2UXDM

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uxdM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uxdM02
1TDHA 5ITTA 5LMUM 3T1HM 4JI8M 1MU5A 3W0FA 2VQEM 4DV4M 3SASA 1K3WA 5BR8M 4LF6M 1J5EM 5ITYA 4GKKM 3GQ4A 4DV2M 4YHHM 3J7AS 4JYAM 4DV1M 4NRWA 3JAMS 3TWMA 1N34M 4LF9M 5ITXA 5ITUA 1HNWM 2UXDM 3U6LA 1KFVA 2OQ4A 1K3XA 4DR7M 4DR6M 4G4QA 4LF4M 4PD2A 4PCZA 4AQYM 1NNJA 3A45A 4JI1M 5IT9S 1R2ZA 1Z5CA 4CISA 1Q39A 4GKJM 4G4NA 1HR0M 2E5LM 1R2YA 1XNQM 1XMOM 4X62M 1PJJA 3TWKA 3GQ5A 4DR1M 1N33M 4PDGA 4ITQA 1Z5BA 1N36M 3U6PA 3U6SA 3GPPA 2OPFA 4B3RM 3A42A 3C58A 1XMQM 1IBLM 4DUYM 4JI0M 5ITXE 1I94M 1PJIA 1L1TA 4KHPM 4OX9M 1L2DA 1PM5A 1IBKM 1TDZA 2ZBKB 4NXNM 4MB7A 5LMNM 2HHHM 4LFAM 1L2CA 3U6OA 2F4VM 3SARA 2UXBM 2HKJA 4DR2M 3U6MA 1Z5AA 4PDIA 4DV6M 3SAVA 1K82A 4K0KM 2VQFM 2UUBM 3SBJA 4LFBM 3GO8A 3JR5A 3U6DA 1L2BA 4X64M 2F5QA 3SATA 3GPYA 4JI5M 5A2QS 3J81S 4G4OA 3OTOM 4DV3M 3DOAA 4DV0M 1Q3CA 4X65M 1Q3BA 5FLXS 3GQ3A 1XC8A 4DR5M 2F5SA 4JI4M 2F5PA 1EE8A 2UU9M 5ITQA 4DR3M 2EA0A 4B3TM 4YY3M 5ITRA 4JI6M 4DV5M 4G4RA 1HNXM 3SAUA 3JR4A 3GPXA 3J80S 1HNZM 4NRVA 4JI2M 4LFCM 4JI3M 3A46A 2UXCM 3T1YM 3VK8A 4LF8M 3U6EA 3VK7A 1Z59A 2XZFA 1L1ZA 1IBMM 1FJGM 1XNRM 3TWLA 3U6CA 4JI7M 3GP1A 4B3SM 2ZM6M 3GPUA 2XZUA 4X66M 1MX0A 4DV7M 2F5OA 4NXMM 1N32M 3U6QA 2UUCM 4B3MM 2Q2EB 4LF5M 4DUZM 4LF7M 2F5NA 4DR4M 5IWAM 4JV5M 2UUAM 3SAWA
chains in the Genus database with same CATH superfamily
1QUTA 1TDHA 1ZV1A 3QWLA 4IBCA 4M9SA 4NC6A 5LMUM 3W67A 2Z7JA 1MU5A 2OO9A 4LRSA 1YUBA 3Q8XA 1NV8A 3I51A 1W5TA 2R46A 3KW6A 1K3WA 5BR8M 3SASA 1PRBA 1IXZA 4AI6A 3R9XB 1WGNA 3GQ4A 3WHKA 2D7EA 1WXQA 5DNYA 1GVNA 4NSOB 3BXWA 4CHTB 2C5RA 4GC5A 2G5GX 1TGUA 4P16A 5KPRA 1YSYA 5ITUA 1HNWM 1KFVA 4GITA 2Y0QA 2LHGA 1QZEA 4LF4M 2B3TA 3J7BA 2MGWA 5EP1A 2V1UA 2EKFA 3L29A 3UMMA 3E4RA 5IT9S 3MJ5A 1C7YA 3B74A 2CV0A 4IIWA 4CISA 1YE9A 1D0MA 1Q39A 1OQYA 4G4NA 1HR0M 3HY5A 1TH3A 2LH0A 3NBIA 4AG5A 4X62M 1R2YA 2WZJA 3W0LB 1PGYA 4AKGA 4KODA 4M9ZA 4IBJA 5BPVA 1SXJA 4PDGA 2DKLA 4LG2A 8CATA 4ITQA 1Z5BA 3B7ZA 1GJTA 1DGHA 2JY7A 3HJQA 2VF7A 3RGPA 3AKZA 2L2DA 3FUWA 1YLAA 2M60A 4JI0M 1E9SA 5ITXE 4FWHA 4XK8F 2Z8YM 3SFZA 1I94M 1NO1A 4KHPM 1PJSA 4OX9M 2C9CA 1WIVA 3KXEC 4I81A 3GLFE 1G59A 1VQ1A 2ZBKB 3U60A 1BVSA 1LV7A 4RF0A 4LFAM 2X8AA 1L2CA 3ZH9B 2F4VM 2LNHC 4QOZC 1GL7A 4HEOA 4L8RC 4NOOB 4PDIA 4K0KM 3FYCA 1V34A 2M5ZA 3B9PA 3GLIB 4CIZA 2VQFM 3QYEA 4LFBM 1IN4A 2GNOA 3GO8A 3JR5A 1FNNA 4X64M 2LBCA 4LJ9A 3I4YA 1GL6A 1QVRA 4LJ5A 3U6DA 3SATA 4JI5M 3KOXE 3J81S 2ZTDA 5F3WA 1OIZA 4G4OA 3AOEA 1JR3A 1NHWC 2CFOA 3KOWE 2XF3A 2HL7A 3J27B 3VFDA 2N35A 4DV3M 2Y0TA 3UJNA 2VDBB 4X65M 3MHVC 3L27A 2LVNC 2CWBA 2F5SA 3FTEA 1ZAEA 1SXJD 1GLNA 1VEGA 3E21A 4PT5A 2GQFA 4ANRA 3KSXA 4B7FA 4YY3M 4B3TM 3WHLA 4DV5M 2ZAOA 3FE3A 3L25A 1G3IA 1NHGC 2DVWB 2JWSA 2YR0A 3VKGA 2XEPA 1HNZM 4JI2M 4LFCM 1IY0A 3DA1A 4JI3M 3VDUA 3AJIB 3L26A 4IBKA 2UXCM 2DWMA 2KZUA 4LY6A 2KEBA 3U5ZB 1EFUB 2CV2A 4GEWA 5EP2A 1L1ZA 5FSWA 3IG8A 1IBMM 2DAEA 3E9SA 1R6BX 1DO2A 3U6CA 4R71A 1DO0A 3GP1A 1D0KA 3SHFA 1XB2B 1OKSA 3U61A 2KZSA 3L2AA 1SG9A 3IG5A 4AKIA 4NXMM 4LF7M 2P5TA 4MGZE 5E6JA 2F5NA 4QOSA 4DR4M 1GJSA 3HJSA 4DBGB 4JV5M 1Y8GA 1QYRA 2DWNA 4S12A 4JN6A 5ITTA 3T1HM 3GLGB 2JP7A 2MR9A 4FCVA 2RGHA 4D81A 3W0FA 1C1KA 2X49A 1H6UA 3MMPA 1IY1A 1XXHB 2R44A 3NWLA 4UN2B 4DV4M 3TQSA 3ZC7B 1VEKA 3FYDA 4LF6M 3AL0C 2JA2A 1Z6TA 4HLQA 1HQCA 1NY5A 1OTRA 4YHHM 4LJ7A 1HT2E 2XFTA 2BNKA 4D80A 3NBXX 4LF9M 2LHCA 5ITXA 4CJ6A 3K1JA 1NJGA 2J7NA 5DFLA 1HJPA 2DNAA 2J7OA 3GLFA 4IJEA 4BBAA 4G4QA 4DR7M 3PFIA 3CF0A 4FD2A 4PCZA 1A5TA 1XXHE 1R2ZA 3F92A 2WSCF 1IN7A 3LW5F 4FVMA 2L4FA 2VIIA 3KDSE 3HU3A 1XMOM 2R4EA 1HT1E 1IXSA 3KOYE 2X4AA 2JNHA 4DR1M 1N33M 3FRHA 3J2PB 1VEJA 4LGMA 4GIPA 4KLNA 2DI0A 1OFIA 1RU3A 2KNAA 1G71A 3GRYA 4QNMA 2C99A 4Q7JA 5IREB 1IBLM 1T43A 4DUYM 2DZNB 4R7GA 1PJIA 3FRIA 3GRUA 2K0BX 3GLHB 3T15A 1L2DA 1PJTA 2L4EA 1QANA 