2UXDM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 20
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxdM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxdM02
4G4OA 1K82A 1Q39A 4JI5M 3U6CA 1IBMM 2UUCM 3J80S 3A45A 3A42A 4JI4M 3JR4A 5ITUA 4LFAM 1L2BA 5ITXA 3U6LA 2UU9M 4B3TM 4K0KM 3GPYA 4JI8M 1NNJA 3GPPA 3T1HM 2F5QA 4DV6M 1R2ZA 3DOAA 4DV2M 4NXNM 3J81S 1MX0A 1PM5A 4DR5M 3GP1A 4JV5M 4X65M 4LF9M 2VQFM 2UUAM 1Z5CA 5LMNM 2OQ4A 4DV1M 5ITXE 2XZUA 1XNQM 4DV0M 4KHPM 4DR3M 4G4QA 2F5OA 4NRVA 4LF6M 4B3RM 2UXDM 3SAVA 3VK8A 4DUZM 4YY3M 2ZBKB 1EE8A 1I94M 3SAUA 4GKJM 4DR1M 4NRWA 4CISA 5BR8M 4DR4M 5ITQA 3GPXA 2F5PA 3GQ4A 4B3MM 1N34M 3JAMS 4LF7M 1TDZA 3OTOM 1XMOM 1N33M 1L2DA 3T1YM 2UUBM 4X64M 3JR5A 1L2CA 1PJJA 1Z5BA 1Z5AA 4YHHM 3TWMA 4JI3M 1HNZM 4PCZA 4OX9M 4GKKM 5IWAM 4JI0M 3GPUA 1MU5A 4X62M 2F5NA 3SAWA 4G4RA 1J5EM 3U6MA 1HNWM 4DV5M 4DV7M 3U6OA 3TWLA 4NXMM 4PD2A 4X66M 4DV3M 1K3XA 4DUYM 4JI1M 2OPFA 3SBJA 1HNXM 2F4VM 5FLXS 4LFCM 4MB7A 4LF4M 2EA0A 3W0FA 5IT9S 3GQ5A 3U6SA 1XC8A 4JI7M 4DR6M 1R2YA 3A46A 1TDHA 2F5SA 4LF5M 3VK7A 3SASA 2UXCM 4ITQA 3TWKA 1N32M 3U6EA 3SATA 1L1ZA 4AQYM 4JI2M 3J7AS 1XMQM 4B3SM 2HKJA 4JI6M 2UXBM 2HHHM 1HR0M 2Q2EB 4DR7M 2ZM6M 5ITTA 1K3WA 3U6DA 2XZFA 3U6QA 1N36M 4JYAM 4G4NA 1IBLM 4LF8M 4LFBM 2VQEM 5ITRA 3U6PA 1Q3BA 1XNRM 4PDGA 1PJIA 3C58A 4PDIA 4DV4M 4DR2M 3GQ3A 3SARA 5A2QS 1L1TA 1IBKM 5LMUM 1KFVA 5ITYA 1FJGM 2E5LM 3GO8A 1Z59A 1Q3CA
chains in the Genus database with same CATH superfamily
4OW0A 1T43A 3DA1A 1IXSA 3H4JA 3T15A 4CHTB 4G3OA 4LJ7A 2M60A 4KLNA 1TR8A 3A42A 2ZAMA 3GRYA 4JI4M 4M9XA 5DYGA 1J09A 3KSXA 2CV0A 2AHMA 3KW6A 2APLA 3GPYA 2Y0QA 3CF6E 1NNJA 1DGGA 2MROB 2R4EA 4OVZA 4DV6M 2LWXA 4GITA 1R2ZA 4GIPA 4AZFA 3DOAA 1ZV1A 1W5SA 4RNAA 1MX0A 3GLHB 2P5TA 2BWEA 4P16A 4X65M 2G8LA 5C18A 1WXQA 3L29A 4L4UA 3MHVC 3FUXA 1VDLA 2ERCA 2EO2A 3HWSA 4LJ6A 3K9PA 3V76A 4B7HA 2OQ4A 4KHPM 1IM2A 3AOEA 4IJEA 4NRVA 3WHKA 2Z4RA 3AJIB 2UXDM 3IG5A 4DUZM 3CGWA 1EE8A 3FUVA 3FYDA 1TH4A 2KA6B 4DR1M 5BR8M 4IBCA 3RFWA 1QYRA 3U5ZA 1R4GA 3U60A 4B3MM 2KNZA 1PJQA 1JR3A 4L8RC 2C9CA 2CHGA 3KS4A 3MMPA 2BJWA 5KQDA 3I4VA 4A3VB 3OTOM 1IXRC 3T1YM 1A5TA 2DAKA 2KW0A 4MGIE 4D81A 3JR5A 1L2CA 1ZMUA 1Z5BA 5KPRA 4IBIA 4PCZA 4LGYA 3R8FA 3E9SA 3TPZA 1NV9A 4R3DA 2DAIA 4P17A 3SAWA 4IBKA 2L7HA 5E26A 1IY0A 1PGYA 3PXGA 1E94E 3UZUA 2DWMA 1J5EM 1VEJA 2G3QA 1DGHB 3Q8XA 5JI2E 3WHLA 1JB0F 2ZTDA 1LV7A 1H6UA 1QQWA 3K1JA 1HQCA 1IN7A 3NBXX 1AIPC 3U6OA 3AL0C 4NXMM 3HX3A 4BBAA 3CF0A 1G71A 1BVSA 4HLQA 2XH9A 3I04M 4IBEA 4DV3M 1K3XA 2CEAA 2R62A 1Z6TA 3LQRA 1IXSB 1G3IA 3L2AA 1VEKA 2JY8A 4KT0F 1E32A 2LTUA 4LZJA 3HU1A 4FW9A 3L28A 2VF8A 5FLXS 3GLGA 3SMSA 2CHVA 3K2LA 4IBFA 2XFSA 1XXHE 4MB7A 3VLFB 1ZAEA 1QDRA 4LJ4A 5IT9S 1I4WA 7CATA 4OVZB 3HJ8A 4KODA 1OFHA 1E9RA 5EJCA 2XLJA 3FUUA 1R2YA 2F5SA 3SASA 1DGFA 4ITQA 3VDPA 3J7BA 4LRTA 3GLFA 2O25A 3U6EA 2JZ1A 2QCUA 1QVRA 1L1ZA 4JI2M 3J7AS 1WJ7A 4B3SM 4L16A 3K8ZA 1GL6A 2L4EA 1W5TA 4JI6M 1GJSA 2FNAA 4BLCA 3QWLA 2WSFF 3PVSA 1NJFA 3BOSA 3U5ZB 4I8OA 3U6PA 3GLIB 1VG5A 2LBCA 4QHTA 1PJIA 3IHPA 2JA2A 2FOIC 1OJLA 3J27B 1CUKA 3GQ3A 4JI8M 2HWJA 4RKUF 5A2QS 1KFVA 2QP9X 2E5LM 2C98A 2HL7A 5FTJA 2XSZD 2Y20A 4LJAA 3KXEC 4G4OA 3SHFA 3MK6A 4JI5M 2XF3A 1IBMM 2UUCM 4LJ9A 1XWIA 3J80S 2I7NA 3JR4A 5ITUA 2DI0A 5H37D 3B74A 1DV0A 1UM8A 2DVWB 1TTEA 5GKNA 3T1HM 2F5QA 3KSJA 1NHGC 4F1IA 4NSRA 4NXNM 5BPVA 1OQYA 2K47A 3ZC7B 3J81S 3B9PA 3QAUA 5FTMA 1IN6A 1UFZA 2DHYA 3BBZA 3B7QA 4DR5M 4AG5A 2VQFM 5FSWA 3K9OA 4DBGB 4DV1M 1HQYE 2R0IA 2CV1A 2Z3XA 2OOAA 3GLGB 2F5OA 4JN6A 2XGNA 4LF6M 3I51A 4B3RM 2DENA 3IG8A 4YY3M 3VK8A 4JXJA 4LY6A 1I94M 3R9XB 4CISA 3EIEA 5ITQA 4L6V6 3GPXA 3KDSE 3KFUG 2F5PA 1N34M 3M7GA 2DAMA 3GLFB 3J2PB 2CUZA 1SXJD 3BXWA 1OFIA 1C1KA 3PNYA 2L09A 2R44A 1N33M 4FVMA 4ZPXA 4LG2A 2L2DA 4I81A 3T38A 4S12A 2XFTA 1GABA 1TH2A 4Y28F 1HNZM 5IWAM 1IN8A 1HT1E 4FCTA 3E46A 1MJGM 3LMMA 2MJ5B 3L27A 1DGBA 