KOZE 3C3DA 3W0LB 1QAMA 3U60A 3MI1M 3PCBM 4ANRA 2DAEA 2O25A 4LZZA 3UGJA 3GLGE 1WXQA 4AKHA 2DAKA 1GKIA 3PNYA 5EP3A 1IY1A 1JR3D 4LF7M 4PCZA 4L78A 5KQ8A 3SYLA 3K92A 3NBXX 2DNAA 2UUAM 4I8OA 1IBKM 1ZMVA 4IBCA 5H37D 1L2DA 2Z8YM 3C3EA 4HLQA 4IJFA 3PCKA 3VLFB 3MV6A 1Z5CA 2D7EA 2KHHA 4CJ6A 2BUWB 2ZM6M 3J7AS 2JZ1A 2BURB 3MV4A 4NC6A 1GLNA 2JY6B 3CF2A 4XBOA 1IXSB 3HHXA 4GRIA 4JI1M 1DO0A 4GEWA 2BUUB 1TR8A 2BV0B 4FD2A 4DR3M 4LY6A 5EP2A 5EXPA 3UMMA 4WHPD 4DR2M 2KNVA 2DAMA 2R46A 5KPZA 3GLIA 2XSVA 2Z3XA 3MJ5A 1YKLA 4DV4M 2XGNA 4GC5A 1XHBA 3DZDA 3RGSA 2DWNA 1YKPA 3KSXA 3L25A 1Z59A 1HQCA 1L8QA 2W82A 3U6PA 1EO9B 2Z4SA 1H6UA 3PCBA 3PCHA 4WHSA 4QNMA 2BOYA 2CHQA 4M0DA 1IN4A 3PCDM 2QP9X 2CFOA 2UUBM 1JQJC 2DHYA 3THGA 4NSRA 3UK6A 2ZTDA 4JI2M 4QHTA 3TH1A 2YFQA 1YE9A 2DI0A 3DOAA 3RFWA 1QDRA 2Y0QA 3W68A 1AUAA 4A3VB 3I4VA 4YHHM 4G4NA 2PCDM 2RRUA 4WHPA 3HGIA 1KSFX 4FCTA 2X8AA 2G8LA 4W5WA 2CV1A 1R7RA 2LTUA 4JXJA 7CATA 2BV0A 1TDHA 1CUKA 1PM5A 1LV7A 3CGWA 2BURA 1DLMA 1XC8A 1FJGM 1UFZA 4WHOB 2QCUA 3KVWA 2EKFA 2UXCM 2C96A 2DAGA 4MB7A 1MJGM 4L6V6 1XNRM 2X4AA 4PD2A 1HR0M 3B7ZA 3U61B 1IN6A 4X66M 4YY3M 2C5RA 2BUYB 1C1KA 3LMXA 3TL4X 4WHOD 3U5ZB 3GLFE 2KEBA 1LTMA 3I51A 2LH0A 4F2LA 2UU9M 2R44A 1DV0A 5DNYA 1PGYA 3E9SA 3MHVC 4ZPXA 4WHRF 4GITA 1DGHA 3T1YM 3MI5M 3AL0C 1PJQA 4OX9M 4GHLA 1VEJA 2MJ5B 4XGIA 3Q8XA 1N77A 4KODA 4LF8M 2EJSA 2CV2A 3MV4M 4HEOA 3D8BA 2DZLA 3MFLM 2CHGA 1BVSA 3HU1A 5IT9S 3T63A 1TH2A 1D0MA 1FNNA 1Q39A 3LMMA 4FCVA 4M9SA 4ILTA 3PXGA 3T38A 2WSCF 2DZNB 2MROB 1NVMA 2R4EA 2L6OA 1F4IA 4FWHA 2LVPC 5KQDA 1YKKB 4AG6A 4DV1M 4KHPM 3I04M 2DENA 4NSOB 3EIHA 3K9PA 1HQYE 3PFIA 2J7NA 2V1CA 4L15A 1T3TA 1NV8A 2J5YA 3SHGB 2VQEM 4OVZB 1KFVA 4QOSA 4FW9A 3KS8A 4LGYA 5EQTA 3SMSA 1GL6A 4L8RC 3F92A 4QHSA 1OKSA 3HKPA 2QSFX 3HWSA 2YR0A 2BWBA 3E46A 3HY5A 1VDLA 3GLIB 3PCGM 3CTWB 2M5ZA 3PCKM 2VF8A 3GP1A 4DUYM 2RKOA 4G6ZA 4EIWA 1E94E 1EFUB 4IBIA 4K0KM 1IN7A 1EOAB 3OTOM 3JAMS 4L4UA 3PVSA 4RKUF 2R18A 2Y21A 2LVAA 3A42A 1R5LA 5EXSA 4I4LA 1OAIA 1TH4A 1ZQ9A 2FFJA 2K47A 2OOAA 2FOIC 4LJ7A 4B3SM 4AKGA 4B3RM 2ERCA 3JR4A 3PCLA 1IXRC 4DV3M 1J5EM 2LVNC 3FUVA 4ITQA 4LJ8A 3VDUA 1N33M 2BUQB 1VG5A 3J2PB 3GPYA 1QUTA 3RE8A 4AW4A 1IN8A 2C9OA 2MGWA 1IBLM 2F5OA 3J7BA 2J7OA 3PCDA 3A45A 2K6BA 3GLFB 2BUQA 2CEAA 5A2QS 3T67A 1IN5A 1WGLA 2KNZA 2LHGA 2WZJA 2ZTCA 5C18A 5GKNA 4DV5M 1XXHA 2YNMD 4JI4M 2DZOB 2KZSA 3MK6A 4DV0M 3U60B 1GL7A 5EXXA 2VIIA 3IHPA 3GQ4A 1OIZA 3D8LA 1SXJD 2WSEF 1G4AE 1JR3A 4M9XA 3KP1E 1NSFA 1EOAA 1K3WA 2D7HA 1WHCA 1TMXA 2LVOC 4D82A 4GC9A 4L16A 3TE6A 4JI7M 1T43A 1W5TA 2D7GA 1D2NA 1Q02A 1T6OA 2JXNA 2H5XA 1PJSA 5FTJA 3WHLA 5IWAM 2V1UA 3FE3A 1S3SA 3U6DA 2XZFA 5DYIA 3MFLA 4KO8A 2K0BX 4WURA 3TQSA 5EP1A 1NJFA 1YUBA 2BUWA 2KNAA 1NHWC 1N34M 1JR3E 1NJGA 1Y8GA 4X64M 3GPUA 3SAUA 4JI0M 3BBZA 5IZ7D 1OIPA 2GQFA 2HAKA 2BUTA 3TWKA 4MH0E 3GO8A 2RGHA 1WIVA 2DWLA 4XK8F 4DV2M 4DR6M 1I94M 3B7QA 3T63M 2VF7A 4LJAA 2MR9A 4IBBA 2G3QA 3NWLA 5ITQA 1N32M 3LKTA 3U6QA 1XMOM 3SATA 3SMPA 3GLHB 4CHTB 3FYDA 3GPXA 4FCWA 2HCBA 5BR8M 1YKPB 4WW0A 4AKIA 3AOGA 2OO9A 2O01F 3EIEA 3QYBA 1L2BA 1YKMA 1EOBB 4WP2A 3B74A 1G41A 2L2DA 5E6JA 3HJ8A 1K3XA 2C99A 4GHAA 1VEGA 3T6PA 5BPVA 5KO3A 2HKJA 2LNHC 1J09A 3K2LA 3R9XB 3PCCM 4LJ4A 2ZAMA 3BXWA 4DR4M 1QAOA 4FWGA 3U6OA 4TUWA 2BUUA 3LMXM 3QWLA 3A46A 3NBIA 4GIPA 3GQ5A 4LG2A 3FTCA 1SG9A 2JA2A 5EP4A 3ZH9B 4WHRA 3GRRA 1HNWM 3GRVA 4CISA 4OVZA 4AG5A
chains in the Genus database with same CATH topology
