2UXDM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxdM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxdM02
3A42A 1L1ZA 4LF6M 3GPUA 1NNJA 2UU9M 4DUZM 1N36M 1KFVA 1N33M 4DV0M 1N32M 4NRVA 1Z5CA 1TDZA 4X65M 4LF8M 4LF7M 4PDGA 3GQ4A 4JI5M 3SAWA 1Z5BA 1XMOM 3SARA 4JYAM 3A46A 4DR6M 1L2BA 5ITXE 3U6QA 4NRWA 3TWMA 4JV5M 2XZFA 1Q3BA 2XZUA 1PM5A 1L2DA 2F5QA 4DR1M 1IBKM 5ITUA 3SASA 2F5OA 4DV5M 1IBLM 3GPPA 4LFCM 2VQFM 4LF9M 5FLXS 4DUYM 3U6OA 4X66M 2ZM6M 2ZBKB 3U6SA 1XMQM 4NXNM 4JI3M 1PJIA 4DV1M 3VK8A 2UXCM 4K0KM 4NXMM 1I94M 2HHHM 3GO8A 2F5NA 1Z59A 2UUBM 1EE8A 3OTOM 1L1TA 3GP1A 1R2ZA 4B3RM 4DV3M 4G4RA 3JR4A 5ITRA 2UUCM 1L2CA 5ITXA 4DR4M 3GPXA 1K3WA 4AQYM 4YHHM 3U6CA 3SATA 4ITQA 1PJJA 3GQ3A 4JI6M 4JI4M 1Q3CA 2EA0A 3C58A 3JR5A 5ITTA 3J80S 2OQ4A 3A45A 3U6LA 4JI2M 1HNWM 4B3MM 4GKJM 3SAUA 2UUAM 4JI7M 1XNQM 3U6MA 4YY3M 2F5PA 1Q39A 4KHPM 2VQEM 4GKKM 4PD2A 1J5EM 3DOAA 4DV6M 4G4QA 4DR3M 4JI8M 5A2QS 4OX9M 1FJGM 1N34M 2HKJA 2F4VM 1XC8A 3GPYA 1HNZM 1HNXM 4JI1M 3TWKA 3T1HM 5LMUM 4DR5M 1Z5AA 2OPFA 2Q2EB 3U6EA 3GQ5A 1MX0A 4X62M 4PDIA 4G4NA 3TWLA 4B3TM 4MB7A 2UXBM 1TDHA 3U6DA 1K82A 4PCZA 2E5LM 4X64M 4LFBM 5LMNM 4B3SM 4CISA 5IWAM 3J7AS 5IT9S 4DV7M 5ITYA 5BR8M 3U6PA 4LF4M 3VK7A 1MU5A 3W0FA 4DR2M 1K3XA 4LF5M 1R2YA 5ITQA 2UXDM 3J81S 4G4OA 3T1YM 1XNRM 3SAVA 2F5SA 1HR0M 4JI0M 1IBMM 4LFAM 4DR7M 3SBJA 4DV2M 4DV4M 3JAMS
chains in the Genus database with same CATH superfamily
2HCBA 2QQ8A 2VIIA 4LRTA 3ZC7B 2YR0A 4LJ4A 2VF7A 4KLNA 3W0LB 2DHRA 1N36M 1IN7A 3AOEA 4DV0M 1SXJE 2DZOB 7CATA 1HJPA 1TDZA 1OTRA 3VDUA 2XLJA 2LTUA 3FYDA 3H4MA 2DAEA 3HHXA 3L25A 4M9SA 2MGWA 3M6AA 1Z5BA 3GLIE 4GHAA 3ZCBB 2DI0A 2YNMD 2A5YB 4II7A 5ITXE 1DV0A 4LRSA 2XZFA 1ZQ9A 4RF1A 2FFJA 3QYEA 1MN3A 4DR1M 2O25A 2W82A 4DV5M 2JXNA 4R7GA 4B7HA 4IBCA 4X66M 3K2LA 1SXJD 2CRUA 3KSXA 1YUBA 4UN2B 4JI3M 4DV1M 3VK8A 2CUZA 2LBCA 2Z3XA 3THGA 2UXCM 3K1JA 3MJ5A 1XHBA 2K9DA 1JR3A 1IQPA 3CF6E 2R18A 2KRUA 3EIHA 2Y0QA 2F5NA 1IXRC 4I4LA 4IBKA 2UUBM 1EE8A 2J5YA 3OTOM 5EQTA 3BOSA 3GP1A 1NJGA 3I01M 1QANA 2O01F 4AW4A 4L6V6 4G4RA 4GMQA 5EXPA 3TQSA 2RGOA 3CGWA 1L2CA 1XB2B 1AIPC 4WURA 3GPXA 1K3WA 1VG5A 2I7NA 1ZAEA 4YHHM 4AKGA 3KVWA 2O5RA 4OW0A 4RKUF 5GKNA 5KQDA 5IZ7D 3GLFA 3AV0A 5ITTA 2JP7A 2R46A 1OIZA 4BB9A 1VDDA 3HJSA 5EXTA 1L8QA 1SXJB 3IG8A 3PXGA 3NWLA 2F5PA 4YY3M 3NBXX 1Q39A 3U5ZB 4KHPM 2VQEM 1VEGA 4FCVA 4G4QA 4DR3M 4JI8M 2KNZA 1C1KA 4FCTA 3PNVA 5A2QS 1JB0F 3GLGA 1YSYA 2HAKA 4QNMA 5JI2E 2F4VM 3L28A 1F4IA 2DWZB 4QNRA 2OOBA 2X8AA 2LVPC 3VKHA 2R44A 3K8ZA 5FTMA 1D2NA 4F2LA 4DR5M 5KO3A 3RFWA 4RNAA 5DFLA 2FNAA 1SXJC 1ZMUA 1G8PA 1EFUB 5FTJA 4EIWA 2UXBM 1UM8A 1DGHB 3J2PB 4M9ZA 4M9XA 3AL0C 2ZANA 4G6ZA 5KPTA 3GRUA 2L6OA 2QBYB 4LFBM 3IG5A 4R3DA 3J7AS 2R4JA 4BLCA 3R8FA 1WXQA 5IT9S 5BR8M 1MU5A 3F92A 4RF0A 1V34A 1QUSA 2XEPA 3HHWA 3D8LA 4LJ9A 4LGYA 4G3OA 2KNAA 4DR2M 1K3XA 1TF0B 2DKLA 3KOWE 1YLAA 3KP0E 4MGYE 3SAVA 2MH8A 2XF3A 2F5SA 1VQ1A 3V76A 1JR3D 2WZJA 4WW0A 1MJGM 4QHTA 4Y28F 1GJTA 3LVVA 4DR7M 3SBJA 3T15A 2C9OA 3VK7A 1T3TA 3FRIA 1N75A 4LJ8A 5KPRA 1NNJA 2UU9M 1XXHE 2XSZD 2CWBA 3FUTA 4NRVA 1Z5CA 2LVOC 2X4AA 3J7BA 3HU2A 3R9XB 4LF7M 2KA6B 1WGNA 4DBGB 2CEAA 4REZA 3GQ4A 2V1UA 3QAUA 4JYAM 1D0LA 1DO2A 1HQCA 3A46A 4DR6M 2G5GX 2JZ0A 2QNJA 4LJ5A 4XK8F 4NRWA 3B7ZA 1OKSA 1HT1E 2ERCA 3FE3A 4IBEA 1PM5A 2EKKA 2RRUA 4P16A 1NJFA 3H4JA 4Z6YA 3GPPA 2DWNA 5FLXS 2ZM6M 3FTEA 2KDLA 1XMQM 4NXNM 2DWMA 4NXMM 3FUXA 1I94M 2CP8A 3B9PA 2VDBB 5H37D 1NSFA 1NHWC 2MJ5B 3SHFA 3LCUA 3GLHA 3HY5A 1L1TA 1T43A 3UGJA 1PRBA 1R5LA 1YE9A 3KW6A 1R2ZA 4I81A 4B3RM 3UJNA 3HX3A 3K92A 2UUCM 3SYKA 4L4UA 2K6BA 1Z6TA 2C99A 4A3VB 4DR4M 1DGBA 4AQYM 3B89A 4GH9A 2B3TA 5EXSA 4ITQA 1IY2A 1Q3CA 3ILKA 2EA0A 4HL4A 3U61A 3TL4X 1XXHB 5KPZA 1HNWM 4NC6A 2BWBA 2QHOB 3LCVB 4JI7M 1DGGA 1NO1A 2EKFA 5F3WA 1WR1B 1TH2A 3ZQJA 4GKKM 1J5EM 3DOAA 4QOSA 3U60B 3E21A 1GL7A 2LVQD 2HKJA 4FWGA 2FH0A 1XC8A 3GPYA 1N78A 1HNZM 