3D8BA 3ZCBB 4MGYE 1XB2B 3HHZA 3U6MA 1WGNA 3LW5F 2QSFX 2CFOA 2FE8A 4W5WA 3C9PA 4GMQA 2MH8A 4DV5M 5EXTA 1OAIA 4MGZE 4WW0A 3FTEA 3L25A 1XXHA 3TWLA 4II7A 3GRUA 1SXJB 3VKHA 3C3EA 2DZOB 2C9OA 4XGIA 1OKSA 2LVPC 2WZJA 2D7EA 2KZSA 2R45A 3SC3A 3HY5A 3PFIA 3SMPA 4I4LA 4MM3B 1D2NA 1L8QA 3QYBA 3EIHA 2X8AA 3FYCA 3SFZA 1NY5A 2CV2A 4LFCM 4M0WA 2C99A 4LF4M 2ZANA 2B3TA 3RGSA 3LCUA 2CHQA 2RGHA 3U61A 1TDHA 2UXCM 1XHBA 1N32M 1WR1B 5DNYA 3HHYA 3HKPA 2LHGA 2G5GX 1PJSA 5EXXA 5KO3A 3SHGB 4LGMA 1G59A 1IQPA 2KEBA 2VDBB 2MGWA 4LJ5A 1HR0M 2QHOB 1R7RA 4DR7M 2ZM6M 5ITTA 1ZMVA 1QDTA 2Z8YM 3RGPA 2XZFA 1N36M 2BJVA 1JQJC 2GQFA 5ITRA 4EIWA 2Z7JA 2FS1A 1ZQ9A 4Q7JA 2DZLA 2QQ8A 2L4FA 5C1BA 3UMMA 5IZ7D 4FWGA 4DR2M 1JR3D 3FTDA 2X4AA 3FRHA 4QOZC 1L1TA 1IBKM 2O01F 2LVOC 1SXJC 4GH9A 3ILKA 3VDUA 1NO1A 1Z59A 4AKGA 1OIZA 4QNRA 3CTWB 5E6JA 3PNVA 4M9ZA 3E4RA 3U6CA 3HU2A 2Y21A 4IBDA 1D0KA 3UGJA 2XEPA 4NSOB 4MGHA 2LXEA 4LFAM 3U6LA 1L2BA 1S3SA 2KNAA 2UU9M 3KOXE 3GPPA 2HCBA 2JWSA 2GNOA 2H1RA 1XXHB 5F3WA 2K9DA 2LHCA 2K0BX 2CRUA 2YR0A 3U60B 2LVQD 1PM5A 4XBOA 3GLIE 3GRVA 2DZNB 3GP1A 4JV5M 1F4IA 3MJ5A 2DWLA 1YLAA 2UUAM 4WURA 1V92A 1Z5CA 1TH3A 1V34A 4QNMA 5ITXE 2XZUA 1XNQM 1OAOC 4DV0M 3VFDA 3ZQJA 1MN3A 4DR3M 4IBGA 4G4QA 1GLNA 3HU3A 5EP4A 2EUCA 1N78A 2QBYA 2LVAA 2MR9A 4LCBA 1G4AE 1NJGA 1NV8A 2L6OA 3SAVA 4GKJM 3SAUA 1NY6A 3U61B 4QHSA 3GQ4A 1GO5A 3W68A 1QZEA 3KOZE 3JAMS 4LF7M 1VDDA 1GJTA 2O5RA 1NNUC 2LVNC 2RRUA 2UUBM 2D7GA 3KOYE 4OU7A 2R65A 2CP8A 3HHXA 4AG6A 1Z5AA 4G6ZA 2KXEA 4YHHM 1PJJA 3I4YA 3GPUA 4JI0M 2X49A 2QZ4A 1MU5A 4X62M 3A98B 4KO8A 2F5NA 4G4RA 1AUAA 4ANRA 4M0DA 1OIPA 3TL4X 2JNHA 4Z8XA 1KSFX 3AOEC 1J7KA 3SYKA 3C3DA 3LVWA 1HNWM 1QAOA 1GVNA 4DV7M 2DAEA 1IN5A 1P3QQ 2RGOA 1YSYA 2V1CA 3IECA 4UN2B 5FTKA 2YQZA 2KDLA 3DFZA 4L78A 2WSCF 2D7HA 1E9SA 3FRIA 2KRUA 5FTNA 3SBJA 2ZTCA 4FWHA 1NSFA 1DGHA 4FCVA 1OTRA 4CJ6A 3AV0A 5FTLA 2EA0A 3GLHE 1PJTA 3U6SA 2DWNA 4DR6M 5EP1A 5KPZA 2KHHA 2R4JA 2JZ0A 3A46A 1NHWC 2KNVA 2N35A 1R6BX 3FE3A 4LF5M 1EFUB 3FTCA 5DYIA 3TWKA 4R71A 4F2LA 3KOWE 3K92A 4HEOA 4PT5A 3AOGA 3SATA 4AQYM 1PRBA 4B7FA 4D80A 3E21A 1XMQM 2DWZB 1YUBA 2YNMD 4GRIA 2HKJA 5KPTA 1DO0A 2HHHM 4TUWA 1SXJE 5EXSA 2UXBM 2QBYB 1G8PA 2JY6B 3B7NA 2M5ZA 4LJ8A 1Y8GA 2H5XA 3U6DA 1Q02A 3U6QA 4G4NA 2HAKA 1IBLM 4LF8M 4LFBM 2VQEM 2V1UA 5KQ8A 3T6PA 2Z4SA 2C5RA 3F92A 1XNRM 3I01M 4PDIA 3C58A 1X37A 4DV4M 4GEWA 3QYEA 4XK8F 4LZZA 3SARA 4NC6A 1IY2A 1D0LA 1VEGA 5JI3E 5LMUM 5ITYA 4B7GA 1FJGM 5EXPA 3TE6A 1QUSA 3GO8A 4HL4A 1Q3CA 2A5YB 2JY5A 2FFJA 4LRSA 1Q39A 1K82A 3GLIA 3A45A 4L15A 5EP3A 2CWBA 2OO9A 5ITXA 4B3TM 3FTFA 5DFLA 1GL7A 4K0KM 1NVMA 4GC9A 2QNJA 2YFQA 3D8LA 1QANA 3KP1E 2L7IA 3SYLA 2LNHC 2RKOA 4DV2M 3LCVB 1SG9A 3UK6A 2EKKA 2JP7A 4IBBA 1G41A 4AKHA 4LF9M 2QPAA 4BB9A 2R46A 3FUWA 2KRKA 5LMNM 3HZJA 1TF0B 2Y0TA 1D0MA 1YE9A 4AKIA 4FCWA 1WGLA 4QOSA 2WSEF 2QENA 3W67A 2ZBKB 2DNAA 2W82A 3HHWA 4NRWA 2LH0A 4R7GA 4DR4M 1N75A 3HJSA 3FUTA 2I7PA 3HGIA 1TDZA 1R5LA 1N77A 2BWBA 4B08A 2K6BA 1XMOM 4NL4H 3AKZA 2XSZA 1LTMA 3LQQA 4MH0E 4RF0A 4X64M 1L2DA 2C96A 3NWLA 5L8RF 1GKIA 1IXZA 3TWMA 4JI3M 4OX9M 4GKKM 2JXNA 1JR3E 2VF7A 3CF2A 5IREB 4CGYB 1TGUA 2J5YA 8CATA 3GRRA 4FD2A 4IIWA 5EP2A 2V6ZM 2J7OA 1V33A 4PD2A 4X66M 4Z6YA 3M0EA 2J7NA 3GLHA 3THGA 2VIIA 4FWDA 2JUJA 4DUYM 2DAGA 4GHLA 2R18A 2R6FA 2DKLA 1QUTA 1VQ1A 2KZUA 4IBJA 4MGKE 2OPFA 1WIVA 4JI1M 3FKEA 1HNXM 2F4VM 1ZMWA 1IN4A 1T6OA 3B7ZA 4WP2A 3M6AA 2JY7A 1QAMA 3W0FA 2EJSA 3GQ5A 1XC8A 4JI7M 3L26A 3RE8A 1SXJA 3Q8GA 3VK7A 1FNNA 1QAQA 4RF1A 1HT2E 4GHAA 1IFYA 2OOBA 4CIZA 1IY1A 4M9SA 3GLGE 2EKFA 1T3TA 1HJPA 3KS8A 3NBIA 2ZAOA 1ORYB 4REZA 2DXIA 3HJQA 4I5SA 3W0LB 3LVVA 3DZDA 1C7YA 2Q2EB 3B89A 4AW4A 3VKGA 1K3WA 3TQSA 3GLFE 3UJNA 4JYAM 2CE7A 4GC5A 5EQTA 1Q3BA 2BNKA 3H4MA 4PDGA 2NQ8C 1WHCA 2DHRA 1QZMA 3KP0E 1EIJA 4IJFA 4NOOB 1DO2A 1RU3A 2FH0A 3ZH9B 1KYIA 4AI6A 3KVWA 3AFHA 3FD9A 4D82A
chains in the Genus database with same CATH topology
