3KOXE

Crystal structure of ornithine 4,5 aminomutase in complex with 2,4-diaminobutyrate (anaerobic)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 42
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3koxE02
3KP1E 3KP0E 3KOWE 3KOXE 3KOZE 3KOYE
chains in the Genus database with same CATH superfamily
2JY6B 4WURA 4HEOA 2R44A 3A45A 3PNYA 2DENA 5DNYA 3VFDA 1OFHA 1R4GA 1FNNA 2O5RA 3GQ4A 3U61B 2ZTDA 4DR7M 1L2DA 3UMMA 3SMPA 3U5ZA 3D8BA 7CATA 4DR5M 4UN2B 4D82A 1VG5A 2K47A 3GLHE 1MU5A 4NSRA 4R3DA 2C99A 5DYIA 3RGPA 4EIWA 2LVAA 2J7OA 2KXEA 4KHPM 3KVWA 2LH0A 2FFJA 2XZFA 1KFVA 4D80A 3HHZA 4LF6M 1D0LA 4KODA 1BVSA 3I04M 1TF0B 4JI8M 4MGIE 2VF8A 3HWSA 4JXJA 4IBBA 1OIPA 4LY6A 1K3XA 1YLAA 3GQ5A 2QCUA 4G4OA 1NV8A 3CF0A 2CE7A 1QZEA 4CISA 3E46A 2KNZA 4QHTA 3GO8A 4I8OA 3EIHA 3H4JA 2CEAA 3KP1E 2AHMA 2RGOA 3J7BA 1DO2A 2CHQA 3RFWA 1QAOA 4JI6M 2CUZA 1NY5A 4L6V6 3IECA 4QOZC 3PVSA 4X62M 2L09A 5EXTA 1OJLA 4LJ5A 1PJTA 3J81S 4X66M 3ILKA 3TPZA 3IG5A 1TH4A 2LNHC 2CHGA 3VDPA 4PDGA 3U60B 1CUKA 4KT0F 4WP2A 3FTCA 4LJAA 3U6SA 2RGHA 1SXJC 3TWLA 1NNJA 2K0BX 3HGIA 4W5WA 3SYLA 1QQWA 4X65M 5EXSA 4LF4M 4XGIA 3KS8A 1IY2A 3HU3A 4OVZA 1TDZA 1QANA 3KFUG 2DHRA 4LJ9A 5EXXA 2HKJA 2HAKA 1T43A 1NJFA 3C3DA 2CV0A 2B3TA 2WSFF 3FYCA 5E26A 1C1KA 1IXSA 2JA2A 4FCTA 1XHBA 3UZUA 3GLIB 2UU9M 2W82A 3JR4A 1WR1B 3TWKA 3C3EA 3FYDA 1VEJA 1F4IA 3FUUA 1NNUC 2KA6B 2MJ5B 3FTFA 1R2ZA 3Q8XA 4LZJA 5ITTA 2VQFM 2F5OA 3KSXA 4QOSA 2JWSA 4XBOA 4LG2A 4M9XA 4L16A 1IBMM 2R18A 2KRKA 1G3IA 1E32A 5EJCA 5EP4A 3SAUA 1TDHA 2R65A 1HT1E 3VK8A 4DV5M 4IBFA 2J7NA 5IT9S 2DAIA 5KPZA 3IHPA 2R6FA 2JY7A 3GRUA 3NBXX 1IY0A 4TUWA 4B7HA 1J09A 3K92A 3B7NA 1VDDA 3IG8A 4KO8A 3AFHA 4NRWA 4F2LA 2HL7A 3KOWE 1L8QA 2K6BA 3DA1A 3GLFB 3W0LB 1NO1A 3HU2A 4I4LA 3GLGB 4DV1M 1EIJA 1YE9A 3KW6A 4I5SA 3U6LA 2RKOA 2XFSA 4AKGA 2HWJA 2HHHM 2LHGA 3TE6A 3AKZA 4DV2M 1GVNA 2Z4SA 2G5GX 3U6DA 2QNJA 3T38A 2LTUA 3D8LA 3T15A 4FW9A 1TTEA 2BWBA 1WGNA 1XMOM 1IN4A 3RGSA 3I01M 3LCUA 1DGBA 1V92A 3QYBA 4AI6A 2KW0A 3FTDA 4LGMA 2KEBA 4DR1M 1Q02A 3HZJA 4IBIA 1IFYA 4DV7M 2LVNC 2KZSA 2QENA 3L27A 5C18A 1G71A 4GMQA 5FTNA 3GPPA 2R46A 3CTWB 1QAMA 3AV0A 2WZJA 5EP1A 5ITYA 2O25A 3M6AA 4IBGA 2CHVA 5FTLA 3AOEA 3AJIB 2UUCM 2LXEA 2QP9X 3KOYE 2QSFX 5IWAM 2CP8A 4IIWA 4NOOB 3PNVA 1C7YA 1NJGA 3L28A 4AG5A 1T3TA 4IJEA 1J7KA 1Q3CA 4Q7JA 3VKHA 3FUTA 2DWNA 2DVWB 3B7QA 4D81A 2XFTA 2F5QA 1OAOC 2LWXA 2KDLA 4B3TM 1HT2E 2DWLA 3B7ZA 2ZANA 3J2PB 1X37A 3KS4A 4DR2M 2OOAA 2RRUA 1AUAA 4FWDA 3AOGA 3BXWA 2H1RA 1JR3A 4G4QA 3U6EA 1QDTA 1DGHA 3U60A 3SAVA 1JQJC 1GL7A 2ZBKB 