3KOXE

Crystal structure of ornithine 4,5 aminomutase in complex with 2,4-diaminobutyrate (anaerobic)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
total genus 42
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3koxE02
3KP0E 3KP1E 3KOYE 3KOWE 3KOZE 3KOXE
chains in the Genus database with same CATH superfamily
1G8PA 3NWLA 3GLGE 1WXQA 2C96A 5EQTA 2O01F 2R45A 4L4UA 4DR6M 1T6OA 2RKOA 1KFVA 1G59A 3W0LB 2QNJA 3GLHE 2R18A 3AOEC 2DVWB 4GRIA 3KOWE 3U60A 1YUBA 1GABA 2EO2A 4K0KM 2UUBM 3MHVC 1A5TA 4R3DA 4B3TM 4RKUF 4LRSA 4RNAA 2LVOC 1R6BX 3GQ5A 3DOAA 1Q39A 3GLFB 1FJGM 1VQ1A 2KDLA 2OQ4A 1HNWM 3LQQA 3U6EA 1DGBA 2DZLA 1PM5A 1KSFX 4M9XA 3U6DA 2KA6B 2K47A 1NVMA 3E21A 2LXEA 4B3MM 3NBIA 2DAIA 4GHLA 2E5LM 4D82A 2Y0QA 3AKZA 4XK8F 1XWIA 1H6UA 3VK7A 3SARA 3A42A 3VKGA 2Z7JA 1VDLA 2Y0TA 5ITQA 1JR3E 2MH8A 2LH0A 1PJQA 3KP0E 3UZUA 1SXJD 3THGA 4UN2B 1HQCA 1OFHA 1D0MA 3HX3A 4LF8M 3OTOM 3SMPA 1IFYA 1N78A 3F92A 3IECA 4FWHA 3KDSE 1L2DA 4LZZA 2KNZA 3AL0C 5KO3A 4BB9A 2WSFF 2CEAA 1IN5A 4L6V6 5IREB 4DV2M 1YE9A 3TWKA 1DGHA 1G3IA 1DGFA 1QZEA 2KNVA 4CHTB 4AKHA 2WSEF 1MJGM 2ZTCA 3SMSA 1Z6TA 4M9ZA 4Z6YA 3IG5A 1NO1A 2C9OA 4A3VB 5JI2E 2OPFA 2XFSA 4JXJA 1I4WA 2DZNB 1K3WA 1QQWA 1TTEA 2L09A 5EP2A 4NC6A 1MN3A 4D80A 2JA2A 3HJQA 2JY6B 3LVVA 1FNNA 5FTKA 1L2BA 4B7GA 3M0EA 3FYCA 4I5SA 1WR1B 2CV0A 1QZMA 2DNAA 1ZMUA 3M6AA 1QAQA 3I01M 1N77A 2RGOA 2G5GX 4Q7JA 1NY5A 2VQEM 3C3EA 1R5LA 2JY5A 1E9SA 4GKJM 3FTDA 5ITRA 4JI3M 3U5ZA 3HZJA 3R9XB 3UGJA 2OOBA 3GQ4A 3SAUA 1GO5A 2VQFM 2CP8A 1IBMM 3LCUA 5DYGA 2DWNA 1Z5AA 3CF6E 2GNOA 3FRHA 2F5SA 1NHGC 3I04M 3GLGA 5EP4A 4BLCA 2L4EA 3FUWA 2XZUA 1XMQM 3LVWA 5KPRA 3TPZA 3ZQJA 1VG5A 3GLHA 2ZBKB 4QOZC 1QUSA 2L7IA 1OIZA 1PGYA 3BBZA 5C1BA 1TH3A 1DGHB 2F5QA 3FYDA 4P17A 4L8RC 4LF7M 1IY0A 1TF0B 2I7PA 3D8BA 5F3WA 3KS8A 3AV0A 1G41A 4B3SM 4MGHA 5FTLA 4LGMA 3L2AA 3HU2A 3HHXA 2YFQA 3U61B 3JAMS 3SAVA 5A2QS 4NRWA 1TH4A 1SXJE 4GC9A 2VF8A 4FCTA 2KZSA 2FH0A 3J80S 4G4OA 2HAKA 2KNAA 1WJ7A 5LMUM 2LWXA 4DUYM 2WZJA 2ZANA 2DENA 3KSJA 4KLNA 4X65M 2XGNA 3UK6A 1JR3A 4NSOB 2G3QA 1QAMA 2HWJA 1JQJC 3RFWA 2D7GA 1QAOA 3GLIE 2ZAMA 2L2DA 3C58A 3U5ZB 4I4LA 3VDPA 5LMNM 1JB0F 2A5YB 5DFLA 4GHAA 1VEGA 4WW0A 1WGNA 4IJFA 3PFIA 2Y21A 3GLGB 2UXCM 1GJSA 1NJGA 4F1IA 1GVNA 1Z5CA 4DV4M 5FTJA 1CUKA 1SG9A 3AOGA 4LFAM 3KXEC 1UFZA 2DAGA 1NSFA 4NRVA 2BJVA 4KHPM 3E9SA 2LVQD 1EE8A 2C98A 3FUTA 4QNMA 2JXNA 2NQ8C 2MR9A 1R2YA 3LMMA 4GC5A 2FNAA 2H5XA 1AUAA 3TWMA 2XEPA 1IN6A 4L16A 1N36M 4FW9A 3V76A 1XHBA 4MGYE 3RGPA 2JNHA 1C7YA 2LHCA 3IG8A 3QYEA 5IZ7D 4G4NA 1WGLA 1GL7A 2CE7A 2EKFA 1XNRM 1KYIA 2YR0A 5E26A 4F2LA 2MJ5B 2HKJA 1N75A 1LTMA 4NXNM 3SC3A 3UMMA 3GPYA 2G8LA 3H4MA 2HHHM 1NNUC 1NV9A 5C18A 7CATA 5EJCA 1D2NA 2ZTDA 2R65A 2KW0A 1N32M 1XXHE 1HNXM 3K9OA 4HL4A 3BXWA 1PRBA 4OW0A 4LG2A 2Z4RA 1IN7A 4G6ZA 4AG5A 2FFJA 2DAKA 1IY2A 3I4VA 3L27A 2C9CA 1HJPA 3RE8A 2UUAM 2CUZA 1IXSA 2AHMA 4JI2M 2XF3A 2OO9A 3W67A 2JZ0A 2W82A 4MH0E 5EP3A 2UXDM 3KSXA 3PNVA 3EIHA 4DR3M 1RU3A 1SXJA 4JI8M 2BNKA 2QPAA 3U6PA 1TH2A 3SYKA 2CHGA 4BBAA 2XZFA 3WHKA 2V1UA 4JYAM 1DO2A 1T3TA 3DFZA 4LGYA 4B3RM 3GQ3A 4P16A 5DYIA 3U6CA 2X8AA 3MJ5A 4X64M 4DV1M 2Z8YM 1R4GA 4IBGA 3TWLA 3R8FA 4IBKA 3GLIA 2FE8A 5ITTA 3FUVA 4RF0A 4IBIA 3HGIA 3FRIA 3B9PA 1Q3CA 4AZFA 4DR7M 4AI6A 3AFHA 1NNJA 1ZMWA 2J7OA 4YHHM 4HLQA 4JI0M 1TR8A 2DZOB 3A98B 5E6JA 1GLNA 4JI4M 2B3TA 1Y8GA 2DHRA 4IBFA 1G4AE 3VFDA 1J7KA 1F4IA 5L8RF 4DV3M 4LRTA 3SHGB 4FCWA 4FWGA 1IM2A 2LVPC 2MROB 4IBBA 4DV5M 4KT0F 3B7NA 1PJSA 2QCUA 2LHGA 3FUUA 4LJ5A 3AJIB 4R7GA 1PJTA 