4II7A 2QENA 3U6OA 5EXPA 5FTMA 1QAQA 2DWZB 3SARA 2HKJA 2OOBA 2XSZA 1Z5AA 4IJFA 4Y28F 1DGBA 5EP4A 2LVQD 3M6AA 4WURA 2DWLA 1J7KA 4AZFA 1T6OA 2CHVA 1Q02A 4ZPXA 3PVSA 5A2QS 3GPYA 3HX3A 3K2LA 1R5LA 2EJSA 3OTOM 3GLHE 2RGOA 2XLJA 4MGIE 4R3DA 2RRUA 4NSRA 5FLXS 2YFQA 3AOGA 1NSFA 1NNUC 3IECA 4I4LA 2F5PA 4JI4M 5ITQA 4AW4A 1OJLA 1QQWA 2JY8A 3EIHA 4RNAA 4KT0F 5EXXA 4OVZB 3MK6A 1QAMA 2JY5A 3I01M 3FTFA 3KP1E 3JR4A 4G3OA 4LCBA 3T38A 2CHGA 2H5XA 1N77A 1MN3A 1D0LA 4KO8A 3V76A 2FS1A 1Z59A 3KOZE 2DHRA 2FE8A 2I7NA 4LJ4A 2A5YB 2KXEA 3LVVA 3B7NA 2XSZD 2G8LA 4LJ8A 4GH9A 3KS4A 4X66M 3B89A 2XFSA 4DV7M 1XXHA 2HWJA 4L6V6 3U6QA 2QBYA 3Q8GA 1TR8A 3K9OA 2VF8A 2FOIC 1WJ7A 1QAOA 4FCWA 5DYIA 5FTNA 4B7GA 3GLIE 2YQZA 1S3SA 1IM2A 4JI8M 2QP9X 1GO5A 1IFYA 3FUVA 4L15A 2UUAM 2I7PA 1TH4A 2AHMA 1XHBA 2LWXA 1IXRC 3CF6E 4LRTA 5EQTA 3D8BA 1NY6A 4L16A 3UZUA 4CGYB 3J7AS 1ZMVA 3LQRA 3CTWB 1NV9A 4DV1M 4NRWA 3TWMA 2CE7A 3C9PA 5EJCA 1N34M 2L7IA 5C1BA 2V1CA 1OAOC 1PJQA 1WR1B 1EIJA 2JY6B 2OQ4A 1K3XA 4DR6M 1SXJB 4IBIA 2KRKA 4IBBA 4RF1A 2YNMD 1AIPC 1W5SA 1I4WA 3A45A 3QAUA 1VDLA 2WSEF 4JI1M 1JR3D 2QPAA 1Z5CA 1L8QA 4GKJM 2QNJA 3SHGB 2DAMA 1JQJC 1PJJA 3RGSA 3TWKA 3U60B 2DXIA 3KS8A 3T6PA 2KNZA 4AG6A 3HHZA 3GLHA 1SXJE 3B7QA 4IBEA 5JI3E 1N36M 3LCVB 4IBFA 5JI2E 3R8FA 4MGYE 4B7HA 3GPPA 3HHWA 2BWEA 4Z6YA 2OPFA 2R4JA 1XMQM 2V6ZM 1D2NA 3C3DA 1KYIA 1L1TA 4XBOA 3GLGE 1X37A 2R45A 1PM5A 1IBKM 1E94E 3BBZA 1XWIA 2BWBA 3LMMA 4MB7A 4XGIA 5LMNM 2HHHM 1E9RA 4HL4A 4M9XA 5C18A 3GRVA 2BJWA 4DV6M 2CUZA 4FCTA 2BJVA 2CHQA 2JZ0A 4OU7A 3SAVA 2C9OA 2DAIA 3SYLA 4REZA 1R4GA 1TF0B 1IN5A 4GMQA 2DHYA 3KP0E 3DOAA 4DV0M 1Q3CA 1WGLA 2KA6B 4FWDA 1Q3BA 3FTDA 2HCBA 2QHOB 3VKHA 4TUWA 3SMPA 3FUUA 5FTJA 3GLIA 4P17A 1EE8A 3KSJA 2LVPC 4L4UA 2L7HA 3L28A 1VDDA 1T3TA 2D7HA 2Z4SA 1WHCA 2R62A 3U61B 4G4RA 4JI6M 3H4MA 1HNXM 4M0WA 3SAUA 1ZMWA 3GPXA 2LXEA 3I4VA 4D82A 2DZLA 2CV1A 4OW0A 2L09A 3A46A 2KNVA 1F4IA 3TPZA 3W68A 3IHPA 4LJAA 3U6EA 3VK7A 1OAIA 3M0EA 3HU2A 1XNRM 2JUJA 3UK6A 1G41A 2MJ5B 4JI7M 3LVWA 1J09A 3ZQJA 4BLCA 5GKNA 3ZCBB 2CEAA 2QZ4A 3HZJA 2ZM6M 3GPUA 3KVWA 2KRUA 1IY2A 3QYBA 1QDTA 4WW0A 3HU1A 1JB0F 1KSFX 2Q2EB 2UUCM 1R7RA 2XGNA 2KW0A 4B3MM 4LF5M 3HHYA 5IWAM 2O01F 3U5ZA 2K47A 3HWSA 1NJFA 2NQ8C 4QHTA 3GLFB 4LZJA 3HHXA 3BOSA 2VQEM 2XH9A 4GC9A 1IN8A 2WSFF 3ILKA 4W5WA 2Z3XA 1J5EM 5ITYA 4GKKM 2DENA 2APLA 4DV2M 2EUCA 3FUXA 2J5YA 1OFHA 3DZDA 4F1IA 1QUSA 4GHAA 1QDRA 4JYAM 4B08A 3JAMS 5EP3A 2QQ8A 4LGYA 1IXSB 2CP8A 4A3VB 2ZAMA 3RE8A 2EO2A 3GLGA 3U6LA 2UXDM 1GABA 4L78A 3HKPA 1LTMA 2O25A 1N75A 3E46A 4PD2A 2KHHA 4AQYM 1UFZA 1MJGM 2FNAA 3FKEA 3LQQA 1NNJA 2MH8A 1DV0A 5IZ7D 2LVOC 2ZTCA 1IQPA 3GRRA 2E5LM 2FH0A 1V92A 1XNQM 4GHLA 4FW9A 3GQ5A 2KDLA 3TE6A 5KPZA 1UM8A 3SMSA 3A98B 3K9PA 2H1RA 5FTKA 2QSFX 2MROB 3K8ZA 1CUKA 4MH0E 3U6PA 3U6SA 3D8LA 2Y21A 2LVAA 3M7GA 5KO3A 2FFJA 4EIWA 2EKKA 4B3RM 5H37D 1ZQ9A 4GRIA 1ZMUA 3A42A 3C58A 2D7GA 4Z8XA 4G6ZA 3LCUA 2JXNA 2LTUA 4I8OA 1TDZA 2QCUA 1N78A 4NXNM 1DGHB 5KQ8A 1E32A 4IBDA 4I5SA 4QHSA 5FTLA 1V33A 2UXBM 3U6MA 2DAGA 1P3QQ 4DR2M 1K82A 2L6OA 5E26A 2UUBM 1SXJC 3SBJA 5KQDA 4NL4H 2R18A 1L2BA 2G3QA 3SC3A 2O5RA 2C96A 2F5QA 2HAKA 1ORYB 3HJ8A 4LJ6A 4M0DA 2R0IA 3HGIA 2W82A 3H4JA 3SYKA 3GQ3A 3FTCA 2K9DA 2DAKA 2Z4RA 3FD9A 5EXTA 1XC8A 3VDPA 4DR5M 3TL4X 5DYGA 2UU9M 5L8RF 4DR3M 3FUTA 4F2LA 2EA0A 1IN6A 2JZ1A 5ITRA 2ZANA 2K6BA 1DGFA 1NVMA 5EXSA 3THGA 3VLFB 5KPTA 4BB9A 3K92A 1G8PA 2CRUA 4LZZA 3J80S 3AFHA 2QBYB 2DZOB 4JXJA 1DGGA 4NRVA 4WP2A 4IBGA 3C3EA 3CF2A 1TTEA 3I04M 2R65A 2OOAA 3AOEC 1G4AE 4MGKE 3UGJA 1TH2A 3T1YM 3VK8A 2C98A 1GKIA 4MM3B 4LF8M 4RKUF 3RFWA 2XZFA 1FJGM 3TWLA 2Y20A 3PNYA 3CGWA 1JR3E 2RKOA 3DFZA 3PNVA 4FWGA 4B3SM 2XZUA 4AKHA 4OVZA 3PXGA 2R6FA 1MX0A 2F5OA 2ERCA 3AV0A 4MGHA 1N32M 1OIPA 1VG5A 3EIEA 4DUZM 1HQYE 1QZMA 4QNRA 3KFUG 1AUAA 7CATA 3SAWA
chains in the Genus database with same CATH topology