2C9CA 3KSJA 4RF1A 2L7IA 2R4JA 3KXEC 3PCIM 4IBGA 5KPTA 4MM3B 3M0EA 2QBYA 3PCMM 4D80A 4FVMA 4QOZC 3GPPA 2I7NA 3U6MA 4BBAA 1Q3BA 3H4MA 1TDZA 1QAQA 2KRUA 1YKMB 2F5SA 2RGOA 3VKGA 1VDDA 1R6BX 3B9PA 2QBYB 1XWIA 1ZAEA 3TPZA 4II7A 2XSUA 1J7KA 1N78A 2A5YB 1Z5BA 3T15A 5FTKA 2EA0A 3J81S 4GH9A 4WHPB 4S12A 1YKNB 4IJEA 1Z5AA 2UXDM 3LVVA 4ILVA 1G3IA 2ZANA 4LFAM 4PDIA 2BUTB 2C98A 2I7PA 3KOYE 4R7GA 5FTLA 4DR7M 1EOCB 2BUYA 2BUZB 3U61A 3TWLA 4LFCM 4JI8M 1E32A 3O6JA 3GRUA 4I5SA 4G4RA 3PCHM 1HT2E 2Y20A 3GLGB 3HU2A 2M60A 3UJNA 1GVNA 1EE8A 2F4VM 3FTFA 4MGZE 1DGBA 3MV6M 4DV7M 2XEPA 2UUCM 4AQYM 4I81A 2Y0TA 1NY6A 1DGGA 2F5QA 2FNAA 2ZAOA 1XMQM 2BUMA 1TGUA 2NQ8C 1Q3CA 4IBEA 1DGFA 4B3MM 1YKKA 5E26A 3L26A 1QQWA 4AI6A 2OQ4A 4IBKA 1YKNA 4Z8XA 5EJCA 4QNRA 4G4OA 2H1RA 3MI1A 2L09A 2DWZB 4NXMM 3FUXA 2HHHM 2Q2EB 1IBMM 1IQPA 4LJ9A 4JYAM 1IM2A 4B7HA 2YQZA 1DO2A 1L2CA 4GKKM 2E5LM 3MI5A 2P5TA 3JR5A 5FSWA 5ITTA 3SYKA 4KLNA 2PCDA 3KFUG 4G4QA 4LRSA 3PCNA 4WHSB 2KW0A 2XSZD 4NRWA 1YKOA 5EXTA 4D81A 3PCEM 4IIWA 4GKJM 1OFIA 1IY2A 4M9ZA 3J80S 3TWMA 4LF4M 3L2AA 4WHSD 3PCFA 3QAUA 4RNAA 3AOEA 1N36M 5FTNA 1NNUC 5FLXS 3HJQA 2BUMB 3HHYA 4OU7A 2XFTA 1DLQA 2EUCA 4IBJA 3U6EA 3FTDA 4X65M 1HNZM 2BUXA 3FUUA 2LWXA 1QANA 3AKZA 2BJWA 4LJ5A 4JI5M 2AZQA 4B08A 4LF6M 1R2YA 1X37A 4WHRB 3GLGA 2BNKA 1DMHA 3I4YA 2CUZA 4CGYB 3CF0A 1E9RA 1HT1E 4M0WA 1EO2A 1EOCA 2DXIA 4RF0A 4MGKE 3UZUA 3ZCBB 3FD9A 5LMNM 3U6SA 1YKLB 3FKEA 3LVWA 5FTMA 3VK8A 3KS4A 1EO2B 4NXNM 3U6LA 2QENA 2F5NA 3LXVM 1IXZA 2UXBM 3O5UA 3KOXE 3GQ3A 4PT5A 3CF6E 4IBDA 3E4RA 3HHZA 1I4WA 3GLHA 3AJIB 1MX0A 4WHQB 3SASA 2BUVA 3KDSE 1G59A 3SAVA 3LKTM 4B7GA 5F3WA 3L29A 4PDGA 3VFDA 3ILKA 2BUZA 2QPAA 2KZUA 4DV6M 3T67M 2BJVA 2R65A 3KP0E 4JI6M 1R2ZA 4WHOA 2AHMA 1SXJB 3DFZA 1NHGC 3T1HM 3SBJA 4HL4A 1PJIA 1YKOB 4JV5M 5JI3E 4NRVA 4B3TM 2ZBKB 3R8FA 1XXHB 1NNJA 2KA6B 4AZFA 4REZA 3GRYA 3J27B 4NOOB 1K82A 4LF9M 1S9AA 3LQRA 2EO2A 1SXJE 3KW6A 4LGMA 1QZMA 2KRKA 4LZJA 2BUXB 2V6ZM 3PCAA 3FTEA 3IG5A 2CE7A 2VQFM 1KYIA 3SFZA 1OJLA 8CATA 3PCIA 3PCMA 4OW0A 2LXEA 3L28A 1DLTA 3ZC7B 2OPFA 3FYCA 4LJ6A 3GLFA 1HNXM 3K1JA 1PJJA 4MGYE 2QZ4A 2XSRA 3KOWE 1SXJA 3U5ZA 3LQQA 2R62A 1E9SA 2R45A 2O5RA 3C58A 2L7HA 4DUZM 3VK7A 3PCJM 3HJSA 3SHFA 3HHWA 1UM8A 3PCLM 3PCJA 2XZUA 1IY0A 5JI2E 2Z4RA 3AFHA 3IG8A 3RGPA 4NL4H 4BLCA 2X49A 2HL7A 3VKHA 2XSZA 2BUVB 2XLJA 1EO9A 3LXVA 3SAWA 5DYGA 1SXJC 5TD3A 2G5GX 3L27A 2DWMA 3DA1A 4DR5M 3W0FA 3PCGA 4P16A 4BB9A 1EOBA 5C1BA 3M7GA 1L1TA 4JI3M 4LCBA 3M6AA 3FUWA 3PCFM 3U6CA 1ORYB 4DR1M 4LF5M 1XNQM 3AOEC 4Z6YA 3O6RA 2FE8A 3PCEA 3VDPA 1TH3A 3BOSA 4LRTA 5IREB 2KXEA 1QYRA 2XH9A 3FUTA 1OFHA 5KPRA 3N9TA 1MU5A 2XFSA 1QVRA 2XF3A 3SARA 1L1ZA 4MGHA 1DGHB 1Z6TA 4GMQA 5ITXE 1N75A 5ITUA 2CHVA 4FWDA 4R3DA 3K8ZA 4JN6A 4LFBM 3PCCA 4WHQA 3SC3A 4IBFA 5LMUM 3O32A 2Z7JA 3PCNM 3HU3A 4B7FA 1G8PA 4MGIE 5ITYA 1W5SA 2DVWB 3A98B 2DHRA 2CV0A 3PCAM 1NY5A 5ITRA 4X62M 3PNVA 3WHKA 1YSYA 5ITXA 2F5PA 3W0LB 3AV0A 3KOZE 3MI1M 1QAMA 3U60A 3PCBM 4LZZA 3UGJA 1WXQA 4AKHA 1GKIA 3PNYA 5EP3A 1IY1A 1JR3D 4LF7M 4PCZA 4L78A 5KQ8A 3SYLA 3K92A 2UUAM 4I8OA 1IBKM 4IBCA 5H37D 1L2DA 4HLQA 4IJFA 3PCKA 3VLFB 3MV6A 1Z5CA 2D7EA 2BUWB 2ZM6M 3J7AS 2BURB 3MV4A 1GLNA 3CF2A 4XBOA 4JI1M 1IXSB 3HHXA 4GRIA 2BUUB 1DO0A 2BV0B 4FD2A 4DR3M 4LY6A 5EP2A 5EXPA 3UMMA 4WHPD 4DR2M 2R46A 5KPZA 3GLIA 2XSVA 2Z3XA 3MJ5A 1YKLA 4DV4M 2XGNA 4GC5A 1XHBA 3DZDA 3RGSA 2DWNA 1YKPA 3KSXA 3L25A 1Z59A 1HQCA 1L8QA 2W82A 3U6PA 1EO9B 2Z4SA 1H6UA 3PCBA 3PCHA 4WHSA 4QNMA 2BOYA 2CHQA 4M0DA 1IN4A 3PCDM 2QP9X 2CFOA 2UUBM 1JQJC 3THGA 4NSRA 3UK6A 4JI2M 4QHTA 3TH1A 2YFQA 1YE9A 3DOAA 3RFWA 2Y0QA 4A3VB 3I4VA 4YHHM 4G4NA 2PCDM 4WHPA 3HGIA 1KSFX 4FCTA 2X8AA 2G8LA 4W5WA 2CV1A 1R7RA 4JXJA 7CATA 2BV0A 1TDHA 1PM5A 2BURA 1LV7A 1DLMA 1XC8A 1FJGM 4WHOB 2QCUA 3KVWA 2UXCM 2C96A 4MB7A 1XNRM 2X4AA 4PD2A 1HR0M 3U61B 1IN6A 4X66M 4YY3M 2C5RA 2BUYB 1C1KA 3LMXA 3TL4X 4WHOD 3U5ZB 2KEBA 3I51A 2LH0A 2UU9M 5DNYA 3E9SA 3MHVC 