1HR0M 2DZNB 1Q39A 4BB9A 4DR6M 4AKHA 2OQ4A 2WSEF 3K9OA 2VQEM 2DNAA 1G59A 2LBCA 2JZ0A 4L4UA 1EE8A 2I7NA 4MGYE 2L4EA 1E9RA 2L6OA 3JAMS 1W5TA 1EFUB 4NSOB 5GKNA 3WHKA 3U6PA 2F5SA 2G8LA 4DV3M 2KZUA 5BR8M 5FSWA 1G8PA 1E94E 3LQRA 5KO3A 1GJTA 3HJ8A 5L8RF 4Z6YA 4GHLA 1K82A 3QAUA 4KLNA 1JR3D 2YNMD 2P5TA 2R45A 3A98B 1QVRA 1PM5A 4LZZA 2V6ZM 3FRIA 4PD2A 1NHWC 3ZH9B 1AIPC 2JY5A 1IXZA 4JN6A 4IBKA 4GITA 5IREB 4LJ4A 3DOAA 2XF3A 1D2NA 2QPAA 4R7GA 3SYKA 3SBJA 3OTOM 2LVQD 3PFIA 3AL0C 3J27B 3HX3A 1NVMA 2XSZA 2Y0TA 5LMUM 3BBZA 4RF0A 1A5TA 2VDBB 2DZOB 4LJ7A 3M7GA 2L4FA 2VF7A 5KQ8A 3VK7A 1TR8A 2XGNA 5FTKA 1IN6A 4P17A 4NC6A 3A46A 1R5LA 4DUYM 1PGYA 4L8RC 2V1UA 4BLCA 3GQ3A 1JR3E 1SXJB 3KOZE 5A2QS 3SMSA 2DAKA 3HHXA 4MH0E 3MJ5A 1N75A 1ZQ9A 3K1JA 4MGZE 3QYEA 2L7IA 4G4RA 3U6QA 1LV7A 2R0IA 4NXNM 2Z3XA 3WHLA 5F3WA 3K8ZA 2DWMA 2DAGA 2Y21A 2Q2EB 4REZA 4QNRA 1G41A 4G4NA 4B08A 4B3RM 3GLGA 3KP0E 2R4EA 4DV6M 4GRIA 1Z5CA 1GL6A 3LVWA 1IXRC 1ZV1A 3K2LA 2F5PA 1Y8GA 1OFIA 2C96A 1IBLM 2V1CA 1MJGM 3HJSA 4LJ6A 2X49A 5ITRA 4DV4M 2C98A 3LW5F 3B9PA 3GLIE 4GKKM 4OVZB 1FJGM 1WHCA 4FCWA 2GNOA 1S3SA 2D7EA 5ITXE 3FUXA 4YHHM 4Z8XA 3NBIA 2DKLA 2YFQA 2ERCA 4GHAA 5EQTA 1QZMA 1QUTA 1ZMUA 4GC9A 1N33M 2C9OA 1DGGA 3ZCBB 1IN8A 1QUSA 3FKEA 3DFZA 2DXIA 2QBYB 3GP1A 2BJVA 5BPVA 3U61A 2J5YA 4DUZM 4M0DA 3LMMA 2XH9A 2ZAOA 4LGYA 2JXNA 4RF1A 3W68A 3DZDA 4JI1M 2EJSA 1SG9A 5H37D 3R8FA 3ZC7B 2M60A 3E21A 2MR9A 1XXHB 1VQ1A 3SAWA 1JB0F 2OOBA 4M9ZA 4QNMA 4B7GA 1N34M 3TQSA 4CHTB 3L25A 2UXCM 4YY3M 1PJJA 1H6UA 4OW0A 4M9SA 2L7HA 4ZPXA 1IM2A 4JYAM 2EKFA 4JV5M 1I4WA 4LRTA 4B7FA 3GLFE 4AW4A 3GLGE 1N36M 4RKUF 3JR5A 3W0FA 1HQYE 4PT5A 4B3MM 3GLHB 4JI3M 2Y0QA 1IBKM 1E9SA 4CJ6A 1LTMA 4IBJA 4LF8M 5KPRA 1XB2B 4LF9M 3HKPA 3E4RA 2GQFA 1N78A 3F92A 2JNHA 3U6MA 4DR3M 2DAMA 1J5EM 3T6PA 2BNKA 3KOXE 1NHGC 3GRYA 3SC3A 4FCVA 3FTEA 2FNAA 1WXQA 3GRVA 3L2AA 1XNRM 4F1IA 1KSFX 1V34A 4GC5A 3AOEC 2EKKA 4LF5M 2QQ8A 4DR4M 1HNXM 5EP3A 3J7AS 4CGYB 3NWLA 5ITQA 2BJWA 3KXEC 4L15A 5C1BA 2YQZA 1Z5BA 1QYRA 2F5NA 1HNWM 2FE8A 4LFCM 4NXMM 2FS1A 1N32M 1GLNA 3HJQA 3M0EA 3LQQA 1NV9A 1DV0A 2KHHA 1R6BX 3LVVA 1WGLA 3CGWA 2X4AA 2R62A 2E5LM 2DAEA 1QDRA 4ITQA 1IN5A 1OKSA 2G3QA 1TH2A 1UM8A 2VIIA 3U6CA 1G4AE 1XNQM 4AG6A 1QAQA 3C58A 2CWBA 1PJIA 4AKIA 2D7GA 4WW0A 2OPFA 2QHOB 2ZAMA 1UFZA 8CATA 2UUAM 4NL4H 2A5YB 2Z8YM 3QWLA 5E6JA 3GLIA 2K9DA 4FVMA 1Z6TA 4RNAA 1PJQA 4JI0M 4CIZA 1SXJA 2JZ1A 2C9CA 4HLQA 5ITXA 3SHGB 4X64M 3U5ZB 2CV1A 1RU3A 1VEGA 3H4MA 3KDSE 2L2DA 4Y28F 1OQYA 1WIVA 3SARA 5LMNM 4LF7M 4B3SM 4IBEA 1Z59A 4JI5M 3T1HM 4MM3B 4I81A 1ZMVA 