4IBJA 3WHKA 4LJ6A 3C3DA 3FUWA 2D7HA 3ZH9B 1OQYA 1QDTA 2JY8A 3FD9A 1OJLA 4Q7JA 4LG2A 3VLFB 3U6EA 1DO0A 2LNHC 1QAOA 1IN8A 4AKIA 4MGZE 1NHGC 1H6UA 1Y8GA 4F1IA 1ZV1A 4CIZA 4B3TM 3VKGA 2MR9A 3FRHA 3IHPA 4BBAA 5FSWA 3HHZA 3B7NA 1E32A 3FTFA 3W67A 2DAGA 3T38A 5LMNM 1TH3A 4B3SM 2NQ8C 3AJIB 1BVSA 2LVNC 3KOZE 3RGPA 3PNYA 2I7PA 2FS1A 1E94E 2KZUA 4IBDA 4OVZA 4W5WA 3U6PA 4LF4M 5KQ8A 1R6BX 2FE8A 2KW0A 2OO9A 4IJEA 3W0FA 2DENA 4FW9A 3CF2A 1IXSB 3DZDA 4LZZA 5ITQA 1QUTA 4S12A 2UXDM 1G71A 1VEKA 3J81S 4G4OA 3T1YM 3VFDA 2JZ1A 1OIPA 4CGYB 4JI0M 4D80A 1R7RA 2L7IA 4DV2M 4HEOA 3I51A 3JAMS 2CV1A 2KXEA 3RE8A 1NVMA 4M0WA 2Z8YM 3GPUA 1OFIA 3K9PA 5C1BA 5FTKA 1JR3E 1N33M 1OAOC 3LQRA 4AI6A 2R0IA 3FYCA 1IN5A 2H1RA 3HZJA 4WP2A 5IREB 3B7QA 3FTCA 3HGIA 2DXIA 1IN4A 3K9OA 3SAWA 1QAMA 2Y20A 3MK6A 1FNNA 3U6QA 1WIVA 3TWMA 2QZ4A 2V1CA 1Q3BA 2CE7A 1D0KA 3AFHA 3KOYE 4L16A 1L2DA 1GO5A 3IECA 1IBKM 4CHTB 1IN6A 4B7GA 2CV2A 3GLFE 2M5ZA 2BNKA 2DAMA 2JY5A 2F5OA 4LFCM 2VQFM 1LV7A 1G4AE 4DUYM 1IXZA 2JWSA 4I8OA 2WSCF 2ZBKB 4R71A 3U6OA 2OOAA 3MMPA 2APLA 2KNVA 3PFIA 3KSJA 2Y0TA 2BJWA 2C9CA 4XBOA 2C96A 3HWSA 1NY5A 4KODA 2HHHM 3TE6A 3GO8A 4B08A 1S3SA 1VDLA 3GLGE 1SXJA 1Z59A 2J7OA 3A98B 2XFSA 2R4EA 3L27A 1T6OA 3U5ZA 3Q8GA 3B74A 2CHVA 4PT5A 3GLIA 4M0DA 5L8RF 2DWLA 5ITXA 3AKZA 3L26A 2KHHA 3HJ8A 1TR8A 2L09A 3AOEC 2LWXA 4JI4M 4JI6M 8CATA 2L7HA 2J7NA 3SHGB 1AUAA 4HLQA 1PJQA 2DVWB 3J80S 2OQ4A 3FKEA 3A45A 5E26A 2WSEF 4JI2M 4B3MM 2UUAM 2XFTA 4MH0E 2D7GA 2QBYA 1IM2A 2DZLA 3GRRA 4OX9M 4QOZC 1G3IA 4KO8A 1N77A 1J7KA 5DYIA 2QP9X 1OAIA 1GVNA 3SMPA 1X37A 5EJCA 3TWKA 4IIWA 5LMUM 1GJSA 1Z5AA 1KSFX 1OFHA 3GLFB 2OPFA 2HL7A 3FUVA 3GQ5A 1E9RA 1QZEA 4X62M 5DNYA 4FVMA 1IFYA 3VDPA 1R4GA 2HWJA 1HQYE 2QPAA 1DGFA 1PJTA 2Z4RA 3T6PA 4MB7A 3BXWA 5FTLA 1HT2E 3U6DA 3L2AA 1K82A 4PCZA 4OVZB 2E5LM 4CISA 3GLGB 2ZTDA 5IWAM 4GC5A 4DV7M 1NNUC 2N35A 4D82A 3KOXE 2L2DA 4IBFA 1J09A 2CHGA 2GQFA 1GL6A 2DNAA 1Q02A 2EUCA 3NBIA 2QENA 4I5SA 2X49A 3CF0A 2JUJA 2C5RA 2CHQA 2R62A 1QAQA 2YQZA 3E46A 1XNRM 4XGIA 4L8RC 4FWDA 4B7FA 4IBIA 5EP3A 1IBMM 3J27B 4LFAM 4IBBA 3FTDA 3EIEA 5BPVA 1LTMA 2L4FA 2Y21A 2DAKA 3L29A 3LW5F 3UZUA 3A42A 3KS8A 1L1ZA 4LF6M 2K0BX 3HJQA 4FWHA 2D7EA 4DUZM 1KFVA 2XH9A 4GC9A 3DFZA 1N32M 1VEJA 3GLHE 4X65M 2LH0A 3SFZA 4LF8M 2DZNB 3MHVC 4MM3B 4PDGA 4JI5M 1XMOM 1CUKA 3HU1A 3SARA 2XSZA 2EO2A 3QYBA 1L2BA 1TGUA 3HKPA 4JV5M 1GABA 3UMMA 2XGNA 2XZUA 2ZAMA 3E4RA 4AKHA 4LZJA 4KT0F 2KEBA 4AG5A 2F5QA 4LY6A 5EP2A 5ITUA 3SASA 1C7YA 1WGLA 1ORYB 2QCUA 3KS4A 1IBLM 4LF9M 2G8LA 5EXXA 3U6SA 4LJAA 1ZMWA 1PJIA 5EP1A 4GIPA 1EIJA 4K0KM 4AZFA 3LVWA 1GLNA 2JY6B 1XXHA 2LHGA 3KP1E 4MGKE 4MGHA 1I4WA 4IBGA 2JY7A 3GLIB 1RU3A 2K47A 1UFZA 2KRKA 2R65A 3M0EA 3Q8XA 1JQJC 3KDSE 4GITA 4D81A 4TUWA 1D0MA 2V6ZM 2M60A 1W5SA 4DV3M 2QSFX 3U60A 3JR4A 5ITRA 4JXJA 3UK6A 2EJSA 1PJSA 3GRVA 4LGMA 4NSOB 4L15A 3U6CA 3SATA 2DHYA 2WSFF 1QQWA 2Z7JA 3W68A 2LXEA 3GRYA 4L78A 3GQ3A 1PJJA 1PGYA 5FTNA 3SYLA 2YFQA 3PVSA 1G41A 1KYIA 1NY6A 3JR5A 5EP4A 3HHYA 1QDRA 3C58A 2CV0A 1V92A 2VF8A 1E9SA 3FUUA 3U6LA 1V33A 4GHLA 3AOGA 1TH4A 2P5TA 4NL4H 3SAUA 1W5TA 2R6FA 4MGIE 3WHLA 4GKJM 4NSRA 3U6MA 1XNQM 1XWIA 5C18A 3GLHB 2H5XA 4FD2A 1GKIA 4PD2A 2RKOA 4DV6M 2L4EA 1QYRA 2R45A 1FJGM 3KFUG 2MROB 2AHMA 2KZSA 1N34M 1A5TA 1ZMVA 3I4VA 3M7GA 1HNXM 4ANRA 2C98A 3SMSA 1NV9A 3HU3A 4JI1M 3T1HM 4CJ6A 3KXEC 3LQQA 4OU7A 3DA1A 2JA2A 3TPZA 2BWEA 1IXSA 2Q2EB 3E9SA 1MX0A 3SC3A 1TTEA 2DAIA 2Z4SA 3I04M 4PDIA 4G4NA 4ZPXA 3U61B 1G59A 3TWLA 2CFOA 2LVAA 3BBZA 2G3QA 4FCWA 3C3EA 1TDHA 5E6JA 2RGHA 3LMMA 4X64M 5JI3E 1IY1A 2FOIC 4P17A 1QVRA 4LJ7A 1DGHA 5ITYA 4IJFA 1P3QQ 4QHSA 2GNOA 2BJVA 2ZAOA 3C9PA 4LCBA 3RGSA 2ZTCA 4AG6A 3I4YA 4LF5M 4GRIA 3QWLA 1R2YA 1QZMA 3CTWB 3D8BA 1WJ7A 4Z8XA 1WHCA 5DYGA 1HR0M 1IY0A 4NOOB 1NV8A 2JNHA 4JN6A 4DV4M 1SG9A 2LHCA 4GEWA
chains in the Genus database with same CATH topology