4ZPXA 4WHRF 4GITA 1DGHA 3T1YM 3MI5M 3AL0C 4OX9M 4GHLA 1N77A 4XGIA 3Q8XA 4KODA 4LF8M 2CV2A 3MV4M 3D8BA 3MFLM 2CHGA 3HU1A 5IT9S 3T63A 1TH2A 1FNNA 3LMMA 1Q39A 4FCVA 4M9SA 4ILTA 3PXGA 3T38A 2DZNB 1NVMA 2R4EA 2L6OA 1YKKB 4FWHA 5KQDA 4AG6A 4DV1M 4KHPM 4NSOB 3EIHA 1HQYE 3PFIA 2J7NA 2V1CA 4L15A 1T3TA 3SHGB 2VQEM 4OVZB 1KFVA 4QOSA 4FW9A 3KS8A 4LGYA 5EQTA 3SMSA 1GL6A 4L8RC 4QHSA 3HKPA 3HWSA 2YR0A 3GLIB 3PCGM 3CTWB 2M5ZA 3PCKM 3GP1A 4DUYM 2RKOA 4G6ZA 4EIWA 1E94E 4IBIA 4K0KM 1IN7A 1EOAB 3OTOM 3JAMS 4L4UA 3PVSA 2R18A 2Y21A 3A42A 5EXSA 4I4LA 1ZQ9A 1TH4A 2FFJA 4LJ7A 2K47A 4AKGA 2FOIC 4B3SM 4B3RM 2ERCA 3JR4A 3PCLA 1IXRC 4DV3M 1J5EM 4ITQA 3FUVA 4LJ8A 3VDUA 1N33M 2BUQB 3J2PB 3GPYA 4AW4A 3RE8A 1IN8A 2C9OA 1IBLM 2F5OA 3PCDA 3J7BA 2J7OA 3A45A 3GLFB 2BUQA 2CEAA 5A2QS 3T67A 1IN5A 5C18A 4DV5M 5GKNA 4JI4M 1XXHA 2YNMD 2DZOB 2KZSA 3MK6A 4DV0M 3U60B 1GL7A 5EXXA 2VIIA 3GQ4A 3D8LA 1SXJD 1G4AE 1JR3A 4M9XA 3KP1E 1NSFA 1EOAA 1K3WA 2D7HA 1TMXA 4D82A 4GC9A 4L16A 3TE6A 4JI7M 1W5TA 2D7GA 1D2NA 3WHLA 5FTJA 5IWAM 2V1UA 1S3SA 3U6DA 2XZFA 5DYIA 3MFLA 4KO8A 3TQSA 4WURA 2BUWA 5EP1A 1NJFA 1YUBA 1NHWC 1N34M 1NJGA 4X64M 3GPUA 3SAUA 4JI0M 5IZ7D 2BUTA 3TWKA 4MH0E 3GO8A 2RGHA 2DWLA 4DR6M 4DV2M 1I94M 3T63M 4LJAA 4IBBA 3NWLA 5ITQA 1N32M 3LKTA 3U6QA 1XMOM 3SATA 3SMPA 3GLHB 4CHTB 3FYDA 3GPXA 4FCWA 2HCBA 5BR8M 1YKPB 4WW0A 4AKIA 3AOGA 3EIEA 1L2BA 1YKMA 1EOBB 1G41A 5E6JA 3HJ8A 1K3XA 2C99A 4GHAA 5KO3A 5BPVA 2HKJA 2LNHC 1J09A 3K2LA 3R9XB 3PCCM 4LJ4A 2ZAMA 4DR4M 4FWGA 1QAOA 3U6OA 4TUWA 2BUUA 3LMXM 3QWLA 3A46A 3NBIA 4GIPA 3GQ5A 4LG2A 3FTCA 2JA2A 5EP4A 4WHRA 3ZH9B 3GRRA 1HNWM 3GRVA 4CISA 4OVZA 4AG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHQ A;  3O5U A;  3O32 A;  3PCI M;  3PCM M;  3PCN M;  4WHQ B;  2BUV A;  1YKM B;  3PCA M;  3HKP A;  3LKT M;  3PCG M;  3PCK M;  3MI1 M;  2BUZ A;  2XSU A;  3T67 M;  3PCB M;  4WHP B;  1EOA B;  4WHO A;  1YKN B;  4ILV A;  1YKO B;  2BUT B;  1EOC B;  2BUY A;  2BUZ B;  3PCL A;  1S9A A;  3O6J A;  2BUQ B;  3PCH M;  3PCK A;  3MV6 A;  3PCD A;  2BUW B;  2BUR B;  2BUX B;  3MV4 A;  2BUQ A;  3PCA A;  2BUU B;  3T67 A;  3HHX A;  3MV6 M;  2BV0 B;  3PCI A;  3PCM A;  4WHP D;  1DLT A;  2BUM A;  2XSV A;  1YKK A;  1YKL A;  1EOA A;  2XSR A;  1YKN A;  1TMX A;  1YKP A;  3MI1 A;  1EO9 B;  3PCB A;  3PCH A;  3PCJ M;  4WHS A;  2BOY A;  3HJS A;  3PCL M;  3PCD M;  3MI5 A;  3MFL A;  3TH1 A;  2BUW A;  2BUV B;  3I4V A;  2PCD A;  4WHP A;  2PCD M;  1EO9 A;  3HGI A;  3PCN A;  4WHS B;  3LXV A;  2BV0 A;  1YKO A;  2BUT A;  2BUR A;  5TD3 A;  1DLM A;  4WHO B;  4WHS D;  3T63 M;  3PCG A;  3PCF A;  3LKT A;  1EOB A;  3HJQ A;  2BUM B;  3HHY A;  4WHO D;  1DLQ A;  2BUY B;  3LMX A;  3PCF M;  1YKP B;  3I51 A;  2BUX A;  4WHR F;  1YKM A;  1EOB B;  2AZQ A;  3O6R A;  3HJ8 A;  3PCE A;  4WHR B;  3MI5 M;  1DMH A;  3I4Y A;  3PCC M;  3N9T A;  3MV4 M;  2BUU A;  3MFL M;  3LMX M;  1EO2 A;  1EOC A;  3T63 A;  4ILT A;  4WHR A;  1YKL B;  1YKK B;  3PCJ A;  3PCE M;  1EO2 B;  3LXV M;  3PCC A; 
#chains in the Genus database with same CATH topology
 4P17 A;  2C9C A;  3KSJ A;  4RF1 A;  1YLA A;  2CRU A;  2L7I A;  2R4J A;  3KXE C;  3PCI M;  4IBG A;  5KPT A;  4MM3 B;  3M0E A;  2QBY A;  3PCM M;  4D80 A;  4FVM A;  2JUJ A;  1HJP A;  3GPP A;  4QOZ C;  2I7N A;  3U6M A;  4BBA A;  1Q3B A;  3H4M A;  1TDZ A;  1QAQ A;  2KRU A;  1YKM B;  2R0I A;  2F5S A;  2RGO A;  3VKG A;  1VDD A;  1R6B X;  2JWS A;  3B9P A;  2QBY B;  1XWI A;  1ZAE A;  1GAB A;  3TPZ A;  1GJS A;  4II7 A;  2XSU A;  3ZQJ A;  1J7K A;  1N78 A;  2A5Y B;  2DKL A;  1WR1 B;  1Z5B A;  3T15 A;  5FTK A;  2EA0 A;  3J81 S;  1PRB A;  3HX3 A;  4GH9 A;  1QDT A;  4S12 A;  4WHP B;  1YKN B;  4IJE A;  1ZV1 