1TDHA 3QWLA 4IBCA 4M9SA 5LMUM 2Z7JA 1MU5A 4LRSA 1YUBA 3Q8XA 3I51A 3KW6A 1W5TA 2R46A 1K3WA 3SASA 5BR8M 1IXZA 4AI6A 3R9XB 3GQ4A 3WHKA 2D7EA 1WXQA 5DNYA 1GVNA 4NSOB 4CHTB 2C5RA 4GC5A 2G5GX 1TGUA 4P16A 5KPRA 1YSYA 5ITUA 1HNWM 1KFVA 4GITA 2Y0QA 4LF4M 3J7BA 5EP1A 2V1UA 3L29A 3UMMA 3E4RA 5IT9S 3MJ5A 2CV0A 4IIWA 4CISA 1YE9A 1Q39A 4G4NA 1HR0M 1TH3A 2LH0A 3NBIA 4AG5A 4X62M 1R2YA 3W0LB 4AKGA 4KODA 4M9ZA 4IBJA 5BPVA 1SXJA 4PDGA 4LG2A 8CATA 4ITQA 1Z5BA 1DGHA 3HJQA 3RGPA 3AKZA 3FUWA 2M60A 4JI0M 1E9SA 5ITXE 4FWHA 3SFZA 1I94M 4KHPM 4OX9M 2C9CA 3KXEC 4I81A 1G59A 2ZBKB 3U60A 1LV7A 4RF0A 4LFAM 2X8AA 1L2CA 3ZH9B 2F4VM 2LNHC 4QOZC 1GL7A 4L8RC 4NOOB 4PDIA 4K0KM 3FYCA 2M5ZA 3GLIB 3B9PA 2VQFM 4LFBM 1IN4A 3GO8A 3JR5A 3U6DA 1FNNA 4X64M 4LJ9A 3I4YA 1GL6A 1QVRA 4LJ5A 3SATA 4JI5M 3KOXE 3J81S 5F3WA 4G4OA 3AOEA 1JR3A 1NHWC 2CFOA 3KOWE 2XF3A 2HL7A 3J27B 3VFDA 4DV3M 2Y0TA 3UJNA 4X65M 3MHVC 3L27A 2F5SA 3FTEA 1ZAEA 1SXJD 1GLNA 4B7FA 4PT5A 4B3TM 3KSXA 4YY3M 3WHLA 4DV5M 2ZAOA 3L25A 1G3IA 1NHGC 2DVWB 2YR0A 3VKGA 2XEPA 1HNZM 4JI2M 4LFCM 1IY0A 3DA1A 4JI3M 3VDUA 3AJIB 3L26A 4IBKA 2UXCM 2DWMA 2KZUA 4LY6A 2KEBA 3U5ZB 2CV2A 5EP2A 1L1ZA 5FSWA 3IG8A 1IBMM 3E9SA 1R6BX 1DO2A 3U6CA 1DO0A 3GP1A 3SHFA 3U61A 2KZSA 3L2AA 3IG5A 4AKIA 4NXMM 4LF7M 2P5TA 4MGZE 5E6JA 2F5NA 4QOSA 4DR4M 3HJSA 4JV5M 1QYRA 2DWNA 4S12A 4JN6A 5ITTA 3T1HM 3GLGB 4FCVA 2RGHA 4D81A 3W0FA 1C1KA 2X49A 1H6UA 1IY1A 1XXHB 3NWLA 4DV4M 3TQSA 3ZC7B 3FYDA 4LF6M 2JA2A 1Z6TA 4HLQA 1HQCA 1NY5A 4YHHM 4LJ7A 1HT2E 2XFTA 2BNKA 4D80A 4LF9M 5ITXA 3K1JA 1NJGA 2J7NA 3GLFA 2J7OA 4DR7M 4IJEA 4BBAA 4G4QA 3PFIA 3CF0A 4FD2A 4PCZA 1R2ZA 1IN7A 4FVMA 2VIIA 3KDSE 3HU3A 1XMOM 2R4EA 1HT1E 3KOYE 2X4AA 4DR1M 1N33M 3J2PB 4LGMA 4GIPA 4KLNA 1OFIA 3GRYA 4QNMA 2C99A 5IREB 1IBLM 4DUYM 2DZNB 4R7GA 1PJIA 3GRUA 3GLHB 3T15A 1L2DA 1QANA 4II7A 2QENA 3U6OA 5EXPA 5FTMA 1QAQA 2DWZB 3SARA 2HKJA 2XSZA 4IJFA 1Z5AA 1DGBA 5EP4A 3M6AA 4WURA 2DWLA 1J7KA 4AZFA 2CHVA 4ZPXA 3GPYA 3PVSA 5A2QS 3K2LA 3OTOM 2RGOA 2XLJA 4MGIE 4R3DA 4NSRA 5FLXS 2YFQA 3AOGA 1NSFA 1NNUC 4JI4M 4I4LA 2F5PA 5ITQA 4AW4A 1OJLA 1QQWA 3EIHA 4RNAA 5EXXA 4OVZB 3MK6A 1QAMA 3FTFA 3KP1E 3JR4A 4LCBA 2CHGA 1N77A 4KO8A 1Z59A 3KOZE 2DHRA 2FE8A 2I7NA 4LJ4A 2A5YB 2KXEA 3LVVA 2XSZD 2G8LA 4LJ8A 4GH9A 3KS4A 4X66M 2XFSA 4DV7M 1XXHA 3U6QA 2QBYA 2FOIC 1QAOA 4FCWA 5FTNA 5DYIA 4B7GA 2YQZA 1S3SA 1IM2A 4JI8M 2QP9X 3FUVA 4L15A 2UUAM 2I7PA 1TH4A 2AHMA 1XHBA 2LWXA 1IXRC 3CF6E 4LRTA 5EQTA 3D8BA 1NY6A 4L16A 3UZUA 4CGYB 3J7AS 3LQRA 3CTWB 4DV1M 4NRWA 3TWMA 2CE7A 5EJCA 1N34M 2L7IA 5C1BA 2V1CA 2OQ4A 1K3XA 4DR6M 1SXJB 4IBIA 2KRKA 4IBBA 4RF1A 2YNMD 1W5SA 1I4WA 3A45A 3QAUA 4JI1M 1JR3D 2QPAA 1Z5CA 1L8QA 4GKJM 3SHGB 1JQJC 1PJJA 3RGSA 3TWKA 3U60B 2DXIA 3KS8A 4AG6A 3HHZA 3GLHA 1SXJE 4IBEA 5JI3E 1N36M 4IBFA 5JI2E 3R8FA 4MGYE 4B7HA 3GPPA 3HHWA 4Z6YA 2OPFA 2R4JA 1XMQM 2V6ZM 1D2NA 1KYIA 1L1TA 4XBOA 1X37A 2R45A 1PM5A 1IBKM 1E94E 1XWIA 4MB7A 3LMMA 4XGIA 5LMNM 2HHHM 1E9RA 4HL4A 4M9XA 5C18A 3GRVA 2BJWA 4DV6M 2CUZA 4FCTA 2BJVA 2CHQA 4OU7A 3SAVA 2C9OA 3SYLA 4REZA 1IN5A 4GMQA 3KP0E 3DOAA 4DV0M 1Q3CA 2KA6B 4FWDA 1Q3BA 3FTDA 2HCBA 3VKHA 4TUWA 3SMPA 3FUUA 5FTJA 3GLIA 1EE8A 3KSJA 4L4UA 2L7HA 3L28A 1VDDA 1T3TA 2D7HA 2Z4SA 2R62A 3U61B 4JI6M 4G4RA 3AL0C 3H4MA 1HNXM 4M0WA 3SAUA 3GPXA 2LXEA 3I4VA 4D82A 2CV1A 4OW0A 2L09A 3A46A 3TPZA 4LJAA 3U6EA 3VK7A 3M0EA 3HU2A 1XNRM 3UK6A 1G41A 4JI7M 3LVWA 1J09A 4BLCA 5GKNA 3ZCBB 2CEAA 2QZ4A 2ZM6M 3GPUA 3KVWA 2KRUA 1IY2A 4WW0A 3HU1A 1KSFX 2UUCM 2Q2EB 4B3MM 1R7RA 2XGNA 2KW0A 4LF5M 3HHYA 5IWAM 3U5ZA 2K47A 3HWSA 1NJFA 2NQ8C 4QHTA 3GLFB 4LZJA 3HHXA 3BOSA 2VQEM 2XH9A 4GC9A 1IN8A 3ILKA 4W5WA 2Z3XA 1J5EM 5ITYA 4GKKM 4DV2M 2EUCA 3FUXA 1OFHA 3DZDA 4GHAA 4JYAM 4B08A 3JAMS 5EP3A 4LGYA 1IXSB 4A3VB 2ZAMA 3RE8A 2EO2A 3GLGA 3U6LA 2UXDM 4L78A 3HKPA 1N75A 4PD2A 4AQYM 2FNAA 3FKEA 3LQQA 1NNJA 5IZ7D 1IQPA 3GRRA 2E5LM 1XNQM 4GHLA 4FW9A 3GQ5A 3TE6A 5KPZA 1UM8A 3SMSA 3A98B 2H1RA 5FTKA 