2UXDM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 20
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxdM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxdM02
1K82A 4NXMM 2UXDM 4JI1M 3U6PA 4GKJM 2ZM6M 1HNXM 4JI7M 1XMOM 2UUBM 1IBLM 4YY3M 2OPFA 4LF4M 5ITXA 2F4VM 1IBKM 4DV6M 4PD2A 4DV2M 2HHHM 4DV1M 2F5PA 5A2QS 2F5SA 2Q2EB 4DUYM 3U6MA 5LMNM 4DR3M 3GPXA 3U6OA 1HNZM 1N33M 5IT9S 4JYAM 4B3TM 4G4RA 1Q3BA 4G4OA 4PCZA 4JI5M 4DR1M 4LF5M 3A45A 3SAWA 3U6EA 3SATA 4X66M 4B3RM 1MX0A 4LFBM 3JAMS 5ITTA 1Q3CA 1PM5A 4X62M 1R2YA 3GPPA 3JR4A 2HKJA 4PDIA 4NRWA 4DR4M 2XZFA 1Z5AA 4PDGA 3U6QA 3OTOM 1HR0M 1L2BA 4NRVA 1TDZA 4CISA 5IWAM 5BR8M 4YHHM 3U6SA 4LF9M 2ZBKB 3U6DA 3A42A 4ITQA 2VQEM 4LF8M 1EE8A 3SASA 1I94M 4KHPM 1L1TA 2F5NA 3DOAA 3T1HM 2UXCM 4JI3M 3J81S 1N32M 4LFCM 4LF6M 3GP1A 3A46A 4LF7M 4DV4M 1L1ZA 5ITUA 2VQFM 3GQ3A 3U6LA 3JR5A 1KFVA 4DR6M 4DR7M 4JI8M 4K0KM 4JI0M 4DV0M 1PJIA 2UUAM 4DV7M 4B3SM 4NXNM 1TDHA 4G4NA 1Q39A 3TWLA 1IBMM 4JI4M 4X65M 1L2DA 3J7AS 4DV5M 3T1YM 4X64M 1FJGM 3VK7A 2F5OA 4JI2M 1XNQM 2EA0A 4DUZM 4LFAM 3SBJA 1HNWM 1Z5CA 4JI6M 1MU5A 5ITYA 3W0FA 4AQYM 3SAUA 3GPUA 1Z5BA 1K3WA 2UU9M 4OX9M 4DR5M 4DV3M 3SAVA 2OQ4A 2XZUA 3C58A 5LMUM 4MB7A 5ITQA 3U6CA 1PJJA 3GPYA 1XC8A 1NNJA 4JV5M 1J5EM 5ITRA 1N34M 1R2ZA 1N36M 4DR2M 1XMQM 2E5LM 4B3MM 3GO8A 3SARA 3J80S 3TWKA 2UXBM 3TWMA 3GQ5A 3GQ4A 4GKKM 5FLXS 4G4QA 3VK8A 1K3XA 1L2CA 2F5QA 1XNRM 2UUCM 5ITXE 1Z59A
chains in the Genus database with same CATH superfamily
1R4GA 2M5ZA 1N75A 3J2PB 3KOWE 1GL6A 2HCBA 1X37A 1SXJC 4JI1M 2UXDM 5EXPA 2L4FA 1J09A 2R6FA 2ZM6M 2VF7A 1GLNA 2XGNA 5KQ8A 1XMOM 1E9SA 2RGHA 4XK8F 3E4RA 1IBLM 2UUBM 3L28A 5EP3A 4LJ7A 1VEJA 2VDBB 2KNVA 1R7RA 3D8LA 2KHHA 5A2QS 4L8RC 4FD2A 2F5SA 3UGJA 3U6MA 4GC9A 1ZV1A 4MGYE 4B7FA 4LZZA 4OVZA 5IT9S 4IBFA 3L29A 4B3TM 1SXJA 3FTDA 1GL7A 1Q3BA 1R6BX 1PGYA 1ZAEA 1H6UA 2QZ4A 2A5YB 2ZAOA 4G3OA 1IN7A 4I8OA 1MX0A 4NSRA 1SXJB 3I51A 2Z4SA 1P3QQ 1Q3CA 3E21A 2ZAMA 1OIZA 2QNJA 3GPPA 3HU3A 2Z3XA 3B74A 3U6QA 1OIPA 1HR0M 4NRVA 5GKNA 3W67A 3HHXA 4DBGB 1NV9A 3UZUA 5BR8M 2KW0A 3AOEA 2XSZD 1QAMA 2DI0A 4IJFA 4LJ6A 3A42A 5L8RF 1YE9A 2EKFA 2CP8A 2MH8A 1ZMVA 4NL4H 2QENA 3FYDA 2VQEM 4I4LA 1VDDA 1YSYA 4XGIA 1FNNA 1OAOC 2XSZA 1I94M 3FKEA 4QNMA 1WGLA 3KOYE 2VIIA 4IIWA 4ZPXA 2F5NA 4D81A 1V33A 2L7HA 3UJNA 3J81S 2MGWA 2Y0QA 1AIPC 3GP1A 3BXWA 1MN3A 1XXHE 2APLA 2JY8A 2C9CA 3DZDA 1DO2A 4KO8A 4MGIE 4QHTA 5E6JA 3WHLA 4FWDA 5KPRA 2VQFM 1E94E 1LV7A 2YQZA 1NV8A 2KNAA 4FW9A 1E9RA 3SHFA 4DV0M 3LVVA 1MJGM 1V92A 4IJEA 4MM3B 3LCUA 3T38A 3MMPA 2R0IA 4A3VB 1Q39A 2KZUA 1IBMM 4JI4M 1WIVA 1DGFA 2KRUA 2QP9X 3M6AA 2MJ5B 3ZH9B 4II7A 4LJAA 3GLFB 4TUWA 4ANRA 5FTLA 1GO5A 4GMQA 1QQWA 2L4EA 1G3IA 1IXZA 1G8PA 3GLGE 3ZQJA 1HQCA 4MGKE 4CIZA 4DUZM 4BB9A 2DZOB 5KQDA 4JI6M 1MU5A 1TTEA 3W0FA 4NSOB 1NVMA 3VLFB 4CGYB 3VDPA 1K3WA 2DZLA 1GABA 1IQPA 2J7OA 1G59A 2FNAA 3AOEC 3SAVA 1OFIA 2V1CA 1UFZA 3VDUA 3CF6E 3GPYA 3HHWA 1J5EM 5FTKA 1VG5A 1Z6TA 2CHQA 2CV2A 1NO1A 1QVRA 3A98B 4DR2M 2E5LM 3SARA 3HWSA 3H4JA 5EP4A 3V76A 3TWMA 3SMSA 3GQ4A 1NY6A 1TH4A 3AV0A 4GKKM 1K3XA 1OQYA 4QOZC 2YR0A 4L78A 3PNYA 5ITXE 1Z59A 2UUCM 2CFOA 4B3RM 3GLGB 1QANA 2DAMA 3PFIA 4Q7JA 4FCTA 4NXMM 4HLQA 2DWMA 4GIPA 4OU7A 3GLFE 2LHCA 5DYGA 2CRUA 1IY0A 1HNXM 4JI7M 3J27B 3HJQA 2R4EA 1NJGA 3SFZA 1XWIA 2OPFA 4LF4M 2C99A 5DNYA 4DV6M 1KSFX 1XHBA 1VEKA 4PD2A 2HHHM 4M9ZA 2LXEA 2CV0A 2LNHC 4DUYM 1HNZM 5LMNM 2QSFX 1N33M 4RNAA 2O5RA 4M0WA 2R65A 4P17A 2CEAA 3SC3A 2X4AA 3IG5A 2RRUA 2X8AA 2O01F 2H5XA 4LRTA 1YUBA 2MR9A 2CV1A 2CHGA 2JP7A 4PT5A 4PCZA 4DR1M 4LF5M 5DFLA 3SATA 1ORYB 2JZ0A 7CATA 1HJPA 1IXSA 2GQFA 2C5RA 3CF0A 3QAUA 3B9PA 4LGMA 2BJWA 4AKGA 1PM5A 1IM2A 4X62M 3KXEC 2DZNB 2KXEA 1JR3D 1Q02A 2HKJA 4IBJA 4DR4M 2XZFA 1Z5AA 3C3DA 3FD9A 2D7GA 4R71A 2HAKA 3FRIA 1WXQA 5IWAM 4FCVA 4JN6A 1R5LA 4P16A 2H1RA 3KSXA 3SYKA 2DWLA 2I7NA 1HT2E 2D7EA 2LVAA 2WZJA 3TPZA 3LVWA 1GJTA 3SASA 