1HT1E 1IXSB 2R6FA 3K2LA 4IBEA 5JI3E 1AIPC 4DV7M 4LJ8A 3Q8XA 3EIEA 1DV0A 3SBJA 4LF4M 2R46A 2UU9M 2WSCF 3B7QA 2HCBA 4JN6A 2I7NA 3QWLA 3HHYA 4ITQA 3FKEA 3KOXE 3KS4A 2EKKA 3L28A 4REZA 4S12A 2DXIA 4L15A 1N34M 1K82A 5EXPA 3Q8GA 4QNRA 1ZQ9A 3MMPA 3JR4A 2DKLA 2KRUA 1Q3BA 1QUTA 3I51A 2EJSA 4DR4M 4DV6M 4CISA 4M0WA 2CFOA 3ZC7B 3RGSA 4AG6A 4II7A 4LJ6A 1NJFA 1XXHA 5IT9S 4IIWA 4JV5M 3GRVA 2BWBA 4FCVA 1UM8A 4QHSA 3QYBA 4PCZA 3H4JA 3VLFB 1L2CA 3A46A 1GKIA 5EXSA 1D0LA 3SAWA 2O5RA 2C5RA 4M0DA 3KP1E 4W5WA 5ITXE 1QANA 4JI7M 3C9PA 2CRUA 4Y28F 1L1TA 4NSRA 2VDBB 3DA1A 4PD2A 4DR1M 1V34A 3GRUA 1OIPA 3L25A 1S3SA 2JP7A 3W0FA 4DBGB 2DI0A 3KOZE 4WURA 1OQYA 3HKPA 3MK6A 2FOIC 3GLHB 4PT5A 2K0BX 3W68A 3GP1A 3GPXA 2DWMA 2QBYA 1IBLM 2X49A 4XGIA 4PDGA 3IHPA 1HQYE 2R44A 3HJ8A 4GH9A 4PDIA 3GPPA 3VK8A 2C99A 4MB7A 1V33A 3CF2A 4KODA 3CTWB 1PJJA 2LBCA 3HWSA 1E32A 2RGHA 2J7NA 3QAUA 4FVMA 3K1JA 4CIZA 1ZAEA 5KQDA 3HU1A 3E46A 1G71A 1E9RA 2EUCA 4OU7A 3VDUA 4LFCM 2KXEA 3ZCBB 5GKNA 4IBJA 4DUZM 1GL6A 5FTMA 3SYLA 2JZ1A 4I8OA 1YSYA 2CV2A 4IJEA 4CJ6A 1QDRA 1WIVA 3KOYE 4DR5M 3CF0A 1ORYB 4B7HA 1J09A 3KW6A 1R7RA 4WP2A 3TE6A 1Z59A 3CGWA 1I94M 1LV7A 3E4RA 2M60A 4B08A 3M7GA 3L26A 1ZMVA 3PVSA 1OAIA 3LQRA 1Q02A 5KQ8A 2Q2EB 2QBYB 4JI1M 1OKSA 1IN8A 1QDTA 2UUCM 4XBOA 1WHCA 1NY6A 2O25A 4GITA 1QYRA 1OFIA 2VIIA 4ANRA 2ZAOA 8CATA 1TDZA 4OX9M 2RRUA 3HJSA 1R2ZA 2DWZB 1MX0A 1NV8A 4LF9M 3C3DA 1XB2B 3L29A 2LVNC 2CWBA 2XFTA 2X4AA 2R4EA 3KVWA 3SHFA 1OTRA 4AQYM 4LF6M 4RF1A 5EP1A 1IXRC 1SXJC 2BJWA 1VEJA 2XSZD 2Y20A 4GIPA 4ZPXA 5ITXA 3U6QA 4LF5M 2QENA 1DGGA 1TDHA 5FLXS 3GLFE 1EIJA 1GJTA 1EFUB 4LY6A 2QHOB 2OOAA 4OVZA 2XSZA 2Z4SA 4QHTA 2QSFX 3LW5F 4FWDA 4LCBA 2CHVA 1W5SA 1T43A 1YLAA 2CHQA 1XC8A 5BPVA 2QP9X 4X62M 2FS1A 1J5EM 3D8LA 3SATA 5BR8M 4DV0M 3LCVB 3TL4X 2JY7A 5H37D 1X37A 2L6OA 3FTCA 3JR5A 3NBXX 1ZV1A 2KRKA 2JY8A 2LTUA 2K6BA 3U61A 3T1HM 4LZJA 3HHWA 4GKKM 4AKIA 2KZUA 3BOSA 4AKGA 3FUXA 1N33M 2HL7A 3B89A 1SXJB 4TUWA 2R4JA 2V1CA 4GMQA 3TQSA 1TGUA 3WHLA 1DO0A 5EXXA 5FSWA 5DNYA 4HEOA 3J7AS 2DHYA 5ITYA 3U6SA 1BVSA 4NXMM 2DAEA 2DAMA 4G4QA 3GLIB 1L1ZA 2D7EA 2M5ZA 1W5TA 3GPUA 3J27B 1P3QQ 3T15A 2VF7A 2P5TA 4X66M 3J81S 3GO8A 2EA0A 2ZM6M 3ILKA 3GRYA 3HY5A 2YQZA 4MGIE 1VEKA 3T38A 4OVZB 5IWAM 2MGWA 3B7ZA 3I4YA 1L8QA 1K3XA 3VKHA 2QZ4A 4G4RA 5EXTA 4MGKE 1C1KA 1OAOC 4FD2A 4I81A 1VDDA 1HR0M 2DWLA 2H1RA 2K9DA 4LJ9A 2F5NA 2LNHC 2YNMD 4CGYB 2QQ8A 5KPZA 1HNZM 2F5OA 3SASA 3T1YM 3FTEA 2XH9A 3DZDA 4IBDA 1MU5A 1D0KA 4GEWA 2R0IA 4LJ7A 2GQFA 2KHHA 4M9SA 1XMOM 4LFBM 3K92A 4LJ4A 2APLA 3PNYA 2L7HA 3T6PA 2UXBM 4MM3B 2LVAA 4NL4H 4EIWA 3UJNA 1JR3D 4D81A 2ERCA 2L4FA 1V92A 1Z5BA 1QVRA 4JI5M 2R62A 2Z3XA 3HU3A 4L78A 1IY1A 3J7BA 4JI6M 2F4VM 3U6MA 4QOSA 3J2PB 3ZH9B 2JWSA 3GLFA 3GRRA 3U6LA 2F5PA 4KO8A 2N35A 2XLJA 1OJLA 3K8ZA 3FD9A 4DR2M 1NHWC 3HHZA 1IQPA 2D7HA 4NOOB 3PXGA 3U60B 3A45A 4LJAA 1XXHB 2JUJA 1HT2E 3K9PA 3KFUG 2BWEA 4IBCA 2KEBA 5FTNA 2V6ZM 1IXZA 3U6OA 2J5YA 4R71A 4B7FA 4MGZE 3SFZA 1IBKM 3FE3A 4AW4A 1E94E 4Z8XA 5ITUA 1XNQM 2CV1A 3FTFA 3B74A 3AOEA 4G3OA 1PJIA 4YY3M 1IN4A 5KPTA
chains in the Genus database with same CATH topology