2HCBA 2VIIA 4LRTA 3ZC7B 2YR0A 4LJ4A 4KLNA 3W0LB 2DHRA 1N36M 1IN7A 3AOEA 4DV0M 1SXJE 2DZOB 7CATA 1TDZA 3VDUA 2XLJA 3FYDA 3H4MA 3HHXA 3L25A 4M9SA 3M6AA 1Z5BA 4GHAA 3ZCBB 2YNMD 2A5YB 4II7A 5ITXE 4LRSA 2XZFA 1ZQ9A 4RF1A 2FFJA 4DR1M 2W82A 4DV5M 4R7GA 4B7HA 4IBCA 4X66M 3K2LA 1SXJD 3KSXA 1YUBA 4JI3M 4DV1M 3VK8A 2CUZA 2Z3XA 2UXCM 3THGA 3K1JA 3MJ5A 1XHBA 3EIHA 1JR3A 1IQPA 3CF6E 2R18A 2KRUA 2Y0QA 2F5NA 1IXRC 4I4LA 4IBKA 2UUBM 1EE8A 3OTOM 5EQTA 3BOSA 3GP1A 1NJGA 1QANA 4AW4A 4G4RA 4GMQA 5EXPA 3TQSA 2RGOA 1L2CA 4WURA 3GPXA 1K3WA 2I7NA 1ZAEA 4YHHM 4AKGA 3KVWA 2O5RA 4OW0A 5GKNA 5KQDA 5IZ7D 3GLFA 3AV0A 5ITTA 2R46A 4BB9A 1VDDA 3HJSA 5EXTA 1L8QA 1SXJB 3IG8A 3PXGA 3NWLA 2F5PA 4YY3M 3U5ZB 1Q39A 4KHPM 2VQEM 4FCVA 4G4QA 4DR3M 4JI8M 3GLGA 1C1KA 4FCTA 3PNVA 5A2QS 1YSYA 4QNMA 5JI2E 2F4VM 3L28A 2DWZB 4QNRA 2X8AA 3VKHA 3K8ZA 5FTMA 1D2NA 4DR5M 5KO3A 3RFWA 4RNAA 2FNAA 1SXJC 1G8PA 5FTJA 4EIWA 2UXBM 1UM8A 1DGHB 3J2PB 4M9ZA 4M9XA 3AL0C 2ZANA 4G6ZA 5KPTA 3GRUA 2L6OA 2QBYB 4LFBM 3IG5A 4R3DA 3J7AS 2R4JA 4BLCA 3R8FA 1WXQA 5IT9S 5BR8M 1MU5A 4RF0A 2XEPA 3HHWA 3D8LA 4LJ9A 4LGYA 4DR2M 1K3XA 3KOWE 3KP0E 4MGYE 3SAVA 2XF3A 2F5SA 1JR3D 4WW0A 4QHTA 4DR7M 3LVVA 3SBJA 3T15A 2C9OA 3VK7A 1T3TA 1N75A 4LJ8A 5KPRA 1NNJA 2UU9M 2XSZD 3FUTA 4NRVA 1Z5CA 2X4AA 3J7BA 3HU2A 3R9XB 4LF7M 2KA6B 2CEAA 4REZA 3GQ4A 2V1UA 3QAUA 4JYAM 1HQCA 1DO2A 3A46A 4DR6M 2G5GX 4LJ5A 4NRWA 2ERCA 1HT1E 4IBEA 1PM5A 4P16A 1NJFA 4Z6YA 3GPPA 2DWNA 5FLXS 2ZM6M 3FTEA 1XMQM 4NXNM 2DWMA 4NXMM 3FUXA 1I94M 3B9PA 5H37D 1NSFA 1NHWC 3SHFA 3GLHA 1L1TA 3UGJA 1YE9A 3KW6A 1R2ZA 4I81A 4B3RM 3UJNA 3K92A 2UUCM 3SYKA 4L4UA 1Z6TA 2C99A 4A3VB 4DR4M 1DGBA 4AQYM 4GH9A 5EXSA 4ITQA 1IY2A 1Q3CA 3ILKA 2EA0A 4HL4A 3U61A 3TL4X 1XXHB 5KPZA 1HNWM 4JI7M 1DGGA 5F3WA 1TH2A 4GKKM 1J5EM 3DOAA 4QOSA 3U60B 1GL7A 2HKJA 4FWGA 1XC8A 3GPYA 1N78A 1HNZM 4IBJA 3WHKA 4LJ6A 3FUWA 3ZH9B 2D7HA 3FD9A 4LG2A 1OJLA 3VLFB 3U6EA 1DO0A 2LNHC 1QAOA 1IN8A 4AKIA 4MGZE 1NHGC 1H6UA 4B3TM 3VKGA 4BBAA 5FSWA 3HHZA 1E32A 3FTFA 3T38A 5LMNM 1TH3A 4B3SM 2NQ8C 3AJIB 3KOZE 3RGPA 3PNYA 2I7PA 1E94E 2KZUA 4IBDA 4OVZA 4W5WA 3U6PA 4LF4M 5KQ8A 1R6BX 2FE8A 2KW0A 3W0FA 4IJEA 4FW9A 3CF2A 1IXSB 3DZDA 4LZZA 5ITQA 4S12A 2UXDM 3J81S 4G4OA 3T1YM 3VFDA 4CGYB 4JI0M 4D80A 1R7RA 2L7IA 4DV2M 3I51A 3JAMS 2CV1A 2KXEA 3RE8A 1NVMA 4M0WA 3GPUA 1OFIA 5C1BA 5FTKA 1N33M 3LQRA 4AI6A 3FYCA 1IN5A 2H1RA 5IREB 3FTCA 3HGIA 2DXIA 1IN4A 3SAWA 1QAMA 2Y20A 3MK6A 1FNNA 3U6QA 3TWMA 2QZ4A 2V1CA 1Q3BA 2CE7A 3AFHA 3KOYE 4L16A 1L2DA 1IBKM 4CHTB 1IN6A 4B7GA 2CV2A 2M5ZA 2BNKA 2F5OA 4LFCM 2VQFM 1LV7A 1G4AE 4DUYM 1IXZA 4I8OA 3U6OA 2ZBKB 3PFIA 3KSJA 2Y0TA 2BJWA 2C9CA 4XBOA 2C96A 3HWSA 1NY5A 4KODA 2HHHM 3TE6A 3GO8A 4B08A 1S3SA 1SXJA 3A98B 1Z59A 2J7OA 2XFSA 2R4EA 3L27A 3U5ZA 2CHVA 4PT5A 3GLIA 4M0DA 2DWLA 5ITXA 3AKZA 3L26A 3HJ8A 2L09A 3AOEC 4JI6M 2LWXA 4JI4M 8CATA 2L7HA 2J7NA 3SHGB 4HLQA 2DVWB 3J80S 2OQ4A 3FKEA 3A45A 5E26A 4JI2M 4B3MM 2UUAM 2XFTA 4MH0E 2D7GA 2QBYA 1IM2A 3GRRA 4OX9M 4QOZC 1G3IA 4KO8A 1N77A 1J7KA 5DYIA 2QP9X 1GVNA 3SMPA 1X37A 5EJCA 3TWKA 4IIWA 5LMUM 1Z5AA 1KSFX 1OFHA 3GLFB 2OPFA 2HL7A 3FUVA 3GQ5A 1E9RA 4X62M 5DNYA 4FVMA 3VDPA 1HQYE 2QPAA 1DGFA 2Z4RA 4MB7A 5FTLA 1HT2E 3U6DA 3L2AA 1K82A 4PCZA 4OVZB 2E5LM 4CISA 3GLGB 5IWAM 4GC5A 4DV7M 1NNUC 4D82A 3KOXE 4IBFA 1J09A 2CHGA 1GL6A 2EUCA 3NBIA 2QENA 4I5SA 2X49A 3CF0A 2C5RA 2CHQA 2R62A 1QAQA 2YQZA 1XNRM 4XGIA 4L8RC 4FWDA 4B7FA 4IBIA 5EP3A 1IBMM 3J27B 4LFAM 4IBBA 3FTDA 3EIEA 5BPVA 2Y21A 3UZUA 3L29A 3KS8A 3A42A 1L1ZA 4LF6M 3HJQA 4FWHA 2D7EA 4DUZM 1KFVA 2XH9A 4GC9A 3DFZA 1N32M 4X65M 2LH0A 3SFZA 4LF8M 2DZNB 3MHVC 4MM3B 4PDGA 4JI5M 1XMOM 3HU1A 3SARA 2XSZA 2EO2A 1L2BA 1TGUA 3HKPA 4JV5M 3UMMA 2XGNA 2XZUA 2ZAMA 3E4RA 4AKHA 4LZJA 2F5QA 2KEBA 4AG5A 4LY6A 5EP2A 5ITUA 3SASA 1ORYB 2QCUA 3KS4A 1IBLM 4LF9M 2G8LA 5EXXA 3U6SA 4LJAA 1PJIA 5EP1A 4GIPA 4K0KM 4AZFA 3LVWA 1GLNA 1XXHA 4MGKE 3KP1E 4MGHA 1I4WA 4IBGA 3GLIB 2K47A 2KRKA 3M0EA 2R65A 