5KO3A 2C9OA 4HEOA 3NWLA 4KHPM 4L16A 3T1HM 4JI3M 1N32M 3KFUG 4LF6M 1HT1E 3FE3A 3RGPA 4LJ8A 4IBDA 3F92A 3U61A 1OAIA 2G5GX 2OOAA 3KP0E 3KVWA 4S12A 4DR6M 4DR7M 1WGNA 2AHMA 1VEGA 2BNKA 3I4YA 3VKHA 4IBIA 3LMMA 3TL4X 5JI3E 2UUAM 3CGWA 4CHTB 1PJIA 4DV7M 1ZQ9A 2XFTA 4F1IA 3TWLA 3LCVB 4X65M 4LCBA 3A46A 1L2DA 1N77A 3J7AS 4AG5A 1J7KA 1XXHA 3PVSA 4FCWA 2BJVA 3KOXE 4GITA 4F2LA 3WHKA 1FJGM 4JI2M 3FUUA 2NQ8C 3RE8A 1W5TA 2YNMD 1Y8GA 2JWSA 3GRUA 4LFAM 3SBJA 2N35A 2QCUA 3K9OA 5ITYA 3SAUA 4L4UA 2UU9M 1ZMUA 8CATA 2QBYA 1QZMA 3IG8A 5FSWA 2R4JA 2ZTDA 4M0DA 3U5ZA 2LH0A 4GH9A 3FUXA 5LMUM 5ITQA 4QNRA 1NJFA 5C18A 3HKPA 3U6CA 4FWGA 1WHCA 1VDLA 3GLGA 1SXJD 2JY6B 4GHAA 1N78A 3L27A 1N36M 2V1UA 1C1KA 3Q8GA 2L09A 3K92A 5H37D 3I01M 3RGSA 5EQTA 3W0LB 4LY6A 5FLXS 1W5SA 1IN4A 3Q8XA 2CUZA 3CF2A 1K82A 1V34A 5EP2A 2Y21A 2YFQA 3GRVA 3U6PA 2KA6B 2R46A 1JR3E 1TR8A 3HHZA 5IZ7D 2HL7A 5FTJA 2KDLA 3IHPA 4R3DA 2JZ1A 2OO9A 4LRSA 3FTFA 5BPVA 2CWBA 1IBKM 1SXJE 5E26A 3E9SA 4DV2M 4DV1M 5IREB 1IXSB 2D7HA 3T6PA 2Q2EB 2QBYB 3J7BA 1NY5A 4DR3M 4LJ9A 2J7NA 2XEPA 3AJIB 4B08A 3FUVA 4EIWA 3BBZA 3GLFA 4LJ5A 3E46A 3K9PA 3ZC7B 3KDSE 4G4RA 4G4OA 3GLIA 1NNUC 3C9PA 1OKSA 3AOGA 5EXTA 3VFDA 3SAWA 2KZSA 3EIEA 3SYLA 3T15A 2DWZB 3MJ5A 2GNOA 4BBAA 2C96A 3JAMS 5ITTA 4AI6A 4OVZB 2BWBA 3FRHA 4Z6YA 1PJTA 2M60A 4PDIA 2V6ZM 2DAKA 3HGIA 2DXIA 3L26A 4B7HA 2MROB 4R7GA 2EUCA 3M7GA 1TDZA 1E32A 3AFHA 3LQQA 2DNAA 4OW0A 1SG9A 2LTUA 4BLCA 2CHVA 4LF9M 2BWEA 2HWJA 4NC6A 3HJSA 2L2DA 3U6DA 3R8FA 4ITQA 3VKGA 3H4MA 2XH9A 4LGYA 2R44A 1UM8A 4LF8M 1KYIA 4CJ6A 3U60A 2Z8YM 4M9XA 5F3WA 4W5WA 1T3TA 3M0EA 2R45A 2W82A 2WSEF 4QHSA 4LF7M 1L1ZA 1CUKA 2L6OA 3FUWA 1NSFA 3U6LA 1DO0A 3KS4A 1NHGC 1PRBA 3DA1A 3K8ZA 4I81A 4K0KM 4AKIA 2LVPC 2DHYA 3GLIE 1D0MA 2FH0A 4IBGA 1G4AE 4AZFA 1DV0A 4D82A 1D0LA 1TDHA 4G4NA 1RU3A 2FOIC 5EXXA 3GLIB 4LG2A 2J5YA 5FTNA 2X49A 5EJCA 4DV5M 3EIHA 3T1YM 1DGHA 2FFJA 1QUTA 2RGOA 3SHGB 3TE6A 2F5OA 2I7PA 3LQRA 4L15A 1XNQM 1PJSA 2EA0A 1GJSA 1D2NA 1HNWM 1Z5CA 2EJSA 3B7NA 3GPUA 1Z5BA 1VQ1A 2LVNC 3I04M 4GRIA 1QZEA 2XF3A 1DGGA 1IFYA 1XB2B 1TGUA 2XZUA 4L6V6 1WR1B 2JUJA 3D8BA 3K1JA 3C58A 1C7YA 4MB7A 1AUAA 4JV5M 1QUSA 4UN2B 3FTEA 5ITRA 4WP2A 1XMQM 1OFHA 4KODA 3TWKA 3HY5A 1IN5A 4G4QA 3VK8A 4IBEA 3CTWB 1A5TA 1XNRM 3B7ZA 3MHVC 3QYBA 4MGHA 3K2LA 2VF8A 1IN8A 3HJ8A 3R9XB 1HQYE 2ZANA 4GKJM 4FWHA 1OTRA 1IY1A 2EKKA 2JY7A 2K9DA 4GC5A 4WURA 4YY3M 2DENA 1QYRA 2F4VM 5ITXA 1OJLA 1LTMA 3QYEA 2F5PA 2R18A 2G8LA 4IBKA 2CE7A 2LHGA 3NBIA 3U6OA 1BVSA 3UK6A 3GPXA 2DAIA 1WJ7A 1JR3A 2QPAA 1T6OA 2FE8A 4REZA 1XXHB 4JYAM 4B7GA 2KEBA 3PNVA 4RF0A 1EFUB 4JI5M 4HL4A 2G3QA 3A45A 4MH0E 2RKOA 4AKHA 1L8QA 3U6EA 4X66M 5EP1A 4LJ4A 1F4IA 4LFBM 1G71A 2QQ8A 3AL0C 1QDRA 3C3EA 5FTMA 4IBCA 1R2YA 2P5TA 2XFSA 2KRKA 2KNZA 2QHOB 3B89A 4KT0F 2XLJA 3JR4A 3U61B 4NRWA 1DGBA 3L2AA 2JXNA 1JB0F 4PDGA 5KPTA 4FVMA 3OTOM 1L2BA 4GEWA 3GLHB 3THGA 3B7QA 4JXJA 4CISA 2LVQD 1YLAA 1T43A 4YHHM 3U6SA 1I4WA 2ZBKB 3KW6A 3FTCA 3NBXX 3GRYA 1TH2A 1G41A 2ZTCA 1EE8A 4MGZE 3DFZA 3HU2A 2DHRA 1QAOA 1L1TA 3DOAA 3I4VA 2UXCM 2EO2A 3HU1A 3GLHA 4LFCM 4G6ZA 3U60B 4AG6A 3U5ZB 4DV4M 2Z4RA 4QOSA 4Y28F 4RKUF 5KPZA 5ITUA 2R62A 3HHYA 3LW5F 3GQ3A 4M9SA 2DAGA 3JR5A 1PJQA 3IECA 3KP1E 4KLNA 3TQSA 2DKLA 1KFVA 1EIJA 1TH3A 3FUTA 4JI8M 3L25A 4JI0M 2JA2A 2LVOC 5C1BA 4D80A 4B3SM 4NXNM 3BOSA 3KS8A 2Y20A 1GVNA 2K47A 3W68A 1IY2A 3HZJA 5DYIA 2DWNA 1TF0B 2WSCF 4X64M 3ZCBB 1IN6A 3VK7A 2DVWB 1NHWC 1ZMWA 4Z8XA 4NOOB 3AKZA 3SMPA 1GKIA 2K6BA 2ERCA 2JNHA 2Z7JA 4AQYM 4AW4A 5EXSA 1DGHB 1D0KA 3GRRA 2Y0TA 3FYCA 2K0BX 3KOZE 4OX9M 4DR5M 4DV3M 2DAEA 1JQJC 3HX3A 2OQ4A 4RF1A 1QDTA 1PJJA 4LZJA 4I5SA 4XBOA 2LWXA 2OOBA 1XC8A 2L7IA 3ILKA 1NNJA 4WW0A 2WSFF 3QWLA 3MK6A 4GHLA 2O25A 3UMMA 3GLHE 1R2ZA 1N34M 4B3MM 4IBBA 1QAQA 3GO8A 1IXRC 1S3SA 3J80S 2UXBM 3PXGA 2FS1A 3GQ5A 5JI2E 2B3TA 2LBCA 3RFWA 1L2CA 2F5QA 3KSJA 2JY5A 2C98A
chains in the Genus database with same CATH topology