3K8ZA 4MH0E 3U6PA 3U6SA 3D8LA 2Y21A 3M7GA 5KO3A 2FFJA 4EIWA 4B3RM 5H37D 1ZQ9A 4GRIA 3A42A 3C58A 2D7GA 4Z8XA 4G6ZA 4I8OA 1TDZA 2QCUA 1N78A 4NXNM 1DGHB 5KQ8A 1E32A 4IBDA 4I5SA 4QHSA 5FTLA 2UXBM 3U6MA 4DR2M 1K82A 2L6OA 5E26A 2UUBM 1SXJC 3SBJA 5KQDA 4NL4H 2R18A 1L2BA 3SC3A 2O5RA 2C96A 2F5QA 4LJ6A 1ORYB 3HJ8A 4M0DA 3HGIA 2W82A 3SYKA 3GQ3A 3FTCA 2Z4RA 3FD9A 5EXTA 1XC8A 3VDPA 4DR5M 3TL4X 5DYGA 2UU9M 4DR3M 3FUTA 2EA0A 1IN6A 5ITRA 2ZANA 1DGFA 1NVMA 5EXSA 3THGA 3VLFB 5KPTA 4BB9A 3K92A 1G8PA 4LZZA 3J80S 3AFHA 2QBYB 2DZOB 4JXJA 1DGGA 4NRVA 4IBGA 3CF2A 2R65A 3AOEC 4MGKE 1G4AE 3UGJA 3T1YM 1TH2A 3VK8A 4LF8M 2C98A 1GKIA 4MM3B 3RFWA 2XZFA 1FJGM 3TWLA 2Y20A 3PNYA 2RKOA 3DFZA 3PNVA 4FWGA 4B3SM 2XZUA 4AKHA 4OVZA 3PXGA 1MX0A 2F5OA 2ERCA 3AV0A 4MGHA 1N32M 3EIEA 4DUZM 1HQYE 1QZMA 4QNRA 3KFUG 3T38A 7CATA 3SAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDH A;  5ITT A;  5LMU M;  3T1H M;  4JI8 M;  1MU5 A;  3W0F A;  2VQE M;  4DV4 M;  3SAS A;  1K3W A;  5BR8 M;  4LF6 M;  1J5E M;  5ITY A;  4GKK M;  3GQ4 A;  4DV2 M;  4YHH M;  3J7A S;  4JYA M;  4DV1 M;  4NRW A;  3JAM S;  3TWM A;  1N34 M;  4LF9 M;  5ITX A;  5ITU A;  1HNW M;  2UXD M;  3U6L A;  1KFV A;  2OQ4 A;  1K3X A;  4DR7 M;  4DR6 M;  4G4Q A;  4LF4 M;  4PD2 A;  4PCZ A;  4AQY M;  1NNJ A;  3A45 A;  4JI1 M;  5IT9 S;  1R2Z A;  1Z5C A;  4CIS A;  1Q39 A;  4GKJ M;  4G4N A;  1HR0 M;  2E5L M;  1R2Y A;  1XNQ M;  1XMO M;  4X62 M;  1PJJ A;  3TWK A;  3GQ5 A;  4DR1 M;  1N33 M;  4PDG A;  4ITQ A;  1Z5B A;  1N36 M;  3U6P A;  3U6S A;  3GPP A;  2OPF A;  4B3R M;  3A42 A;  3C58 A;  1XMQ M;  1IBL M;  4DUY M;  4JI0 M;  5ITX E;  1I94 M;  1PJI A;  1L1T A;  4KHP M;  4OX9 M;  1L2D A;  1PM5 A;  1IBK M;  1TDZ A;  2ZBK B;  4NXN M;  4MB7 A;  5LMN M;  2HHH M;  4LFA M;  1L2C A;  3U6O A;  2F4V M;  3SAR A;  2UXB M;  2HKJ A;  4DR2 M;  3U6M A;  1Z5A A;  4PDI A;  4DV6 M;  3SAV A;  1K82 A;  4K0K M;  2VQF M;  2UUB M;  3SBJ A;  4LFB M;  3GO8 A;  3JR5 A;  3U6D A;  1L2B A;  4X64 M;  2F5Q A;  3SAT A;  3GPY A;  4JI5 M;  5A2Q S;  3J81 S;  4G4O A;  3OTO M;  4DV3 M;  3DOA A;  4DV0 M;  1Q3C A;  4X65 M;  1Q3B A;  5FLX S;  3GQ3 A;  1XC8 A;  4DR5 M;  2F5S A;  4JI4 M;  2F5P A;  1EE8 A;  2UU9 M;  5ITQ A;  4DR3 M;  2EA0 A;  4B3T M;  4YY3 M;  5ITR A;  4JI6 M;  4DV5 M;  4G4R A;  1HNX M;  3SAU A;  3JR4 A;  3GPX A;  3J80 S;  1HNZ M;  4NRV A;  4JI2 M;  4LFC M;  4JI3 M;  3A46 A;  2UXC M;  3T1Y M;  3VK8 A;  4LF8 M;  3U6E A;  3VK7 A;  1Z59 A;  2XZF A;  1L1Z A;  1IBM M;  1FJG M;  1XNR M;  3TWL A;  3U6C A;  4JI7 M;  3GP1 A;  4B3S M;  2ZM6 M;  3GPU A;  2XZU A;  4X66 M;  1MX0 A;  4DV7 M;  2F5O A;  4NXM M;  1N32 M;  3U6Q A;  2UUC M;  4B3M M;  2Q2E B;  4LF5 M;  4DUZ M;  4LF7 M;  2F5N A;  4DR4 M;  5IWA M;  4JV5 M;  2UUA M;  3SAW A; 
#chains in the Genus database with same CATH topology
 1QUT A;  1TDH A;  1ZV1 A;  3QWL A;  4IBC A;  4M9S A;  4NC6 A;  5LMU M;  3W67 A;  2Z7J A;  1MU5 A;  2OO9 A;  4LRS A;  1YUB A;  3Q8X A;  1NV8 A;  3I51 A;  1W5T A;  2R46 A;  3KW6 A;  1K3W A;  5BR8 M;  3SAS A;  1PRB A;  1IXZ A;  4AI6 A;  3R9X B;  1WGN A;  3GQ4 A;  3WHK A;  2D7E A;  1WXQ A;  5DNY A;  1GVN A;  4NSO B;  3BXW A;  4CHT B;  2C5R A;  4GC5 A;  2G5G X;  1TGU A;  4P16 A;  5KPR A;  1YSY A;  5ITU A;  1HNW M;  1KFV A;  4GIT A;  2Y0Q A;  2LHG A;  1QZE A;  4LF4 M;  2B3T A;  3J7B A;  2MGW A;  5EP1 A;  2V1U A;  2EKF A;  3L29 A;  3UMM A;  3E4R A;  5IT9 S;  3MJ5 A;  1C7Y A;  3B74 A;  2CV0 A;  4IIW A;  4CIS A;  1YE9 A;  1D0M A;  1Q39 A;  1OQY A;  4G4N A;  1HR0 M;  3HY5 A;  1TH3 A;  2LH0 A;  3NBI A;  4AG5 A;  4X62 M;  1R2Y A;  2WZJ A;  3W0L B;  1PGY A;  4AKG A;  4KOD A;  4M9Z A;  4IBJ A;  5BPV A;  1SXJ A;  4PDG A;  2DKL A;  4LG2 A;  8CAT A;  4ITQ A;  1Z5B A;  3B7Z A;  1GJT A;  1DGH A;  2JY7 A;  3HJQ A;  2VF7 A;  3RGP A;  3AKZ A;  2L2D A;  3FUW A;  1YLA A;  2M60 A;  4JI0 M;  1E9S A;  5ITX E;  4FWH A;  4XK8 F;  