4OW0A 4CHTB 3DA1A 3T15A 4LJ7A 2M60A 4KLNA 3A42A 4JI4M 2ZAMA 3GRYA 4M9XA 5DYGA 1J09A 3KSXA 2CV0A 2AHMA 3KW6A 3GPYA 1NNJA 2Y0QA 3CF6E 4JI8M 1DGGA 4OVZA 2R4EA 4DV6M 2LWXA 4GITA 1R2ZA 4GIPA 4AZFA 3DOAA 1W5SA 4RNAA 1MX0A 3GLHB 2P5TA 4P16A 4X65M 2G8LA 5C18A 1WXQA 3L29A 4L4UA 3MHVC 3FUXA 4LJ6A 2ERCA 2EO2A 3HWSA 4B7HA 2OQ4A 4KHPM 1IM2A 3AOEA 4IJEA 4NRVA 3WHKA 2Z4RA 3AJIB 2UXDM 3IG5A 4DUZM 1EE8A 3FUVA 3FYDA 1TH4A 2KA6B 4DR1M 5BR8M 4IBCA 3RFWA 1QYRA 3U5ZA 3U60A 4B3MM 1JR3A 4L8RC 2C9CA 2CHGA 3KS4A 2BJWA 5KQDA 3I4VA 4A3VB 3OTOM 1IXRC 3T1YM 2KW0A 4MGIE 4D81A 3JR5A 1L2CA 1Z5BA 5KPRA 4IBIA 4PCZA 4LGYA 3R8FA 3E9SA 3TPZA 4R3DA 3SAWA 4IBKA 2L7HA 5E26A 1IY0A 3PXGA 3UZUA 1E94E 2DWMA 1J5EM 5JI2E 1DGHB 3Q8XA 3WHLA 1LV7A 1H6UA 1QQWA 3K1JA 1HQCA 1IN7A 3U6OA 3AL0C 4NXMM 4BBAA 3CF0A 4HLQA 2XH9A 4IBEA 4DV3M 1K3XA 2CEAA 2R62A 1Z6TA 3LQRA 1IXSB 1G3IA 3L2AA 1E32A 4LZJA 3HU1A 4FW9A 3L28A 5FLXS 3GLGA 3SMSA 2CHVA 3K2LA 4IBFA 2XFSA 4MB7A 3VLFB 1ZAEA 4LJ4A 5IT9S 1I4WA 7CATA 4OVZB 3HJ8A 4KODA 1OFHA 1E9RA 5EJCA 2XLJA 3FUUA 1R2YA 2F5SA 3SASA 1DGFA 4ITQA 3VDPA 3J7BA 4LRTA 3GLFA 3U6EA 2QCUA 1QVRA 1L1ZA 4JI2M 3J7AS 4B3SM 4L16A 3K8ZA 1GL6A 4JI6M 1W5TA 2FNAA 4BLCA 3QWLA 3PVSA 1NJFA 3BOSA 3U5ZB 4I8OA 3U6PA 3GLIB 4QHTA 1PJIA 2JA2A 2FOIC 1OJLA 3J27B 3GQ3A 5A2QS 1KFVA 2QP9X 2E5LM 2C98A 2HL7A 5FTJA 2XSZD 2Y20A 4LJAA 3KXEC 4G4OA 3SHFA 3MK6A 4JI5M 2XF3A 1IBMM 2UUCM 4LJ9A 1XWIA 3J80S 2I7NA 3JR4A 5ITUA 5H37D 1UM8A 2DVWB 5GKNA 3T1HM 2F5QA 3KSJA 1NHGC 4NSRA 4NXNM 5BPVA 2K47A 3ZC7B 3J81S 3B9PA 3QAUA 5FTMA 1IN6A 4DR5M 4AG5A 2VQFM 5FSWA 4DV1M 1HQYE 2CV1A 2Z3XA 3GLGB 2F5OA 4JN6A 2XGNA 4LF6M 3I51A 4B3RM 3VK8A 3IG8A 4YY3M 4JXJA 4LY6A 1I94M 3R9XB 4CISA 3EIEA 5ITQA 3GPXA 3KDSE 3KFUG 2F5PA 1N34M 3M7GA 3GLFB 3J2PB 2CUZA 1SXJD 1OFIA 1C1KA 3PNYA 2L09A 1N33M 4FVMA 4ZPXA 4LG2A 4I81A 3T38A 4S12A 2XFTA 1TH2A 1HNZM 5IWAM 1IN8A 1HT1E 4FCTA 3LMMA 3L27A 1DGBA 3D8BA 3ZCBB 4MGYE 3HHZA 3U6MA 4W5WA 2CFOA 2FE8A 4GMQA 4DV5M 5EXTA 4MGZE 4WW0A 3L25A 3FTEA 3VKHA 1XXHA 3TWLA 4II7A 3GRUA 1SXJB 2DZOB 2C9OA 4XGIA 2D7EA 2KZSA 2R45A 3SC3A 3SMPA 3PFIA 4I4LA 4MM3B 1D2NA 1L8QA 3EIHA 2X8AA 3FYCA 3SFZA 1NY5A 2CV2A 4LFCM 4M0WA 2C99A 4LF4M 2ZANA 3RGSA 2CHQA 2RGHA 3U61A 1TDHA 2UXCM 1XHBA 1N32M 5DNYA 3HHYA 3HKPA 2G5GX 5EXXA 5KO3A 3SHGB 4LGMA 1G59A 1IQPA 2KEBA 4LJ5A 1HR0M 1R7RA 4DR7M 2ZM6M 5ITTA 3RGPA 2XZFA 1N36M 2BJVA 1JQJC 5ITRA 4EIWA 2Z7JA 1ZQ9A 5C1BA 3UMMA 5IZ7D 4FWGA 4DR2M 1JR3D 3FTDA 2X4AA 4QOZC 1L1TA 1IBKM 1SXJC 4GH9A 3ILKA 3VDUA 1Z59A 4AKGA 4QNRA 3CTWB 5E6JA 3PNVA 4M9ZA 3E4RA 3U6CA 3HU2A 2Y21A 4IBDA 3UGJA 2XEPA 4NSOB 4MGHA 2LXEA 4LFAM 3U6LA 1L2BA 1S3SA 2UU9M 3KOXE 3GPPA 2HCBA 2H1RA 1XXHB 5F3WA 2YR0A 3U60B 1PM5A 4XBOA 4JV5M 3GRVA 2DZNB 3GP1A 3MJ5A 2DWLA 2UUAM 4WURA 1Z5CA 1TH3A 4QNMA 2XZUA 5ITXE 1XNQM 4DV0M 3VFDA 4DR3M 4IBGA 4G4QA 1GLNA 3HU3A 5EP4A 2EUCA 1N78A 2QBYA 4LCBA 1G4AE 1NJGA 3SAVA 2L6OA 4GKJM 3SAUA 1NY6A 3U61B 4QHSA 3GQ4A 3KOZE 3JAMS 4LF7M 1VDDA 2O5RA 1NNUC 2UUBM 2D7GA 3KOYE 4OU7A 2R65A 3HHXA 4AG6A 1PJJA 1Z5AA 4G6ZA 2KXEA 4YHHM 3I4YA 3GPUA 4JI0M 2X49A 2QZ4A 1MU5A 4X62M 3A98B 4KO8A 2F5NA 4G4RA 4M0DA 3TL4X 4Z8XA 1KSFX 3AOEC 1J7KA 3SYKA 3LVWA 1HNWM 1QAOA 1GVNA 4DV7M 2V1CA 1IN5A 5FTKA 2RGOA 1YSYA 2DWNA 2YQZA 3DFZA 4L78A 2D7HA 1E9SA 2KRUA 5FTNA 3SBJA 4FWHA 1NSFA 1DGHA 4FCVA 3AV0A 5FTLA 2EA0A 3U6SA 4DR6M 5EP1A 5KPZA 3A46A 2R4JA 4LF5M 1NHWC 1R6BX 3FTCA 3TWKA 5DYIA 3KOWE 3K92A 4PT5A 3AOGA 3SATA 4AQYM 4B7FA 4D80A 1XMQM 2DWZB 1YUBA 2YNMD 4GRIA 2HKJA 5KPTA 1DO0A 2HHHM 4TUWA 1SXJE 5EXSA 2UXBM 2QBYB 1G8PA 2M5ZA 4LJ8A 3U6DA 3U6QA 4G4NA 1IBLM 4LF8M 4LFBM 2VQEM 2V1UA 5KQ8A 2C5RA 2Z4SA 1XNRM 4PDIA 3C58A 1X37A 4DV4M 4LZZA 3SARA 1IY2A 5JI3E 5LMUM 5ITYA 4B7GA 1FJGM 5EXPA 3TE6A 3GO8A 4HL4A 1Q3CA 2A5YB 2FFJA 4LRSA 1Q39A 1K82A 3GLIA 3A45A 4L15A 5EP3A 5ITXA 4B3TM 3FTFA 4K0KM 1GL7A 1NVMA 4GC9A 2YFQA 3D8LA 1QANA 3KP1E 2L7IA 3SYLA 2LNHC 2RKOA 4DV2M 