2M5ZA 1N75A 3J2PB 3KOWE 1GL6A 2HCBA 1X37A 1SXJC 4JI1M 2UXDM 5EXPA 1J09A 2ZM6M 1GLNA 2XGNA 5KQ8A 1XMOM 1E9SA 2RGHA 2UUBM 3E4RA 1IBLM 3L28A 5EP3A 4LJ7A 1R7RA 3D8LA 5A2QS 4L8RC 4FD2A 2F5SA 3UGJA 3U6MA 4GC9A 4MGYE 4B7FA 4LZZA 4OVZA 5IT9S 4IBFA 3L29A 4B3TM 1SXJA 3FTDA 1GL7A 1Q3BA 1R6BX 1ZAEA 2QZ4A 1H6UA 2A5YB 2ZAOA 4I8OA 1IN7A 1MX0A 4NSRA 1SXJB 3I51A 2Z4SA 1Q3CA 2ZAMA 3GPPA 3HU3A 2Z3XA 3U6QA 1HR0M 4NRVA 5GKNA 3HHXA 3UZUA 5BR8M 2KW0A 3AOEA 2XSZD 1QAMA 4IJFA 4LJ6A 3UMMA 3A42A 1YE9A 4NL4H 2QENA 3FYDA 2VQEM 4I4LA 1VDDA 1YSYA 4XGIA 1FNNA 2XSZA 1I94M 3FKEA 4QNMA 3KOYE 2VIIA 4IIWA 4ZPXA 2F5NA 4D81A 2L7HA 3UJNA 3J81S 2Y0QA 3GP1A 3A46A 3WHLA 3DZDA 2C9CA 4KO8A 1DO2A 4QHTA 4MGIE 5E6JA 4FWDA 5KPRA 2VQFM 1E94E 1LV7A 2YQZA 4FW9A 1E9RA 3SHFA 4DV0M 3LVVA 4IJEA 4MM3B 3T38A 4A3VB 1Q39A 2KZUA 1IBMM 4JI4M 2KRUA 1DGFA 2QP9X 3M6AA 3ZH9B 4II7A 4LJAA 3GLFB 4TUWA 5FTLA 4GMQA 1QQWA 1G3IA 1IXZA 1G8PA 1HQCA 4MGKE 4DUZM 4BB9A 2DZOB 5KQDA 4JI6M 1MU5A 3W0FA 4NSOB 1NVMA 3VLFB 4CGYB 3VDPA 1K3WA 1IQPA 2J7OA 1G59A 2FNAA 3AOEC 3SAVA 1OFIA 2V1CA 3VDUA 3CF6E 3GPYA 3HHWA 1J5EM 5FTKA 1Z6TA 2CHQA 2CV2A 1QVRA 3A98B 4DR2M 2E5LM 3SARA 3HWSA 5EP4A 3TWMA 3SMSA 3GQ4A 1NY6A 1TH4A 3AV0A 4GKKM 1K3XA 4QOZC 2YR0A 4L78A 3PNYA 5ITXE 1Z59A 2UUCM 2CFOA 4B3RM 3GLGB 1QANA 3PFIA 4NXMM 4FCTA 4HLQA 2DWMA 4GIPA 4OU7A 5DYGA 1IY0A 1HNXM 4JI7M 3J27B 3HJQA 2R4EA 1NJGA 3SFZA 1XWIA 2OPFA 4LF4M 2C99A 5DNYA 4DV6M 1KSFX 1XHBA 4PD2A 2HHHM 4M9ZA 2LXEA 2CV0A 2LNHC 4DUYM 1HNZM 5LMNM 1N33M 4RNAA 2O5RA 4M0WA 2R65A 2CEAA 3SC3A 2X4AA 3IG5A 2X8AA 2CV1A 4LRTA 1YUBA 2CHGA 4PCZA 4PT5A 4DR1M 4LF5M 3SATA 1ORYB 7CATA 2C5RA 3CF0A 3QAUA 3B9PA 4LGMA 2BJWA 4AKGA 1PM5A 1IM2A 4X62M 3KXEC 2DZNB 2KXEA 1JR3D 2HKJA 4IBJA 4DR4M 2XZFA 1Z5AA 3FD9A 2D7GA 1WXQA 5IWAM 4FCVA 4JN6A 4P16A 2H1RA 3KSXA 3SYKA 2DWLA 2I7NA 1HT2E 2D7EA 3TPZA 3LVWA 3SASA 5KO3A 2C9OA 3NWLA 4KHPM 4L16A 3T1HM 4JI3M 1N32M 3KFUG 4LF6M 1HT1E 3RGPA 4LJ8A 4IBDA 3U61A 2G5GX 4S12A 3KP0E 3KVWA 4DR6M 4DR7M 3VKHA 2AHMA 2BNKA 3I4YA 4IBIA 3LMMA 3TL4X 5JI3E 2UUAM 4CHTB 1PJIA 4DV7M 1ZQ9A 2XFTA 3TWLA 4X65M 4LCBA 1L2DA 1N77A 3J7AS 4AG5A 1J7KA 1XXHA 3PVSA 4FCWA 2BJVA 3KOXE 4GITA 3WHKA 1FJGM 4JI2M 3FUUA 2NQ8C 3RE8A 1W5TA 2YNMD 3GRUA 4LFAM 3SBJA 2QCUA 5ITYA 3SAUA 4L4UA 2UU9M 8CATA 2QBYA 1QZMA 3IG8A 5FSWA 2R4JA 4M0DA 3U5ZA 2LH0A 4GH9A 3FUXA 5LMUM 5ITQA 4QNRA 1NJFA 5C18A 3HKPA 3U6CA 4FWGA 3GLGA 1SXJD 4GHAA 1N78A 3L27A 1N36M 2V1UA 1C1KA 2L09A 3K92A 5H37D 3RGSA 5EQTA 3W0LB 4LY6A 5FLXS 1W5SA 1IN4A 3Q8XA 2CUZA 3CF2A 1K82A 5EP2A 2Y21A 2YFQA 3GRVA 3U6PA 2KA6B 2R46A 3HHZA 5IZ7D 2HL7A 5FTJA 4R3DA 4LRSA 3FTFA 5BPVA 1IBKM 1SXJE 5E26A 3E9SA 4DV2M 4DV1M 5IREB 1IXSB 2D7HA 2Q2EB 2QBYB 3J7BA 1NY5A 4DR3M 4LJ9A 2J7NA 2XEPA 3AJIB 4B08A 3FUVA 4EIWA 3GLFA 4LJ5A 3ZC7B 3KDSE 4G4RA 4G4OA 3GLIA 1NNUC 3VFDA 3SAWA 3AOGA 5EXTA 2KZSA 3EIEA 3SYLA 3T15A 2DWZB 3MJ5A 4BBAA 2C96A 3JAMS 5ITTA 4AI6A 4OVZB 4Z6YA 2M60A 4PDIA 2V6ZM 3HGIA 2DXIA 3L26A 4B7HA 4R7GA 2EUCA 3M7GA 1TDZA 1E32A 3AFHA 3LQQA 4OW0A 4BLCA 2CHVA 4LF9M 3HJSA 3U6DA 3R8FA 4ITQA 3VKGA 3H4MA 2XH9A 4LGYA 1UM8A 4LF8M 1KYIA 3U60A 4M9XA 5F3WA 4W5WA 1T3TA 3M0EA 2R45A 2W82A 4QHSA 4LF7M 1L1ZA 2L6OA 3FUWA 1NSFA 3U6LA 1DO0A 3KS4A 1NHGC 3K8ZA 3DA1A 4I81A 4K0KM 4AKIA 4IBGA 1G4AE 4AZFA 4D82A 1TDHA 4G4NA 3GLIB 2FOIC 5EXXA 4LG2A 5FTNA 2X49A 5EJCA 4DV5M 3EIHA 3T1YM 1DGHA 2FFJA 2RGOA 2F5OA 3SHGB 3TE6A 3LQRA 2I7PA 4L15A 1XNQM 2EA0A 1D2NA 1HNWM 1Z5CA 3GPUA 1Z5BA 4GRIA 2XF3A 1DGGA 1TGUA 2XZUA 3D8BA 3K1JA 3C58A 4MB7A 4JV5M 3FTEA 5ITRA 1XMQM 1OFHA 4KODA 3TWKA 1IN5A 4G4QA 3VK8A 4IBEA 3CTWB 1XNRM 3MHVC 4MGHA 3K2LA 1IN8A 3HJ8A 3R9XB 1HQYE 2ZANA 4GKJM 4FWHA 1IY1A 4GC5A 4WURA 4YY3M 1QYRA 2F4VM 5ITXA 1OJLA 2F5PA 2R18A 2G8LA 4IBKA 2CE7A 3NBIA 3U6OA 3UK6A 3GPXA 1JR3A 2QPAA 2FE8A 4REZA 1XXHB 4JYAM 4B7GA 2KEBA 3PNVA 4RF0A 4JI5M 4HL4A 4MH0E 3A45A 2RKOA 4AKHA 1L8QA 3U6EA 4X66M 5EP1A 4LJ4A 4LFBM 3AL0C 