1G8PA 3NWLA 1WXQA 2C96A 5EQTA 2R45A 4L4UA 4DR6M 2RKOA 1KFVA 1G59A 3W0LB 2R18A 3AOEC 2DVWB 4GRIA 3KOWE 1YUBA 2EO2A 2UUBM 3MHVC 4R3DA 4B3TM 4LRSA 4RNAA 1R6BX 3GQ5A 3DOAA 1Q39A 3GLFB 1FJGM 1HNWM 2OQ4A 3LQQA 3U6EA 1DGBA 1PM5A 1KSFX 4M9XA 3U6DA 2KA6B 2K47A 1NVMA 4B3MM 2LXEA 3NBIA 2E5LM 4D82A 2Y0QA 3AKZA 1XWIA 1H6UA 3VK7A 3SARA 3A42A 3VKGA 2Z7JA 2Y0TA 5ITQA 3UZUA 2LH0A 3KP0E 1SXJD 3THGA 1HQCA 1OFHA 4LF8M 3OTOM 3SMPA 1N78A 4FWHA 3KDSE 1L2DA 4LZZA 3AL0C 5KO3A 4BB9A 2CEAA 1IN5A 5IREB 4DV2M 4AKHA 1YE9A 3TWKA 1DGHA 1G3IA 1DGFA 4CHTB 3SMSA 1Z6TA 4M9ZA 4Z6YA 3IG5A 4A3VB 2C9OA 2OPFA 5JI2E 2XFSA 4JXJA 1I4WA 2DZNB 1K3WA 1QQWA 2L09A 5EP2A 4D80A 2JA2A 3HJQA 3LVVA 1FNNA 5FTKA 1L2BA 4B7GA 3M0EA 3FYCA 4I5SA 2CV0A 1QZMA 3M6AA 1QAQA 1N77A 2RGOA 2G5GX 2VQEM 1NY5A 1E9SA 4GKJM 3FTDA 5ITRA 4JI3M 3U5ZA 3R9XB 3UGJA 3GQ4A 3SAUA 2VQFM 2DWNA 1IBMM 5DYGA 1Z5AA 3CF6E 2F5SA 1NHGC 3GLGA 2XZUA 5EP4A 4BLCA 3FUWA 1XMQM 3LVWA 5KPRA 3TPZA 3GLHA 2ZBKB 4QOZC 2L7IA 5C1BA 1TH3A 1DGHB 2F5QA 3FYDA 4L8RC 4LF7M 4GHLA 1IY0A 2I7PA 3D8BA 5F3WA 3KS8A 3AV0A 1G41A 4B3SM 4MGHA 5FTLA 4LGMA 3L2AA 3HU2A 3HHXA 2YFQA 3U61B 3JAMS 3SAVA 5A2QS 4NRWA 1TH4A 1SXJE 4GC9A 4FCTA 2KZSA 3J80S 4G4OA 5LMUM 2LWXA 4DUYM 3KSJA 2ZANA 4KLNA 4X65M 2XGNA 3UK6A 1JR3A 4NSOB 1QAMA 1JQJC 3RFWA 2D7GA 1QAOA 2ZAMA 3C58A 3U5ZB 4I4LA 3VDPA 5LMNM 2A5YB 4GHAA 4WW0A 4IJFA 3PFIA 2Y21A 3GLGB 2UXCM 1NJGA 1GVNA 1Z5CA 4DV4M 5FTJA 3AOGA 4LFAM 3KXEC 1NSFA 4NRVA 2BJVA 4KHPM 3E9SA 1EE8A 2C98A 3FUTA 4QNMA 2NQ8C 1R2YA 3LMMA 4GC5A 2FNAA 3TWMA 2XEPA 1IN6A 4L16A 1N36M 4FW9A 1XHBA 4MGYE 3RGPA 3IG8A 5IZ7D 4G4NA 1GL7A 2CE7A 1XNRM 1KYIA 2YR0A 5E26A 2HKJA 1N75A 3SC3A 4NXNM 3UMMA 3GPYA 2G8LA 3H4MA 2HHHM 1NNUC 5C18A 7CATA 5EJCA 1D2NA 2R65A 2KW0A 1N32M 1HNXM 4HL4A 4OW0A 4LG2A 2Z4RA 1IN7A 4G6ZA 4AG5A 2FFJA 1IY2A 3I4VA 3L27A 2C9CA 3RE8A 2UUAM 2CUZA 2AHMA 4JI2M 2XF3A 2W82A 4MH0E 5EP3A 2UXDM 3KSXA 3PNVA 3EIHA 4DR3M 1SXJA 4JI8M 2BNKA 2QPAA 3U6PA 1TH2A 3SYKA 2CHGA 4BBAA 2XZFA 3WHKA 2V1UA 4JYAM 1DO2A 1T3TA 3DFZA 4LGYA 4B3RM 3GQ3A 4P16A 5DYIA 3U6CA 2X8AA 3MJ5A 4X64M 4DV1M 4IBGA 3TWLA 3R8FA 4IBKA 3GLIA 2FE8A 5ITTA 3FUVA 4RF0A 4IBIA 3HGIA 3B9PA 1Q3CA 4AZFA 4DR7M 4AI6A 3AFHA 1NNJA 2J7OA 4YHHM 4HLQA 4JI0M 2DZOB 3A98B 5E6JA 1GLNA 4JI4M 2DHRA 4IBFA 1G4AE 3VFDA 1J7KA 4DV3M 4LRTA 3SHGB 4FCWA 4FWGA 1IM2A 4IBBA 4DV5M 2QCUA 3FUUA 4LJ5A 3AJIB 4R7GA 1HT1E 1IXSB 3K2LA 4IBEA 5JI3E 4DV7M 4LJ8A 3Q8XA 3EIEA 3SBJA 4LF4M 2R46A 2UU9M 3HHYA 2HCBA 4JN6A 2I7NA 3QWLA 4ITQA 3FKEA 3KOXE 3KS4A 3L28A 4REZA 4S12A 2DXIA 4L15A 1N34M 1K82A 5EXPA 4QNRA 1ZQ9A 3JR4A 2KRUA 1Q3BA 3I51A 4DR4M 4DV6M 4CISA 4M0WA 2CFOA 3ZC7B 3RGSA 4AG6A 4II7A 4LJ6A 1NJFA 1XXHA 5IT9S 4IIWA 4JV5M 3GRVA 4FCVA 1UM8A 4QHSA 4PCZA 3VLFB 1L2CA 3A46A 1GKIA 5EXSA 3SAWA 2O5RA 2C5RA 4M0DA 3KP1E 4W5WA 5ITXE 1QANA 4JI7M 1L1TA 4NSRA 3DA1A 4PD2A 4DR1M 3GRUA 3L25A 1S3SA 3W0FA 3KOZE 4WURA 3HKPA 3MK6A 2FOIC 3GLHB 4PT5A 3GPXA 3GP1A 2DWMA 2QBYA 1IBLM 2X49A 4XGIA 4PDGA 1HQYE 4GH9A 3HJ8A 4PDIA 3VK8A 3GPPA 2C99A 4MB7A 3CF2A 4KODA 3CTWB 1PJJA 3HWSA 1E32A 2RGHA 2J7NA 3QAUA 4FVMA 3K1JA 1ZAEA 5KQDA 3HU1A 2EUCA 1E9RA 4OU7A 3VDUA 4LFCM 2KXEA 3ZCBB 5GKNA 4IBJA 4DUZM 1GL6A 5FTMA 3SYLA 4I8OA 1YSYA 2CV2A 4IJEA 3KOYE 4DR5M 3CF0A 1ORYB 4B7HA 1J09A 3KW6A 1R7RA 3TE6A 1Z59A 1I94M 1LV7A 3E4RA 2M60A 4B08A 3M7GA 3L26A 3PVSA 3LQRA 5KQ8A 2Q2EB 2QBYB 4JI1M 1IN8A 2UUCM 4XBOA 1NY6A 1TDZA 4GITA 1QYRA 1OFIA 2VIIA 2ZAOA 8CATA 4OX9M 3HJSA 1R2ZA 2DWZB 1MX0A 4LF9M 3L29A 2XFTA 2X4AA 2R4EA 3KVWA 3SHFA 4AQYM 4LF6M 4RF1A 5EP1A 1IXRC 1SXJC 2BJWA 2XSZD 2Y20A 4GIPA 4ZPXA 5ITXA 3U6QA 4LF5M 2QENA 1DGGA 1TDHA 5FLXS 4LY6A 4OVZA 2XSZA 2Z4SA 4QHTA 4FWDA 4LCBA 2CHVA 1W5SA 2CHQA 1XC8A 5BPVA 2QP9X 4X62M 1J5EM 3D8LA 3SATA 5BR8M 4DV0M 3TL4X 5H37D 1X37A 2L6OA 3FTCA 3JR5A 2KRKA 3U61A 3T1HM 4LZJA 3HHWA 4GKKM 2KZUA 3BOSA 4AKGA 3FUXA 1N33M 2HL7A 1SXJB 4TUWA 2R4JA 2V1CA 4GMQA 3TQSA 1TGUA 3WHLA 1DO0A 5EXXA 5FSWA 5DNYA 3J7AS 5ITYA 