A;  1Z5A A;  3QYE A;  3LVV A;  2UXD M;  4ILV A;  2GNO A;  1G3I A;  2ZAN A;  4LFA M;  4PDI A;  2BUT B;  2C98 A;  2I7P A;  3KOY E;  4R7G A;  5FTL A;  4DR7 M;  1EOC B;  2BUY A;  2BUZ B;  3U61 A;  3TWL A;  4LFC M;  4JI8 M;  1E32 A;  3O6J A;  3GRU A;  4I5S A;  4G4R A;  2JY8 A;  1HT2 E;  3PCH M;  2Y20 A;  3GLG B;  2APL A;  3HU2 A;  3I01 M;  2M60 A;  1OAO C;  3UJN A;  1GVN A;  1EE8 A;  2F4V M;  3FTF A;  1P3Q Q;  1DGB A;  4MGZ E;  3MV6 M;  4DV7 M;  2XEP A;  2UUC M;  1NV9 A;  4I81 A;  2Y0T A;  3C9P A;  1NY6 A;  1DGG A;  4AQY M;  2F5Q A;  2FNA A;  2CP8 A;  2ZAO A;  1XMQ M;  1TGU A;  2BUM A;  2NQ8 C;  1Q3C A;  4IBE A;  1DGF A;  4B3M M;  1YKK A;  5E26 A;  3L26 A;  1QQW A;  4AI6 A;  2OQ4 A;  4IBK A;  1YKN A;  4Z8X A;  5EJC A;  4QNR A;  4G4O A;  2H1R A;  3MI1 A;  1GJT A;  2L09 A;  4G3O A;  2DWZ B;  4NXM M;  4F1I A;  3FUX A;  1TF0 B;  2Q2E B;  2HHH M;  1IBM M;  1EIJ A;  1IQP A;  4LJ9 A;  4JYA M;  1IM2 A;  1MN3 A;  2L4F A;  2YQZ A;  1DO2 A;  4B7H A;  1L2C A;  4GKK M;  2E5L M;  3MI5 A;  2P5T A;  3JR5 A;  5FSW A;  5ITT A;  3SYK A;  2JZ0 A;  4KLN A;  3KFU G;  2PCD A;  4G4Q A;  4LRS A;  3PCN A;  4WHS B;  2KW0 A;  2XSZ D;  4NRW A;  2FS1 A;  1YKO A;  5EXT A;  4D81 A;  2CWB A;  3PCE M;  4IIW A;  2VDB B;  4GKJ M;  1OFI A;  1IY2 A;  4M9Z A;  3J80 S;  3TWM A;  4LF4 M;  3L2A A;  4WHS D;  3PCF A;  2L4E A;  3QAU A;  3AOE A;  4RNA A;  5FTN A;  1NNU C;  1N36 M;  1WGN A;  5FLX S;  3LW5 F;  3HJQ A;  3V76 A;  3HHY A;  4OU7 A;  2BUM B;  2XFT A;  1DLQ A;  2EUC A;  1OQY A;  4IBJ A;  3U6E A;  1D0L A;  3FTD A;  4X65 M;  1HNZ M;  2BUX A;  3FUU A;  2LWX A;  1QAN A;  3AKZ A;  1IXS A;  2BJW A;  4LJ5 A;  4JI5 M;  2AZQ A;  4B08 A;  4LF6 M;  1R2Y A;  1X37 A;  4Y28 F;  4WHR B;  3GLG A;  1WJ7 A;  2BNK A;  1DMH A;  3I4Y A;  2LHC A;  2CUZ A;  1OTR A;  4CGY B;  3CF0 A;  1E9R A;  1HT1 E;  4M0W A;  1EO2 A;  1EOC A;  3E21 A;  2DXI A;  2BWE A;  4RF0 A;  4MGK E;  3UZU A;  3ZCB B;  3FD9 A;  5LMN M;  3U6S A;  1YKL B;  3FKE A;  3LVW A;  5FTM A;  3VK8 A;  3KS4 A;  1EO2 B;  4NXN M;  3U6L A;  2QEN A;  2F5N A;  3LXV M;  3GLI E;  1IXZ A;  2UXB M;  3O5U A;  3KOX E;  2QHO B;  3GQ3 A;  4PT5 A;  1PJT A;  3CF6 E;  4IBD A;  3E4R A;  3HHZ A;  1I4W A;  3Q8G A;  3GLH A;  1IFY A;  3AJI B;  1MX0 A;  4WHQ B;  3SAS A;  2BUV A;  3KDS E;  1G59 A;  3SAV A;  3LKT M;  4B7G A;  3FRH A;  3B89 A;  3L29 A;  4PDG A;  5F3W A;  3VFD A;  3ILK A;  2BUZ A;  2QPA A;  2KZU A;  4DV6 M;  3T67 M;  2JNH A;  2BJV A;  2R65 A;  3KP0 E;  4JI6 M;  3LCU A;  1R2Z A;  4WHO A;  2AHM A;  1SXJ B;  3DFZ A;  1NHG C;  3T1H M;  2QQ8 A;  1XB2 B;  3SBJ A;  3LCV B;  2N35 A;  4HL4 A;  1PJI A;  1YKO B;  2B3T A;  4JV5 M;  5JI3 E;  4NRV A;  4B3T M;  2ZBK B;  2LVQ D;  3R8F A;  1XXH B;  1QUS A;  1ZMW A;  2HWJ A;  2KA6 B;  4AZF A;  1NNJ A;  4REZ A;  1TTE A;  3GRY A;  3J27 B;  4NOO B;  1K82 A;  4LF9 M;  1S9A A;  1V34 A;  4KT0 F;  5L8R F;  3FRI A;  3LQR A;  4DBG B;  2EO2 A;  1SXJ E;  3KW6 A;  4LGM A;  1QZM A;  1XXH E;  2KRK A;  2JP7 A;  4LZJ A;  2BUX B;  2V6Z M;  3PCA A;  2K9D A;  3FTE A;  3IG5 A;  2CE7 A;  3GLH E;  2VQF M;  1KYI A;  3SFZ A;  1GO5 A;  1OJL A;  8CAT A;  3HZJ A;  3PCI A;  3PCM A;  4OW0 A;  2LXE A;  3L28 A;  1DLT A;  1RU3 A;  3ZC7 B;  2OPF A;  3FYC A;  4LJ6 A;  4Q7J A;  3GLF A;  2FH0 A;  1HNX M;  3K1J A;  1PJJ A;  4MGY E;  2QZ4 A;  2XSR A;  3KOW E;  1SXJ A;  3U5Z A;  3LQQ A;  2R62 A;  1E9S A;  2R45 A;  2O5R A;  3C58 A;  2L7H A;  4DUZ M;  3VK7 A;  3PCJ M;  3HJS A;  3SHF A;  3HHW A;  1UM8 A;  3PCL M;  3PCJ A;  2LBC A;  2XZU A;  3H4J A;  1IY0 A;  2MH8 A;  2WSF F;  2Z4R A;  3AFH A;  3IG8 A;  5DFL A;  5JI2 E;  3RGP A;  4NL4 H;  4BLC A;  1G71 A;  2X49 A;  2HL7 