5FTMA 4IBCA 1R2YA 2P5TA 2XFSA 2KRKA 2XLJA 3JR4A 3U61B 4NRWA 1DGBA 3L2AA 5KPTA 4PDGA 4FVMA 3OTOM 1L2BA 3GLHB 3THGA 4CISA 4JXJA 4YHHM 3U6SA 1I4WA 2ZBKB 3KW6A 3FTCA 3GRYA 1TH2A 1G41A 1EE8A 4MGZE 3DFZA 3HU2A 2DHRA 1QAOA 1L1TA 3DOAA 3I4VA 2UXCM 2EO2A 3HU1A 3GLHA 4LFCM 4G6ZA 3U60B 4AG6A 3U5ZB 4DV4M 2Z4RA 4QOSA 5KPZA 5ITUA 2R62A 3HHYA 3GQ3A 4M9SA 3JR5A 1KFVA 3KP1E 3TQSA 4KLNA 1TH3A 3FUTA 4JI8M 3L25A 4JI0M 2JA2A 5C1BA 4D80A 4B3SM 4NXNM 3BOSA 3KS8A 2Y20A 1GVNA 2K47A 1IY2A 5DYIA 2DWNA 4X64M 3ZCBB 1IN6A 3VK7A 2DVWB 1NHWC 4Z8XA 4NOOB 3AKZA 3SMPA 1GKIA 2Z7JA 2ERCA 4AQYM 4AW4A 5EXSA 1DGHB 3GRRA 2Y0TA 3FYCA 3KOZE 4OX9M 4DR5M 4DV3M 2OQ4A 1JQJC 4RF1A 1PJJA 4LZJA 4I5SA 4XBOA 2LWXA 1XC8A 1NNJA 2L7IA 3ILKA 4GHLA 4WW0A 3QWLA 3MK6A 1N34M 1R2ZA 4B3MM 4IBBA 1QAQA 3GO8A 1IXRC 1S3SA 3J80S 2UXBM 3PXGA 3GQ5A 5JI2E 1L2CA 3RFWA 2F5QA 3KSJA 2C98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K82 A;  4NXM M;  2UXD M;  4JI1 M;  3U6P A;  4GKJ M;  2ZM6 M;  1HNX M;  4JI7 M;  1XMO M;  2UUB M;  1IBL M;  4YY3 M;  2OPF A;  4LF4 M;  5ITX A;  2F4V M;  1IBK M;  4DV6 M;  4PD2 A;  4DV2 M;  2HHH M;  4DV1 M;  2F5P A;  5A2Q S;  2F5S A;  2Q2E B;  4DUY M;  3U6M A;  5LMN M;  4DR3 M;  3GPX A;  3U6O A;  1HNZ M;  1N33 M;  5IT9 S;  4JYA M;  4B3T M;  4G4R A;  1Q3B A;  4G4O A;  4PCZ A;  4JI5 M;  4DR1 M;  4LF5 M;  3A45 A;  3SAW A;  3U6E A;  3SAT A;  4X66 M;  4B3R M;  1MX0 A;  4LFB M;  3JAM S;  5ITT A;  1Q3C A;  1PM5 A;  4X62 M;  1R2Y A;  3GPP A;  3JR4 A;  2HKJ A;  4PDI A;  4NRW A;  4DR4 M;  2XZF A;  1Z5A A;  4PDG A;  3U6Q A;  3OTO M;  1HR0 M;  1L2B A;  4NRV A;  1TDZ A;  4CIS A;  5IWA M;  5BR8 M;  4YHH M;  3U6S A;  4LF9 M;  2ZBK B;  3U6D A;  3A42 A;  4ITQ A;  2VQE M;  4LF8 M;  1EE8 A;  3SAS A;  1I94 M;  4KHP M;  1L1T A;  2F5N A;  3DOA A;  3T1H M;  2UXC M;  4JI3 M;  3J81 S;  1N32 M;  4LFC M;  4LF6 M;  3GP1 A;  3A46 A;  4LF7 M;  4DV4 M;  1L1Z A;  5ITU A;  2VQF M;  3GQ3 A;  3U6L A;  3JR5 A;  1KFV A;  4DR6 M;  4DR7 M;  4JI8 M;  4K0K M;  4JI0 M;  4DV0 M;  1PJI A;  2UUA M;  4DV7 M;  4B3S M;  4NXN M;  1TDH A;  4G4N A;  1Q39 A;  3TWL A;  1IBM M;  4JI4 M;  4X65 M;  1L2D A;  3J7A S;  4DV5 M;  3T1Y M;  4X64 M;  1FJG M;  3VK7 A;  2F5O A;  4JI2 M;  1XNQ M;  2EA0 A;  4DUZ M;  4LFA M;  3SBJ A;  1HNW M;  1Z5C A;  4JI6 M;  1MU5 A;  5ITY A;  3W0F A;  4AQY M;  3SAU A;  3GPU A;  1Z5B A;  1K3W A;  2UU9 M;  4OX9 M;  4DR5 M;  4DV3 M;  3SAV A;  2OQ4 A;  2XZU A;  3C58 A;  5LMU M;  4MB7 A;  5ITQ A;  3U6C A;  1PJJ A;  3GPY A;  1XC8 A;  1NNJ A;  4JV5 M;  1J5E M;  5ITR A;  1N34 M;  1R2Z A;  1N36 M;  4DR2 M;  1XMQ M;  2E5L M;  4B3M M;  3GO8 A;  3SAR A;  3J80 S;  3TWK A;  2UXB M;  3TWM A;  3GQ5 A;  3GQ4 A;  4GKK M;  5FLX S;  4G4Q A;  3VK8 A;  1K3X A;  1L2C A;  2F5Q A;  1XNR M;  2UUC M;  5ITX E;  1Z59 A; 
#chains in the Genus database with same CATH topology
 1R4G A;  2M5Z A;  1N75 A;  3J2P B;  3KOW E;  1GL6 A;  2HCB A;  1X37 A;  1SXJ C;  4JI1 M;  2UXD M;  5EXP A;  2L4F A;  1J09 A;  2R6F A;  2ZM6 M;  2VF7 A;  1GLN A;  2XGN A;  5KQ8 A;  1XMO M;  1E9S A;  2RGH A;  4XK8 F;  3E4R A;  1IBL M;  2UUB M;  3L28 A;  5EP3 A;  4LJ7 A;  1VEJ A;  2VDB B;  2KNV A;  1R7R A;  3D8L A;  2KHH A;  5A2Q S;  4L8R C;  4FD2 A;  2F5S A;  3UGJ A;  3U6M A;  4GC9 A;  1ZV1 A;  4MGY E;  4B7F A;  4LZZ A;  4OVZ A;  5IT9 S;  4IBF A;  3L29 A;  4B3T M;  1SXJ A;  3FTD A;  1GL7 A;  1Q3B A;  1R6B X;  1PGY A;  1ZAE A;  1H6U A;  2QZ4 A;  2A5Y B;  2ZAO A;  4G3O A;  1IN7 A;  4I8O A;  1MX0 A;  4NSR A;  1SXJ B;  3I51 A;  2Z4S A;  1P3Q Q;  1Q3C A;  3E21 A;  2ZAM A;  1OIZ A;  2QNJ A;  3GPP A;  3HU3 A;  2Z3X A;  3B74 A;  3U6Q A;  1OIP A;  1HR0 M;  4NRV A;  5GKN A;  3W67 A;  3HHX A;  4DBG B;  1NV9 A;  3UZU A;  5BR8 M;  2KW0 A;  3AOE A;  2XSZ D;  1QAM A;  2DI0 A;  4IJF A;  4LJ6 A;  3A42 A;  5L8R F;  1YE9 A;  2EKF A;  2CP8 A;  2MH8 A;  1ZMV A;  4NL4 H;  2QEN A;  3FYD A;  2VQE M;  