3U6SA 4NXMM 4G4QA 3GLIB 1L1ZA 2D7EA 2M5ZA 1W5TA 3GPUA 3J27B 3T15A 3J81S 2P5TA 4X66M 3GO8A 2EA0A 3U60A 2ZM6M 3ILKA 3GRYA 4MGIE 2YQZA 4K0KM 5IWAM 3T38A 4OVZB 3I4YA 1L8QA 1K3XA 3VKHA 2QZ4A 4G4RA 5EXTA 4MGKE 1C1KA 4FD2A 4I81A 1VDDA 1HR0M 2DWLA 2H1RA 4LJ9A 2F5NA 2LNHC 2YNMD 4CGYB 5KPZA 1HNZM 2F5OA 3SASA 3T1YM 3FTEA 2XH9A 3DZDA 4IBDA 1MU5A 4LJ7A 4M9SA 1XMOM 4LFBM 3K92A 4LJ4A 3PNYA 2UXBM 2L7HA 4AKIA 4MM3B 4NL4H 4EIWA 3UJNA 1JR3D 4D81A 2ERCA 1Z5BA 1QVRA 4JI5M 2R62A 2Z3XA 3HU3A 4L78A 1IY1A 3J7BA 4JI6M 2F4VM 3U6MA 4QOSA 3J2PB 3ZH9B 3GLFA 3U6LA 3GRRA 2F5PA 4KO8A 2XLJA 1OJLA 3K8ZA 3FD9A 4DR2M 1NHWC 3HHZA 1IQPA 2D7HA 4NOOB 3PXGA 3U60B 3A45A 4LJAA 1XXHB 1HT2E 3KFUG 4IBCA 2KEBA 5FTNA 2V6ZM 1IXZA 3U6OA 4B7FA 4MGZE 3SFZA 1IBKM 4AW4A 1E94E 4Z8XA 5ITUA 1XNQM 2CV1A 3FTFA 3AOEA 1PJIA 4YY3M 1IN4A 5KPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP0 E;  3KP1 E;  3KOY E;  3KOW E;  3KOZ E;  3KOX E; 
#chains in the Genus database with same CATH topology
 1G8P A;  3NWL A;  3GLG E;  1WXQ A;  2C96 A;  5EQT A;  2O01 F;  2R45 A;  4L4U A;  4DR6 M;  1T6O A;  2RKO A;  1KFV A;  1G59 A;  3W0L B;  2QNJ A;  3GLH E;  2R18 A;  3AOE C;  2DVW B;  4GRI A;  3KOW E;  3U60 A;  1YUB A;  1GAB A;  2EO2 A;  4K0K M;  2UUB M;  3MHV C;  1A5T A;  4R3D A;  4B3T M;  4RKU F;  4LRS A;  4RNA A;  2LVO C;  1R6B X;  3GQ5 A;  3DOA A;  1Q39 A;  3GLF B;  1FJG M;  1VQ1 A;  2KDL A;  2OQ4 A;  1HNW M;  3LQQ A;  3U6E A;  1DGB A;  2DZL A;  1PM5 A;  1KSF X;  4M9X A;  3U6D A;  2KA6 B;  2K47 A;  1NVM A;  3E21 A;  2LXE A;  4B3M M;  3NBI A;  2DAI A;  4GHL A;  2E5L M;  4D82 A;  2Y0Q A;  3AKZ A;  4XK8 F;  1XWI A;  1H6U A;  3VK7 A;  3SAR A;  3A42 A;  3VKG A;  2Z7J A;  1VDL A;  2Y0T A;  5ITQ A;  1JR3 E;  2MH8 A;  2LH0 A;  1PJQ A;  3KP0 E;  3UZU A;  1SXJ D;  3THG A;  4UN2 B;  1HQC A;  1OFH A;  1D0M A;  3HX3 A;  4LF8 M;  3OTO M;  3SMP A;  1IFY A;  1N78 A;  3F92 A;  3IEC A;  4FWH A;  3KDS E;  1L2D A;  4LZZ A;  2KNZ A;  3AL0 C;  5KO3 A;  4BB9 A;  2WSF F;  2CEA A;  1IN5 A;  4L6V 6;  5IRE B;  4DV2 M;  1YE9 A;  3TWK A;  1DGH A;  1G3I A;  1DGF A;  1QZE A;  2KNV A;  4CHT B;  4AKH A;  2WSE F;  1MJG M;  2ZTC A;  3SMS A;  1Z6T A;  4M9Z A;  4Z6Y A;  3IG5 A;  1NO1 A;  2C9O A;  4A3V B;  5JI2 E;  2OPF A;  2XFS A;  4JXJ A;  1I4W A;  2DZN B;  1K3W A;  1QQW A;  1TTE A;  2L09 A;  5EP2 A;  4NC6 A;  1MN3 A;  4D80 A;  2JA2 A;  3HJQ A;  2JY6 B;  3LVV A;  1FNN A;  5FTK A;  1L2B A;  4B7G A;  3M0E A;  3FYC A;  4I5S A;  1WR1 B;  2CV0 A;  1QZM A;  2DNA A;  1ZMU A;  3M6A A;  1QAQ A;  3I01 M;  1N77 A;  2RGO A;  2G5G X;  4Q7J A;  1NY5 A;  2VQE M;  3C3E A;  1R5L A;  2JY5 A;  1E9S A;  4GKJ M;  3FTD A;  5ITR A;  4JI3 M;  3U5Z A;  3HZJ A;  3R9X B;  3UGJ A;  2OOB A;  3GQ4 A;  3SAU A;  1GO5 A;  2VQF M;  2CP8 A;  1IBM M;  3LCU A;  5DYG A;  2DWN A;  1Z5A A;  3CF6 E;  2GNO A;  3FRH A;  2F5S A;  1NHG C;  3I04 M;  3GLG A;  5EP4 A;  4BLC A;  2L4E A;  3FUW A;  2XZU A;  1XMQ M;  3LVW A;  5KPR A;  3TPZ A;  3ZQJ A;  1VG5 A;  3GLH A;  2ZBK B;  4QOZ C;  1QUS A;  2L7I A;  1OIZ A;  1PGY A;  3BBZ A;  5C1B A;  1TH3 A;  1DGH B;  2F5Q A;  3FYD A;  4P17 A;  4L8R C;  4LF7 M;  1IY0 A;  1TF0 B;  2I7P A;  3D8B A;  5F3W A;  3KS8 A;  3AV0 A;  1G41 A;  4B3S M;  4MGH A;  5FTL A;  4LGM A;  3L2A A;  3HU2 A;  3HHX A;  2YFQ A;  3U61 B;  3JAM S;  3SAV A;  5A2Q S;  4NRW A;  1TH4 A;  1SXJ E;  4GC9 A;  2VF8 A;  4FCT A;  2KZS A;  2FH0 A;  3J80 S;  4G4O A;  2HAK A;  2KNA A;  1WJ7 A;  5LMU M;  2LWX A;  4DUY M;  2WZJ A;  2ZAN A;  2DEN A;  3KSJ A;  4KLN A;  4X65 M;  2XGN A;  3UK6 A;  1JR3 A;  4NSO B;  2G3Q A;  1QAM A;  2HWJ A;  1JQJ C;  3RFW A;  2D7G A;  1QAO A;  3GLI E;  2ZAM A;  2L2D A;  3C58 A;  3U5Z B;  4I4L A;  3VDP A;  5LMN M;  1JB0 F;  2A5Y B;  5DFL A;  4GHA A;  1VEG A;  4WW0 A;  1WGN A;  4IJF A;  3PFI A;  2Y21 A;  3GLG B;  2UXC M;  1GJS A;  1NJG A;  4F1I A;  1GVN A;  1Z5C A;  4DV4 M;  5FTJ A;  1CUK A;  1SG9 A;  3AOG A;  4LFA M;  3KXE C;  1UFZ A;  2DAG A;  1NSF A;  4NRV A;  2BJV A;  4KHP M;  3E9S A;  2LVQ D;  1EE8 A;  2C98 A;  3FUT A;  4QNM A;  2JXN A;  2NQ8 C;  2MR9 A;  1R2Y A;  3LMM A;  4GC5 A;  2FNA A;  2H5X A;  1AUA A;  3TWM A;  2XEP A;  1IN6 A;  4L16 A;  1N36 M;  4FW9 A;  3V76 A;  1XHB A;  4MGY E;  3RGP A;  2JNH A;  1C7Y A;  2LHC A;  3IG8 A;  3QYE A;  5IZ7 D;  4G4N A;  1WGL A;  1GL7 A;  2CE7 A;  2EKF A;  1XNR M;  1KYI A;  2YR0 A;  5E26 A;  4F2L A;  2MJ5 B;  2HKJ A;  1N75 A;  1LTM A;  4NXN M;  3SC3 A;  3UMM A;  3GPY A;  2G8L A;  3H4M A;  2HHH M;  1NNU C;  1NV9 A;  5C18 A;  7CAT A;  5EJC A;  1D2N A;  2ZTD A;  2R65 A;  2KW0 A;  1N32 M;  1XXH E;  1HNX M;  3K9O A;  4HL4 A;  3BXW A;  1PRB A;  4OW0 A;  4LG2 A;  2Z4R A;  1IN7 A;  4G6Z A;  4AG5 A;  2FFJ A;  2DAK A;  1IY2 A;  3I4V A;  3L27 A;  2C9C A;  1HJP A;  3RE8 A;  2UUA M;  2CUZ A;  1IXS A;  2AHM A;  4JI2 M;  2XF3 A;  2OO9 A;  3W67 A;  2JZ0 A;  2W82 A;  4MH0 E;  5EP3 A;  2UXD M;  3KSX A;  3PNV A;  3EIH A;  4DR3 M;  1RU3 A;  1SXJ A;  4JI8 M;  2BNK A;  2QPA A;  3U6P A;  1TH2 A;  3SYK A;  2CHG A;  4BBA A;  2XZF A;  3WHK A;  2V1U A;  4JYA M;  1DO2 A;  1T3T A;  3DFZ A;  4LGY A;  4B3R M;  3GQ3 A;  4P16 A;  5DYI A;  3U6C A;  2X8A A;  3MJ5 A;  4X64 M;  4DV1 M;  2Z8Y M;  1R4G A;  4IBG A;  3TWL A;  3R8F A;  4IBK A;  3GLI A;  2FE8 A;  5ITT A;  3FUV A;  4RF0 A;  4IBI A;  3HGI A;  3FRI A;  3B9P A;  1Q3C A;  4AZF A;  4DR7 M;  4AI6 A;  3AFH A;  1NNJ A;  1ZMW A;  2J7O A;  4YHH M;  4HLQ A;  4JI0 M;  1TR8 A;  2DZO B;  3A98 B;  5E6J A;  1GLN A;  4JI4 M;  2B3T A;  1Y8G A;  2DHR A;  4IBF A;  1G4A E;  3VFD A;  1J7K A;  1F4I A;  5L8R F;  4DV3 M;  4LRT A;  3SHG B;  4FCW A;  4FWG A;  1IM2 A;  2LVP C;  2MRO B;  4IBB A;  4DV5 M;  4KT0 F;  3B7N A;  1PJS A;  2QCU A;  2LHG A;  3FUU A;  4LJ5 A;  3AJI B;  4R7G A;  1PJT A;  1HT1 E;  1IXS B;  2R6F A;  3K2L A;  4IBE A;  5JI3 E;  1AIP C;  4DV7 M;  4LJ8 A;  3Q8X A;  3EIE A;  1DV0 A;  3SBJ A;  4LF4 M;  2R46 A;  2UU9 M;  2WSC F;  3B7Q A;  2HCB A;  4JN6 A;  2I7N A;  3QWL A;  3HHY A;  4ITQ A;  3FKE A;  3KOX E;  3KS4 A;  2EKK A;  3L28 A;  4REZ A;  4S12 A;  2DXI A;  4L15 A;  1N34 M;  1K82 A;  5EXP A;  3Q8G A;  4QNR A;  1ZQ9 A;  3MMP A;  3JR4 A;  2DKL A;  2KRU A;  1Q3B A;  1QUT A;  3I51 A;  2EJS A;  4DR4 M;  4DV6 M;  4CIS A;  4M0W A;  2CFO A;  3ZC7 B;  3RGS A;  4AG6 A;  4II7 A;  4LJ6 A;  1NJF A;  1XXH A;  5IT9 S;  4IIW A;  4JV5 M;  3GRV A;  2BWB A;  4FCV A;  1UM8 A;  4QHS A;  3QYB A;  4PCZ A;  3H4J A;  3VLF B;  1L2C A;  3A46 A;  1GKI A;  5EXS A;  1D0L A;  3SAW A;  2O5R A;  2C5R A;  4M0D A;  3KP1 E;  4W5W A;  5ITX E;  1QAN A;  4JI7 M;  3C9P A;  2CRU A;  4Y28 F;  1L1T A;  4NSR A;  2VDB B;  3DA1 A;  4PD2 A;  4DR1 M;  1V34 A;  3GRU A;  1OIP A;  3L25 A;  1S3S A;  2JP7 A;  3W0F A;  4DBG B;  2DI0 A;  3KOZ E;  4WUR A;  1OQY A;  3HKP A;  3MK6 A;  2FOI C;  3GLH B;  4PT5 A;  2K0B X;  3W68 A;  3GP1 A;  3GPX A;  2DWM A;  2QBY A;  1IBL M;  2X49 A;  4XGI A;  4PDG A;  3IHP A;  1HQY E;  2R44 A;  3HJ8 A;  4GH9 A;  4PDI A;  3GPP A;  3VK8 A;  2C99 A;  4MB7 A;  1V33 A;  3CF2 A;  4KOD A;  3CTW B;  