2Z8Y M;  3SFZ A;  1I94 M;  1NO1 A;  4KHP M;  1PJS A;  4OX9 M;  2C9C A;  1WIV A;  3KXE C;  4I81 A;  3GLF E;  1G59 A;  1VQ1 A;  2ZBK B;  3U60 A;  1BVS A;  1LV7 A;  4RF0 A;  4LFA M;  2X8A A;  1L2C A;  3ZH9 B;  2F4V M;  2LNH C;  4QOZ C;  1GL7 A;  4HEO A;  4L8R C;  4NOO B;  4PDI A;  4K0K M;  3FYC A;  1V34 A;  2M5Z A;  3B9P A;  3GLI B;  4CIZ A;  2VQF M;  3QYE A;  4LFB M;  1IN4 A;  2GNO A;  3GO8 A;  3JR5 A;  1FNN A;  4X64 M;  2LBC A;  4LJ9 A;  3I4Y A;  1GL6 A;  1QVR A;  4LJ5 A;  3U6D A;  3SAT A;  4JI5 M;  3KOX E;  3J81 S;  2ZTD A;  5F3W A;  1OIZ A;  4G4O A;  3AOE A;  1JR3 A;  1NHW C;  2CFO A;  3KOW E;  2XF3 A;  2HL7 A;  3J27 B;  3VFD A;  2N35 A;  4DV3 M;  2Y0T A;  3UJN A;  2VDB B;  4X65 M;  3MHV C;  3L27 A;  2LVN C;  2CWB A;  2F5S A;  3FTE A;  1ZAE A;  1SXJ D;  1GLN A;  1VEG A;  3E21 A;  4PT5 A;  2GQF A;  4ANR A;  3KSX A;  4B7F A;  4YY3 M;  4B3T M;  3WHL A;  4DV5 M;  2ZAO A;  3FE3 A;  3L25 A;  1G3I A;  1NHG C;  2DVW B;  2JWS A;  2YR0 A;  3VKG A;  2XEP A;  1HNZ M;  4JI2 M;  4LFC M;  1IY0 A;  3DA1 A;  4JI3 M;  3VDU A;  3AJI B;  3L26 A;  4IBK A;  2UXC M;  2DWM A;  2KZU A;  4LY6 A;  2KEB A;  3U5Z B;  1EFU B;  2CV2 A;  4GEW A;  5EP2 A;  1L1Z A;  5FSW A;  3IG8 A;  1IBM M;  2DAE A;  3E9S A;  1R6B X;  1DO2 A;  3U6C A;  4R71 A;  1DO0 A;  3GP1 A;  1D0K A;  3SHF A;  1XB2 B;  1OKS A;  3U61 A;  2KZS A;  3L2A A;  1SG9 A;  3IG5 A;  4AKI A;  4NXM M;  4LF7 M;  2P5T A;  4MGZ E;  5E6J A;  2F5N A;  4QOS A;  4DR4 M;  1GJS A;  3HJS A;  4DBG B;  4JV5 M;  1Y8G A;  1QYR A;  2DWN A;  4S12 A;  4JN6 A;  5ITT A;  3T1H M;  3GLG B;  2JP7 A;  2MR9 A;  4FCV A;  2RGH A;  4D81 A;  3W0F A;  1C1K A;  2X49 A;  1H6U A;  3MMP A;  1IY1 A;  1XXH B;  2R44 A;  3NWL A;  4UN2 B;  4DV4 M;  3TQS A;  3ZC7 B;  1VEK A;  3FYD A;  4LF6 M;  3AL0 C;  2JA2 A;  1Z6T A;  4HLQ A;  1HQC A;  1NY5 A;  1OTR A;  4YHH M;  4LJ7 A;  1HT2 E;  2XFT A;  2BNK A;  4D80 A;  3NBX X;  4LF9 M;  2LHC A;  5ITX A;  4CJ6 A;  3K1J A;  1NJG A;  2J7N A;  5DFL A;  1HJP A;  2DNA A;  2J7O A;  3GLF A;  4IJE A;  4BBA A;  4G4Q A;  4DR7 M;  3PFI A;  3CF0 A;  4FD2 A;  4PCZ A;  1A5T A;  1XXH E;  1R2Z A;  3F92 A;  2WSC F;  1IN7 A;  3LW5 F;  4FVM A;  2L4F A;  2VII A;  3KDS E;  3HU3 A;  1XMO M;  2R4E A;  1HT1 E;  1IXS A;  3KOY E;  2X4A A;  2JNH A;  4DR1 M;  1N33 M;  3FRH A;  3J2P B;  1VEJ A;  4LGM A;  4GIP A;  4KLN A;  2DI0 A;  1OFI A;  1RU3 A;  2KNA A;  1G71 A;  3GRY A;  4QNM A;  2C99 A;  4Q7J A;  5IRE B;  1IBL M;  1T43 A;  4DUY M;  2DZN B;  4R7G A;  1PJI A;  3FRI A;  3GRU A;  2K0B X;  3GLH B;  3T15 A;  1L2D A;  1PJT A;  2L4E A;  1QAN A;  4II7 A;  2QEN A;  3U6O A;  5EXP A;  5FTM A;  1QAQ A;  2DWZ B;  3SAR A;  2HKJ A;  2OOB A;  2XSZ A;  1Z5A A;  4IJF A;  4Y28 F;  1DGB A;  5EP4 A;  2LVQ D;  3M6A A;  4WUR A;  2DWL A;  1J7K A;  4AZF A;  1T6O A;  2CHV A;  1Q02 A;  4ZPX A;  3PVS A;  5A2Q S;  3GPY A;  3HX3 A;  3K2L A;  1R5L A;  2EJS A;  3OTO M;  3GLH E;  2RGO A;  2XLJ A;  4MGI E;  4R3D A;  2RRU A;  4NSR A;  5FLX S;  2YFQ A;  3AOG A;  1NSF A;  1NNU C;  3IEC A;  4I4L A;  2F5P A;  4JI4 M;  5ITQ A;  4AW4 A;  1OJL A;  1QQW A;  2JY8 A;  3EIH A;  4RNA A;  4KT0 F;  5EXX A;  4OVZ B;  3MK6 A;  1QAM A;  2JY5 A;  3I01 M;  3FTF A;  3KP1 E;  3JR4 A;  4G3O A;  4LCB A;  3T38 A;  2CHG A;  2H5X A;  1N77 A;  1MN3 A;  1D0L A;  4KO8 A;  3V76 A;  2FS1 A;  1Z59 A;  3KOZ E;  2DHR A;  2FE8 A;  2I7N A;  4LJ4 A;  2A5Y B;  2KXE A;  3LVV A;  3B7N A;  2XSZ D;  2G8L A;  4LJ8 A;  4GH9 A;  3KS4 A;  4X66 M;  3B89 A;  2XFS A;  4DV7 M;  1XXH A;  2HWJ A;  4L6V 6;  3U6Q A;  2QBY A;  3Q8G A;  1TR8 A;  3K9O A;  2VF8 A;  2FOI C;  1WJ7 A;  1QAO A;  4FCW A;  5DYI A;  5FTN A;  4B7G A;  3GLI E;  2YQZ A;  1S3S A;  1IM2 A;  4JI8 M;  2QP9 X;  1GO5 A;  1IFY A;  3FUV A;  4L15 A;  2UUA M;  2I7P A;  1TH4 A;  2AHM A;  1XHB A;  2LWX A;  1IXR C;  3CF6 E;  4LRT A;  5EQT A;  3D8B A;  1NY6 A;  4L16 A;  