1L2CA 1IN7A 1ZMWA 1DGHB 3I51A 3FE3A 4QHSA 1TH3A 3L29A 4ANRA 3VKGA 3MHVC 3GPXA 3PXGA 3K9PA 1L1ZA 1Z5AA 4DV0M 5KPTA 4HL4A 2EA0A 1PRBA 3HY5A 4M0WA 2WSCF 4OX9M 3C9PA 3FUWA 4II7A 3L26A 2F4VM 2MROB 4K0KM 3RE8A 2Z7JA 2APLA 2XEPA 2Y20A 1SXJD 4LRSA 4MGKE 3TL4X 4FWHA 2JUJA 4MGHA 1XWIA 1R2YA 1HNZM 4PDIA 1L2BA 2UXBM 2NQ8C 1IY1A 4S12A 4PCZA 3TWMA 2XSZD 3BOSA 3GLFA 2CV2A 3FUVA 3SHFA 3SFZA 2ZM6M 1IQPA 4JI7M 1PJSA 3VDUA 1XC8A 1VEKA 2JY8A 2QBYA 1GKIA 4AZFA 3GRRA 2QZ4A 3J80S 4JI4M 3GPYA 2ZTCA 3T1YM 1YUBA 1GABA 4FWGA 1P3QQ 3U6OA 5EP2A 2BWEA 2R4JA 5FTMA 2DZLA 2XLJA 1Q3BA 3FRHA 5JI2E 4P16A 5FTJA 3MMPA 2OO9A 1SXJE 1I94M 3SATA 1XXHA 3R9XB 1TGUA 2XZUA 4GIPA 4LFBM 3MK6A 4GH9A 2KNVA 3UK6A 1V33A 2N35A 1MN3A 2X8AA 4OU7A 4MB7A 1IXSB 2UUBM 2UXDM 2I7PA 3SASA 4IBCA 2DHYA 4L78A 3EIEA 4NRVA 5JI3E 3I4YA 4IBDA 1N77A 5EXPA 4GEWA 3GLHA 5IZ7D 4R71A 3W67A 2DI0A 1T6OA 2MH8A 4LCBA 2HCBA 1GO5A 1OTRA 1NSFA 2H5XA 2M5ZA 3CF2A 4DBGB 3UGJA 3B74A 3CF6E 4FD2A 4GKJM 2CFOA 2LHCA 2LVOC 1KYIA 2EUCA 1YSYA 3HU1A 3KSJA 3HHYA 1DGFA 3B89A 4G6ZA 2FOIC 2JP7A 2YR0A 2LVPC 3HHWA 4IJFA 5ITUA 4XK8F 5DFLA 3LCVB 4A3VB 2O01F 1HJPA 2CRUA 4BBAA 5DYGA 1MX0A 2C5RA 1HQCA 3Q8GA 3FD9A 2KRUA 3I4VA 3V76A 1OAIA 1D0KA 1L1TA 1GJSA 4AQYM 3GPUA 2FH0A 1ORYB 4LJ8A 4LFAM 4G3OA 3ZQJA 2D7HA 1VDLA 3A42A 2Z4RA 1K3WA 1W5SA 1D0MA 2MGWA 5KQDA 2DWZB 1NY6A 1XXHE 1WJ7A 2EO2A 1R7RA 1ZAEA 1XMQM 3E9SA 3THGA 3VLFB 3UJNA 2KNAA 4JI2M 1DO0A 5FLXS 1OIZA
chains in the Genus database with same CATH topology
4WURA 3A45A 3PNYA 5DNYA 1HNWM 3U61B 3VFDA 1OFHA 2O5RA 1FNNA 3GQ4A 4DR7M 1L2DA 3UMMA 3SMPA 3U5ZA 3D8BA 7CATA 4DR5M 4D82A 2K47A 4NSRA 1MU5A 4R3DA 2C99A 5DYIA 3RGPA 4EIWA 2J7OA 2KXEA 4KHPM 3KVWA 2LH0A 2FFJA 2XZFA 1KFVA 4D80A 3HHZA 4LF6M 4KODA 4JI8M 4MGIE 3HWSA 4JXJA 4IBBA 1K3XA 4LY6A 3GQ5A 2QCUA 4G4OA 3CF0A 2CE7A 4CISA 4QHTA 3GO8A 4I8OA 3EIHA 2CEAA 3KP1E 2AHMA 2RGOA 3J7BA 1DO2A 2CHQA 3RFWA 1QAOA 4JI6M 2CUZA 1NY5A 4QOZC 3PVSA 4X62M 2L09A 5EXTA 1OJLA 4LJ5A 3J81S 4X66M 3ILKA 3TPZA 3IG5A 1TH4A 2LNHC 2CHGA 3VDPA 4PDGA 3U60B 3FTCA 4LJAA 3U6SA 2RGHA 1SXJC 3TWLA 1NNJA 3HGIA 4W5WA 3SYLA 1QQWA 4X65M 5EXSA 4LF4M 4XGIA 3KS8A 1IY2A 3HU3A 4OVZA 1TDZA 1QANA 3KFUG 2DHRA 4LJ9A 5EXXA 2HKJA 1NJFA 2CV0A 3FYCA 5E26A 1C1KA 2JA2A 4FCTA 1XHBA 3UZUA 3GLIB 2UU9M 2W82A 3JR4A 3TWKA 3FYDA 3FUUA 1NNUC 2KA6B 3FTFA 1R2ZA 3Q8XA 4LZJA 5ITTA 2VQFM 2F5OA 3KSXA 4QOSA 4LG2A 4XBOA 4M9XA 4L16A 1IBMM 2R18A 2KRKA 1G3IA 1E32A 5EJCA 5EP4A 3SAUA 1TDHA 2R65A 1HT1E 3VK8A 4DV5M 4IBFA 2J7NA 5IT9S 5KPZA 3GRUA 4TUWA 1IY0A 4B7HA 1J09A 3K92A 1VDDA 3IG8A 4KO8A 