3UK6A 4IBBA 1G41A 4AKHA 4LF9M 2QPAA 4BB9A 2R46A 3FUWA 2KRKA 5LMNM 2Y0TA 1YE9A 4AKIA 4FCWA 4QOSA 2QENA 2ZBKB 2W82A 3HHWA 4NRWA 2LH0A 4R7GA 4DR4M 1N75A 3HJSA 3FUTA 2I7PA 3HGIA 1TDZA 1N77A 4B08A 1XMOM 4NL4H 3AKZA 2XSZA 4MH0E 3LQQA 4RF0A 4X64M 1L2DA 2C96A 3NWLA 1GKIA 1IXZA 3TWMA 4JI3M 4OX9M 4GKKM 4CGYB 3CF2A 5IREB 1TGUA 8CATA 3GRRA 4FD2A 4IIWA 5EP2A 2V6ZM 2J7OA 4PD2A 4X66M 4Z6YA 3M0EA 2J7NA 3GLHA 3THGA 2VIIA 4FWDA 4DUYM 4GHLA 2R18A 2KZUA 4JI1M 2OPFA 4IBJA 4MGKE 3FKEA 1HNXM 2F4VM 1IN4A 3M6AA 1QAMA 3W0FA 3GQ5A 1XC8A 4JI7M 3L26A 3RE8A 1SXJA 3VK7A 1FNNA 1QAQA 4RF1A 1HT2E 4GHAA 1IY1A 4M9SA 1T3TA 3KS8A 3NBIA 2ZAOA 1ORYB 4REZA 2DXIA 3HJQA 4I5SA 3W0LB 3LVVA 3DZDA 2Q2EB 4AW4A 3VKGA 1K3WA 3TQSA 3UJNA 4JYAM 2CE7A 4GC5A 5EQTA 1Q3BA 2BNKA 3H4MA 4PDGA 2NQ8C 2DHRA 1QZMA 3KP0E 4IJFA 4NOOB 1DO2A 3ZH9B 1KYIA 4AI6A 3KVWA 3AFHA 3FD9A 4D82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4O A;  1K82 A;  1Q39 A;  4JI5 M;  3U6C A;  1IBM M;  2UUC M;  3J80 S;  3A45 A;  3A42 A;  4JI4 M;  3JR4 A;  5ITU A;  4LFA M;  1L2B A;  5ITX A;  3U6L A;  2UU9 M;  4B3T M;  4K0K M;  3GPY A;  4JI8 M;  1NNJ A;  3GPP A;  3T1H M;  2F5Q A;  4DV6 M;  1R2Z A;  3DOA A;  4DV2 M;  4NXN M;  3J81 S;  1MX0 A;  1PM5 A;  4DR5 M;  3GP1 A;  4JV5 M;  4X65 M;  4LF9 M;  2VQF M;  2UUA M;  1Z5C A;  5LMN M;  2OQ4 A;  4DV1 M;  5ITX E;  2XZU A;  1XNQ M;  4DV0 M;  4KHP M;  4DR3 M;  4G4Q A;  2F5O A;  4NRV A;  4LF6 M;  4B3R M;  2UXD M;  3SAV A;  3VK8 A;  4DUZ M;  4YY3 M;  2ZBK B;  1EE8 A;  1I94 M;  3SAU A;  4GKJ M;  4DR1 M;  4NRW A;  4CIS A;  5BR8 M;  4DR4 M;  5ITQ A;  3GPX A;  2F5P A;  3GQ4 A;  4B3M M;  1N34 M;  3JAM S;  4LF7 M;  1TDZ A;  3OTO M;  1XMO M;  1N33 M;  1L2D A;  3T1Y M;  2UUB M;  4X64 M;  3JR5 A;  1L2C A;  1PJJ A;  1Z5B A;  1Z5A A;  4YHH M;  3TWM A;  4JI3 M;  1HNZ M;  4PCZ A;  4OX9 M;  4GKK M;  5IWA M;  4JI0 M;  3GPU A;  1MU5 A;  4X62 M;  2F5N A;  3SAW A;  4G4R A;  1J5E M;  3U6M A;  1HNW M;  4DV5 M;  4DV7 M;  3U6O A;  3TWL A;  4NXM M;  4PD2 A;  4X66 M;  4DV3 M;  1K3X A;  4DUY M;  4JI1 M;  2OPF A;  3SBJ A;  1HNX M;  2F4V M;  5FLX S;  4LFC M;  4MB7 A;  4LF4 M;  2EA0 A;  3W0F A;  5IT9 S;  3GQ5 A;  3U6S A;  1XC8 A;  4JI7 M;  4DR6 M;  1R2Y A;  3A46 A;  1TDH A;  2F5S A;  4LF5 M;  3VK7 A;  3SAS A;  2UXC M;  4ITQ A;  3TWK A;  1N32 M;  3U6E A;  3SAT A;  1L1Z A;  4AQY M;  4JI2 M;  3J7A S;  1XMQ M;  4B3S M;  2HKJ A;  4JI6 M;  2UXB M;  2HHH M;  1HR0 M;  2Q2E B;  4DR7 M;  2ZM6 M;  5ITT A;  1K3W A;  3U6D A;  2XZF A;  3U6Q A;  1N36 M;  4JYA M;  4G4N A;  1IBL M;  4LF8 M;  4LFB M;  2VQE M;  5ITR A;  3U6P A;  1Q3B A;  1XNR M;  4PDG A;  1PJI A;  3C58 A;  4PDI A;  4DV4 M;  4DR2 M;  3GQ3 A;  3SAR A;  5A2Q S;  1L1T A;  1IBK M;  5LMU M;  1KFV A;  5ITY A;  1FJG M;  2E5L M;  3GO8 A;  1Z59 A;  1Q3C A; 
#chains in the Genus database with same CATH topology
 4OW0 A;  1T43 A;  3DA1 A;  1IXS A;  3H4J A;  3T15 A;  4CHT B;  4G3O A;  4LJ7 A;  2M60 A;  4KLN A;  1TR8 A;  3A42 A;  2ZAM A;  3GRY A;  4JI4 M;  4M9X A;  5DYG A;  1J09 A;  3KSX A;  2CV0 A;  2AHM A;  3KW6 A;  2APL A;  3GPY A;  2Y0Q A;  3CF6 E;  1NNJ A;  1DGG A;  2MRO B;  2R4E A;  4OVZ A;  4DV6 M;  2LWX A;  4GIT A;  1R2Z A;  4GIP A;  4AZF A;  3DOA A;  1ZV1 A;  1W5S A;  4RNA A;  1MX0 A;  3GLH B;  2P5T A;  2BWE A;  4P16 A;  4X65 M;  2G8L A;  5C18 A;  1WXQ A;  3L29 A;  4L4U A;  3MHV C;  3FUX A;  1VDL A;  2ERC A;  2EO2 A;  3HWS A;  4LJ6 A;  3K9P A;  3V76 A;  4B7H A;  2OQ4 A;  4KHP M;  1IM2 A;  3AOE A;  4IJE A;  4NRV A;  3WHK A;  2Z4R A;  3AJI B;  2UXD M;  3IG5 A;  4DUZ M;  3CGW A;  1EE8 A;  3FUV A;  3FYD A;  1TH4 A;  2KA6 B;  4DR1 M;  5BR8 M;  4IBC A;  3RFW A;  1QYR A;  3U5Z A;  1R4G A;  3U60 A;  4B3M M;  2KNZ A;  1PJQ A;  1JR3 A;  4L8R C;  2C9C A;  2CHG A;  3KS4 A;  3MMP A;  2BJW A;  5KQD A;  3I4V A;  4A3V B;  3OTO M;  1IXR C;  3T1Y M;  1A5T A;  2DAK A;  2KW0 A;  4MGI E;  4D81 A;  