A;  3VKH A;  2XSZ A;  2BUV B;  1VQ1 A;  2XLJ A;  2R6F A;  1EO9 A;  1A5T A;  2EKK A;  3LXV A;  3SAW A;  2OOB A;  5DYG A;  1SXJ C;  5TD3 A;  3W67 A;  2G5G X;  2DAI A;  3L27 A;  2DWM A;  3DA1 A;  2JY5 A;  4DR5 M;  3W0F A;  3PCG A;  4P16 A;  4BB9 A;  1EOB A;  4CIZ A;  2QNJ A;  5C1B A;  3M7G A;  1L1T A;  4JI3 M;  4LCB A;  3M6A A;  3FUW A;  3PCF M;  3IEC A;  3U6C A;  1ORY B;  4DR1 M;  4LF5 M;  3MMP A;  1XNQ M;  3AOE C;  4Z6Y A;  4UN2 B;  4R71 A;  3O6R A;  2FE8 A;  3PCE A;  3VDP A;  1TH3 A;  3BOS A;  4LRT A;  5IRE B;  2KXE A;  2JY7 A;  1QYR A;  1JB0 F;  1C7Y A;  2XH9 A;  3FUT A;  1OFH A;  3B7N A;  5KPR A;  3N9T A;  1MU5 A;  2XFS A;  1QZE A;  1QVR A;  2XF3 A;  3SAR A;  1L1Z A;  4MGH A;  1AIP C;  1DGH B;  1Z6T A;  4GMQ A;  5ITX E;  1N75 A;  5ITU A;  2CHV A;  4FWD A;  1NO1 A;  1V92 A;  4R3D A;  3K8Z A;  4JN6 A;  4LFB M;  1D0K A;  3PCC A;  4WHQ A;  3SC3 A;  4IBF A;  5LMU M;  3O32 A;  2Z7J A;  1V33 A;  3PCN M;  3HU3 A;  4B7F A;  1VEK A;  1G8P A;  4MGI E;  5ITY A;  1ZMU A;  1W5S A;  2DVW B;  3A98 B;  2DHR A;  2CV0 A;  3PCA M;  1NY5 A;  5ITR A;  4X62 M;  3PNV A;  3WHK A;  1YSY A;  1R4G A;  5ITX A;  2F5P A;  2KDL A;  3AV0 A;  3K9O A;  3KOZ E;  3C3D A;  3W0L B;  1QAM A;  3U60 A;  3MI1 M;  3PCB M;  4ANR A;  2DAE A;  2O25 A;  4LZZ A;  3UGJ A;  3GLG E;  1WXQ A;  4AKH A;  2DAK A;  1GKI A;  3PNY A;  5EP3 A;  1IY1 A;  1JR3 D;  4LF7 M;  4PCZ A;  4L78 A;  5KQ8 A;  3SYL A;  3K92 A;  3NBX X;  2DNA A;  2UUA M;  4I8O A;  1IBK M;  1ZMV A;  4IBC A;  5H37 D;  1L2D A;  2Z8Y M;  3C3E A;  4HLQ A;  4IJF A;  3PCK A;  3VLF B;  3MV6 A;  1Z5C A;  2D7E A;  2KHH A;  4CJ6 A;  2BUW B;  2ZM6 M;  3J7A S;  2JZ1 A;  2BUR B;  3MV4 A;  4NC6 A;  1GLN A;  2JY6 B;  3CF2 A;  4XBO A;  1IXS B;  3HHX A;  4GRI A;  4JI1 M;  1DO0 A;  4GEW A;  2BUU B;  1TR8 A;  2BV0 B;  4FD2 A;  4DR3 M;  4LY6 A;  5EP2 A;  5EXP A;  3UMM A;  4WHP D;  4DR2 M;  2KNV A;  2DAM A;  2R46 A;  5KPZ A;  3GLI A;  2XSV A;  2Z3X A;  3MJ5 A;  1YKL A;  4DV4 M;  2XGN A;  4GC5 A;  1XHB A;  3DZD A;  3RGS A;  2DWN A;  1YKP A;  3KSX A;  3L25 A;  1Z59 A;  1HQC A;  1L8Q A;  2W82 A;  3U6P A;  1EO9 B;  2Z4S A;  1H6U A;  3PCB A;  3PCH A;  4WHS A;  4QNM A;  2BOY A;  2CHQ A;  4M0D A;  1IN4 A;  3PCD M;  2QP9 X;  2CFO A;  2UUB M;  1JQJ C;  2DHY A;  3THG A;  4NSR A;  3UK6 A;  2ZTD A;  4JI2 M;  4QHT A;  3TH1 A;  2YFQ A;  1YE9 A;  2DI0 A;  3DOA A;  3RFW A;  1QDR A;  2Y0Q A;  3W68 A;  1AUA A;  4A3V B;  3I4V A;  4YHH M;  4G4N A;  2PCD M;  2RRU A;  4WHP A;  3HGI A;  1KSF X;  4FCT A;  2X8A A;  2G8L A;  4W5W A;  2CV1 A;  1R7R A;  2LTU A;  4JXJ A;  7CAT A;  2BV0 A;  1TDH A;  1CUK A;  1PM5 A;  1LV7 A;  3CGW A;  2BUR A;  1DLM A;  1XC8 A;  1FJG M;  1UFZ A;  4WHO B;  2QCU A;  3KVW A;  2EKF A;  2UXC M;  2C96 A;  2DAG A;  4MB7 A;  1MJG M;  4L6V 6;  1XNR M;  2X4A A;  4PD2 A;  1HR0 M;  3B7Z A;  3U61 B;  1IN6 A;  4X66 M;  4YY3 M;  2C5R A;  2BUY B;  1C1K A;  3LMX A;  3TL4 X;  4WHO D;  3U5Z B;  3GLF E;  2KEB A;  1LTM A;  3I51 A;  2LH0 A;  4F2L A;  2UU9 M;  2R44 A;  1DV0 A;  5DNY A;  1PGY A;  3E9S A;  3MHV C;  4ZPX A;  4WHR F;  4GIT A;  1DGH A;  3T1Y M;  3MI5 M;  3AL0 C;  1PJQ A;  4OX9 M;  4GHL A;  1VEJ A;  2MJ5 B;  4XGI A;  3Q8X A;  1N77 A;  4KOD A;  4LF8 M;  2EJS A;  2CV2 A;  3MV4 M;  4HEO A;  3D8B A;  2DZL A;  3MFL M;  2CHG A;  1BVS A;  3HU1 A;  5IT9 S;  3T63 A;  1TH2 A;  1D0M A;  1FNN A;  1Q39 A;  3LMM A;  4FCV A;  4M9S A;  4ILT A;  3PXG A;  3T38 A;  2WSC F;  2DZN B;  2MRO B;  1NVM A;  2R4E A;  2L6O A;  1F4I A;  4FWH A;  2LVP C;  5KQD A;  1YKK B;  4AG6 A;  4DV1 M;  4KHP M;  3I04 M;  2DEN A;  4NSO B;  3EIH A;  3K9P A;  1HQY E;  3PFI A;  2J7N A;  2V1C A;  4L15 A;  1T3T