3Q8XA 1JQJC 3KDSE 4GITA 4D81A 4TUWA 2V6ZM 2M60A 1W5SA 4DV3M 3U60A 3JR4A 5ITRA 4JXJA 3UK6A 4NSOB 3GRVA 4LGMA 4L15A 3U6CA 3SATA 2Z7JA 1QQWA 1PJJA 2LXEA 3GRYA 4L78A 3GQ3A 5FTNA 3SYLA 2YFQA 3PVSA 1G41A 1KYIA 1NY6A 3JR5A 5EP4A 3HHYA 3C58A 2CV0A 1E9SA 3FUUA 3U6LA 4GHLA 3AOGA 1TH4A 2P5TA 4NL4H 3SAUA 1W5TA 3WHLA 4MGIE 4GKJM 4NSRA 3U6MA 1XNQM 1XWIA 5C18A 3GLHB 4FD2A 1GKIA 4PD2A 2RKOA 4DV6M 2R45A 1QYRA 1FJGM 3KFUG 2AHMA 2KZSA 1N34M 3I4VA 3M7GA 1HNXM 2C98A 3SMSA 3HU3A 4JI1M 3T1HM 3KXEC 3LQQA 4OU7A 3DA1A 2JA2A 3TPZA 2Q2EB 3E9SA 1MX0A 3SC3A 4PDIA 2Z4SA 4G4NA 3U61B 4ZPXA 1G59A 3TWLA 2CFOA 4FCWA 1TDHA 5E6JA 2RGHA 3LMMA 4X64M 5JI3E 1IY1A 2FOIC 1QVRA 4LJ7A 1DGHA 5ITYA 4IJFA 4QHSA 2BJVA 2ZAOA 4LCBA 3RGSA 4AG6A 3I4YA 4LF5M 4GRIA 3QWLA 1R2YA 1QZMA 3CTWB 3D8BA 4Z8XA 5DYGA 1HR0M 1IY0A 4NOOB 4JN6A 4DV4M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A42 A;  1L1Z A;  4LF6 M;  3GPU A;  1NNJ A;  2UU9 M;  4DUZ M;  1N36 M;  1KFV A;  1N33 M;  4DV0 M;  1N32 M;  4NRV A;  1Z5C A;  1TDZ A;  4X65 M;  4LF8 M;  4LF7 M;  4PDG A;  3GQ4 A;  4JI5 M;  3SAW A;  1Z5B A;  1XMO M;  3SAR A;  4JYA M;  3A46 A;  4DR6 M;  1L2B A;  5ITX E;  3U6Q A;  4NRW A;  3TWM A;  4JV5 M;  2XZF A;  1Q3B A;  2XZU A;  1PM5 A;  1L2D A;  2F5Q A;  4DR1 M;  1IBK M;  5ITU A;  3SAS A;  2F5O A;  4DV5 M;  1IBL M;  3GPP A;  4LFC M;  2VQF M;  4LF9 M;  5FLX S;  4DUY M;  3U6O A;  4X66 M;  2ZM6 M;  2ZBK B;  3U6S A;  1XMQ M;  4NXN M;  4JI3 M;  1PJI A;  4DV1 M;  3VK8 A;  2UXC M;  4K0K M;  4NXM M;  1I94 M;  2HHH M;  3GO8 A;  2F5N A;  1Z59 A;  2UUB M;  1EE8 A;  3OTO M;  1L1T A;  3GP1 A;  1R2Z A;  4B3R M;  4DV3 M;  4G4R A;  3JR4 A;  5ITR A;  2UUC M;  1L2C A;  5ITX A;  4DR4 M;  3GPX A;  1K3W A;  4AQY M;  4YHH M;  3U6C A;  3SAT A;  4ITQ A;  1PJJ A;  3GQ3 A;  4JI6 M;  4JI4 M;  1Q3C A;  2EA0 A;  3C58 A;  3JR5 A;  5ITT A;  3J80 S;  2OQ4 A;  3A45 A;  3U6L A;  4JI2 M;  1HNW M;  4B3M M;  4GKJ M;  3SAU A;  2UUA M;  4JI7 M;  1XNQ M;  3U6M A;  4YY3 M;  2F5P A;  1Q39 A;  4KHP M;  2VQE M;  4GKK M;  4PD2 A;  1J5E M;  3DOA A;  4DV6 M;  4G4Q A;  4DR3 M;  4JI8 M;  5A2Q S;  4OX9 M;  1FJG M;  1N34 M;  2HKJ A;  2F4V M;  1XC8 A;  3GPY A;  1HNZ M;  1HNX M;  4JI1 M;  3TWK A;  3T1H M;  5LMU M;  4DR5 M;  1Z5A A;  2OPF A;  2Q2E B;  3U6E A;  3GQ5 A;  1MX0 A;  4X62 M;  4PDI A;  4G4N A;  3TWL A;  4B3T M;  4MB7 A;  2UXB M;  1TDH A;  3U6D A;  1K82 A;  4PCZ A;  2E5L M;  4X64 M;  4LFB M;  5LMN M;  4B3S M;  4CIS A;  5IWA M;  3J7A S;  5IT9 S;  4DV7 M;  5ITY A;  5BR8 M;  3U6P A;  4LF4 M;  3VK7 A;  1MU5 A;  3W0F A;  4DR2 M;  1K3X A;  4LF5 M;  1R2Y A;  5ITQ A;  2UXD M;  3J81 S;  4G4O A;  3T1Y M;  1XNR M;  3SAV A;  2F5S A;  1HR0 M;  4JI0 M;  1IBM M;  4LFA M;  4DR7 M;  3SBJ A;  4DV2 M;  4DV4 M;  3JAM S; 
#chains in the Genus database with same CATH topology
 2HCB A;  2QQ8 A;  2VII A;  4LRT A;  3ZC7 B;  2YR0 A;  4LJ4 A;  2VF7 A;  4KLN A;  3W0L B;  2DHR A;  1N36 M;  1IN7 A;  3AOE A;  4DV0 M;  1SXJ E;  2DZO B;  7CAT A;  1HJP A;  1TDZ A;  1OTR A;  3VDU A;  2XLJ A;  2LTU A;  3FYD A;  3H4M A;  2DAE A;  3HHX A;  3L25 A;  4M9S A;  2MGW A;  3M6A A;  1Z5B A;  3GLI E;  4GHA A;  3ZCB B;  2DI0 A;  2YNM D;  2A5Y B;  4II7 A;  5ITX E;  1DV0 A;  4LRS A;  2XZF A;  1ZQ9 A;  4RF1 A;  2FFJ A;  3QYE A;  1MN3 A;  4DR1 M;  2O25 A;  2W82 A;  4DV5 M;  2JXN A;  4R7G A;  4B7H A;  4IBC A;  4X66 M;  3K2L A;  1SXJ D;  2CRU A;  3KSX A;  1YUB A;  4UN2 B;  4JI3 M;  4DV1 M;  3VK8 A;  2CUZ A;  2LBC A;  2Z3X A;  3THG A;  2UXC M;  3K1J A;  3MJ5 A;  1XHB A;  2K9D A;  1JR3 A;  1IQP A;  3CF6 E;  2R18 A;  2KRU A;  3EIH A;  2Y0Q A;  2F5N A;  1IXR C;  4I4L A;  4IBK A;  2UUB M;  1EE8 A;  2J5Y A;  3OTO M;  5EQT A;  3BOS A;  3GP1 A;  1NJG A;  3I01 M;  1QAN A;  2O01 F;  4AW4 A;  4L6V 6;  4G4R A;  4GMQ A;  5EXP A;  3TQS A;  2RGO A;  3CGW A;  1L2C A;  1XB2 B;  1AIP C;  4WUR A;  3GPX A;  1K3W A;  1VG5 A;  