4I4L A;  1VDD A;  1YSY A;  4XGI A;  1FNN A;  1OAO C;  2XSZ A;  1I94 M;  3FKE A;  4QNM A;  1WGL A;  3KOY E;  2VII A;  4IIW A;  4ZPX A;  2F5N A;  4D81 A;  1V33 A;  2L7H A;  3UJN A;  3J81 S;  2MGW A;  2Y0Q A;  1AIP C;  3GP1 A;  3BXW A;  1MN3 A;  1XXH E;  2APL A;  2JY8 A;  2C9C A;  3DZD A;  1DO2 A;  4KO8 A;  4MGI E;  4QHT A;  5E6J A;  3WHL A;  4FWD A;  5KPR A;  2VQF M;  1E94 E;  1LV7 A;  2YQZ A;  1NV8 A;  2KNA A;  4FW9 A;  1E9R A;  3SHF A;  4DV0 M;  3LVV A;  1MJG M;  1V92 A;  4IJE A;  4MM3 B;  3LCU A;  3T38 A;  3MMP A;  2R0I A;  4A3V B;  1Q39 A;  2KZU A;  1IBM M;  4JI4 M;  1WIV A;  1DGF A;  2KRU A;  2QP9 X;  3M6A A;  2MJ5 B;  3ZH9 B;  4II7 A;  4LJA A;  3GLF B;  4TUW A;  4ANR A;  5FTL A;  1GO5 A;  4GMQ A;  1QQW A;  2L4E A;  1G3I A;  1IXZ A;  1G8P A;  3GLG E;  3ZQJ A;  1HQC A;  4MGK E;  4CIZ A;  4DUZ M;  4BB9 A;  2DZO B;  5KQD A;  4JI6 M;  1MU5 A;  1TTE A;  3W0F A;  4NSO B;  1NVM A;  3VLF B;  4CGY B;  3VDP A;  1K3W A;  2DZL A;  1GAB A;  1IQP A;  2J7O A;  1G59 A;  2FNA A;  3AOE C;  3SAV A;  1OFI A;  2V1C A;  1UFZ A;  3VDU A;  3CF6 E;  3GPY A;  3HHW A;  1J5E M;  5FTK A;  1VG5 A;  1Z6T A;  2CHQ A;  2CV2 A;  1NO1 A;  1QVR A;  3A98 B;  4DR2 M;  2E5L M;  3SAR A;  3HWS A;  3H4J A;  5EP4 A;  3V76 A;  3TWM A;  3SMS A;  3GQ4 A;  1NY6 A;  1TH4 A;  3AV0 A;  4GKK M;  1K3X A;  1OQY A;  4QOZ C;  2YR0 A;  4L78 A;  3PNY A;  5ITX E;  1Z59 A;  2UUC M;  2CFO A;  4B3R M;  3GLG B;  1QAN A;  2DAM A;  3PFI A;  4Q7J A;  4FCT A;  4NXM M;  4HLQ A;  2DWM A;  4GIP A;  4OU7 A;  3GLF E;  2LHC A;  5DYG A;  2CRU A;  1IY0 A;  1HNX M;  4JI7 M;  3J27 B;  3HJQ A;  2R4E A;  1NJG A;  3SFZ A;  1XWI A;  2OPF A;  4LF4 M;  2C99 A;  5DNY A;  4DV6 M;  1KSF X;  1XHB A;  1VEK A;  4PD2 A;  2HHH M;  4M9Z A;  2LXE A;  2CV0 A;  2LNH C;  4DUY M;  1HNZ M;  5LMN M;  2QSF X;  1N33 M;  4RNA A;  2O5R A;  4M0W A;  2R65 A;  4P17 A;  2CEA A;  3SC3 A;  2X4A A;  3IG5 A;  2RRU A;  2X8A A;  2O01 F;  2H5X A;  4LRT A;  1YUB A;  2MR9 A;  2CV1 A;  2CHG A;  2JP7 A;  4PT5 A;  4PCZ A;  4DR1 M;  4LF5 M;  5DFL A;  3SAT A;  1ORY B;  2JZ0 A;  7CAT A;  1HJP A;  1IXS A;  2GQF A;  2C5R A;  3CF0 A;  3QAU A;  3B9P A;  4LGM A;  2BJW A;  4AKG A;  1PM5 A;  1IM2 A;  4X62 M;  3KXE C;  2DZN B;  2KXE A;  1JR3 D;  1Q02 A;  2HKJ A;  4IBJ A;  4DR4 M;  2XZF A;  1Z5A A;  3C3D A;  3FD9 A;  2D7G A;  4R71 A;  2HAK A;  3FRI A;  1WXQ A;  5IWA M;  4FCV A;  4JN6 A;  1R5L A;  4P16 A;  2H1R A;  3KSX A;  3SYK A;  2DWL A;  2I7N A;  1HT2 E;  2D7E A;  2LVA A;  2WZJ A;  3TPZ A;  3LVW A;  1GJT A;  3SAS A;  5KO3 A;  2C9O A;  4HEO A;  3NWL A;  4KHP M;  4L16 A;  3T1H M;  4JI3 M;  1N32 M;  3KFU G;  4LF6 M;  1HT1 E;  3FE3 A;  3RGP A;  4LJ8 A;  4IBD A;  3F92 A;  3U61 A;  1OAI A;  2G5G X;  2OOA A;  3KP0 E;  3KVW A;  4S12 A;  4DR6 M;  4DR7 M;  1WGN A;  2AHM A;  1VEG A;  2BNK A;  3I4Y A;  3VKH A;  4IBI A;  3LMM A;  3TL4 X;  5JI3 E;  2UUA M;  3CGW A;  4CHT B;  1PJI A;  4DV7 M;  1ZQ9 A;  2XFT A;  4F1I A;  3TWL A;  3LCV B;  4X65 M;  4LCB A;  3A46 A;  1L2D A;  1N77 A;  3J7A S;  4AG5 A;  1J7K A;  1XXH A;  3PVS A;  4FCW A;  2BJV A;  3KOX E;  4GIT A;  4F2L A;  3WHK A;  1FJG M;  4JI2 M;  3FUU A;  2NQ8 C;  3RE8 A;  1W5T A;  2YNM D;  1Y8G A;  2JWS A;  3GRU A;  4LFA M;  3SBJ A;  2N35 A;  2QCU A;  3K9O A;  5ITY A;  3SAU A;  4L4U A;  2UU9 M;  1ZMU A;  8CAT A;  2QBY A;  1QZM A;  3IG8 A;  5FSW A;  2R4J A;  2ZTD A;  4M0D A;  3U5Z A;  2LH0 A;  4GH9 A;  3FUX A;  5LMU M;  5ITQ A;  4QNR A;  1NJF A;  5C18 A;  3HKP A;  3U6C A;  4FWG A;  1WHC A;  1VDL A;  3GLG A;  1SXJ D;  2JY6 B;  4GHA A;  1N78 A;  3L27 A;  1N36 M;  2V1U A;  1C1K A;  3Q8G A;  2L09 A;  3K92 A;  5H37 D;  3I01 M;  3RGS A;  5EQT A;  3W0L B;  4LY6 A;  5FLX S;  1W5S A;  1IN4 A;  3Q8X A;  2CUZ A;  3CF2 A;  1K82 A;  1V34 A;  5EP2 A;  2Y21 A;  2YFQ A;  3GRV A;  3U6P A;  2KA6 B;  2R46 A;  1JR3 E;  1TR8 A;  3HHZ A;  5IZ7 D;  2HL7 A;  5FTJ A;  2KDL A;  3IHP A;  4R3D A;  2JZ1 A;  2OO9 A;  4LRS A;  3FTF A;  5BPV A;  2CWB A;  1IBK M;  1SXJ E;  5E26 A;  3E9S A;  4DV2 M;  4DV1 M;  5IRE B;  1IXS B;  2D7H A;  3T6P A;  2Q2E B;  2QBY B;  3J7B A;  1NY5 A;  4DR3 M;  4LJ9 A;  2J7N A;  2XEP A;  3AJI B;  4B08 A;  3FUV A;  4EIW A;  3BBZ A;  3GLF A;  4LJ5 A;  3E46 A;  3K9P A;  3ZC7 B;  3KDS E;  4G4R A;  4G4O A;  3GLI A;  1NNU C;  3C9P A;  1OKS A;  3AOG A;  5EXT A;  3VFD A;  3SAW A;  2KZS A;  3EIE A;  3SYL A;  3T15 A;  2DWZ B;  3MJ5 A;  2GNO A;  4BBA A;  2C96 A;  3JAM S;  5ITT A;  4AI6 A;  4OVZ B;  2BWB A;  3FRH A;  4Z6Y A;  1PJT A;  2M60 A;  4PDI A;  2V6Z M;  2DAK A;  3HGI A;  2DXI A;  3L26 A;  4B7H A;  2MRO B;  4R7G A;  2EUC A;  3M7G A;  1TDZ A;  1E32 A;  3AFH A;  3LQQ A;  2DNA A;  4OW0 A;  1SG9 A;  2LTU A;  4BLC A;  2CHV A;  4LF9 M;  2BWE A;  2HWJ A;  4NC6 A;  3HJS A;  2L2D A;  3U6D A;  3R8F A;  4ITQ A;  3VKG A;  3H4M A;  2XH9 A;  4LGY A;  2R44 A;  1UM8 A;  4LF8 M;  1KYI A;  4CJ6 A;  3U60 A;  2Z8Y M;  4M9X A;  5F3W A;  4W5W A;  1T3T A;  3M0E A;  2R45 A;  2W82 A;  2WSE F;  4QHS A;  4LF7 M;  1L1Z A;  1CUK A;  2L6O A;  3FUW A;  1NSF A;  3U6L A;  1DO0 A;  3KS4 A;  1NHG C;  1PRB A;  3DA1 A;  3K8Z A;  4I81 A;  4K0K M;  4AKI A;  2LVP C;  2DHY A;  3GLI E;  1D0M A;  2FH0 A;  4IBG A;  1G4A E;  4AZF A;  1DV0 A;  4D82 A;  1D0L A;  1TDH A;  4G4N A;  1RU3 A;  2FOI C;  5EXX A;  3GLI B;  4LG2 A;  2J5Y A;  5FTN A;  2X49 A;  5EJC A;  4DV5 M;  3EIH A;  3T1Y M;  1DGH A;  2FFJ A;  1QUT A;  2RGO A;  3SHG B;  3TE6 A;  2F5O A;  2I7P A;  3LQR A;  4L15 A;  1XNQ M;  1PJS A;  2EA0 A;  1GJS A;  1D2N A;  1HNW M;  1Z5C A;  2EJS A;  3B7N A;  3GPU A;  1Z5B A;  1VQ1 A;  2LVN C;  3I04 M;  4GRI A;  1QZE A;  2XF3 A;  1DGG A;  1IFY A;  1XB2 B;  1TGU A;  2XZU A;  4L6V 6;  1WR1 B;  2JUJ A;  3D8B A;  3K1J A;  3C58 A;  1C7Y A;  4MB7 A;  1AUA A;  4JV5 M;  1QUS A;  4UN2 B;  3FTE A;  5ITR A;  4WP2 A;  1XMQ M;  1OFH A;  4KOD A;  3TWK A;  3HY5 A;  1IN5 A;  4G4Q A;  3VK8 A;  4IBE A;  3CTW B;  1A5T A;  1XNR M;  3B7Z A;  3MHV C;  3QYB A;  4MGH A;  3K2L A;  2VF8 A;  1IN8 A;  3HJ8 A;  3R9X B;  1HQY E;  2ZAN A;  4GKJ M;  4FWH A;  1OTR A;  1IY1 A;  2EKK A;  2JY7 A;  2K9D A;  4GC5 A;  4WUR A;  4YY3 M;  2DEN A;  1QYR A;  2F4V M;  5ITX A;  1OJL A;  1LTM A;  3QYE A;  2F5P A;  2R18 A;  2G8L A;  4IBK A;  2CE7 A;  2LHG A;  3NBI A;  3U6O A;  1BVS A;  3UK6 A;  3GPX A;  2DAI A;  1WJ7 A;  1JR3 A;  2QPA A;  1T6O A;  2FE8 A;  4REZ A;  1XXH B;  4JYA M;  4B7G A;  2KEB A;  3PNV A;  4RF0 A;  1EFU B;  4JI5 M;  4HL4 A;  2G3Q A;  3A45 A;  4MH0 E;  2RKO A;  4AKH A;  1L8Q A;  3U6E A;  4X66 M;  5EP1 A;  4LJ4 A;  1F4I A;  4LFB M;  1G71 A;  2QQ8 A;  3AL0 C;  1QDR A;  3C3E A;  5FTM A;  4IBC A;  1R2Y A;  2P5T A;  2XFS A;  2KRK A;  2KNZ A;  2QHO B;  3B89 A;  4KT0 F;  2XLJ A;  3JR4 A;  3U61 B;  4NRW A;  1DGB A;  3L2A A;  2JXN A;  1JB0 F;  4PDG A;  5KPT A;  4FVM A;  3OTO M;  1L2B A;  4GEW A;  3GLH B;  3THG A;  3B7Q A;  4JXJ A;  4CIS A;  2LVQ D;  1YLA A;  1T43 A;  4YHH M;  3U6S A;  1I4W A;  2ZBK B;  3KW6 A;  3FTC A;  3NBX X;  3GRY A;  1TH2 A;  1G41 A;  2ZTC A;  1EE8 A;  4MGZ E;  3DFZ A;  3HU2 A;  2DHR A;  1QAO A;  1L1T A;  3DOA A;  3I4V A;  2UXC M;  2EO2 A;  3HU1 A;  3GLH A;  4LFC M;  4G6Z A;  3U60 B;  4AG6 A;  3U5Z B;  4DV4 M;  2Z4R A;  4QOS A;  4Y28 F;  4RKU F;  5KPZ A;  5ITU A;  2R62 A;  3HHY A;  3LW5 F;  3GQ3 A;  4M9S A;  2DAG A;  3JR5 A;  1PJQ A;  3IEC A;  3KP1 E;  4KLN A;  3TQS A;  2DKL A;  1KFV A;  1EIJ A;  1TH3 A;  3FUT A;  4JI8 M;  3L25 A;  4JI0 M;  2JA2 A;  2LVO C;  5C1B A;  4D80 A;  4B3S M;  4NXN M;  3BOS A;  3KS8 A;  2Y20 A;  1GVN A;  2K47 A;  3W68 A;  1IY2 A;  3HZJ A;  5DYI A;  2DWN A;  1TF0 B;  2WSC F;  4X64 M;  3ZCB B;  1IN6 A;  3VK7 A;  2DVW B;  1NHW C;  1ZMW A;  4Z8X A;  4NOO B;  3AKZ A;  3SMP A;  1GKI A;  2K6B A;  2ERC A;  2JNH A;  2Z7J A;  4AQY M;  4AW4 A;  5EXS A;  1DGH B;  1D0K A;  3GRR A;  2Y0T A;  3FYC A;  2K0B X;  3KOZ E;  4OX9 M;  4DR5 M;  4DV3 M;  2DAE A;  1JQJ C;  3HX3 A;  2OQ4 A;  4RF1 A;  1QDT A;  1PJJ A;  4LZJ A;  4I5S A;  4XBO A;  2LWX A;  2OOB A;  1XC8 A;  2L7I A;  3ILK A;  1NNJ A;  4WW0 A;  2WSF F;  3QWL A;  3MK6 A;  4GHL A;  2O25 A;  3UMM A;  3GLH E;  1R2Z A;  1N34 M;  4B3M M;  4IBB A;  1QAQ A;  3GO8 A;  1IXR C;  1S3S A;  3J80 S;  2UXB M;  3PXG A;  2FS1 A;  3GQ5 A;  5JI2 E;  2B3T A;  2LBC A;  3RFW A;  1L2C A;  2F5Q A;  3KSJ A;  2JY5 A;  2C98 A; 