3UZU A;  4CGY B;  3J7A S;  1ZMV A;  3LQR A;  3CTW B;  1NV9 A;  4DV1 M;  4NRW A;  3TWM A;  2CE7 A;  3C9P A;  5EJC A;  1N34 M;  2L7I A;  5C1B A;  2V1C A;  1OAO C;  1PJQ A;  1WR1 B;  1EIJ A;  2JY6 B;  2OQ4 A;  1K3X A;  4DR6 M;  1SXJ B;  4IBI A;  2KRK A;  4IBB A;  4RF1 A;  2YNM D;  1AIP C;  1W5S A;  1I4W A;  3A45 A;  3QAU A;  1VDL A;  2WSE F;  4JI1 M;  1JR3 D;  2QPA A;  1Z5C A;  1L8Q A;  4GKJ M;  2QNJ A;  3SHG B;  2DAM A;  1JQJ C;  1PJJ A;  3RGS A;  3TWK A;  3U60 B;  2DXI A;  3KS8 A;  3T6P A;  2KNZ A;  4AG6 A;  3HHZ A;  3GLH A;  1SXJ E;  3B7Q A;  4IBE A;  5JI3 E;  1N36 M;  3LCV B;  4IBF A;  5JI2 E;  3R8F A;  4MGY E;  4B7H A;  3GPP A;  3HHW A;  2BWE A;  4Z6Y A;  2OPF A;  2R4J A;  1XMQ M;  2V6Z M;  1D2N A;  3C3D A;  1KYI A;  1L1T A;  4XBO A;  3GLG E;  1X37 A;  2R45 A;  1PM5 A;  1IBK M;  1E94 E;  3BBZ A;  1XWI A;  2BWB A;  3LMM A;  4MB7 A;  4XGI A;  5LMN M;  2HHH M;  1E9R A;  4HL4 A;  4M9X A;  5C18 A;  3GRV A;  2BJW A;  4DV6 M;  2CUZ A;  4FCT A;  2BJV A;  2CHQ A;  2JZ0 A;  4OU7 A;  3SAV A;  2C9O A;  2DAI A;  3SYL A;  4REZ A;  1R4G A;  1TF0 B;  1IN5 A;  4GMQ A;  2DHY A;  3KP0 E;  3DOA A;  4DV0 M;  1Q3C A;  1WGL A;  2KA6 B;  4FWD A;  1Q3B A;  3FTD A;  2HCB A;  2QHO B;  3VKH A;  4TUW A;  3SMP A;  3FUU A;  5FTJ A;  3GLI A;  4P17 A;  1EE8 A;  3KSJ A;  2LVP C;  4L4U A;  2L7H A;  3L28 A;  1VDD A;  1T3T A;  2D7H A;  2Z4S A;  1WHC A;  2R62 A;  3U61 B;  4G4R A;  4JI6 M;  3H4M A;  1HNX M;  4M0W A;  3SAU A;  1ZMW A;  3GPX A;  2LXE A;  3I4V A;  4D82 A;  2DZL A;  2CV1 A;  4OW0 A;  2L09 A;  3A46 A;  2KNV A;  1F4I A;  3TPZ A;  3W68 A;  3IHP A;  4LJA A;  3U6E A;  3VK7 A;  1OAI A;  3M0E A;  3HU2 A;  1XNR M;  2JUJ A;  3UK6 A;  1G41 A;  2MJ5 B;  4JI7 M;  3LVW A;  1J09 A;  3ZQJ A;  4BLC A;  5GKN A;  3ZCB B;  2CEA A;  2QZ4 A;  3HZJ A;  2ZM6 M;  3GPU A;  3KVW A;  2KRU A;  1IY2 A;  3QYB A;  1QDT A;  4WW0 A;  3HU1 A;  1JB0 F;  1KSF X;  2Q2E B;  2UUC M;  1R7R A;  2XGN A;  2KW0 A;  4B3M M;  4LF5 M;  3HHY A;  5IWA M;  2O01 F;  3U5Z A;  2K47 A;  3HWS A;  1NJF A;  2NQ8 C;  4QHT A;  3GLF B;  4LZJ A;  3HHX A;  3BOS A;  2VQE M;  2XH9 A;  4GC9 A;  1IN8 A;  2WSF F;  3ILK A;  4W5W A;  2Z3X A;  1J5E M;  5ITY A;  4GKK M;  2DEN A;  2APL A;  4DV2 M;  2EUC A;  3FUX A;  2J5Y A;  1OFH A;  3DZD A;  4F1I A;  1QUS A;  4GHA A;  1QDR A;  4JYA M;  4B08 A;  3JAM S;  5EP3 A;  2QQ8 A;  4LGY A;  1IXS B;  2CP8 A;  4A3V B;  2ZAM A;  3RE8 A;  2EO2 A;  3GLG A;  3U6L A;  2UXD M;  1GAB A;  4L78 A;  3HKP A;  1LTM A;  2O25 A;  1N75 A;  3E46 A;  4PD2 A;  2KHH A;  4AQY M;  1UFZ A;  1MJG M;  2FNA A;  3FKE A;  3LQQ A;  1NNJ A;  2MH8 A;  1DV0 A;  5IZ7 D;  2LVO C;  2ZTC A;  1IQP A;  3GRR A;  2E5L M;  2FH0 A;  1V92 A;  1XNQ M;  4GHL A;  4FW9 A;  3GQ5 A;  2KDL A;  3TE6 A;  5KPZ A;  1UM8 A;  3SMS A;  3A98 B;  3K9P A;  2H1R A;  5FTK A;  2QSF X;  2MRO B;  3K8Z A;  1CUK A;  4MH0 E;  3U6P A;  3U6S A;  3D8L A;  2Y21 A;  2LVA A;  3M7G A;  5KO3 A;  2FFJ A;  4EIW A;  2EKK A;  4B3R M;  5H37 D;  1ZQ9 A;  4GRI A;  1ZMU A;  3A42 A;  3C58 A;  2D7G A;  4Z8X A;  4G6Z A;  3LCU A;  2JXN A;  2LTU A;  4I8O A;  1TDZ A;  2QCU A;  1N78 A;  4NXN M;  1DGH B;  5KQ8 A;  1E32 A;  4IBD A;  4I5S A;  4QHS A;  5FTL A;  1V33 A;  2UXB M;  3U6M A;  2DAG A;  1P3Q Q;  4DR2 M;  1K82 A;  2L6O A;  5E26 A;  2UUB M;  1SXJ C;  3SBJ A;  5KQD A;  4NL4 H;  2R18 A;  1L2B A;  2G3Q A;  3SC3 A;  2O5R A;  2C96 A;  2F5Q A;  2HAK A;  1ORY B;  3HJ8 A;  4LJ6 A;  4M0D A;  2R0I A;  3HGI A;  2W82 A;  3H4J A;  3SYK A;  3GQ3 A;  3FTC A;  2K9D A;  2DAK A;  2Z4R A;  3FD9 A;  5EXT A;  1XC8 A;  3VDP A;  4DR5 M;  3TL4 X;  5DYG A;  2UU9 M;  5L8R F;  4DR3 M;  3FUT A;  4F2L A;  2EA0 A;  1IN6 A;  2JZ1 A;  5ITR A;  2ZAN A;  2K6B A;  1DGF A;  1NVM A;  5EXS A;  3THG A;  3VLF B;  5KPT A;  4BB9 A;  3K92 A;  1G8P A;  2CRU A;  4LZZ A;  3J80 S;  3AFH A;  2QBY B;  2DZO B;  4JXJ A;  1DGG A;  4NRV A;  4WP2 A;  4IBG A;  3C3E A;  3CF2 A;  1TTE A;  3I04 M;  2R65 A;  2OOA A;  3AOE C;  1G4A E;  4MGK E;  3UGJ A;  1TH2 A;  3T1Y M;  3VK8 A;  2C98 A;  1GKI A;  4MM3 B;  4LF8 M;  4RKU F;  3RFW A;  2XZF A;  1FJG M;  3TWL A;  2Y20 A;  3PNY A;  3CGW A;  1JR3 E;  2RKO A;  3DFZ A;  3PNV A;  4FWG A;  4B3S M;  2XZU A;  4AKH A;  4OVZ A;  3PXG A;  2R6F A;  1MX0 A;  2F5O A;  2ERC A;  3AV0 A;  4MGH A;  1N32 M;  1OIP A;  1VG5 A;  3EIE A;  4DUZ M;  1HQY E;  1QZM A;  4QNR A;  3KFU G;  1AUA A;  7CAT A;  3SAW A; 