2I7N A;  1ZAE A;  4YHH M;  4AKG A;  3KVW A;  2O5R A;  4OW0 A;  4RKU F;  5GKN A;  5KQD A;  5IZ7 D;  3GLF A;  3AV0 A;  5ITT A;  2JP7 A;  2R46 A;  1OIZ A;  4BB9 A;  1VDD A;  3HJS A;  5EXT A;  1L8Q A;  1SXJ B;  3IG8 A;  3PXG A;  3NWL A;  2F5P A;  4YY3 M;  3NBX X;  1Q39 A;  3U5Z B;  4KHP M;  2VQE M;  1VEG A;  4FCV A;  4G4Q A;  4DR3 M;  4JI8 M;  2KNZ A;  1C1K A;  4FCT A;  3PNV A;  5A2Q S;  1JB0 F;  3GLG A;  1YSY A;  2HAK A;  4QNM A;  5JI2 E;  2F4V M;  3L28 A;  1F4I A;  2DWZ B;  4QNR A;  2OOB A;  2X8A A;  2LVP C;  3VKH A;  2R44 A;  3K8Z A;  5FTM A;  1D2N A;  4F2L A;  4DR5 M;  5KO3 A;  3RFW A;  4RNA A;  5DFL A;  2FNA A;  1SXJ C;  1ZMU A;  1G8P A;  1EFU B;  5FTJ A;  4EIW A;  2UXB M;  1UM8 A;  1DGH B;  3J2P B;  4M9Z A;  4M9X A;  3AL0 C;  2ZAN A;  4G6Z A;  5KPT A;  3GRU A;  2L6O A;  2QBY B;  4LFB M;  3IG5 A;  4R3D A;  3J7A S;  2R4J A;  4BLC A;  3R8F A;  1WXQ A;  5IT9 S;  5BR8 M;  1MU5 A;  3F92 A;  4RF0 A;  1V34 A;  1QUS A;  2XEP A;  3HHW A;  3D8L A;  4LJ9 A;  4LGY A;  4G3O A;  2KNA A;  4DR2 M;  1K3X A;  1TF0 B;  2DKL A;  3KOW E;  1YLA A;  3KP0 E;  4MGY E;  3SAV A;  2MH8 A;  2XF3 A;  2F5S A;  1VQ1 A;  3V76 A;  1JR3 D;  2WZJ A;  4WW0 A;  1MJG M;  4QHT A;  4Y28 F;  1GJT A;  3LVV A;  4DR7 M;  3SBJ A;  3T15 A;  2C9O A;  3VK7 A;  1T3T A;  3FRI A;  1N75 A;  4LJ8 A;  5KPR A;  1NNJ A;  2UU9 M;  1XXH E;  2XSZ D;  2CWB A;  3FUT A;  4NRV A;  1Z5C A;  2LVO C;  2X4A A;  3J7B A;  3HU2 A;  3R9X B;  4LF7 M;  2KA6 B;  1WGN A;  4DBG B;  2CEA A;  4REZ A;  3GQ4 A;  2V1U A;  3QAU A;  4JYA M;  1D0L A;  1DO2 A;  1HQC A;  3A46 A;  4DR6 M;  2G5G X;  2JZ0 A;  2QNJ A;  4LJ5 A;  4XK8 F;  4NRW A;  3B7Z A;  1OKS A;  1HT1 E;  2ERC A;  3FE3 A;  4IBE A;  1PM5 A;  2EKK A;  2RRU A;  4P16 A;  1NJF A;  3H4J A;  4Z6Y A;  3GPP A;  2DWN A;  5FLX S;  2ZM6 M;  3FTE A;  2KDL A;  1XMQ M;  4NXN M;  2DWM A;  4NXM M;  3FUX A;  1I94 M;  2CP8 A;  3B9P A;  2VDB B;  5H37 D;  1NSF A;  1NHW C;  2MJ5 B;  3SHF A;  3LCU A;  3GLH A;  3HY5 A;  1L1T A;  1T43 A;  3UGJ A;  1PRB A;  1R5L A;  1YE9 A;  3KW6 A;  1R2Z A;  4I81 A;  4B3R M;  3UJN A;  3HX3 A;  3K92 A;  2UUC M;  3SYK A;  4L4U A;  2K6B A;  1Z6T A;  2C99 A;  4A3V B;  4DR4 M;  1DGB A;  4AQY M;  3B89 A;  4GH9 A;  2B3T A;  5EXS A;  4ITQ A;  1IY2 A;  1Q3C A;  3ILK A;  2EA0 A;  4HL4 A;  3U61 A;  3TL4 X;  1XXH B;  5KPZ A;  1HNW M;  4NC6 A;  2BWB A;  2QHO B;  3LCV B;  4JI7 M;  1DGG A;  1NO1 A;  2EKF A;  5F3W A;  1WR1 B;  1TH2 A;  3ZQJ A;  4GKK M;  1J5E M;  3DOA A;  4QOS A;  3U60 B;  3E21 A;  1GL7 A;  2LVQ D;  2HKJ A;  4FWG A;  2FH0 A;  1XC8 A;  3GPY A;  1N78 A;  1HNZ M;  4IBJ A;  3WHK A;  4LJ6 A;  3C3D A;  3FUW A;  2D7H A;  3ZH9 B;  1OQY A;  1QDT A;  2JY8 A;  3FD9 A;  1OJL A;  4Q7J A;  4LG2 A;  3VLF B;  3U6E A;  1DO0 A;  2LNH C;  1QAO A;  1IN8 A;  4AKI A;  4MGZ E;  1NHG C;  1H6U A;  1Y8G A;  4F1I A;  1ZV1 A;  4CIZ A;  4B3T M;  3VKG A;  2MR9 A;  3FRH A;  3IHP A;  4BBA A;  5FSW A;  3HHZ A;  3B7N A;  1E32 A;  3FTF A;  3W67 A;  2DAG A;  3T38 A;  5LMN M;  1TH3 A;  4B3S M;  2NQ8 C;  3AJI B;  1BVS A;  2LVN C;  3KOZ E;  3RGP A;  3PNY A;  2I7P A;  2FS1 A;  1E94 E;  2KZU A;  4IBD A;  4OVZ A;  4W5W A;  3U6P A;  4LF4 M;  5KQ8 A;  1R6B X;  2FE8 A;  2KW0 A;  2OO9 A;  4IJE A;  3W0F A;  2DEN A;  4FW9 A;  3CF2 A;  1IXS B;  3DZD A;  4LZZ A;  5ITQ A;  1QUT A;  4S12 A;  2UXD M;  1G71 A;  1VEK A;  3J81 S;  4G4O A;  3T1Y M;  3VFD A;  2JZ1 A;  1OIP A;  4CGY B;  4JI0 M;  4D80 A;  1R7R A;  2L7I A;  4DV2 M;  4HEO A;  3I51 A;  3JAM S;  2CV1 A;  2KXE A;  3RE8 A;  1NVM A;  4M0W A;  2Z8Y M;  3GPU A;  1OFI A;  3K9P A;  5C1B A;  5FTK A;  1JR3 E;  1N33 M;  1OAO C;  3LQR A;  4AI6 A;  2R0I A;  3FYC A;  1IN5 A;  2H1R A;  3HZJ A;  4WP2 A;  5IRE B;  3B7Q A;  3FTC A;  3HGI A;  2DXI A;  1IN4 A;  3K9O A;  3SAW A;  1QAM A;  2Y20 A;  3MK6 A;  1FNN A;  3U6Q A;  1WIV A;  3TWM A;  2QZ4 A;  2V1C A;  1Q3B A;  