#chains in the Genus database with same CATH homology
 2M5Z A;  1N75 A;  3J2P B;  3KOW E;  1GL6 A;  2HCB A;  1X37 A;  1SXJ C;  4JI1 M;  2UXD M;  5EXP A;  1J09 A;  2ZM6 M;  1GLN A;  2XGN A;  5KQ8 A;  1XMO M;  1E9S A;  2RGH A;  2UUB M;  3E4R A;  1IBL M;  3L28 A;  5EP3 A;  4LJ7 A;  1R7R A;  3D8L A;  5A2Q S;  4L8R C;  4FD2 A;  2F5S A;  3UGJ A;  3U6M A;  4GC9 A;  4MGY E;  4B7F A;  4LZZ A;  4OVZ A;  5IT9 S;  4IBF A;  3L29 A;  4B3T M;  1SXJ A;  3FTD A;  1GL7 A;  1Q3B A;  1R6B X;  1ZAE A;  2QZ4 A;  1H6U A;  2A5Y B;  2ZAO A;  4I8O A;  1IN7 A;  1MX0 A;  4NSR A;  1SXJ B;  3I51 A;  2Z4S A;  1Q3C A;  2ZAM A;  3GPP A;  3HU3 A;  2Z3X A;  3U6Q A;  1HR0 M;  4NRV A;  5GKN A;  3HHX A;  3UZU A;  5BR8 M;  2KW0 A;  3AOE A;  2XSZ D;  1QAM A;  4IJF A;  4LJ6 A;  3UMM A;  3A42 A;  1YE9 A;  4NL4 H;  2QEN A;  3FYD A;  2VQE M;  4I4L A;  1VDD A;  1YSY A;  4XGI A;  1FNN A;  2XSZ A;  1I94 M;  3FKE A;  4QNM A;  3KOY E;  2VII A;  4IIW A;  4ZPX A;  2F5N A;  4D81 A;  2L7H A;  3UJN A;  3J81 S;  2Y0Q A;  3GP1 A;  3A46 A;  3WHL A;  3DZD A;  2C9C A;  4KO8 A;  1DO2 A;  4QHT A;  4MGI E;  5E6J A;  4FWD A;  5KPR A;  2VQF M;  1E94 E;  1LV7 A;  2YQZ A;  4FW9 A;  1E9R A;  3SHF A;  4DV0 M;  3LVV A;  4IJE A;  4MM3 B;  3T38 A;  4A3V B;  1Q39 A;  2KZU A;  1IBM M;  4JI4 M;  2KRU A;  1DGF A;  2QP9 X;  3M6A A;  3ZH9 B;  4II7 A;  4LJA A;  3GLF B;  4TUW A;  5FTL A;  4GMQ A;  1QQW A;  1G3I A;  1IXZ A;  1G8P A;  1HQC A;  4MGK E;  4DUZ M;  4BB9 A;  2DZO B;  5KQD A;  4JI6 M;  1MU5 A;  3W0F A;  4NSO B;  1NVM A;  3VLF B;  4CGY B;  3VDP A;  1K3W A;  1IQP A;  2J7O A;  1G59 A;  2FNA A;  3AOE C;  3SAV A;  1OFI A;  2V1C A;  3VDU A;  3CF6 E;  3GPY A;  3HHW A;  1J5E M;  5FTK A;  1Z6T A;  2CHQ A;  2CV2 A;  1QVR A;  3A98 B;  4DR2 M;  2E5L M;  3SAR A;  3HWS A;  5EP4 A;  3TWM A;  3SMS A;  3GQ4 A;  1NY6 A;  1TH4 A;  3AV0 A;  4GKK M;  1K3X A;  4QOZ C;  2YR0 A;  4L78 A;  3PNY A;  5ITX E;  1Z59 A;  2UUC M;  2CFO A;  4B3R M;  3GLG B;  1QAN A;  3PFI A;  4NXM M;  4FCT A;  4HLQ A;  2DWM A;  4GIP A;  4OU7 A;  5DYG A;  1IY0 A;  1HNX M;  4JI7 M;  3J27 B;  3HJQ A;  2R4E A;  1NJG A;  3SFZ A;  1XWI A;  2OPF A;  4LF4 M;  2C99 A;  5DNY A;  4DV6 M;  1KSF X;  1XHB A;  4PD2 A;  2HHH M;  4M9Z A;  2LXE A;  2CV0 A;  2LNH C;  4DUY M;  1HNZ M;  5LMN M;  1N33 M;  4RNA A;  2O5R A;  4M0W A;  2R65 A;  2CEA A;  3SC3 A;  2X4A A;  3IG5 A;  2X8A A;  2CV1 A;  4LRT A;  1YUB A;  2CHG A;  4PCZ A;  4PT5 A;  4DR1 M;  4LF5 M;  3SAT A;  1ORY B;  7CAT A;  2C5R A;  3CF0 A;  3QAU A;  3B9P A;  4LGM A;  2BJW A;  4AKG A;  1PM5 A;  1IM2 A;  4X62 M;  3KXE C;  2DZN B;  2KXE A;  1JR3 D;  2HKJ A;  4IBJ A;  4DR4 M;  2XZF A;  1Z5A A;  3FD9 A;  2D7G A;  1WXQ A;  5IWA M;  4FCV A;  4JN6 A;  4P16 A;  2H1R A;  3KSX A;  3SYK A;  2DWL A;  2I7N A;  1HT2 E;  2D7E A;  3TPZ A;  3LVW A;  3SAS A;  5KO3 A;  2C9O A;  3NWL A;  4KHP M;  4L16 A;  3T1H M;  4JI3 M;  1N32 M;  3KFU G;  4LF6 M;  1HT1 E;  3RGP A;  4LJ8 A;  4IBD A;  3U61 A;  2G5G X;  4S12 A;  3KP0 E;  3KVW A;  4DR6 M;  4DR7 M;  3VKH A;  2AHM A;  2BNK A;  3I4Y A;  4IBI A;  3LMM A;  3TL4 X;  5JI3 E;  2UUA M;  4CHT B;  1PJI A;  4DV7 M;  1ZQ9 A;  2XFT A;  3TWL A;  4X65 M;  4LCB A;  1L2D A;  1N77 A;  3J7A S;  4AG5 A;  1J7K A;  1XXH A;  3PVS A;  4FCW A;  2BJV A;  3KOX E;  4GIT A;  3WHK A;  1FJG M;  4JI2 M;  3FUU A;  2NQ8 C;  