3AFHA 4NRWA 3KOWE 2HL7A 1L8QA 3DA1A 3GLFB 3W0LB 3HU2A 4I4LA 3GLGB 4DV1M 1YE9A 3KW6A 4I5SA 3U6LA 2RKOA 2XFSA 4AKGA 2HHHM 3TE6A 3AKZA 4DV2M 1GVNA 2Z4SA 2G5GX 3U6DA 3T38A 3D8LA 3T15A 4FW9A 1XMOM 1IN4A 3RGSA 1DGBA 4AI6A 2KW0A 3FTDA 4LGMA 2KEBA 4DR1M 4IBIA 4DV7M 2KZSA 2QENA 3L27A 5C18A 4GMQA 5FTNA 3GPPA 2R46A 3CTWB 1QAMA 3AV0A 5EP1A 5ITYA 3M6AA 4IBGA 2CHVA 5FTLA 3AOEA 3AJIB 2UUCM 2LXEA 2QP9X 3KOYE 5IWAM 4IIWA 4NOOB 3PNVA 1NJGA 3L28A 4AG5A 1T3TA 4IJEA 1J7KA 1Q3CA 3VKHA 3FUTA 2DWNA 2DVWB 4D81A 2XFTA 2F5QA 2LWXA 4B3TM 1HT2E 2DWLA 2ZANA 3J2PB 1X37A 3KS4A 4DR2M 4FWDA 3AOGA 2H1RA 1JR3A 4G4QA 3U6EA 3U60A 1DGHA 3SAVA 1JQJC 1GL7A 2ZBKB 1HR0M 2DZNB 1Q39A 4BB9A 4DR6M 4AKHA 2OQ4A 2VQEM 1G59A 4L4UA 1EE8A 2I7NA 4MGYE 1E9RA 2L6OA 3JAMS 1W5TA 4NSOB 5GKNA 3WHKA 3U6PA 2F5SA 2G8LA 4DV3M 2KZUA 5BR8M 5FSWA 1G8PA 1E94E 3LQRA 5KO3A 3HJ8A 4Z6YA 4GHLA 1K82A 3QAUA 4KLNA 1JR3D 2YNMD 2P5TA 2R45A 3A98B 1QVRA 1PM5A 4LZZA 2V6ZM 4PD2A 1NHWC 3ZH9B 1IXZA 4JN6A 4IBKA 4GITA 5IREB 4LJ4A 3DOAA 2XF3A 1D2NA 2QPAA 4R7GA 3SYKA 3SBJA 3OTOM 3AL0C 3PFIA 3J27B 1NVMA 2XSZA 2Y0TA 5LMUM 4RF0A 2DZOB 4LJ7A 3M7GA 3VK7A 5KQ8A 2XGNA 5FTKA 1IN6A 3A46A 4DUYM 4L8RC 2V1UA 4BLCA 3GQ3A 3KOZE 1SXJB 5A2QS 3SMSA 3HHXA 4MH0E 3MJ5A 1N75A 1ZQ9A 3K1JA 4MGZE 4G4RA 2L7IA 3U6QA 1LV7A 4NXNM 2Z3XA 3WHLA 5F3WA 3K8ZA 2DWMA 2Y21A 2Q2EB 4REZA 1G41A 4G4NA 4B08A 3GLGA 3KP0E 2R4EA 4DV6M 4GRIA 1Z5CA 1GL6A 3LVWA 1IXRC 3K2LA 2F5PA 1OFIA 2C96A 1IBLM 2V1CA 3HJSA 4LJ6A 2X49A 5ITRA 4DV4M 2C98A 3B9PA 4GKKM 4OVZB 1FJGM 4FCWA 1S3SA 2D7EA 5ITXE 3FUXA 4YHHM 4Z8XA 3NBIA 2YFQA 2ERCA 4GHAA 5EQTA 1QZMA 4GC9A 1N33M 2C9OA 1DGGA 3ZCBB 1IN8A 3FKEA 3DFZA 2DXIA 2QBYB 3GP1A 2BJVA 5BPVA 3U61A 4DUZM 4M0DA 3LMMA 2XH9A 2ZAOA 4LGYA 4RF1A 4JI1M 3DZDA 5H37D 3R8FA 3ZC7B 2M60A 1XXHB 3SAWA 4M9ZA 4QNMA 4B7GA 1N34M 3TQSA 4CHTB 3L25A 2UXCM 4YY3M 1PJJA 1H6UA 4OW0A 4M9SA 2L7HA 4ZPXA 1IM2A 4JYAM 4JV5M 1I4WA 4LRTA 4B7FA 4AW4A 1N36M 3JR5A 3W0FA 1HQYE 4PT5A 4B3MM 3GLHB 4JI3M 2Y0QA 1IBKM 1E9SA 4IBJA 4LF8M 5KPRA 4LF9M 3HKPA 3E4RA 1N78A 3U6MA 4DR3M 1J5EM 2BNKA 3KOXE 1NHGC 3GRYA 3SC3A 4FCVA 3FTEA 2FNAA 1WXQA 3GRVA 3L2AA 1XNRM 1KSFX 4GC5A 3AOEC 4LF5M 4DR4M 1HNXM 5EP3A 3J7AS 4CGYB 3NWLA 5ITQA 2BJWA 3KXEC 4L15A 5C1BA 2YQZA 1Z5BA 1QYRA 2F5NA 2FE8A 4LFCM 4NXMM 1N32M 1GLNA 3HJQA 3M0EA 3LQQA 3LVVA 1R6BX 2X4AA 2R62A 2E5LM 4ITQA 1IN5A 1TH2A 1UM8A 2VIIA 3U6CA 1G4AE 1XNQM 4AG6A 1QAQA 3C58A 1PJIA 4AKIA 2D7GA 4WW0A 2OPFA 2ZAMA 8CATA 2UUAM 4NL4H 2A5YB 3QWLA 3GLIA 5E6JA 4FVMA 1Z6TA 4RNAA 4JI0M 1SXJA 4HLQA 2C9CA 5ITXA 4X64M 3SHGB 3U5ZB 2CV1A 3H4MA 