2CE7 A;  1D0K A;  3AFH A;  3KOY E;  4L16 A;  1L2D A;  1GO5 A;  3IEC A;  1IBK M;  4CHT B;  1IN6 A;  4B7G A;  2CV2 A;  3GLF E;  2M5Z A;  2BNK A;  2DAM A;  2JY5 A;  2F5O A;  4LFC M;  2VQF M;  1LV7 A;  1G4A E;  4DUY M;  1IXZ A;  2JWS A;  4I8O A;  2WSC F;  2ZBK B;  4R71 A;  3U6O A;  2OOA A;  3MMP A;  2APL A;  2KNV A;  3PFI A;  3KSJ A;  2Y0T A;  2BJW A;  2C9C A;  4XBO A;  2C96 A;  3HWS A;  1NY5 A;  4KOD A;  2HHH M;  3TE6 A;  3GO8 A;  4B08 A;  1S3S A;  1VDL A;  3GLG E;  1SXJ A;  1Z59 A;  2J7O A;  3A98 B;  2XFS A;  2R4E A;  3L27 A;  1T6O A;  3U5Z A;  3Q8G A;  3B74 A;  2CHV A;  4PT5 A;  3GLI A;  4M0D A;  5L8R F;  2DWL A;  5ITX A;  3AKZ A;  3L26 A;  2KHH A;  3HJ8 A;  1TR8 A;  2L09 A;  3AOE C;  2LWX A;  4JI4 M;  4JI6 M;  8CAT A;  2L7H A;  2J7N A;  3SHG B;  1AUA A;  4HLQ A;  1PJQ A;  2DVW B;  3J80 S;  2OQ4 A;  3FKE A;  3A45 A;  5E26 A;  2WSE F;  4JI2 M;  4B3M M;  2UUA M;  2XFT A;  4MH0 E;  2D7G A;  2QBY A;  1IM2 A;  2DZL A;  3GRR A;  4OX9 M;  4QOZ C;  1G3I A;  4KO8 A;  1N77 A;  1J7K A;  5DYI A;  2QP9 X;  1OAI A;  1GVN A;  3SMP A;  1X37 A;  5EJC A;  3TWK A;  4IIW A;  5LMU M;  1GJS A;  1Z5A A;  1KSF X;  1OFH A;  3GLF B;  2OPF A;  2HL7 A;  3FUV A;  3GQ5 A;  1E9R A;  1QZE A;  4X62 M;  5DNY A;  4FVM A;  1IFY A;  3VDP A;  1R4G A;  2HWJ A;  1HQY E;  2QPA A;  1DGF A;  1PJT A;  2Z4R A;  3T6P A;  4MB7 A;  3BXW A;  5FTL A;  1HT2 E;  3U6D A;  3L2A A;  1K82 A;  4PCZ A;  4OVZ B;  2E5L M;  4CIS A;  3GLG B;  2ZTD A;  5IWA M;  4GC5 A;  4DV7 M;  1NNU C;  2N35 A;  4D82 A;  3KOX E;  2L2D A;  4IBF A;  1J09 A;  2CHG A;  2GQF A;  1GL6 A;  2DNA A;  1Q02 A;  2EUC A;  3NBI A;  2QEN A;  4I5S A;  2X49 A;  3CF0 A;  2JUJ A;  2C5R A;  2CHQ A;  2R62 A;  1QAQ A;  2YQZ A;  3E46 A;  1XNR M;  4XGI A;  4L8R C;  4FWD A;  4B7F A;  4IBI A;  5EP3 A;  1IBM M;  3J27 B;  4LFA M;  4IBB A;  3FTD A;  3EIE A;  5BPV A;  1LTM A;  2L4F A;  2Y21 A;  2DAK A;  3L29 A;  3LW5 F;  3UZU A;  3A42 A;  3KS8 A;  1L1Z A;  4LF6 M;  2K0B X;  3HJQ A;  4FWH A;  2D7E A;  4DUZ M;  1KFV A;  2XH9 A;  4GC9 A;  3DFZ A;  1N32 M;  1VEJ A;  3GLH E;  4X65 M;  2LH0 A;  3SFZ A;  4LF8 M;  2DZN B;  3MHV C;  4MM3 B;  4PDG A;  4JI5 M;  1XMO M;  1CUK A;  3HU1 A;  3SAR A;  2XSZ A;  2EO2 A;  3QYB A;  1L2B A;  1TGU A;  3HKP A;  4JV5 M;  1GAB A;  3UMM A;  2XGN A;  2XZU A;  2ZAM A;  3E4R A;  4AKH A;  4LZJ A;  4KT0 F;  2KEB A;  4AG5 A;  2F5Q A;  4LY6 A;  5EP2 A;  5ITU A;  3SAS A;  1C7Y A;  1WGL A;  1ORY B;  2QCU A;  3KS4 A;  1IBL M;  4LF9 M;  2G8L A;  5EXX A;  3U6S A;  4LJA A;  1ZMW A;  1PJI A;  5EP1 A;  4GIP A;  1EIJ A;  4K0K M;  4AZF A;  3LVW A;  1GLN A;  2JY6 B;  1XXH A;  2LHG A;  3KP1 E;  4MGK E;  4MGH A;  1I4W A;  4IBG A;  2JY7 A;  3GLI B;  1RU3 A;  2K47 A;  1UFZ A;  2KRK A;  2R65 A;  3M0E A;  3Q8X A;  1JQJ C;  3KDS E;  4GIT A;  4D81 A;  4TUW A;  1D0M A;  2V6Z M;  2M60 A;  1W5S A;  4DV3 M;  2QSF X;  3U60 A;  3JR4 A;  5ITR A;  4JXJ A;  3UK6 A;  2EJS A;  1PJS A;  3GRV A;  4LGM A;  4NSO B;  4L15 A;  3U6C A;  3SAT A;  2DHY A;  2WSF F;  1QQW A;  2Z7J A;  3W68 A;  2LXE A;  3GRY A;  4L78 A;  3GQ3 A;  1PJJ A;  1PGY A;  5FTN A;  3SYL A;  2YFQ A;  3PVS A;  1G41 A;  1KYI A;  1NY6 A;  3JR5 A;  5EP4 A;  3HHY A;  1QDR A;  3C58 A;  2CV0 A;  1V92 A;  2VF8 A;  1E9S A;  3FUU A;  3U6L A;  1V33 A;  4GHL A;  3AOG A;  1TH4 A;  2P5T A;  4NL4 H;  3SAU A;  1W5T A;  2R6F A;  4MGI E;  3WHL A;  4GKJ M;  4NSR A;  3U6M A;  1XNQ M;  1XWI A;  5C18 A;  3GLH B;  2H5X A;  4FD2 A;  1GKI A;  4PD2 A;  2RKO A;  4DV6 M;  2L4E A;  1QYR A;  2R45 A;  1FJG M;  3KFU G;  2MRO B;  2AHM A;  2KZS A;  1N34 M;  1A5T A;  1ZMV A;  3I4V A;  3M7G A;  1HNX M;  4ANR A;  2C98 A;  3SMS A;  1NV9 A;  3HU3 A;  4JI1 M;  3T1H M;  4CJ6 A;  3KXE C;  3LQQ A;  4OU7 A;  3DA1 A;  2JA2 A;  3TPZ A;  2BWE A;  1IXS A;  2Q2E B;  3E9S A;  1MX0 A;  3SC3 A;  1TTE A;  2DAI A;  2Z4S A;  3I04 M;  4PDI A;  4G4N A;  4ZPX A;  3U61 B;  1G59 A;  3TWL A;  2CFO A;  2LVA A;  3BBZ A;  2G3Q A;  4FCW A;  3C3E A;  1TDH A;  5E6J A;  2RGH A;  3LMM A;  4X64 M;  5JI3 E;  1IY1 A;  2FOI C;  4P17 A;  1QVR A;  4LJ7 A;  1DGH A;  5ITY A;  4IJF A;  1P3Q Q;  4QHS A;  2GNO A;  2BJV A;  2ZAO A;  3C9P A;  4LCB A;  3RGS A;  2ZTC A;  4AG6 A;  3I4Y A;  4LF5 M;  4GRI A;  3QWL A;  1R2Y A;  1QZM A;  3CTW B;  3D8B A;  1WJ7 A;  4Z8X A;  1WHC A;  5DYG A;  1HR0 M;  1IY0 A;  4NOO B;  1NV8 A;  2JNH A;  4JN6 A;  4DV4 M;  1SG9 A;  2LHC A;  4GEW A; 