#chains in the Genus database with same CATH homology
 1TDH A;  3QWL A;  4IBC A;  4M9S A;  5LMU M;  2Z7J A;  1MU5 A;  4LRS A;  1YUB A;  3Q8X A;  3I51 A;  3KW6 A;  1W5T A;  2R46 A;  1K3W A;  3SAS A;  5BR8 M;  1IXZ A;  4AI6 A;  3R9X B;  3GQ4 A;  3WHK A;  2D7E A;  1WXQ A;  5DNY A;  1GVN A;  4NSO B;  4CHT B;  2C5R A;  4GC5 A;  2G5G X;  1TGU A;  4P16 A;  5KPR A;  1YSY A;  5ITU A;  1HNW M;  1KFV A;  4GIT A;  2Y0Q A;  4LF4 M;  3J7B A;  5EP1 A;  2V1U A;  3L29 A;  3UMM A;  3E4R A;  5IT9 S;  3MJ5 A;  2CV0 A;  4IIW A;  4CIS A;  1YE9 A;  1Q39 A;  4G4N A;  1HR0 M;  1TH3 A;  2LH0 A;  3NBI A;  4AG5 A;  4X62 M;  1R2Y A;  3W0L B;  4AKG A;  4KOD A;  4M9Z A;  4IBJ A;  5BPV A;  1SXJ A;  4PDG A;  4LG2 A;  8CAT A;  4ITQ A;  1Z5B A;  1DGH A;  3HJQ A;  3RGP A;  3AKZ A;  3FUW A;  2M60 A;  4JI0 M;  1E9S A;  5ITX E;  4FWH A;  3SFZ A;  1I94 M;  4KHP M;  4OX9 M;  2C9C A;  3KXE C;  4I81 A;  1G59 A;  2ZBK B;  3U60 A;  1LV7 A;  4RF0 A;  4LFA M;  2X8A A;  1L2C A;  3ZH9 B;  2F4V M;  2LNH C;  4QOZ C;  1GL7 A;  4L8R C;  4NOO B;  4PDI A;  4K0K M;  3FYC A;  2M5Z A;  3GLI B;  3B9P A;  2VQF M;  4LFB M;  1IN4 A;  3GO8 A;  3JR5 A;  3U6D A;  1FNN A;  4X64 M;  4LJ9 A;  3I4Y A;  1GL6 A;  1QVR A;  4LJ5 A;  3SAT A;  4JI5 M;  3KOX E;  3J81 S;  5F3W A;  4G4O A;  3AOE A;  1JR3 A;  1NHW C;  2CFO A;  3KOW E;  2XF3 A;  2HL7 A;  3J27 B;  3VFD A;  4DV3 M;  2Y0T A;  3UJN A;  4X65 M;  3MHV C;  3L27 A;  2F5S A;  3FTE A;  1ZAE A;  1SXJ D;  1GLN A;  4B7F A;  4PT5 A;  4B3T M;  3KSX A;  4YY3 M;  3WHL A;  4DV5 M;  2ZAO A;  3L25 A;  1G3I A;  1NHG C;  2DVW B;  2YR0 A;  3VKG A;  2XEP A;  1HNZ M;  4JI2 M;  4LFC M;  1IY0 A;  3DA1 A;  4JI3 M;  3VDU A;  3AJI B;  3L26 A;  4IBK A;  2UXC M;  2DWM A;  2KZU A;  4LY6 A;  2KEB A;  3U5Z B;  2CV2 A;  5EP2 A;  1L1Z A;  5FSW A;  3IG8 A;  1IBM M;  3E9S A;  1R6B X;  1DO2 A;  3U6C A;  1DO0 A;  3GP1 A;  3SHF A;  3U61 A;  2KZS A;  3L2A A;  3IG5 A;  4AKI A;  4NXM M;  4LF7 M;  2P5T A;  4MGZ E;  5E6J A;  2F5N A;  4QOS A;  4DR4 M;  3HJS A;  4JV5 M;  1QYR A;  2DWN A;  4S12 A;  4JN6 A;  5ITT A;  3T1H M;  3GLG B;  4FCV A;  2RGH A;  4D81 A;  3W0F A;  1C1K A;  2X49 A;  1H6U A;  1IY1 A;  1XXH B;  3NWL A;  4DV4 M;  3TQS A;  3ZC7 B;  3FYD A;  4LF6 M;  2JA2 A;  1Z6T A;  4HLQ A;  1HQC A;  1NY5 A;  4YHH M;  4LJ7 A;  1HT2 E;  2XFT A;  2BNK A;  4D80 A;  4LF9 M;  5ITX A;  3K1J A;  1NJG A;  2J7N A;  3GLF A;  2J7O A;  4DR7 M;  4IJE A;  4BBA A;  4G4Q A;  3PFI A;  3CF0 A;  4FD2 A;  4PCZ A;  1R2Z A;  1IN7 A;  4FVM A;  2VII A;  3KDS E;  3HU3 A;  1XMO M;  2R4E A;  1HT1 E;  3KOY E;  2X4A A;  4DR1 M;  1N33 M;  3J2P B;  4LGM A;  4GIP A;  4KLN A;  1OFI A;  3GRY A;  4QNM A;  2C99 A;  5IRE B;  1IBL M;  4DUY M;  2DZN B;  4R7G A;  1PJI A;  3GRU A;  3GLH B;  3T15 A;  1L2D A;  1QAN A;  4II7 A;  2QEN A;  3U6O A;  5EXP A;  5FTM A;  1QAQ A;  2DWZ B;  3SAR A;  2HKJ A;  2XSZ A;  4IJF A;  1Z5A A;  1DGB A;  5EP4 A;  3M6A A;  4WUR A;  2DWL A;  1J7K A;  4AZF A;  2CHV A;  4ZPX A;  3GPY A;  3PVS A;  5A2Q S;  3K2L A;  3OTO M;  2RGO A;  2XLJ A;  4MGI E;  4R3D A;  4NSR A;  5FLX S;  2YFQ A;  3AOG A;  1NSF A;  1NNU C;  4JI4 M;  4I4L A;  2F5P A;  5ITQ A;  4AW4 A;  1OJL A;  1QQW A;  3EIH A;  4RNA A;  5EXX A;  4OVZ B;  3MK6 A;  1QAM A;  3FTF A;  3KP1 E;  3JR4 A;  4LCB A;  2CHG A;  1N77 A;  4KO8 A;  1Z59 A;  3KOZ E;  2DHR A;  2FE8 