3KDSE 3SARA 5LMNM 4LF7M 4B3SM 4IBEA 1Z59A 4JI5M 3T1HM 4MM3B 4I81A 1L2CA 1IN7A 1DGHB 3I51A 4QHSA 1TH3A 3L29A 3VKGA 3MHVC 3GPXA 3PXGA 1L1ZA 1Z5AA 4DV0M 5KPTA 4HL4A 2EA0A 4M0WA 4OX9M 3FUWA 4II7A 3L26A 2F4VM 4K0KM 3RE8A 2Z7JA 2Y20A 2XEPA 4LRSA 1SXJD 4MGKE 4FWHA 4MGHA 1XWIA 1R2YA 1HNZM 4PDIA 1L2BA 2UXBM 2NQ8C 1IY1A 4S12A 4PCZA 3TWMA 2XSZD 3BOSA 3GLFA 2CV2A 3FUVA 3SHFA 3SFZA 2ZM6M 1IQPA 4JI7M 3VDUA 1XC8A 2QBYA 1GKIA 4AZFA 3GRRA 2QZ4A 3J80S 4JI4M 3GPYA 3T1YM 1YUBA 4FWGA 3U6OA 5EP2A 2R4JA 5FTMA 2XLJA 1Q3BA 5JI2E 4P16A 5FTJA 1SXJE 1I94M 3SATA 1XXHA 3R9XB 1TGUA 2XZUA 4GIPA 4LFBM 3MK6A 4GH9A 3UK6A 2X8AA 4OU7A 4MB7A 1IXSB 2UUBM 2UXDM 2I7PA 3SASA 4IBCA 4L78A 3EIEA 4NRVA 5JI3E 3I4YA 4IBDA 1N77A 5EXPA 5IZ7D 3GLHA 4LCBA 2HCBA 1NSFA 2M5ZA 3CF2A 3UGJA 3CF6E 4FD2A 4GKJM 2CFOA 1KYIA 2EUCA 1YSYA 3HU1A 3KSJA 3HHYA 1DGFA 4B3RM 4G6ZA 2FOIC 2YR0A 4IJFA 5ITUA 3HHWA 4A3VB 4BBAA 5DYGA 1MX0A 2C5RA 1HQCA 1L1TA 3FD9A 2KRUA 3I4VA 4AQYM 3GPUA 4LJ8A 1ORYB 4LFAM 2D7HA 3A42A 2Z4RA 1K3WA 1W5SA 5KQDA 2DWZB 1NY6A 2EO2A 1R7RA 1ZAEA 1XMQM 3E9SA 3THGA 3VLFB 3UJNA 4QNRA 4JI2M 1DO0A 5FLXS 3TL4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP1 E;  3KP0 E;  3KOW E;  3KOX E;  3KOZ E;  3KOY E; 
#chains in the Genus database with same CATH topology
 2JY6 B;  4WUR A;  4HEO A;  2R44 A;  3A45 A;  3PNY A;  2DEN A;  5DNY A;  3VFD A;  1OFH A;  1R4G A;  1FNN A;  2O5R A;  3GQ4 A;  3U61 B;  2ZTD A;  4DR7 M;  1L2D A;  3UMM A;  3SMP A;  3U5Z A;  3D8B A;  7CAT A;  4DR5 M;  4UN2 B;  4D82 A;  1VG5 A;  2K47 A;  3GLH E;  1MU5 A;  4NSR A;  4R3D A;  2C99 A;  5DYI A;  3RGP A;  4EIW A;  2LVA A;  2J7O A;  2KXE A;  4KHP M;  3KVW A;  2LH0 A;  2FFJ A;  2XZF A;  1KFV A;  4D80 A;  3HHZ A;  4LF6 M;  1D0L A;  4KOD A;  1BVS A;  3I04 M;  1TF0 B;  4JI8 M;  4MGI E;  2VF8 A;  3HWS A;  4JXJ A;  4IBB A;  1OIP A;  4LY6 A;  1K3X A;  1YLA A;  3GQ5 A;  2QCU A;  4G4O A;  1NV8 A;  3CF0 A;  2CE7 A;  1QZE A;  4CIS A;  3E46 A;  2KNZ A;  4QHT A;  3GO8 A;  4I8O A;  3EIH A;  3H4J A;  2CEA A;  3KP1 E;  2AHM A;  2RGO A;  3J7B A;  1DO2 A;  2CHQ A;  3RFW A;  1QAO A;  4JI6 M;  2CUZ A;  1NY5 A;  4L6V 6;  3IEC A;  4QOZ C;  3PVS A;  4X62 M;  2L09 A;  5EXT A;  1OJL A;  4LJ5 A;  1PJT A;  3J81 S;  4X66 M;  3ILK A;  3TPZ A;  3IG5 A;  1TH4 A;  2LNH C;  2CHG A;  3VDP A;  4PDG A;  3U60 B;  1CUK A;  4KT0 F;  4WP2 A;  3FTC A;  4LJA A;  3U6S A;  2RGH A;  1SXJ C;  3TWL A;  1NNJ A;  2K0B X;  3HGI A;  4W5W A;  3SYL A;  1QQW A;  4X65 M;  5EXS A;  4LF4 M;  4XGI A;  3KS8 A;  1IY2 A;  3HU3 A;  4OVZ A;  1TDZ A;  1QAN