3JR5 A;  1L2C A;  1ZMU A;  1Z5B A;  5KPR A;  4IBI A;  4PCZ A;  4LGY A;  3R8F A;  3E9S A;  3TPZ A;  1NV9 A;  4R3D A;  2DAI A;  4P17 A;  3SAW A;  4IBK A;  2L7H A;  5E26 A;  1IY0 A;  1PGY A;  3PXG A;  1E94 E;  3UZU A;  2DWM A;  1J5E M;  1VEJ A;  2G3Q A;  1DGH B;  3Q8X A;  5JI2 E;  3WHL A;  1JB0 F;  2ZTD A;  1LV7 A;  1H6U A;  1QQW A;  3K1J A;  1HQC A;  1IN7 A;  3NBX X;  1AIP C;  3U6O A;  3AL0 C;  4NXM M;  3HX3 A;  4BBA A;  3CF0 A;  1G71 A;  1BVS A;  4HLQ A;  2XH9 A;  3I04 M;  4IBE A;  4DV3 M;  1K3X A;  2CEA A;  2R62 A;  1Z6T A;  3LQR A;  1IXS B;  1G3I A;  3L2A A;  1VEK A;  2JY8 A;  4KT0 F;  1E32 A;  2LTU A;  4LZJ A;  3HU1 A;  4FW9 A;  3L28 A;  2VF8 A;  5FLX S;  3GLG A;  3SMS A;  2CHV A;  3K2L A;  4IBF A;  2XFS A;  1XXH E;  4MB7 A;  3VLF B;  1ZAE A;  1QDR A;  4LJ4 A;  5IT9 S;  1I4W A;  7CAT A;  4OVZ B;  3HJ8 A;  4KOD A;  1OFH A;  1E9R A;  5EJC A;  2XLJ A;  3FUU A;  1R2Y A;  2F5S A;  3SAS A;  1DGF A;  4ITQ A;  3VDP A;  3J7B A;  4LRT A;  3GLF A;  2O25 A;  3U6E A;  2JZ1 A;  2QCU A;  1QVR A;  1L1Z A;  4JI2 M;  3J7A S;  1WJ7 A;  4B3S M;  4L16 A;  3K8Z A;  1GL6 A;  2L4E A;  1W5T A;  4JI6 M;  1GJS A;  2FNA A;  4BLC A;  3QWL A;  2WSF F;  3PVS A;  1NJF A;  3BOS A;  3U5Z B;  4I8O A;  3U6P A;  3GLI B;  1VG5 A;  2LBC A;  4QHT A;  1PJI A;  3IHP A;  2JA2 A;  2FOI C;  1OJL A;  3J27 B;  1CUK A;  3GQ3 A;  4JI8 M;  2HWJ A;  4RKU F;  5A2Q S;  1KFV A;  2QP9 X;  2E5L M;  2C98 A;  2HL7 A;  5FTJ A;  2XSZ D;  2Y20 A;  4LJA A;  3KXE C;  4G4O A;  3SHF A;  3MK6 A;  4JI5 M;  2XF3 A;  1IBM M;  2UUC M;  4LJ9 A;  1XWI A;  3J80 S;  2I7N A;  3JR4 A;  5ITU A;  2DI0 A;  5H37 D;  3B74 A;  1DV0 A;  1UM8 A;  2DVW B;  1TTE A;  5GKN A;  3T1H M;  2F5Q A;  3KSJ A;  1NHG C;  4F1I A;  4NSR A;  4NXN M;  5BPV A;  1OQY A;  2K47 A;  3ZC7 B;  3J81 S;  3B9P A;  3QAU A;  5FTM A;  1IN6 A;  1UFZ A;  2DHY A;  3BBZ A;  3B7Q A;  4DR5 M;  4AG5 A;  2VQF M;  5FSW A;  3K9O A;  4DBG B;  4DV1 M;  1HQY E;  2R0I A;  2CV1 A;  2Z3X A;  2OOA A;  3GLG B;  2F5O A;  4JN6 A;  2XGN A;  4LF6 M;  3I51 A;  4B3R M;  2DEN A;  3IG8 A;  4YY3 M;  3VK8 A;  4JXJ A;  4LY6 A;  1I94 M;  3R9X B;  4CIS A;  3EIE A;  5ITQ A;  4L6V 6;  3GPX A;  3KDS E;  3KFU G;  2F5P A;  1N34 M;  3M7G A;  2DAM A;  3GLF B;  3J2P B;  2CUZ A;  1SXJ D;  3BXW A;  1OFI A;  1C1K A;  3PNY A;  2L09 A;  2R44 A;  1N33 M;  4FVM A;  4ZPX A;  4LG2 A;  2L2D A;  4I81 A;  3T38 A;  4S12 A;  2XFT A;  1GAB A;  1TH2 A;  4Y28 F;  1HNZ M;  5IWA M;  1IN8 A;  1HT1 E;  4FCT A;  3E46 A;  1MJG M;  3LMM A;  2MJ5 B;  3L27 A;  1DGB A;  3D8B A;  3ZCB B;  4MGY E;  1XB2 B;  3HHZ A;  3U6M A;  1WGN A;  3LW5 F;  2QSF X;  2CFO A;  2FE8 A;  4W5W A;  3C9P A;  4GMQ A;  2MH8 A;  4DV5 M;  5EXT A;  1OAI A;  4MGZ E;  4WW0 A;  3FTE A;  3L25 A;  1XXH A;  3TWL A;  4II7 A;  3GRU A;  1SXJ B;  3VKH A;  3C3E A;  2DZO B;  2C9O A;  4XGI A;  1OKS A;  2LVP C;  2WZJ A;  2D7E A;  2KZS A;  2R45 A;  3SC3 A;  3HY5 A;  3PFI A;  3SMP A;  4I4L A;  4MM3 B;  1D2N A;  1L8Q A;  3QYB A;  3EIH A;  2X8A A;  3FYC A;  3SFZ A;  1NY5 A;  2CV2 A;  4LFC M;  4M0W A;  2C99 A;  4LF4 M;  2ZAN A;  2B3T A;  3RGS A;  3LCU A;  2CHQ A;  2RGH A;  3U61 A;  1TDH A;  2UXC M;  1XHB A;  1N32 M;  1WR1 B;  5DNY A;  3HHY A;  3HKP A;  2LHG A;  2G5G X;  1PJS A;  5EXX A;  5KO3 A;  3SHG B;  4LGM A;  1G59 A;  1IQP A;  2KEB A;  2VDB B;  2MGW A;  4LJ5 A;  1HR0 M;  2QHO B;  1R7R A;  4DR7 M;  2ZM6 M;  5ITT A;  1ZMV A;  1QDT A;  2Z8Y M;  3RGP A;  2XZF A;  1N36 M;  2BJV A;  1JQJ C;  2GQF A;  5ITR A;  4EIW A;  2Z7J A;  2FS1 A;  1ZQ9 A;  4Q7J A;  2DZL A;  2QQ8 A;  2L4F A;  5C1B A;  3UMM A;  5IZ7 D;  4FWG A;  4DR2 M;  1JR3 D;  3FTD A;  2X4A A;  3FRH A;  4QOZ C;  1L1T A;  1IBK M;  2O01 F;  2LVO C;  1SXJ C;  4GH9 A;  3ILK A;  3VDU A;  1NO1 A;  1Z59 A;  4AKG A;  1OIZ A;  4QNR A;  3CTW B;  5E6J A;  3PNV A;  4M9Z A;  3E4R A;  3U6C A;  3HU2 A;  2Y21 A;  4IBD A;  1D0K