#chains in the Genus database with same CATH homology
 2HCB A;  2VII A;  4LRT A;  3ZC7 B;  2YR0 A;  4LJ4 A;  4KLN A;  3W0L B;  2DHR A;  1N36 M;  1IN7 A;  3AOE A;  4DV0 M;  1SXJ E;  2DZO B;  7CAT A;  1TDZ A;  3VDU A;  2XLJ A;  3FYD A;  3H4M A;  3HHX A;  3L25 A;  4M9S A;  3M6A A;  1Z5B A;  4GHA A;  3ZCB B;  2YNM D;  2A5Y B;  4II7 A;  5ITX E;  4LRS A;  2XZF A;  1ZQ9 A;  4RF1 A;  2FFJ A;  4DR1 M;  2W82 A;  4DV5 M;  4R7G A;  4B7H A;  4IBC A;  4X66 M;  3K2L A;  1SXJ D;  3KSX A;  1YUB A;  4JI3 M;  4DV1 M;  3VK8 A;  2CUZ A;  2Z3X A;  2UXC M;  3THG A;  3K1J A;  3MJ5 A;  1XHB A;  3EIH A;  1JR3 A;  1IQP A;  3CF6 E;  2R18 A;  2KRU A;  2Y0Q A;  2F5N A;  1IXR C;  4I4L A;  4IBK A;  2UUB M;  1EE8 A;  3OTO M;  5EQT A;  3BOS A;  3GP1 A;  1NJG A;  1QAN A;  4AW4 A;  4G4R A;  4GMQ A;  5EXP A;  3TQS A;  2RGO A;  1L2C A;  4WUR A;  3GPX A;  1K3W A;  2I7N A;  1ZAE A;  4YHH M;  4AKG A;  3KVW A;  2O5R A;  4OW0 A;  5GKN A;  5KQD A;  5IZ7 D;  3GLF A;  3AV0 A;  5ITT A;  2R46 A;  4BB9 A;  1VDD A;  3HJS A;  5EXT A;  1L8Q A;  1SXJ B;  3IG8 A;  3PXG A;  3NWL A;  2F5P A;  4YY3 M;  3U5Z B;  1Q39 A;  4KHP M;  2VQE M;  4FCV A;  4G4Q A;  4DR3 M;  4JI8 M;  3GLG A;  1C1K A;  4FCT A;  3PNV A;  5A2Q S;  1YSY A;  4QNM A;  5JI2 E;  2F4V M;  3L28 A;  2DWZ B;  4QNR A;  2X8A A;  3VKH A;  3K8Z A;  5FTM A;  1D2N A;  4DR5 M;  5KO3 A;  3RFW A;  4RNA A;  2FNA A;  1SXJ C;  1G8P A;  5FTJ A;  4EIW A;  2UXB M;  1UM8 A;  1DGH B;  3J2P B;  4M9Z A;  4M9X A;  3AL0 C;  2ZAN A;  4G6Z A;  5KPT A;  3GRU A;  2L6O A;  2QBY B;  4LFB M;  3IG5 A;  4R3D A;  3J7A S;  2R4J A;  4BLC A;  3R8F A;  1WXQ A;  5IT9 S;  5BR8 M;  1MU5 A;  4RF0 A;  2XEP A;  3HHW A;  3D8L A;  4LJ9 A;  4LGY A;  4DR2 M;  1K3X A;  3KOW E;  3KP0 E;  4MGY E;  3SAV A;  2XF3 A;  2F5S A;  1JR3 D;  4WW0 A;  4QHT A;  4DR7 M;  3LVV A;  3SBJ A;  3T15 A;  2C9O A;  3VK7 A;  1T3T A;  1N75 A;  4LJ8 A;  5KPR A;  1NNJ A;  2UU9 M;  2XSZ D;  3FUT A;  4NRV A;  1Z5C A;  2X4A A;  3J7B A;  3HU2 A;  3R9X B;  4LF7 M;  2KA6 B;  2CEA A;  4REZ A;  3GQ4 A;  2V1U A;  3QAU A;  4JYA M;  1HQC A;  1DO2 A;  3A46 A;  4DR6 M;  2G5G X;  4LJ5 A;  4NRW A;  2ERC A;  1HT1 E;  4IBE A;  1PM5 A;  4P16 A;  1NJF A;  4Z6Y A;  3GPP A;  2DWN A;  5FLX S;  2ZM6 M;  3FTE A;  1XMQ M;  4NXN M;  2DWM A;  4NXM M;  3FUX A;  1I94 M;  3B9P A;  5H37 D;  1NSF A;  1NHW C;  3SHF A;  3GLH A;  1L1T A;  3UGJ A;  1YE9 A;  3KW6 A;  1R2Z A;  4I81 A;  4B3R M;  3UJN A;  3K92 A;  2UUC M;  3SYK A;  4L4U A;  1Z6T A;  2C99 A;  4A3V B;  4DR4 M;  1DGB A;  4AQY M;  4GH9 A;  5EXS A;  4ITQ A;  1IY2 A;  1Q3C A;  3ILK A;  2EA0 A;  4HL4 A;  3U61 A;  3TL4 X;  1XXH B;  5KPZ A;  1HNW M;  4JI7 M;  1DGG A;  5F3W A;  1TH2 A;  4GKK M;  1J5E M;  3DOA A;  4QOS A;  3U60 B;  1GL7 A;  2HKJ A;  4FWG A;  1XC8 A;  3GPY A;  1N78 A;  1HNZ M;  4IBJ A;  3WHK A;  4LJ6 A;  3FUW A;  3ZH9 B;  2D7H A;  3FD9 A;  4LG2 A;  1OJL A;  3VLF B;  3U6E A;  1DO0 A;  2LNH C;  1QAO A;  1IN8 A;  4AKI A;  4MGZ E;  1NHG C;  1H6U A;  4B3T M;  3VKG A;  4BBA A;  5FSW A;  3HHZ A;  1E32 A;  3FTF A;  3T38 A;  5LMN M;  1TH3 A;  4B3S M;  2NQ8 C;  3AJI B;  3KOZ E;  3RGP A;  3PNY A;  2I7P A;  1E94 E;  2KZU A;  4IBD A;  4OVZ A;  4W5W A;  3U6P A;  4LF4 M;  5KQ8 A;  1R6B X;  2FE8 A;  2KW0 A;  3W0F A;  4IJE A;  4FW9 A;  3CF2 A;  1IXS B;  3DZD A;  4LZZ A;  5ITQ A;  4S12 A;  2UXD M;  