A;  3KFU G;  2DHR A;  4LJ9 A;  5EXX A;  2HKJ A;  2HAK A;  1T43 A;  1NJF A;  3C3D A;  2CV0 A;  2B3T A;  2WSF F;  3FYC A;  5E26 A;  1C1K A;  1IXS A;  2JA2 A;  4FCT A;  1XHB A;  3UZU A;  3GLI B;  2UU9 M;  2W82 A;  3JR4 A;  1WR1 B;  3TWK A;  3C3E A;  3FYD A;  1VEJ A;  1F4I A;  3FUU A;  1NNU C;  2KA6 B;  2MJ5 B;  3FTF A;  1R2Z A;  3Q8X A;  4LZJ A;  5ITT A;  2VQF M;  2F5O A;  3KSX A;  4QOS A;  2JWS A;  4XBO A;  4LG2 A;  4M9X A;  4L16 A;  1IBM M;  2R18 A;  2KRK A;  1G3I A;  1E32 A;  5EJC A;  5EP4 A;  3SAU A;  1TDH A;  2R65 A;  1HT1 E;  3VK8 A;  4DV5 M;  4IBF A;  2J7N A;  5IT9 S;  2DAI A;  5KPZ A;  3IHP A;  2R6F A;  2JY7 A;  3GRU A;  3NBX X;  1IY0 A;  4TUW A;  4B7H A;  1J09 A;  3K92 A;  3B7N A;  1VDD A;  3IG8 A;  4KO8 A;  3AFH A;  4NRW A;  4F2L A;  2HL7 A;  3KOW E;  1L8Q A;  2K6B A;  3DA1 A;  3GLF B;  3W0L B;  1NO1 A;  3HU2 A;  4I4L A;  3GLG B;  4DV1 M;  1EIJ A;  1YE9 A;  3KW6 A;  4I5S A;  3U6L A;  2RKO A;  2XFS A;  4AKG A;  2HWJ A;  2HHH M;  2LHG A;  3TE6 A;  3AKZ A;  4DV2 M;  1GVN A;  2Z4S A;  2G5G X;  3U6D A;  2QNJ A;  3T38 A;  2LTU A;  3D8L A;  3T15 A;  4FW9 A;  1TTE A;  2BWB A;  1WGN A;  1XMO M;  1IN4 A;  3RGS A;  3I01 M;  3LCU A;  1DGB A;  1V92 A;  3QYB A;  4AI6 A;  2KW0 A;  3FTD A;  4LGM A;  2KEB A;  4DR1 M;  1Q02 A;  3HZJ A;  4IBI A;  1IFY A;  4DV7 M;  2LVN C;  2KZS A;  2QEN A;  3L27 A;  5C18 A;  1G71 A;  4GMQ A;  5FTN A;  3GPP A;  2R46 A;  3CTW B;  1QAM A;  3AV0 A;  2WZJ A;  5EP1 A;  5ITY A;  2O25 A;  3M6A A;  4IBG A;  2CHV A;  5FTL A;  3AOE A;  3AJI B;  2UUC M;  2LXE A;  2QP9 X;  3KOY E;  2QSF X;  5IWA M;  2CP8 A;  4IIW A;  4NOO B;  3PNV A;  1C7Y A;  1NJG A;  3L28 A;  4AG5 A;  1T3T A;  4IJE A;  1J7K A;  1Q3C A;  4Q7J A;  3VKH A;  3FUT A;  2DWN A;  2DVW B;  3B7Q A;  4D81 A;  2XFT A;  2F5Q A;  1OAO C;  2LWX A;  2KDL A;  4B3T M;  1HT2 E;  2DWL A;  3B7Z A;  2ZAN A;  3J2P B;  1X37 A;  3KS4 A;  4DR2 M;  2OOA A;  2RRU A;  1AUA A;  4FWD A;  3AOG A;  3BXW A;  2H1R A;  1JR3 A;  4G4Q A;  3U6E A;  1QDT A;  1DGH A;  3U60 A;  3SAV A;  1JQJ C;  1GL7 A;  2ZBK B;  1HR0 M;  2DZN B;  1Q39 A;  4BB9 A;  4DR6 M;  4AKH A;  2OQ4 A;  2WSE F;  3K9O A;  2VQE M;  2DNA A;  1G59 A;  2LBC A;  2JZ0 A;  4L4U A;  1EE8 A;  2I7N A;  4MGY E;  2L4E A;  1E9R A;  2L6O A;  3JAM S;  1W5T A;  1EFU B;  4NSO B;  5GKN A;  3WHK A;  3U6P A;  2F5S A;  2G8L A;  4DV3 M;  2KZU A;  5BR8 M;  5FSW A;  1G8P A;  1E94 E;  3LQR A;  5KO3 A;  1GJT A;  3HJ8 A;  5L8R F;  4Z6Y A;  4GHL A;  1K82 A;  3QAU A;  4KLN A;  1JR3 D;  2YNM D;  2P5T A;  2R45 A;  3A98 B;  1QVR