A;  3UGJ A;  2XEP A;  4NSO B;  4MGH A;  2LXE A;  4LFA M;  3U6L A;  1L2B A;  1S3S A;  2KNA A;  2UU9 M;  3KOX E;  3GPP A;  2HCB A;  2JWS A;  2GNO A;  2H1R A;  1XXH B;  5F3W A;  2K9D A;  2LHC A;  2K0B X;  2CRU A;  2YR0 A;  3U60 B;  2LVQ D;  1PM5 A;  4XBO A;  3GLI E;  3GRV A;  2DZN B;  3GP1 A;  4JV5 M;  1F4I A;  3MJ5 A;  2DWL A;  1YLA A;  2UUA M;  4WUR A;  1V92 A;  1Z5C A;  1TH3 A;  1V34 A;  4QNM A;  5ITX E;  2XZU A;  1XNQ M;  1OAO C;  4DV0 M;  3VFD A;  3ZQJ A;  1MN3 A;  4DR3 M;  4IBG A;  4G4Q A;  1GLN A;  3HU3 A;  5EP4 A;  2EUC A;  1N78 A;  2QBY A;  2LVA A;  2MR9 A;  4LCB A;  1G4A E;  1NJG A;  1NV8 A;  2L6O A;  3SAV A;  4GKJ M;  3SAU A;  1NY6 A;  3U61 B;  4QHS A;  3GQ4 A;  1GO5 A;  3W68 A;  1QZE A;  3KOZ E;  3JAM S;  4LF7 M;  1VDD A;  1GJT A;  2O5R A;  1NNU C;  2LVN C;  2RRU A;  2UUB M;  2D7G A;  3KOY E;  4OU7 A;  2R65 A;  2CP8 A;  3HHX A;  4AG6 A;  1Z5A A;  4G6Z A;  2KXE A;  4YHH M;  1PJJ A;  3I4Y A;  3GPU A;  4JI0 M;  2X49 A;  2QZ4 A;  1MU5 A;  4X62 M;  3A98 B;  4KO8 A;  2F5N A;  4G4R A;  1AUA A;  4ANR A;  4M0D A;  1OIP A;  3TL4 X;  2JNH A;  4Z8X A;  1KSF X;  3AOE C;  1J7K A;  3SYK A;  3C3D A;  3LVW A;  1HNW M;  1QAO A;  1GVN A;  4DV7 M;  2DAE A;  1IN5 A;  1P3Q Q;  2RGO A;  1YSY A;  2V1C A;  3IEC A;  4UN2 B;  5FTK A;  2YQZ A;  2KDL A;  3DFZ A;  4L78 A;  2WSC F;  2D7H A;  1E9S A;  3FRI A;  2KRU A;  5FTN A;  3SBJ A;  2ZTC A;  4FWH A;  1NSF A;  1DGH A;  4FCV A;  1OTR A;  4CJ6 A;  3AV0 A;  5FTL A;  2EA0 A;  3GLH E;  1PJT A;  3U6S A;  2DWN A;  4DR6 M;  5EP1 A;  5KPZ A;  2KHH A;  2R4J A;  2JZ0 A;  3A46 A;  1NHW C;  2KNV A;  2N35 A;  1R6B X;  3FE3 A;  4LF5 M;  1EFU B;  3FTC A;  5DYI A;  3TWK A;  4R71 A;  4F2L A;  3KOW E;  3K92 A;  4HEO A;  4PT5 A;  3AOG A;  3SAT A;  4AQY M;  1PRB A;  4B7F A;  4D80 A;  3E21 A;  1XMQ M;  2DWZ B;  1YUB A;  2YNM D;  4GRI A;  2HKJ A;  5KPT A;  1DO0 A;  2HHH M;  4TUW A;  1SXJ E;  5EXS A;  2UXB M;  2QBY B;  1G8P A;  2JY6 B;  3B7N A;  2M5Z A;  4LJ8 A;  1Y8G A;  2H5X A;  3U6D A;  1Q02 A;  3U6Q A;  4G4N A;  2HAK A;  1IBL M;  4LF8 M;  4LFB M;  2VQE M;  2V1U A;  5KQ8 A;  3T6P A;  2Z4S A;  2C5R A;  3F92 A;  1XNR M;  3I01 M;  4PDI A;  3C58 A;  1X37 A;  4DV4 M;  4GEW A;  3QYE A;  4XK8 F;  4LZZ A;  3SAR A;  4NC6 A;  1IY2 A;  1D0L A;  1VEG A;  5JI3 E;  5LMU M;  5ITY A;  4B7G A;  1FJG M;  5EXP A;  3TE6 A;  1QUS A;  3GO8 A;  4HL4 A;  1Q3C A;  2A5Y B;  2JY5 A;  2FFJ A;  4LRS A;  1Q39 A;  1K82 A;  3GLI A;  3A45 A;  4L15 A;  5EP3 A;  2CWB A;  2OO9 A;  5ITX A;  4B3T M;  3FTF A;  5DFL A;  1GL7 A;  4K0K M;  1NVM A;  4GC9 A;  2QNJ A;  2YFQ A;  3D8L A;  1QAN A;  3KP1 E;  2L7I A;  3SYL A;  2LNH C;  2RKO A;  4DV2 M;  3LCV B;  1SG9 A;  3UK6 A;  2EKK A;  2JP7 A;  4IBB A;  1G41 A;  4AKH A;  4LF9 M;  2QPA A;  4BB9 A;  2R46 A;  3FUW A;  2KRK A;  5LMN M;  3HZJ A;  1TF0 B;  2Y0T A;  1D0M A;  1YE9 A;  4AKI A;  4FCW A;  1WGL A;  4QOS A;  2WSE F;  2QEN A;  3W67 A;  2ZBK B;  2DNA A;  2W82 A;  3HHW A;  4NRW A;  2LH0 A;  4R7G A;  4DR4 M;  1N75 A;  3HJS A;  3FUT A;  2I7P A;  3HGI A;  1TDZ A;  1R5L A;  1N77 A;  2BWB A;  4B08 A;  2K6B A;  1XMO M;  4NL4 H;  3AKZ A;  2XSZ A;  1LTM A;  3LQQ A;  4MH0 E;  4RF0 A;  4X64 M;  1L2D A;  2C96 A;  3NWL A;  5L8R F;  1GKI A;  1IXZ A;  3TWM A;  4JI3 M;  4OX9 M;  4GKK M;  2JXN A;  1JR3 E;  2VF7 A;  3CF2 A;  5IRE B;  4CGY B;  1TGU A;  2J5Y A;  8CAT A;  3GRR A;  4FD2 A;  4IIW A;  5EP2 A;  2V6Z M;  2J7O A;  1V33 A;  4PD2 A;  4X66 M;  4Z6Y A;  3M0E A;  2J7N A;  3GLH A;  3THG A;  2VII A;  4FWD A;  2JUJ A;  4DUY M;  2DAG A;  4GHL A;  2R18 A;  2R6F A;  2DKL A;  1QUT A;  1VQ1 A;  2KZU A;  4IBJ A;  4MGK E;  2OPF A;  1WIV A;  4JI1 M;  3FKE A;  1HNX M;  2F4V M;  1ZMW A;  1IN4 A;  1T6O A;  3B7Z A;  4WP2 A;  3M6A A;  2JY7 A;  1QAM A;  3W0F A;  2EJS A;  3GQ5 A;  1XC8 A;  4JI7 M;  3L26 A;  3RE8 A;  1SXJ A;  3Q8G A;  3VK7 A;  1FNN A;  1QAQ A;  4RF1 A;  1HT2 E;  4GHA A;  1IFY A;  2OOB A;  4CIZ A;  1IY1 A;  4M9S A;  3GLG E;  2EKF A;  1T3T A;  1HJP A;  3KS8 A;  3NBI A;  2ZAO A;  1ORY B;  4REZ A;  2DXI A;  3HJQ A;  4I5S A;  3W0L B;  3LVV A;  3DZD A;  1C7Y A;  2Q2E B;  3B89 A;  4AW4 A;  3VKG A;  1K3W A;  3TQS A;  3GLF E;  3UJN A;  4JYA M;  2CE7 A;  4GC5 A;  5EQT A;  1Q3B A;  2BNK A;  3H4M A;  4PDG A;  2NQ8 C;  1WHC A;  2DHR A;  1QZM A;  3KP0 E;  1EIJ A;  4IJF A;  4NOO B;  1DO2 A;  1RU3 A;  2FH0 A;  3ZH9 B;  1KYI A;  4AI6 A;  3KVW A;  3AFH A;  3FD9 A;  4D82 A; 