3J81 S;  4G4O A;  3T1Y M;  3VFD A;  4CGY B;  4JI0 M;  4D80 A;  1R7R A;  2L7I A;  4DV2 M;  3I51 A;  3JAM S;  2CV1 A;  2KXE A;  3RE8 A;  1NVM A;  4M0W A;  3GPU A;  1OFI A;  5C1B A;  5FTK A;  1N33 M;  3LQR A;  4AI6 A;  3FYC A;  1IN5 A;  2H1R A;  5IRE B;  3FTC A;  3HGI A;  2DXI A;  1IN4 A;  3SAW A;  1QAM A;  2Y20 A;  3MK6 A;  1FNN A;  3U6Q A;  3TWM A;  2QZ4 A;  2V1C A;  1Q3B A;  2CE7 A;  3AFH A;  3KOY E;  4L16 A;  1L2D A;  1IBK M;  4CHT B;  1IN6 A;  4B7G A;  2CV2 A;  2M5Z A;  2BNK A;  2F5O A;  4LFC M;  2VQF M;  1LV7 A;  1G4A E;  4DUY M;  1IXZ A;  4I8O A;  3U6O A;  2ZBK B;  3PFI A;  3KSJ A;  2Y0T A;  2BJW A;  2C9C A;  4XBO A;  2C96 A;  3HWS A;  1NY5 A;  4KOD A;  2HHH M;  3TE6 A;  3GO8 A;  4B08 A;  1S3S A;  1SXJ A;  3A98 B;  1Z59 A;  2J7O A;  2XFS A;  2R4E A;  3L27 A;  3U5Z A;  2CHV A;  4PT5 A;  3GLI A;  4M0D A;  2DWL A;  5ITX A;  3AKZ A;  3L26 A;  3HJ8 A;  2L09 A;  3AOE C;  4JI6 M;  2LWX A;  4JI4 M;  8CAT A;  2L7H A;  2J7N A;  3SHG B;  4HLQ A;  2DVW B;  3J80 S;  2OQ4 A;  3FKE A;  3A45 A;  5E26 A;  4JI2 M;  4B3M M;  2UUA M;  2XFT A;  4MH0 E;  2D7G A;  2QBY A;  1IM2 A;  3GRR A;  4OX9 M;  4QOZ C;  1G3I A;  4KO8 A;  1N77 A;  1J7K A;  5DYI A;  2QP9 X;  1GVN A;  3SMP A;  1X37 A;  5EJC A;  3TWK A;  4IIW A;  5LMU M;  1Z5A A;  1KSF X;  1OFH A;  3GLF B;  2OPF A;  2HL7 A;  3FUV A;  3GQ5 A;  1E9R A;  4X62 M;  5DNY A;  4FVM A;  3VDP A;  1HQY E;  2QPA A;  1DGF A;  2Z4R A;  4MB7 A;  5FTL A;  1HT2 E;  3U6D A;  3L2A A;  1K82 A;  4PCZ A;  4OVZ B;  2E5L M;  4CIS A;  3GLG B;  5IWA M;  4GC5 A;  4DV7 M;  1NNU C;  4D82 A;  3KOX E;  4IBF A;  1J09 A;  2CHG A;  1GL6 A;  2EUC A;  3NBI A;  2QEN A;  4I5S A;  2X49 A;  3CF0 A;  2C5R A;  2CHQ A;  2R62 A;  1QAQ A;  2YQZ A;  1XNR M;  4XGI A;  4L8R C;  4FWD A;  4B7F A;  4IBI A;  5EP3 A;  1IBM M;  3J27 B;  4LFA M;  4IBB A;  3FTD A;  3EIE A;  5BPV A;  2Y21 A;  3UZU A;  3L29 A;  3KS8 A;  3A42 A;  1L1Z A;  4LF6 M;  3HJQ A;  4FWH A;  2D7E A;  4DUZ M;  1KFV A;  2XH9 A;  4GC9 A;  3DFZ A;  1N32 M;  4X65 M;  2LH0 A;  3SFZ A;  4LF8 M;  2DZN B;  3MHV C;  4MM3 B;  4PDG A;  4JI5 M;  1XMO M;  3HU1 A;  3SAR A;  2XSZ A;  2EO2 A;  1L2B A;  1TGU A;  3HKP A;  4JV5 M;  3UMM A;  2XGN A;  2XZU A;  2ZAM A;  3E4R A;  4AKH A;  4LZJ A;  2F5Q A;  2KEB A;  4AG5 A;  4LY6 A;  5EP2 A;  5ITU A;  3SAS A;  1ORY B;  2QCU A;  3KS4 A;  1IBL M;  4LF9 M;  2G8L A;  5EXX A;  3U6S A;  4LJA A;  1PJI A;  5EP1 A;  4GIP A;  4K0K M;  4AZF A;  3LVW A;  1GLN A;  1XXH A;  4MGK E;  3KP1 E;  4MGH A;  1I4W A;  4IBG A;  3GLI B;  2K47 A;  2KRK A;  3M0E A;  2R65 A;  3Q8X A;  1JQJ C;  3KDS E;  4GIT A;  4D81 A;  4TUW A;  2V6Z M;  2M60 A;  1W5S A;  4DV3 M;  3U60 A;  3JR4 A;  5ITR A;  4JXJ A;  3UK6 A;  4NSO B;  3GRV A;  4LGM A;  4L15 A;  3U6C A;  3SAT A;  2Z7J A;  1QQW A;  1PJJ A;  2LXE A;  3GRY A;  4L78 A;  3GQ3 A;  5FTN A;  3SYL A;  2YFQ A;  3PVS A;  1G41 A;  1KYI A;  1NY6 A;  3JR5 A;  5EP4 A;  3HHY A;  3C58 A;  2CV0 A;  1E9S A;  3FUU A;  3U6L A;  4GHL A;  3AOG A;  1TH4 A;  2P5T A;  4NL4 H;  3SAU A;  1W5T A;  3WHL A;  4MGI E;  4GKJ M;  4NSR A;  3U6M A;  1XNQ M;  1XWI A;  5C18 A;  3GLH B;  4FD2 A;  1GKI A;  4PD2 A;  2RKO A;  4DV6 M;  2R45 A;  1QYR A;  1FJG M;  3KFU G;  2AHM A;  2KZS A;  1N34 M;  3I4V A;  3M7G A;  1HNX M;  2C98 A;  3SMS A;  3HU3 A;  4JI1 M;  3T1H M;  3KXE C;  3LQQ A;  4OU7 A;  3DA1 A;  2JA2 A;  3TPZ A;  2Q2E B;  3E9S A;  1MX0 A;  3SC3 A;  4PDI A;  2Z4S A;  4G4N A;  3U61 B;  4ZPX A;  1G59 A;  3TWL A;  2CFO A;  4FCW A;  1TDH A;  5E6J A;  2RGH A;  3LMM A;  4X64 M;  5JI3 E;  1IY1 A;  2FOI C;  1QVR A;  4LJ7 A;  1DGH A;  5ITY A;  4IJF A;  4QHS A;  2BJV A;  2ZAO A;  4LCB A;  3RGS A;  4AG6 A;  3I4Y A;  4LF5 M;  4GRI A;  3QWL A;  1R2Y A;  1QZM A;  3CTW B;  3D8B A;  4Z8X A;  5DYG A;  1HR0 M;  1IY0 A;  4NOO B;  4JN6 A;  4DV4 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...