1PJJ A;  2LBC A;  3HWS A;  1E32 A;  2RGH A;  2J7N A;  3QAU A;  4FVM A;  3K1J A;  4CIZ A;  1ZAE A;  5KQD A;  3HU1 A;  3E46 A;  1G71 A;  1E9R A;  2EUC A;  4OU7 A;  3VDU A;  4LFC M;  2KXE A;  3ZCB B;  5GKN A;  4IBJ A;  4DUZ M;  1GL6 A;  5FTM A;  3SYL A;  2JZ1 A;  4I8O A;  1YSY A;  2CV2 A;  4IJE A;  4CJ6 A;  1QDR A;  1WIV A;  3KOY E;  4DR5 M;  3CF0 A;  1ORY B;  4B7H A;  1J09 A;  3KW6 A;  1R7R A;  4WP2 A;  3TE6 A;  1Z59 A;  3CGW A;  1I94 M;  1LV7 A;  3E4R A;  2M60 A;  4B08 A;  3M7G A;  3L26 A;  1ZMV A;  3PVS A;  1OAI A;  3LQR A;  1Q02 A;  5KQ8 A;  2Q2E B;  2QBY B;  4JI1 M;  1OKS A;  1IN8 A;  1QDT A;  2UUC M;  4XBO A;  1WHC A;  1NY6 A;  2O25 A;  4GIT A;  1QYR A;  1OFI A;  2VII A;  4ANR A;  2ZAO A;  8CAT A;  1TDZ A;  4OX9 M;  2RRU A;  3HJS A;  1R2Z A;  2DWZ B;  1MX0 A;  1NV8 A;  4LF9 M;  3C3D A;  1XB2 B;  3L29 A;  2LVN C;  2CWB A;  2XFT A;  2X4A A;  2R4E A;  3KVW A;  3SHF A;  1OTR A;  4AQY M;  4LF6 M;  4RF1 A;  5EP1 A;  1IXR C;  1SXJ C;  2BJW A;  1VEJ A;  2XSZ D;  2Y20 A;  4GIP A;  4ZPX A;  5ITX A;  3U6Q A;  4LF5 M;  2QEN A;  1DGG A;  1TDH A;  5FLX S;  3GLF E;  1EIJ A;  1GJT A;  1EFU B;  4LY6 A;  2QHO B;  2OOA A;  4OVZ A;  2XSZ A;  2Z4S A;  4QHT A;  2QSF X;  3LW5 F;  4FWD A;  4LCB A;  2CHV A;  1W5S A;  1T43 A;  1YLA A;  2CHQ A;  1XC8 A;  5BPV A;  2QP9 X;  4X62 M;  2FS1 A;  1J5E M;  3D8L A;  3SAT A;  5BR8 M;  4DV0 M;  3LCV B;  3TL4 X;  2JY7 A;  5H37 D;  1X37 A;  2L6O A;  3FTC A;  3JR5 A;  3NBX X;  1ZV1 A;  2KRK A;  2JY8 A;  2LTU A;  2K6B A;  3U61 A;  3T1H M;  4LZJ A;  3HHW A;  4GKK M;  4AKI A;  2KZU A;  3BOS A;  4AKG A;  3FUX A;  1N33 M;  2HL7 A;  3B89 A;  1SXJ B;  4TUW A;  2R4J A;  2V1C A;  4GMQ A;  3TQS A;  1TGU A;  3WHL A;  1DO0 A;  5EXX A;  5FSW A;  5DNY A;  4HEO A;  3J7A S;  2DHY A;  5ITY A;  3U6S A;  1BVS A;  4NXM M;  2DAE A;  2DAM A;  4G4Q A;  3GLI B;  1L1Z A;  2D7E A;  2M5Z A;  1W5T A;  3GPU A;  3J27 B;  1P3Q Q;  3T15 A;  2VF7 A;  2P5T A;  4X66 M;  3J81 S;  3GO8 A;  2EA0 A;  2ZM6 M;  3ILK A;  3GRY A;  3HY5 A;  2YQZ A;  4MGI E;  1VEK A;  3T38 A;  4OVZ B;  5IWA M;  2MGW A;  3B7Z A;  3I4Y A;  1L8Q A;  1K3X A;  3VKH A;  2QZ4 A;  4G4R A;  5EXT A;  4MGK E;  1C1K A;  1OAO C;  4FD2 A;  4I81 A;  1VDD A;  1HR0 M;  2DWL A;  2H1R A;  2K9D A;  4LJ9 A;  2F5N A;  2LNH C;  2YNM D;  4CGY B;  2QQ8 A;  5KPZ A;  1HNZ M;  2F5O A;  3SAS A;  3T1Y M;  3FTE A;  2XH9 A;  3DZD A;  4IBD A;  1MU5 A;  1D0K A;  4GEW A;  2R0I A;  4LJ7 A;  2GQF A;  2KHH A;  4M9S A;  1XMO M;  4LFB M;  3K92 A;  4LJ4 A;  2APL A;  3PNY A;  2L7H A;  3T6P A;  2UXB M;  4MM3 B;  2LVA A;  4NL4 H;  4EIW A;  3UJN A;  1JR3 D;  4D81 A;  2ERC A;  2L4F A;  1V92 A;  1Z5B A;  1QVR A;  4JI5 M;  2R62 A;  2Z3X A;  3HU3 A;  4L78 A;  1IY1 A;  3J7B A;  4JI6 M;  2F4V M;  3U6M A;  4QOS A;  3J2P B;  3ZH9 B;  2JWS A;  3GLF A;  3GRR A;  3U6L A;  2F5P A;  4KO8 A;  2N35 A;  2XLJ A;  1OJL A;  3K8Z A;  3FD9 A;  4DR2 M;  1NHW C;  3HHZ A;  1IQP A;  2D7H A;  4NOO B;  3PXG A;  3U60 B;  3A45 A;  4LJA A;  1XXH B;  2JUJ A;  1HT2 E;  3K9P A;  3KFU G;  2BWE A;  4IBC A;  2KEB A;  5FTN A;  2V6Z M;  1IXZ A;  3U6O A;  2J5Y A;  4R71 A;  4B7F A;  4MGZ E;  3SFZ A;  1IBK M;  3FE3 A;  4AW4 A;  1E94 E;  4Z8X A;  5ITU A;  1XNQ M;  2CV1 A;  3FTF A;  3B74 A;  3AOE A;  4G3O A;  1PJI A;  4YY3 M;  1IN4 A;  5KPT A; 
#chains in the Genus database with same CATH homology