A;  2I7N A;  4LJ4 A;  2A5Y B;  2KXE A;  3LVV A;  2XSZ D;  2G8L A;  4LJ8 A;  4GH9 A;  3KS4 A;  4X66 M;  2XFS A;  4DV7 M;  1XXH A;  3U6Q A;  2QBY A;  2FOI C;  1QAO A;  4FCW A;  5FTN A;  5DYI A;  4B7G A;  2YQZ A;  1S3S A;  1IM2 A;  4JI8 M;  2QP9 X;  3FUV A;  4L15 A;  2UUA M;  2I7P A;  1TH4 A;  2AHM A;  1XHB A;  2LWX A;  1IXR C;  3CF6 E;  4LRT A;  5EQT A;  3D8B A;  1NY6 A;  4L16 A;  3UZU A;  4CGY B;  3J7A S;  3LQR A;  3CTW B;  4DV1 M;  4NRW A;  3TWM A;  2CE7 A;  5EJC A;  1N34 M;  2L7I A;  5C1B A;  2V1C A;  2OQ4 A;  1K3X A;  4DR6 M;  1SXJ B;  4IBI A;  2KRK A;  4IBB A;  4RF1 A;  2YNM D;  1W5S A;  1I4W A;  3A45 A;  3QAU A;  4JI1 M;  1JR3 D;  2QPA A;  1Z5C A;  1L8Q A;  4GKJ M;  3SHG B;  1JQJ C;  1PJJ A;  3RGS A;  3TWK A;  3U60 B;  2DXI A;  3KS8 A;  4AG6 A;  3HHZ A;  3GLH A;  1SXJ E;  4IBE A;  5JI3 E;  1N36 M;  4IBF A;  5JI2 E;  3R8F A;  4MGY E;  4B7H A;  3GPP A;  3HHW A;  4Z6Y A;  2OPF A;  2R4J A;  1XMQ M;  2V6Z M;  1D2N A;  1KYI A;  1L1T A;  4XBO A;  1X37 A;  2R45 A;  1PM5 A;  1IBK M;  1E94 E;  1XWI A;  4MB7 A;  3LMM A;  4XGI A;  5LMN M;  2HHH M;  1E9R A;  4HL4 A;  4M9X A;  5C18 A;  3GRV A;  2BJW A;  4DV6 M;  2CUZ A;  4FCT A;  2BJV A;  2CHQ A;  4OU7 A;  3SAV A;  2C9O A;  3SYL A;  4REZ A;  1IN5 A;  4GMQ A;  3KP0 E;  3DOA A;  4DV0 M;  1Q3C A;  2KA6 B;  4FWD A;  1Q3B A;  3FTD A;  2HCB A;  3VKH A;  4TUW A;  3SMP A;  3FUU A;  5FTJ A;  3GLI A;  1EE8 A;  3KSJ A;  4L4U A;  2L7H A;  3L28 A;  1VDD A;  1T3T A;  2D7H A;  2Z4S A;  2R62 A;  3U61 B;  4JI6 M;  4G4R A;  3AL0 C;  3H4M A;  1HNX M;  4M0W A;  3SAU A;  3GPX A;  2LXE A;  3I4V A;  4D82 A;  2CV1 A;  4OW0 A;  2L09 A;  3A46 A;  3TPZ A;  4LJA A;  3U6E A;  3VK7 A;  3M0E A;  3HU2 A;  1XNR M;  3UK6 A;  1G41 A;  4JI7 M;  3LVW A;  1J09 A;  4BLC A;  5GKN A;  3ZCB B;  2CEA A;  2QZ4 A;  2ZM6 M;  3GPU A;  3KVW A;  2KRU A;  1IY2 A;  4WW0 A;  3HU1 A;  1KSF X;  2UUC M;  2Q2E B;  4B3M M;  1R7R A;  2XGN A;  2KW0 A;  4LF5 M;  3HHY A;  5IWA M;  3U5Z A;  2K47 A;  3HWS A;  1NJF A;  2NQ8 C;  4QHT A;  3GLF B;  4LZJ A;  3HHX A;  3BOS A;  2VQE M;  2XH9 A;  4GC9 A;  1IN8 A;  3ILK A;  4W5W A;  2Z3X A;  1J5E M;  5ITY A;  4GKK M;  4DV2 M;  2EUC A;  3FUX A;  1OFH A;  3DZD A;  4GHA A;  4JYA M;  4B08 A;  3JAM S;  5EP3 A;  4LGY A;  1IXS B;  4A3V B;  2ZAM A;  3RE8 A;  2EO2 A;  3GLG A;  3U6L A;  2UXD M;  4L78 A;  3HKP A;  1N75 A;  4PD2 A;  4AQY M;  2FNA A;  3FKE A;  3LQQ A;  1NNJ A;  5IZ7 D;  1IQP A;  3GRR A;  2E5L M;  1XNQ M;  4GHL A;  4FW9 A;  3GQ5 A;  3TE6 A;  5KPZ A;  1UM8 A;  3SMS A;  3A98 B;  2H1R A;  5FTK A;  3K8Z A;  4MH0 E;  3U6P A;  3U6S A;  3D8L A;  2Y21 A;  3M7G A;  5KO3 A;  2FFJ A;  4EIW A;  4B3R M;  5H37 D;  1ZQ9 A;  4GRI A;  3A42 A;  3C58 A;  2D7G A;  4Z8X A;  4G6Z A;  4I8O A;  1TDZ A;  2QCU A;  1N78 A;  4NXN M;  1DGH B;  5KQ8 A;  1E32 A;  4IBD A;  4I5S A;  4QHS A;  5FTL A;  2UXB M;  3U6M A;  4DR2 M;  1K82 A;  2L6O A;  5E26 A;  2UUB M;  1SXJ C;  3SBJ A;  5KQD A;  4NL4 H;  2R18 A;  1L2B A;  3SC3 A;  2O5R A;  2C96 A;  2F5Q A;  4LJ6 A;  1ORY B;  3HJ8 A;  4M0D A;  3HGI A;  2W82 A;  3SYK A;  3GQ3 A;  3FTC A;  2Z4R A;  3FD9 A;  5EXT A;  1XC8 A;  3VDP A;  4DR5 M;  3TL4 X;  5DYG A;  2UU9 M;  4DR3 M;  3FUT A;  2EA0 A;  1IN6 A;  5ITR A;  2ZAN A;  1DGF A;  1NVM A;  5EXS A;  3THG A;  3VLF B;  5KPT A;  4BB9 A;  3K92 A;  1G8P A;  4LZZ A;  3J80 S;  3AFH A;  2QBY B;  2DZO B;  4JXJ A;  1DGG A;  4NRV A;  4IBG A;  3CF2 A;  2R65 A;  3AOE C;  4MGK E;  1G4A E;  3UGJ A;  3T1Y M;  1TH2 A;  3VK8 A;  4LF8 M;  2C98 A;  1GKI A;  4MM3 B;  3RFW A;  2XZF A;  1FJG M;  3TWL A;  2Y20 A;  3PNY A;  2RKO A;  3DFZ A;  3PNV A;  4FWG A;  4B3S M;  2XZU A;  4AKH A;  4OVZ A;  3PXG A;  1MX0 A;  2F5O A;  2ERC A;  3AV0 A;  4MGH A;  1N32 M;  3EIE A;  4DUZ M;  1HQY E;  1QZM A;  4QNR A;  3KFU G;  3T38 A;  7CAT A;  3SAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...