A;  1NV8 A;  2J5Y A;  3SHG B;  2VQE M;  4OVZ B;  1KFV A;  4QOS A;  4FW9 A;  3KS8 A;  4LGY A;  5EQT A;  3SMS A;  1GL6 A;  4L8R C;  3F92 A;  4QHS A;  1OKS A;  3HKP A;  2QSF X;  3HWS A;  2YR0 A;  2BWB A;  3E46 A;  3HY5 A;  1VDL A;  3GLI B;  3PCG M;  3CTW B;  2M5Z A;  3PCK M;  2VF8 A;  3GP1 A;  4DUY M;  2RKO A;  4G6Z A;  4EIW A;  1E94 E;  1EFU B;  4IBI A;  4K0K M;  1IN7 A;  1EOA B;  3OTO M;  3JAM S;  4L4U A;  3PVS A;  4RKU F;  2R18 A;  2Y21 A;  2LVA A;  3A42 A;  1R5L A;  5EXS A;  4I4L A;  1OAI A;  1TH4 A;  1ZQ9 A;  2FFJ A;  2K47 A;  2OOA A;  2FOI C;  4LJ7 A;  4B3S M;  4AKG A;  4B3R M;  2ERC A;  3JR4 A;  3PCL A;  1IXR C;  4DV3 M;  1J5E M;  2LVN C;  3FUV A;  4ITQ A;  4LJ8 A;  3VDU A;  1N33 M;  2BUQ B;  1VG5 A;  3J2P B;  3GPY A;  1QUT A;  3RE8 A;  4AW4 A;  1IN8 A;  2C9O A;  2MGW A;  1IBL M;  2F5O A;  3J7B A;  2J7O A;  3PCD A;  3A45 A;  2K6B A;  3GLF B;  2BUQ A;  2CEA A;  5A2Q S;  3T67 A;  1IN5 A;  1WGL A;  2KNZ A;  2LHG A;  2WZJ A;  2ZTC A;  5C18 A;  5GKN A;  4DV5 M;  1XXH A;  2YNM D;  4JI4 M;  2DZO B;  2KZS A;  3MK6 A;  4DV0 M;  3U60 B;  1GL7 A;  5EXX A;  2VII A;  3IHP A;  3GQ4 A;  1OIZ A;  3D8L A;  1SXJ D;  2WSE F;  1G4A E;  1JR3 A;  4M9X A;  3KP1 E;  1NSF A;  1EOA A;  1K3W A;  2D7H A;  1WHC A;  1TMX A;  2LVO C;  4D82 A;  4GC9 A;  4L16 A;  3TE6 A;  4JI7 M;  1T43 A;  1W5T A;  2D7G A;  1D2N A;  1Q02 A;  1T6O A;  2JXN A;  2H5X A;  1PJS A;  5FTJ A;  3WHL A;  5IWA M;  2V1U A;  3FE3 A;  1S3S A;  3U6D A;  2XZF A;  5DYI A;  3MFL A;  4KO8 A;  2K0B X;  4WUR A;  3TQS A;  5EP1 A;  1NJF A;  1YUB A;  2BUW A;  2KNA A;  1NHW C;  1N34 M;  1JR3 E;  1NJG A;  1Y8G A;  4X64 M;  3GPU A;  3SAU A;  4JI0 M;  3BBZ A;  5IZ7 D;  1OIP A;  2GQF A;  2HAK A;  2BUT A;  3TWK A;  4MH0 E;  3GO8 A;  2RGH A;  1WIV A;  2DWL A;  4XK8 F;  4DV2 M;  4DR6 M;  1I94 M;  3B7Q A;  3T63 M;  2VF7 A;  4LJA A;  2MR9 A;  4IBB A;  2G3Q A;  3NWL A;  5ITQ A;  1N32 M;  3LKT A;  3U6Q A;  1XMO M;  3SAT A;  3SMP A;  3GLH B;  4CHT B;  3FYD A;  3GPX A;  4FCW A;  2HCB A;  5BR8 M;  1YKP B;  4WW0 A;  4AKI A;  3AOG A;  2OO9 A;  2O01 F;  3EIE A;  3QYB A;  1L2B A;  1YKM A;  1EOB B;  4WP2 A;  3B74 A;  1G41 A;  2L2D A;  5E6J A;  3HJ8 A;  1K3X A;  2C99 A;  4GHA A;  1VEG A;  3T6P A;  5BPV A;  5KO3 A;  2HKJ A;  2LNH C;  1J09 A;  3K2L A;  3R9X B;  3PCC M;  4LJ4 A;  2ZAM A;  3BXW A;  4DR4 M;  1QAO A;  4FWG A;  3U6O A;  4TUW A;  2BUU A;  3LMX M;  3QWL A;  3A46 A;  3NBI A;  4GIP A;  3GQ5 A;  4LG2 A;  3FTC A;  1SG9 A;  2JA2 A;  5EP4 A;  3ZH9 B;  4WHR A;  3GRR A;  1HNW M;  3GRV A;  4CIS A;  4OVZ A;  4AG5 A; 
#chains in the Genus database with same CATH homology
 2C9C A;  3KSJ A;  4RF1 A;  2L7I A;  2R4J A;  3KXE C;  3PCI M;  4IBG A;  5KPT A;  4MM3 B;  3M0E A;  2QBY A;  3PCM M;  4D80 A;  4FVM A;  4QOZ C;  3GPP A;  2I7N A;  3U6M A;  4BBA A;  1Q3B A;  3H4M A;  1TDZ A;  1QAQ A;  2KRU A;  1YKM B;  2F5S A;  2RGO A;  3VKG A;  1VDD A;  1R6B X;  3B9P A;  2QBY B;  1XWI A;  1ZAE A;  3TPZ A;  4II7 A;  2XSU A;  1J7K A;  1N78 A;  2A5Y B;  1Z5B A;  3T15 A;  5FTK A;  2EA0 A;  3J81 S;  4GH9 A;  4WHP B;  4S12 A;  1YKN B;  4IJE A;  1Z5A A;  2UXD M;  3LVV A;  4ILV A;  1G3I A;  2ZAN A;  4LFA M;  4PDI A;  2BUT B;  2C98 A;  2I7P A;  3KOY E;  4R7G A;  5FTL A;  4DR7 M;  1EOC B;  2BUY A;  2BUZ B;  3U61 A;  3TWL A;  4LFC M;  4JI8 M;  1E32 A;  3O6J A;  3GRU A;  4I5S A;  4G4R A;  3PCH M;  1HT2 E;  2Y20 A;  3GLG B;  3HU2 A;  2M60 A;  3UJN A;  1GVN A;  1EE8 A;  2F4V M;  3FTF A;  4MGZ E;  1DGB A;  3MV6 M;  4DV7 M;  2XEP A;  2UUC M;  4AQY M;  4I81 A;  2Y0T A;  1NY6 A;  1DGG A;  2F5Q A;  2FNA A;  2ZAO A;  1XMQ M;  2BUM A;  1TGU A;  2NQ8 C;  1Q3C A;  4IBE A;  1DGF