 1G8P A;  3NWL A;  1WXQ A;  2C96 A;  5EQT A;  2R45 A;  4L4U A;  4DR6 M;  2RKO A;  1KFV A;  1G59 A;  3W0L B;  2R18 A;  3AOE C;  2DVW B;  4GRI A;  3KOW E;  1YUB A;  2EO2 A;  2UUB M;  3MHV C;  4R3D A;  4B3T M;  4LRS A;  4RNA A;  1R6B X;  3GQ5 A;  3DOA A;  1Q39 A;  3GLF B;  1FJG M;  1HNW M;  2OQ4 A;  3LQQ A;  3U6E A;  1DGB A;  1PM5 A;  1KSF X;  4M9X A;  3U6D A;  2KA6 B;  2K47 A;  1NVM A;  4B3M M;  2LXE A;  3NBI A;  2E5L M;  4D82 A;  2Y0Q A;  3AKZ A;  1XWI A;  1H6U A;  3VK7 A;  3SAR A;  3A42 A;  3VKG A;  2Z7J A;  2Y0T A;  5ITQ A;  3UZU A;  2LH0 A;  3KP0 E;  1SXJ D;  3THG A;  1HQC A;  1OFH A;  4LF8 M;  3OTO M;  3SMP A;  1N78 A;  4FWH A;  3KDS E;  1L2D A;  4LZZ A;  3AL0 C;  5KO3 A;  4BB9 A;  2CEA A;  1IN5 A;  5IRE B;  4DV2 M;  4AKH A;  1YE9 A;  3TWK A;  1DGH A;  1G3I A;  1DGF A;  4CHT B;  3SMS A;  1Z6T A;  4M9Z A;  4Z6Y A;  3IG5 A;  4A3V B;  2C9O A;  2OPF A;  5JI2 E;  2XFS A;  4JXJ A;  1I4W A;  2DZN B;  1K3W A;  1QQW A;  2L09 A;  5EP2 A;  4D80 A;  2JA2 A;  3HJQ A;  3LVV A;  1FNN A;  5FTK A;  1L2B A;  4B7G A;  3M0E A;  3FYC A;  4I5S A;  2CV0 A;  1QZM A;  3M6A A;  1QAQ A;  1N77 A;  2RGO A;  2G5G X;  2VQE M;  1NY5 A;  1E9S A;  4GKJ M;  3FTD A;  5ITR A;  4JI3 M;  3U5Z A;  3R9X B;  3UGJ A;  3GQ4 A;  3SAU A;  2VQF M;  2DWN A;  1IBM M;  5DYG A;  1Z5A A;  3CF6 E;  2F5S A;  1NHG C;  3GLG A;  2XZU A;  5EP4 A;  4BLC A;  3FUW A;  1XMQ M;  3LVW A;  5KPR A;  3TPZ A;  3GLH A;  2ZBK B;  4QOZ C;  2L7I A;  5C1B A;  1TH3 A;  1DGH B;  2F5Q A;  3FYD A;  4L8R C;  4LF7 M;  4GHL A;  1IY0 A;  2I7P A;  3D8B A;  5F3W A;  3KS8 A;  3AV0 A;  1G41 A;  4B3S M;  4MGH A;  5FTL A;  4LGM A;  3L2A A;  3HU2 A;  3HHX A;  2YFQ A;  3U61 B;  3JAM S;  3SAV A;  5A2Q S;  4NRW A;  1TH4 A;  1SXJ E;  4GC9 A;  4FCT A;  2KZS A;  3J80 S;  4G4O A;  5LMU M;  2LWX A;  4DUY M;  3KSJ A;  2ZAN A;  4KLN A;  4X65 M;  2XGN A;  3UK6 A;  1JR3 A;  4NSO B;  1QAM A;  1JQJ C;  3RFW A;  2D7G A;  1QAO A;  2ZAM A;  3C58 A;  3U5Z B;  4I4L A;  3VDP A;  5LMN M;  2A5Y B;  4GHA A;  4WW0 A;  4IJF A;  3PFI A;  2Y21 A;  3GLG B;  2UXC M;  1NJG A;  1GVN A;  1Z5C A;  4DV4 M;  5FTJ A;  3AOG A;  4LFA M;  3KXE C;  1NSF A;  4NRV A;  2BJV A;  4KHP M;  3E9S A;  1EE8 A;  2C98 A;  3FUT A;  4QNM A;  2NQ8 C;  1R2Y A;  3LMM A;  4GC5 A;  2FNA A;  3TWM A;  2XEP A;  1IN6 A;  4L16 A;  1N36 M;  4FW9 A;  1XHB A;  4MGY E;  3RGP A;  3IG8 A;  5IZ7 D;  4G4N A;  1GL7 A;  2CE7 A;  1XNR M;  1KYI A;  2YR0 A;  5E26 A;  2HKJ A;  1N75 A;  3SC3 A;  4NXN M;  3UMM A;  3GPY A;  2G8L A;  3H4M A;  2HHH M;  1NNU C;  5C18 A;  7CAT A;  5EJC A;  1D2N A;  2R65 A;  2KW0 A;  1N32 M;  1HNX M;  4HL4 A;  4OW0 A;  4LG2 A;  2Z4R A;  1IN7 A;  4G6Z A;  4AG5 A;  2FFJ A;  1IY2 A;  3I4V A;  3L27 A;  2C9C A;  3RE8 A;  2UUA M;  2CUZ A;  2AHM A;  4JI2 M;  2XF3 A;  2W82 A;  4MH0 E;  5EP3 A;  2UXD M;  3KSX A;  3PNV A;  3EIH A;  4DR3 M;  1SXJ A;  4JI8 M;  2BNK A;  2QPA A;  3U6P A;  1TH2 A;  3SYK A;  2CHG A;  4BBA A;  2XZF A;  3WHK A;  2V1U A;  4JYA M;  1DO2 A;  1T3T A;  3DFZ A;  4LGY A;  4B3R M;  3GQ3 A;  4P16 A;  5DYI A;  3U6C A;  2X8A A;  3MJ5 A;  4X64 M;  4DV1 M;  4IBG A;  3TWL A;  3R8F A;  4IBK A;  3GLI A;  2FE8 A;  5ITT A;  3FUV A;  4RF0 A;  4IBI A;  3HGI A;  3B9P A;  1Q3C A;  4AZF A;  4DR7 M;  4AI6 A;  3AFH A;  1NNJ A;  2J7O A;  4YHH M;  4HLQ A;  4JI0 M;  2DZO B;  3A98 B;  5E6J A;  1GLN A;  4JI4 M;  2DHR A;  4IBF A;  1G4A E;  3VFD A;  1J7K A;  4DV3 M;  4LRT A;  3SHG B;  4FCW A;  4FWG A;  1IM2 A;  4IBB A;  4DV5 M;  2QCU A;  3FUU A;  4LJ5 A;  3AJI B;  4R7G A;  1HT1 E;  1IXS B;  3K2L A;  4IBE A;  5JI3 E;  4DV7 M;  4LJ8 A;  3Q8X A;  3EIE A;  3SBJ A;  4LF4 M;  2R46 A;  2UU9 