A;  1PM5 A;  4LZZ A;  2V6Z M;  3FRI A;  4PD2 A;  1NHW C;  3ZH9 B;  1AIP C;  2JY5 A;  1IXZ A;  4JN6 A;  4IBK A;  4GIT A;  5IRE B;  4LJ4 A;  3DOA A;  2XF3 A;  1D2N A;  2QPA A;  4R7G A;  3SYK A;  3SBJ A;  3OTO M;  2LVQ D;  3PFI A;  3AL0 C;  3J27 B;  3HX3 A;  1NVM A;  2XSZ A;  2Y0T A;  5LMU M;  3BBZ A;  4RF0 A;  1A5T A;  2VDB B;  2DZO B;  4LJ7 A;  3M7G A;  2L4F A;  2VF7 A;  5KQ8 A;  3VK7 A;  1TR8 A;  2XGN A;  5FTK A;  1IN6 A;  4P17 A;  4NC6 A;  3A46 A;  1R5L A;  4DUY M;  1PGY A;  4L8R C;  2V1U A;  4BLC A;  3GQ3 A;  1JR3 E;  1SXJ B;  3KOZ E;  5A2Q S;  3SMS A;  2DAK A;  3HHX A;  4MH0 E;  3MJ5 A;  1N75 A;  1ZQ9 A;  3K1J A;  4MGZ E;  3QYE A;  2L7I A;  4G4R A;  3U6Q A;  1LV7 A;  2R0I A;  4NXN M;  2Z3X A;  3WHL A;  5F3W A;  3K8Z A;  2DWM A;  2DAG A;  2Y21 A;  2Q2E B;  4REZ A;  4QNR A;  1G41 A;  4G4N A;  4B08 A;  4B3R M;  3GLG A;  3KP0 E;  2R4E A;  4DV6 M;  4GRI A;  1Z5C A;  1GL6 A;  3LVW A;  1IXR C;  1ZV1 A;  3K2L A;  2F5P A;  1Y8G A;  1OFI A;  2C96 A;  1IBL M;  2V1C A;  1MJG M;  3HJS A;  4LJ6 A;  2X49 A;  5ITR A;  4DV4 M;  2C98 A;  3LW5 F;  3B9P A;  3GLI E;  4GKK M;  4OVZ B;  1FJG M;  1WHC A;  4FCW A;  2GNO A;  1S3S A;  2D7E A;  5ITX E;  3FUX A;  4YHH M;  4Z8X A;  3NBI A;  2DKL A;  2YFQ A;  2ERC A;  4GHA A;  5EQT A;  1QZM A;  1QUT A;  1ZMU A;  4GC9 A;  1N33 M;  2C9O A;  1DGG A;  3ZCB B;  1IN8 A;  1QUS A;  3FKE A;  3DFZ A;  2DXI A;  2QBY B;  3GP1 A;  2BJV A;  5BPV A;  3U61 A;  2J5Y A;  4DUZ M;  4M0D A;  3LMM A;  2XH9 A;  2ZAO A;  4LGY A;  2JXN A;  4RF1 A;  3W68 A;  3DZD A;  4JI1 M;  2EJS A;  1SG9 A;  5H37 D;  3R8F A;  3ZC7 B;  2M60 A;  3E21 A;  2MR9 A;  1XXH B;  1VQ1 A;  3SAW A;  1JB0 F;  2OOB A;  4M9Z A;  4QNM A;  4B7G A;  1N34 M;  3TQS A;  4CHT B;  3L25 A;  2UXC M;  4YY3 M;  1PJJ A;  1H6U A;  4OW0 A;  4M9S A;  2L7H A;  4ZPX A;  1IM2 A;  4JYA M;  2EKF A;  4JV5 M;  1I4W A;  4LRT A;  4B7F A;  3GLF E;  4AW4 A;  3GLG E;  1N36 M;  4RKU F;  3JR5 A;  3W0F A;  1HQY E;  4PT5 A;  4B3M M;  3GLH B;  4JI3 M;  2Y0Q A;  1IBK M;  1E9S A;  4CJ6 A;  1LTM A;  4IBJ A;  4LF8 M;  5KPR A;  1XB2 B;  4LF9 M;  3HKP A;  3E4R A;  2GQF A;  1N78 A;  3F92 A;  2JNH A;  3U6M A;  4DR3 M;  2DAM A;  1J5E M;  3T6P A;  2BNK A;  3KOX E;  1NHG C;  3GRY A;  3SC3 A;  4FCV A;  3FTE A;  2FNA A;  1WXQ A;  3GRV A;  3L2A A;  1XNR M;  4F1I A;  1KSF X;  1V34 A;  4GC5 A;  3AOE C;  2EKK A;  4LF5 M;  2QQ8 A;  4DR4 M;  1HNX M;  5EP3 A;  3J7A S;  4CGY B;  3NWL A;  5ITQ A;  2BJW A;  3KXE C;  4L15 A;  5C1B A;  2YQZ A;  1Z5B A;  1QYR A;  2F5N A;  1HNW M;  2FE8 A;  4LFC