A;  4B3M M;  1YKK A;  5E26 A;  3L26 A;  1QQW A;  4AI6 A;  2OQ4 A;  4IBK A;  1YKN A;  4Z8X A;  5EJC A;  4QNR A;  4G4O A;  2H1R A;  3MI1 A;  2L09 A;  2DWZ B;  4NXM M;  3FUX A;  2HHH M;  2Q2E B;  1IBM M;  1IQP A;  4LJ9 A;  4JYA M;  1IM2 A;  4B7H A;  2YQZ A;  1DO2 A;  1L2C A;  4GKK M;  2E5L M;  3MI5 A;  2P5T A;  3JR5 A;  5FSW A;  5ITT A;  3SYK A;  4KLN A;  2PCD A;  3KFU G;  4G4Q A;  4LRS A;  3PCN A;  4WHS B;  2KW0 A;  2XSZ D;  4NRW A;  1YKO A;  5EXT A;  4D81 A;  3PCE M;  4IIW A;  4GKJ M;  1OFI A;  1IY2 A;  4M9Z A;  3J80 S;  3TWM A;  4LF4 M;  3L2A A;  4WHS D;  3PCF A;  3QAU A;  4RNA A;  3AOE A;  1N36 M;  5FTN A;  1NNU C;  5FLX S;  3HJQ A;  2BUM B;  3HHY A;  4OU7 A;  2XFT A;  1DLQ A;  2EUC A;  4IBJ A;  3U6E A;  3FTD A;  4X65 M;  1HNZ M;  2BUX A;  3FUU A;  2LWX A;  1QAN A;  3AKZ A;  2BJW A;  4LJ5 A;  4JI5 M;  2AZQ A;  4B08 A;  4LF6 M;  1R2Y A;  1X37 A;  4WHR B;  3GLG A;  2BNK A;  1DMH A;  3I4Y A;  2CUZ A;  4CGY B;  3CF0 A;  1E9R A;  1HT1 E;  4M0W A;  1EO2 A;  1EOC A;  2DXI A;  4RF0 A;  4MGK E;  3UZU A;  3ZCB B;  3FD9 A;  5LMN M;  3U6S A;  1YKL B;  3FKE A;  3LVW A;  5FTM A;  3VK8 A;  3KS4 A;  1EO2 B;  4NXN M;  3U6L A;  2QEN A;  2F5N A;  3LXV M;  1IXZ A;  2UXB M;  3O5U A;  3KOX E;  3GQ3 A;  4PT5 A;  3CF6 E;  4IBD A;  3E4R A;  3HHZ A;  1I4W A;  3GLH A;  3AJI B;  1MX0 A;  4WHQ B;  3SAS A;  2BUV A;  3KDS E;  1G59 A;  3SAV A;  3LKT M;  4B7G A;  5F3W A;  3L29 A;  4PDG A;  3VFD A;  3ILK A;  2BUZ A;  2QPA A;  2KZU A;  4DV6 M;  3T67 M;  2BJV A;  2R65 A;  3KP0 E;  4JI6 M;  1R2Z A;  4WHO A;  2AHM A;  1SXJ B;  3DFZ A;  1NHG C;  3T1H M;  3SBJ A;  4HL4 A;  1PJI A;  1YKO B;  4JV5 M;  5JI3 E;  4NRV A;  4B3T M;  2ZBK B;  3R8F A;  1XXH B;  1NNJ A;  2KA6 B;  4AZF A;  4REZ A;  3GRY A;  3J27 B;  4NOO B;  1K82 A;  4LF9 M;  1S9A A;  3LQR A;  2EO2 A;  1SXJ E;  3KW6 A;  4LGM A;  1QZM A;  2KRK A;  4LZJ A;  2BUX B;  2V6Z M;  3PCA A;  3FTE A;  3IG5 A;  2CE7 A;  2VQF M;  1KYI A;  3SFZ A;  1OJL A;  8CAT A;  3PCI A;  3PCM A;  4OW0 A;  2LXE A;  3L28 A;  1DLT A;  3ZC7 B;  2OPF A;  3FYC A;  4LJ6 A;  3GLF A;  1HNX M;  3K1J A;  1PJJ A;  4MGY E;  2QZ4 A;  2XSR A;  3KOW E;  1SXJ A;  3U5Z A;  3LQQ A;  2R62 A;  1E9S A;  2R45 A;  2O5R A;  3C58 A;  2L7H A;  4DUZ M;  3VK7 A;  3PCJ M;  3HJS A;  3SHF A;  3HHW A;  1UM8 A;  3PCL M;  3PCJ A;  2XZU A;  1IY0 A;  5JI2 E;  2Z4R A;  3AFH A;  3IG8 A;  3RGP A;  4NL4 H;  4BLC A;  2X49 A;  2HL7 A;  3VKH A;  2XSZ A;  2BUV B;  2XLJ A;  1EO9 A;  3LXV A;  3SAW A;  5DYG A;  1SXJ C;  5TD3 A;  2G5G X;  3L27 A;  2DWM A;  3DA1 A;  4DR5 M;  3W0F A;  3PCG A;  4P16 A;  4BB9 A;  1EOB A;  5C1B A;  3M7G A;  1L1T A;  4JI3 M;  4LCB A;  3M6A A;  3FUW A;  3PCF M;  3U6C A;  1ORY B;  4DR1 M;  4LF5 M;  1XNQ M;  3AOE C;  4Z6Y A;  3O6R A;  2FE8 A;  3PCE A;  3VDP A;  1TH3 A;  3BOS A;  4LRT A;  5IRE B;  2KXE A;  1QYR A;  2XH9 A;  3FUT A;  1OFH A;  5KPR A;  3N9T A;  1MU5 A;  2XFS A;  1QVR A;  2XF3 A;  3SAR A;  1L1Z A;  4MGH A;  1DGH B;  1Z6T A;  4GMQ A;  5ITX E;  1N75 A;  5ITU A;  2CHV A;  4FWD A;  4R3D A;  3K8Z A;  4JN6 A;  4LFB M;  3PCC A;  4WHQ A;  3SC3 A;  4IBF A;  5LMU M;  3O32 A;  2Z7J A;  3PCN M;  3HU3 A;  4B7F A;  1G8P A;  4MGI E;  5ITY A;  1W5S A;  2DVW B;  3A98 B;  2DHR A;  2CV0 A;  3PCA M;  1NY5 A;  5ITR A;  4X62 M;  3PNV A;  3WHK A;  1YSY A;  5ITX A;  2F5P A;  3W0L B;  3AV0 A;  3KOZ E;  3MI1 M;  1QAM A;  3U60 A;  3PCB M;  4LZZ A;  3UGJ A;  1WXQ A;  4AKH A;  1GKI A;  3PNY A;  5EP3 A;  1IY1 A;  1JR3 D;  4LF7 M;  4PCZ A;  4L78 A;  5KQ8 A;  3SYL A;  3K92 A;  2UUA M;  4I8O A;  1IBK M;  4IBC A;  5H37 D;  1L2D A;  4HLQ A;  4IJF A;  3PCK A;  3VLF B;  3MV6 A;  1Z5C A;  2D7E A;  2BUW