#chains in the Genus database with same CATH homology
 4OW0 A;  4CHT B;  3DA1 A;  3T15 A;  4LJ7 A;  2M60 A;  4KLN A;  3A42 A;  4JI4 M;  2ZAM A;  3GRY A;  4M9X A;  5DYG A;  1J09 A;  3KSX A;  2CV0 A;  2AHM A;  3KW6 A;  3GPY A;  1NNJ A;  2Y0Q A;  3CF6 E;  4JI8 M;  1DGG A;  4OVZ A;  2R4E A;  4DV6 M;  2LWX A;  4GIT A;  1R2Z A;  4GIP A;  4AZF A;  3DOA A;  1W5S A;  4RNA A;  1MX0 A;  3GLH B;  2P5T A;  4P16 A;  4X65 M;  2G8L A;  5C18 A;  1WXQ A;  3L29 A;  4L4U A;  3MHV C;  3FUX A;  4LJ6 A;  2ERC A;  2EO2 A;  3HWS A;  4B7H A;  2OQ4 A;  4KHP M;  1IM2 A;  3AOE A;  4IJE A;  4NRV A;  3WHK A;  2Z4R A;  3AJI B;  2UXD M;  3IG5 A;  4DUZ M;  1EE8 A;  3FUV A;  3FYD A;  1TH4 A;  2KA6 B;  4DR1 M;  5BR8 M;  4IBC A;  3RFW A;  1QYR A;  3U5Z A;  3U60 A;  4B3M M;  1JR3 A;  4L8R C;  2C9C A;  2CHG A;  3KS4 A;  2BJW A;  5KQD A;  3I4V A;  4A3V B;  3OTO M;  1IXR C;  3T1Y M;  2KW0 A;  4MGI E;  4D81 A;  3JR5 A;  1L2C A;  1Z5B A;  5KPR A;  4IBI A;  4PCZ A;  4LGY A;  3R8F A;  3E9S A;  3TPZ A;  4R3D A;  3SAW A;  4IBK A;  2L7H A;  5E26 A;  1IY0 A;  3PXG A;  3UZU A;  1E94 E;  2DWM A;  1J5E M;  5JI2 E;  1DGH B;  3Q8X A;  3WHL A;  1LV7 A;  1H6U A;  1QQW A;  3K1J A;  1HQC A;  1IN7 A;  3U6O A;  3AL0 C;  4NXM M;  4BBA A;  3CF0 A;  4HLQ A;  2XH9 A;  4IBE A;  4DV3 M;  1K3X A;  2CEA A;  2R62 A;  1Z6T A;  3LQR A;  1IXS B;  1G3I A;  3L2A A;  1E32 A;  4LZJ A;  3HU1 A;  4FW9 A;  3L28 A;  5FLX S;  3GLG A;  3SMS A;  2CHV A;  3K2L A;  4IBF A;  2XFS A;  4MB7 A;  3VLF B;  1ZAE A;  4LJ4 A;  5IT9 S;  1I4W A;  7CAT A;  4OVZ B;  3HJ8 A;  4KOD A;  1OFH A;  1E9R A;  5EJC A;  2XLJ A;  3FUU A;  1R2Y A;  2F5S A;  3SAS A;  1DGF A;  4ITQ A;  3VDP A;  3J7B A;  4LRT A;  3GLF A;  3U6E A;  2QCU A;  1QVR A;  1L1Z A;  4JI2 M;  3J7A S;  4B3S M;  4L16 A;  3K8Z A;  1GL6 A;  4JI6 M;  1W5T A;  2FNA A;  4BLC A;  3QWL A;  3PVS A;  1NJF A;  3BOS A;  3U5Z B;  4I8O A;  3U6P A;  3GLI B;  4QHT A;  1PJI A;  2JA2 A;  2FOI C;  1OJL A;  3J27 B;  3GQ3 A;  5A2Q S;  1KFV A;  2QP9 X;  2E5L M;  2C98 A;  2HL7 A;  5FTJ A;  2XSZ D;  2Y20 A;  4LJA A;  3KXE C;  4G4O A;  3SHF A;  3MK6 A;  4JI5 M;  2XF3 A;  1IBM M;  2UUC M;  4LJ9 A;  1XWI A;  3J80 S;  2I7N A;  3JR4 A;  5ITU A;  5H37 D;  1UM8 A;  2DVW B;  5GKN A;  3T1H M;  2F5Q A;  3KSJ A;  1NHG C;  4NSR A;  4NXN M;  5BPV A;  2K47 A;  3ZC7 B;  3J81 S;  3B9P A;  3QAU A;  5FTM A;  1IN6 A;  4DR5 M;  4AG5 A;  2VQF M;  5FSW A;  4DV1 M;  1HQY E;  2CV1 A;  2Z3X A;  3GLG B;  2F5O A;  4JN6 A;  2XGN A;  4LF6 M;  3I51 A;  4B3R M;  3VK8 A;  3IG8 A;  4YY3 M;  4JXJ A;  4LY6 A;  1I94 M;  3R9X B;  4CIS A;  3EIE A;  5ITQ A;  3GPX A;  3KDS E;  3KFU G;  2F5P A;  1N34 M;  3M7G A;  3GLF B;  3J2P B;  2CUZ A;  1SXJ D;  1OFI A;  1C1K A;  3PNY A;  2L09 A;  1N33 M;  4FVM A;  4ZPX A;  4LG2 A;  4I81 A;  3T38 A;  4S12 A;  2XFT A;  1TH2 A;  1HNZ M;  5IWA M;  1IN8 A;  1HT1 E;  4FCT A;  3LMM A;  3L27 A;  1DGB A;  3D8B A;  3ZCB B;  4MGY E;  3HHZ A;  3U6M A;  4W5W A;  2CFO A;  2FE8 A;  4GMQ A;  4DV5 M;  5EXT A;  4MGZ E;  4WW0 A;  3L25 A;  3FTE A;  3VKH A;  1XXH A;  3TWL A;  4II7 A;  3GRU A;  1SXJ B;  2DZO B;  2C9O A;  4XGI A;  2D7E A;  2KZS A;  2R45 A;  3SC3 A;  3SMP A;  3PFI A;  4I4L A;  4MM3 B;  1D2N A;  1L8Q A;  3EIH A;  2X8A A;  3FYC A;  3SFZ A;  1NY5 A;  2CV2 A;  4LFC M;  4M0W A;  2C99 A;  4LF4 M;  2ZAN A;  3RGS A;  