3RE8 A;  1W5T A;  2YNM D;  3GRU A;  4LFA M;  3SBJ A;  2QCU A;  5ITY A;  3SAU A;  4L4U A;  2UU9 M;  8CAT A;  2QBY A;  1QZM A;  3IG8 A;  5FSW A;  2R4J A;  4M0D A;  3U5Z A;  2LH0 A;  4GH9 A;  3FUX A;  5LMU M;  5ITQ A;  4QNR A;  1NJF A;  5C18 A;  3HKP A;  3U6C A;  4FWG A;  3GLG A;  1SXJ D;  4GHA A;  1N78 A;  3L27 A;  1N36 M;  2V1U A;  1C1K A;  2L09 A;  3K92 A;  5H37 D;  3RGS A;  5EQT A;  3W0L B;  4LY6 A;  5FLX S;  1W5S A;  1IN4 A;  3Q8X A;  2CUZ A;  3CF2 A;  1K82 A;  5EP2 A;  2Y21 A;  2YFQ A;  3GRV A;  3U6P A;  2KA6 B;  2R46 A;  3HHZ A;  5IZ7 D;  2HL7 A;  5FTJ A;  4R3D A;  4LRS A;  3FTF A;  5BPV A;  1IBK M;  1SXJ E;  5E26 A;  3E9S A;  4DV2 M;  4DV1 M;  5IRE B;  1IXS B;  2D7H A;  2Q2E B;  2QBY B;  3J7B A;  1NY5 A;  4DR3 M;  4LJ9 A;  2J7N A;  2XEP A;  3AJI B;  4B08 A;  3FUV A;  4EIW A;  3GLF A;  4LJ5 A;  3ZC7 B;  3KDS E;  4G4R A;  4G4O A;  3GLI A;  1NNU C;  3VFD A;  3SAW A;  3AOG A;  5EXT A;  2KZS A;  3EIE A;  3SYL A;  3T15 A;  2DWZ B;  3MJ5 A;  4BBA A;  2C96 A;  3JAM S;  5ITT A;  4AI6 A;  4OVZ B;  4Z6Y A;  2M60 A;  4PDI A;  2V6Z M;  3HGI A;  2DXI A;  3L26 A;  4B7H A;  4R7G A;  2EUC A;  3M7G A;  1TDZ A;  1E32 A;  3AFH A;  3LQQ A;  4OW0 A;  4BLC A;  2CHV A;  4LF9 M;  3HJS A;  3U6D A;  3R8F A;  4ITQ A;  3VKG A;  3H4M A;  2XH9 A;  4LGY A;  1UM8 A;  4LF8 M;  1KYI A;  3U60 A;  4M9X A;  5F3W A;  4W5W A;  1T3T A;  3M0E A;  2R45 A;  2W82 A;  4QHS A;  4LF7 M;  1L1Z A;  2L6O A;  3FUW A;  1NSF A;  3U6L A;  1DO0 A;  3KS4 A;  1NHG C;  3K8Z A;  3DA1 A;  4I81 A;  4K0K M;  4AKI A;  4IBG A;  1G4A E;  4AZF A;  4D82 A;  1TDH A;  4G4N A;  3GLI B;  2FOI C;  5EXX A;  4LG2 A;  5FTN A;  2X49 A;  5EJC A;  4DV5 M;  3EIH A;  3T1Y M;  1DGH A;  2FFJ A;  2RGO A;  2F5O A;  3SHG B;  3TE6 A;  3LQR A;  2I7P A;  4L15 A;  1XNQ M;  2EA0 A;  1D2N A;  1HNW M;  1Z5C A;  3GPU A;  1Z5B A;  4GRI A;  2XF3 A;  1DGG A;  1TGU A;  2XZU A;  3D8B A;  3K1J A;  3C58 A;  4MB7 A;  4JV5 M;  3FTE A;  5ITR A;  1XMQ M;  1OFH A;  4KOD A;  3TWK A;  1IN5 A;  4G4Q A;  3VK8 A;  4IBE A;  3CTW B;  1XNR M;  3MHV C;  4MGH A;  3K2L A;  1IN8 A;  3HJ8 A;  3R9X B;  1HQY E;  2ZAN A;  4GKJ M;  4FWH A;  1IY1 A;  4GC5 A;  4WUR A;  4YY3 M;  1QYR A;  2F4V M;  5ITX A;  1OJL A;  2F5P A;  2R18 A;  2G8L A;  4IBK A;  2CE7 A;  3NBI A;  3U6O A;  3UK6 A;  3GPX A;  1JR3 A;  2QPA A;  2FE8 A;  4REZ A;  1XXH B;  4JYA M;  4B7G A;  2KEB A;  3PNV A;  4RF0 A;  4JI5 M;  4HL4 A;  4MH0 E;  3A45 A;  2RKO A;  4AKH A;  1L8Q A;  3U6E A;  4X66 M;  5EP1 A;  4LJ4 A;  4LFB M;  3AL0 C;  5FTM A;  4IBC A;  1R2Y A;  2P5T A;  2XFS A;  2KRK A;  2XLJ A;  3JR4 A;  3U61 B;  4NRW A;  1DGB A;  3L2A A;  5KPT A;  4PDG A;  4FVM A;  3OTO M;  1L2B A;  3GLH B;  3THG A;  4CIS A;  4JXJ A;  4YHH M;  3U6S A;  1I4W A;  2ZBK B;  3KW6 A;  3FTC A;  3GRY A;  1TH2 A;  1G41 A;  1EE8 A;  4MGZ E;  3DFZ A;  3HU2 A;  2DHR A;  1QAO A;  1L1T A;  3DOA A;  3I4V A;  2UXC M;  2EO2 A;  3HU1 A;  3GLH A;  4LFC M;  4G6Z A;  3U60 B;  4AG6 A;  3U5Z B;  4DV4 M;  2Z4R A;  4QOS A;  5KPZ A;  5ITU A;  2R62 A;  3HHY A;  3GQ3 A;  4M9S A;  3JR5 A;  1KFV A;  3KP1 E;  3TQS A;  4KLN A;  1TH3 A;  3FUT A;  4JI8 M;  3L25 A;  4JI0 M;  2JA2 A;  5C1B A;  4D80 A;  4B3S M;  4NXN M;  3BOS A;  3KS8 A;  2Y20 A;  1GVN A;  2K47 A;  1IY2 A;  5DYI A;  2DWN A;  4X64 M;  3ZCB B;  1IN6 A;  3VK7 A;  2DVW B;  1NHW C;  4Z8X A;  4NOO B;  3AKZ A;  3SMP A;  1GKI A;  2Z7J A;  2ERC A;  4AQY M;  4AW4 A;  5EXS A;  1DGH B;  3GRR A;  2Y0T A;  3FYC A;  3KOZ E;  4OX9 M;  4DR5 M;  4DV3 M;  2OQ4 A;  1JQJ C;  4RF1 A;  1PJJ A;  4LZJ A;  4I5S A;  4XBO A;  2LWX A;  1XC8 A;  1NNJ A;  2L7I A;  3ILK A;  4GHL A;  4WW0 A;  3QWL A;  3MK6 A;  1N34 M;  1R2Z A;  4B3M M;  4IBB A;  1QAQ A;  3GO8 A;  1IXR C;  1S3S A;  3J80 S;  2UXB M;  3PXG A;  3GQ5 A;  5JI2 E;  1L2C A;  3RFW A;  2F5Q A;  3KSJ A;  2C98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...