B;  2ZM6 M;  3J7A S;  2BUR B;  3MV4 A;  1GLN A;  3CF2 A;  4XBO A;  4JI1 M;  1IXS B;  3HHX A;  4GRI A;  2BUU B;  1DO0 A;  2BV0 B;  4FD2 A;  4DR3 M;  4LY6 A;  5EP2 A;  5EXP A;  3UMM A;  4WHP D;  4DR2 M;  2R46 A;  5KPZ A;  3GLI A;  2XSV A;  2Z3X A;  3MJ5 A;  1YKL A;  4DV4 M;  2XGN A;  4GC5 A;  1XHB A;  3DZD A;  3RGS A;  2DWN A;  1YKP A;  3KSX A;  3L25 A;  1Z59 A;  1HQC A;  1L8Q A;  2W82 A;  3U6P A;  1EO9 B;  2Z4S A;  1H6U A;  3PCB A;  3PCH A;  4WHS A;  4QNM A;  2BOY A;  2CHQ A;  4M0D A;  1IN4 A;  3PCD M;  2QP9 X;  2CFO A;  2UUB M;  1JQJ C;  3THG A;  4NSR A;  3UK6 A;  4JI2 M;  4QHT A;  3TH1 A;  2YFQ A;  1YE9 A;  3DOA A;  3RFW A;  2Y0Q A;  4A3V B;  3I4V A;  4YHH M;  4G4N A;  2PCD M;  4WHP A;  3HGI A;  1KSF X;  4FCT A;  2X8A A;  2G8L A;  4W5W A;  2CV1 A;  1R7R A;  4JXJ A;  7CAT A;  2BV0 A;  1TDH A;  1PM5 A;  2BUR A;  1LV7 A;  1DLM A;  1XC8 A;  1FJG M;  4WHO B;  2QCU A;  3KVW A;  2UXC M;  2C96 A;  4MB7 A;  1XNR M;  2X4A A;  4PD2 A;  1HR0 M;  3U61 B;  1IN6 A;  4X66 M;  4YY3 M;  2C5R A;  2BUY B;  1C1K A;  3LMX A;  3TL4 X;  4WHO D;  3U5Z B;  2KEB A;  3I51 A;  2LH0 A;  2UU9 M;  5DNY A;  3E9S A;  3MHV C;  4ZPX A;  4WHR F;  4GIT A;  1DGH A;  3T1Y M;  3MI5 M;  3AL0 C;  4OX9 M;  4GHL A;  1N77 A;  4XGI A;  3Q8X A;  4KOD A;  4LF8 M;  2CV2 A;  3MV4 M;  3D8B A;  3MFL M;  2CHG A;  3HU1 A;  5IT9 S;  3T63 A;  1TH2 A;  1FNN A;  3LMM A;  1Q39 A;  4FCV A;  4M9S A;  4ILT A;  3PXG A;  3T38 A;  2DZN B;  1NVM A;  2R4E A;  2L6O A;  1YKK B;  4FWH A;  5KQD A;  4AG6 A;  4DV1 M;  4KHP M;  4NSO B;  3EIH A;  1HQY E;  3PFI A;  2J7N A;  2V1C A;  4L15 A;  1T3T A;  3SHG B;  2VQE M;  4OVZ B;  1KFV A;  4QOS A;  4FW9 A;  3KS8 A;  4LGY A;  5EQT A;  3SMS A;  1GL6 A;  4L8R C;  4QHS A;  3HKP A;  3HWS A;  2YR0 A;  3GLI B;  3PCG M;  3CTW B;  2M5Z A;  3PCK M;  3GP1 A;  4DUY M;  2RKO A;  4G6Z A;  4EIW A;  1E94 E;  4IBI A;  4K0K M;  1IN7 A;  1EOA B;  3OTO M;  3JAM S;  4L4U A;  3PVS A;  2R18 A;  2Y21 A;  3A42 A;  5EXS A;  4I4L A;  1ZQ9 A;  1TH4 A;  2FFJ A;  4LJ7 A;  2K47 A;  4AKG A;  2FOI C;  4B3S M;  4B3R M;  2ERC A;  3JR4 A;  3PCL A;  1IXR C;  4DV3 M;  1J5E M;  4ITQ A;  3FUV A;  4LJ8 A;  3VDU A;  1N33 M;  2BUQ B;  3J2P B;  3GPY A;  4AW4 A;  3RE8 A;  1IN8 A;  2C9O A;  1IBL M;  2F5O A;  3PCD A;  3J7B A;  2J7O A;  3A45 A;  3GLF B;  2BUQ A;  2CEA A;  5A2Q S;  3T67 A;  1IN5 A;  5C18 A;  4DV5 M;  5GKN A;  4JI4 M;  1XXH A;  2YNM D;  2DZO B;  2KZS A;  3MK6 A;  4DV0 M;  3U60 B;  1GL7 A;  5EXX A;  2VII A;  3GQ4 A;  3D8L A;  1SXJ D;  1G4A E;  1JR3 A;  4M9X A;  3KP1 E;  1NSF A;  1EOA A;  1K3W A;  2D7H A;  1TMX A;  4D82 A;  4GC9 A;  4L16 A;  3TE6 A;  4JI7 M;  1W5T A;  2D7G A;  1D2N A;  3WHL A;  5FTJ A;  5IWA M;  2V1U A;  1S3S A;  3U6D A;  2XZF A;  5DYI A;  3MFL A;  4KO8 A;  3TQS A;  4WUR A;  2BUW A;  5EP1 A;  1NJF A;  1YUB A;  1NHW C;  1N34 M;  1NJG A;  4X64 M;  3GPU A;  3SAU A;  4JI0 M;  5IZ7 D;  2BUT A;  3TWK A;  4MH0 E;  3GO8 A;  2RGH A;  2DWL A;  4DR6 M;  4DV2 M;  1I94 M;  3T63 M;  4LJA A;  4IBB A;  3NWL A;  5ITQ A;  1N32 M;  3LKT A;  3U6Q A;  1XMO M;  3SAT A;  3SMP A;  3GLH B;  4CHT B;  3FYD A;  3GPX A;  4FCW A;  2HCB A;  5BR8 M;  1YKP B;  4WW0 A;  4AKI A;  3AOG A;  3EIE A;  1L2B A;  1YKM A;  1EOB B;  1G41 A;  5E6J A;  3HJ8 A;  1K3X A;  2C99 A;  4GHA A;  5KO3 A;  5BPV A;  2HKJ A;  2LNH C;  1J09 A;  3K2L A;  3R9X B;  3PCC M;  4LJ4 A;  2ZAM A;  4DR4 M;  4FWG A;  1QAO A;  3U6O A;  4TUW A;  2BUU A;  3LMX M;  3QWL A;  3A46 A;  3NBI A;  4GIP A;  3GQ5 A;  4LG2 A;  3FTC A;  2JA2 A;  5EP4 A;  4WHR A;  3ZH9 B;  3GRR A;  1HNW M;  3GRV A;  4CIS A;  4OVZ A;  4AG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...