2CHQ A;  2RGH A;  3U61 A;  1TDH A;  2UXC M;  1XHB A;  1N32 M;  5DNY A;  3HHY A;  3HKP A;  2G5G X;  5EXX A;  5KO3 A;  3SHG B;  4LGM A;  1G59 A;  1IQP A;  2KEB A;  4LJ5 A;  1HR0 M;  1R7R A;  4DR7 M;  2ZM6 M;  5ITT A;  3RGP A;  2XZF A;  1N36 M;  2BJV A;  1JQJ C;  5ITR A;  4EIW A;  2Z7J A;  1ZQ9 A;  5C1B A;  3UMM A;  5IZ7 D;  4FWG A;  4DR2 M;  1JR3 D;  3FTD A;  2X4A A;  4QOZ C;  1L1T A;  1IBK M;  1SXJ C;  4GH9 A;  3ILK A;  3VDU A;  1Z59 A;  4AKG A;  4QNR A;  3CTW B;  5E6J A;  3PNV A;  4M9Z A;  3E4R A;  3U6C A;  3HU2 A;  2Y21 A;  4IBD A;  3UGJ A;  2XEP A;  4NSO B;  4MGH A;  2LXE A;  4LFA M;  3U6L A;  1L2B A;  1S3S A;  2UU9 M;  3KOX E;  3GPP A;  2HCB A;  2H1R A;  1XXH B;  5F3W A;  2YR0 A;  3U60 B;  1PM5 A;  4XBO A;  4JV5 M;  3GRV A;  2DZN B;  3GP1 A;  3MJ5 A;  2DWL A;  2UUA M;  4WUR A;  1Z5C A;  1TH3 A;  4QNM A;  2XZU A;  5ITX E;  1XNQ M;  4DV0 M;  3VFD A;  4DR3 M;  4IBG A;  4G4Q A;  1GLN A;  3HU3 A;  5EP4 A;  2EUC A;  1N78 A;  2QBY A;  4LCB A;  1G4A E;  1NJG A;  3SAV A;  2L6O A;  4GKJ M;  3SAU A;  1NY6 A;  3U61 B;  4QHS A;  3GQ4 A;  3KOZ E;  3JAM S;  4LF7 M;  1VDD A;  2O5R A;  1NNU C;  2UUB M;  2D7G A;  3KOY E;  4OU7 A;  2R65 A;  3HHX A;  4AG6 A;  1PJJ A;  1Z5A A;  4G6Z A;  2KXE A;  4YHH M;  3I4Y A;  3GPU A;  4JI0 M;  2X49 A;  2QZ4 A;  1MU5 A;  4X62 M;  3A98 B;  4KO8 A;  2F5N A;  4G4R A;  4M0D A;  3TL4 X;  4Z8X A;  1KSF X;  3AOE C;  1J7K A;  3SYK A;  3LVW A;  1HNW M;  1QAO A;  1GVN A;  4DV7 M;  2V1C A;  1IN5 A;  5FTK A;  2RGO A;  1YSY A;  2DWN A;  2YQZ A;  3DFZ A;  4L78 A;  2D7H A;  1E9S A;  2KRU A;  5FTN A;  3SBJ A;  4FWH A;  1NSF A;  1DGH A;  4FCV A;  3AV0 A;  5FTL A;  2EA0 A;  3U6S A;  4DR6 M;  5EP1 A;  5KPZ A;  3A46 A;  2R4J A;  4LF5 M;  1NHW C;  1R6B X;  3FTC A;  3TWK A;  5DYI A;  3KOW E;  3K92 A;  4PT5 A;  3AOG A;  3SAT A;  4AQY M;  4B7F A;  4D80 A;  1XMQ M;  2DWZ B;  1YUB A;  2YNM D;  4GRI A;  2HKJ A;  5KPT A;  1DO0 A;  2HHH M;  4TUW A;  1SXJ E;  5EXS A;  2UXB M;  2QBY B;  1G8P A;  2M5Z A;  4LJ8 A;  3U6D A;  3U6Q A;  4G4N A;  1IBL M;  4LF8 M;  4LFB M;  2VQE M;  2V1U A;  5KQ8 A;  2C5R A;  2Z4S A;  1XNR M;  4PDI A;  3C58 A;  1X37 A;  4DV4 M;  4LZZ A;  3SAR A;  1IY2 A;  5JI3 E;  5LMU M;  5ITY A;  4B7G A;  1FJG M;  5EXP A;  3TE6 A;  3GO8 A;  4HL4 A;  1Q3C A;  2A5Y B;  2FFJ A;  4LRS A;  1Q39 A;  1K82 A;  3GLI A;  3A45 A;  4L15 A;  5EP3 A;  5ITX A;  4B3T M;  3FTF A;  4K0K M;  1GL7 A;  1NVM A;  4GC9 A;  2YFQ A;  3D8L A;  1QAN A;  3KP1 E;  2L7I A;  3SYL A;  2LNH C;  2RKO A;  4DV2 M;  3UK6 A;  4IBB A;  1G41 A;  4AKH A;  4LF9 M;  2QPA A;  4BB9 A;  2R46 A;  3FUW A;  2KRK A;  5LMN M;  2Y0T A;  1YE9 A;  4AKI A;  4FCW A;  4QOS A;  2QEN A;  2ZBK B;  2W82 A;  3HHW A;  4NRW A;  2LH0 A;  4R7G A;  4DR4 M;  1N75 A;  3HJS A;  3FUT A;  2I7P A;  3HGI A;  1TDZ A;  1N77 A;  4B08 A;  1XMO M;  4NL4 H;  3AKZ A;  2XSZ A;  4MH0 E;  3LQQ A;  4RF0 A;  4X64 M;  1L2D A;  2C96 A;  3NWL A;  1GKI A;  1IXZ A;  3TWM A;  4JI3 M;  4OX9 M;  4GKK M;  4CGY B;  3CF2 A;  5IRE B;  1TGU A;  8CAT A;  3GRR A;  4FD2 A;  4IIW A;  5EP2 A;  2V6Z M;  2J7O A;  4PD2 A;  4X66 M;  4Z6Y A;  3M0E A;  2J7N A;  3GLH A;  3THG A;  2VII A;  4FWD A;  4DUY M;  4GHL A;  2R18 A;  2KZU A;  4JI1 M;  2OPF A;  4IBJ A;  4MGK E;  3FKE A;  1HNX M;  2F4V M;  1IN4 A;  3M6A A;  1QAM A;  3W0F A;  3GQ5 A;  1XC8 A;  4JI7 M;  3L26 A;  3RE8 A;  1SXJ A;  3VK7 A;  1FNN A;  1QAQ A;  4RF1 A;  1HT2 E;  4GHA A;  1IY1 A;  4M9S A;  1T3T A;  3KS8 A;  3NBI A;  2ZAO A;  1ORY B;  4REZ A;  2DXI A;  3HJQ A;  4I5S A;  3W0L B;  3LVV A;  3DZD A;  2Q2E B;  4AW4 A;  3VKG A;  1K3W A;  3TQS A;  3UJN A;  4JYA M;  2CE7 A;  4GC5 A;  5EQT A;  1Q3B A;  2BNK A;  3H4M A;  4PDG A;  2NQ8 C;  2DHR A;  1QZM A;  3KP0 E;  4IJF A;  4NOO B;  1DO2 A;  3ZH9 B;  1KYI A;  4AI6 A;  3KVW A;  3AFH A;  3FD9 A;  4D82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...