M;  3HHY A;  2HCB A;  4JN6 A;  2I7N A;  3QWL A;  4ITQ A;  3FKE A;  3KOX E;  3KS4 A;  3L28 A;  4REZ A;  4S12 A;  2DXI A;  4L15 A;  1N34 M;  1K82 A;  5EXP A;  4QNR A;  1ZQ9 A;  3JR4 A;  2KRU A;  1Q3B A;  3I51 A;  4DR4 M;  4DV6 M;  4CIS A;  4M0W A;  2CFO A;  3ZC7 B;  3RGS A;  4AG6 A;  4II7 A;  4LJ6 A;  1NJF A;  1XXH A;  5IT9 S;  4IIW A;  4JV5 M;  3GRV A;  4FCV A;  1UM8 A;  4QHS A;  4PCZ A;  3VLF B;  1L2C A;  3A46 A;  1GKI A;  5EXS A;  3SAW A;  2O5R A;  2C5R A;  4M0D A;  3KP1 E;  4W5W A;  5ITX E;  1QAN A;  4JI7 M;  1L1T A;  4NSR A;  3DA1 A;  4PD2 A;  4DR1 M;  3GRU A;  3L25 A;  1S3S A;  3W0F A;  3KOZ E;  4WUR A;  3HKP A;  3MK6 A;  2FOI C;  3GLH B;  4PT5 A;  3GPX A;  3GP1 A;  2DWM A;  2QBY A;  1IBL M;  2X49 A;  4XGI A;  4PDG A;  1HQY E;  4GH9 A;  3HJ8 A;  4PDI A;  3VK8 A;  3GPP A;  2C99 A;  4MB7 A;  3CF2 A;  4KOD A;  3CTW B;  1PJJ A;  3HWS A;  1E32 A;  2RGH A;  2J7N A;  3QAU A;  4FVM A;  3K1J A;  1ZAE A;  5KQD A;  3HU1 A;  2EUC A;  1E9R A;  4OU7 A;  3VDU A;  4LFC M;  2KXE A;  3ZCB B;  5GKN A;  4IBJ A;  4DUZ M;  1GL6 A;  5FTM A;  3SYL A;  4I8O A;  1YSY A;  2CV2 A;  4IJE A;  3KOY E;  4DR5 M;  3CF0 A;  1ORY B;  4B7H A;  1J09 A;  3KW6 A;  1R7R A;  3TE6 A;  1Z59 A;  1I94 M;  1LV7 A;  3E4R A;  2M60 A;  4B08 A;  3M7G A;  3L26 A;  3PVS A;  3LQR A;  5KQ8 A;  2Q2E B;  2QBY B;  4JI1 M;  1IN8 A;  2UUC M;  4XBO A;  1NY6 A;  1TDZ A;  4GIT A;  1QYR A;  1OFI A;  2VII A;  2ZAO A;  8CAT A;  4OX9 M;  3HJS A;  1R2Z A;  2DWZ B;  1MX0 A;  4LF9 M;  3L29 A;  2XFT A;  2X4A A;  2R4E A;  3KVW A;  3SHF A;  4AQY M;  4LF6 M;  4RF1 A;  5EP1 A;  1IXR C;  1SXJ C;  2BJW A;  2XSZ D;  2Y20 A;  4GIP A;  4ZPX A;  5ITX A;  3U6Q A;  4LF5 M;  2QEN A;  1DGG A;  1TDH A;  5FLX S;  4LY6 A;  4OVZ A;  2XSZ A;  2Z4S A;  4QHT A;  4FWD A;  4LCB A;  2CHV A;  1W5S A;  2CHQ A;  1XC8 A;  5BPV A;  2QP9 X;  4X62 M;  1J5E M;  3D8L A;  3SAT A;  5BR8 M;  4DV0 M;  3TL4 X;  5H37 D;  1X37 A;  2L6O A;  3FTC A;  3JR5 A;  2KRK A;  3U61 A;  3T1H M;  4LZJ A;  3HHW A;  4GKK M;  2KZU A;  3BOS A;  4AKG A;  3FUX A;  1N33 M;  2HL7 A;  1SXJ B;  4TUW A;  2R4J A;  2V1C A;  4GMQ A;  3TQS A;  1TGU A;  3WHL A;  1DO0 A;  5EXX A;  5FSW A;  5DNY A;  3J7A S;  5ITY A;  3U6S A;  4NXM M;  4G4Q A;  3GLI B;  1L1Z A;  2D7E A;  2M5Z A;  1W5T A;  3GPU A;  3J27 B;  3T15 A;  3J81 S;  2P5T A;  4X66 M;  3GO8 A;  2EA0 A;  3U60 A;  2ZM6 M;  3ILK A;  3GRY A;  4MGI E;  2YQZ A;  4K0K M;  5IWA M;  3T38 A;  4OVZ B;  3I4Y A;  1L8Q A;  1K3X A;  3VKH A;  2QZ4 A;  4G4R A;  5EXT A;  4MGK E;  1C1K A;  4FD2 A;  4I81 A;  1VDD A;  1HR0 M;  2DWL A;  2H1R A;  4LJ9 A;  2F5N A;  2LNH C;  2YNM D;  4CGY B;  5KPZ A;  1HNZ M;  2F5O A;  3SAS A;  3T1Y M;  3FTE A;  2XH9 A;  3DZD A;  4IBD A;  1MU5 A;  4LJ7 A;  4M9S A;  1XMO M;  4LFB M;  3K92 A;  4LJ4 A;  3PNY A;  2UXB M;  2L7H A;  4AKI A;  4MM3 B;  4NL4 H;  4EIW A;  3UJN A;  1JR3 D;  4D81 A;  2ERC A;  1Z5B A;  1QVR A;  4JI5 M;  2R62 A;  2Z3X A;  3HU3 A;  4L78 A;  1IY1 A;  3J7B A;  4JI6 M;  2F4V M;  3U6M A;  4QOS A;  3J2P B;  3ZH9 B;  3GLF A;  3U6L A;  3GRR A;  2F5P A;  4KO8 A;  2XLJ A;  1OJL A;  3K8Z A;  3FD9 A;  4DR2 M;  1NHW C;  3HHZ A;  1IQP A;  2D7H A;  4NOO B;  3PXG A;  3U60 B;  3A45 A;  4LJA A;  1XXH B;  1HT2 E;  3KFU G;  4IBC A;  2KEB A;  5FTN A;  2V6Z M;  1IXZ A;  3U6O A;  4B7F A;  4MGZ E;  3SFZ A;  1IBK M;  4AW4 A;  1E94 E;  4Z8X A;  5ITU A;  1XNQ M;  2CV1 A;  3FTF A;  3AOE A;  1PJI A;  4YY3 M;  1IN4 A;  5KPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...