M;  4NXM M;  2FS1 A;  1N32 M;  1GLN A;  3HJQ A;  3M0E A;  3LQQ A;  1NV9 A;  1DV0 A;  2KHH A;  1R6B X;  3LVV A;  1WGL A;  3CGW A;  2X4A A;  2R62 A;  2E5L M;  2DAE A;  1QDR A;  4ITQ A;  1IN5 A;  1OKS A;  2G3Q A;  1TH2 A;  1UM8 A;  2VII A;  3U6C A;  1G4A E;  1XNQ M;  4AG6 A;  1QAQ A;  3C58 A;  2CWB A;  1PJI A;  4AKI A;  2D7G A;  4WW0 A;  2OPF A;  2QHO B;  2ZAM A;  1UFZ A;  8CAT A;  2UUA M;  4NL4 H;  2A5Y B;  2Z8Y M;  3QWL A;  5E6J A;  3GLI A;  2K9D A;  4FVM A;  1Z6T A;  4RNA A;  1PJQ A;  4JI0 M;  4CIZ A;  1SXJ A;  2JZ1 A;  2C9C A;  4HLQ A;  5ITX A;  3SHG B;  4X64 M;  3U5Z B;  2CV1 A;  1RU3 A;  1VEG A;  3H4M A;  3KDS E;  2L2D A;  4Y28 F;  1OQY A;  1WIV A;  3SAR A;  5LMN M;  4LF7 M;  4B3S M;  4IBE A;  1Z59 A;  4JI5 M;  3T1H M;  4MM3 B;  4I81 A;  1ZMV A;  1L2C A;  1IN7 A;  1ZMW A;  1DGH B;  3I51 A;  3FE3 A;  4QHS A;  1TH3 A;  3L29 A;  4ANR A;  3VKG A;  3MHV C;  3GPX A;  3PXG A;  3K9P A;  1L1Z A;  1Z5A A;  4DV0 M;  5KPT A;  4HL4 A;  2EA0 A;  1PRB A;  3HY5 A;  4M0W A;  2WSC F;  4OX9 M;  3C9P A;  3FUW A;  4II7 A;  3L26 A;  2F4V M;  2MRO B;  4K0K M;  3RE8 A;  2Z7J A;  2APL A;  2XEP A;  2Y20 A;  1SXJ D;  4LRS A;  4MGK E;  3TL4 X;  4FWH A;  2JUJ A;  4MGH A;  1XWI A;  1R2Y A;  1HNZ M;  4PDI A;  1L2B A;  2UXB M;  2NQ8 C;  1IY1 A;  4S12 A;  4PCZ A;  3TWM A;  2XSZ D;  3BOS A;  3GLF A;  2CV2 A;  3FUV A;  3SHF A;  3SFZ A;  2ZM6 M;  1IQP A;  4JI7 M;  1PJS A;  3VDU A;  1XC8 A;  1VEK A;  2JY8 A;  2QBY A;  1GKI A;  4AZF A;  3GRR A;  2QZ4 A;  3J80 S;  4JI4 M;  3GPY A;  2ZTC A;  3T1Y M;  1YUB A;  1GAB A;  4FWG A;  1P3Q Q;  3U6O A;  5EP2 A;  2BWE A;  2R4J A;  5FTM A;  2DZL A;  2XLJ A;  1Q3B A;  3FRH A;  5JI2 E;  4P16 A;  5FTJ A;  3MMP A;  2OO9 A;  1SXJ E;  1I94 M;  3SAT A;  1XXH A;  3R9X B;  1TGU A;  2XZU A;  4GIP A;  4LFB M;  3MK6 A;  4GH9 A;  2KNV A;  3UK6 A;  1V33 A;  2N35 A;  1MN3 A;  2X8A A;  4OU7 A;  4MB7 A;  1IXS B;  2UUB M;  2UXD M;  2I7P A;  3SAS A;  4IBC A;  2DHY A;  4L78 A;  3EIE A;  4NRV A;  5JI3 E;  3I4Y A;  4IBD A;  1N77 A;  5EXP A;  4GEW A;  3GLH A;  5IZ7 D;  4R71 A;  3W67 A;  2DI0 A;  1T6O A;  2MH8 A;  4LCB A;  2HCB A;  1GO5 A;  1OTR A;  1NSF A;  2H5X A;  2M5Z A;  3CF2 A;  4DBG B;  3UGJ A;  3B74 A;  3CF6 E;  4FD2 A;  4GKJ M;  2CFO A;  2LHC A;  2LVO C;  1KYI A;  2EUC A;  1YSY A;  3HU1 A;  3KSJ A;  3HHY A;  1DGF A;  3B89 A;  4G6Z A;  2FOI C;  2JP7 A;  2YR0 A;  2LVP C;  3HHW A;  4IJF A;  5ITU A;  4XK8 F;  5DFL A;  3LCV B;  4A3V B;  2O01 F;  1HJP A;  2CRU A;  4BBA A;  5DYG A;  1MX0 A;  2C5R A;  1HQC A;  3Q8G A;  3FD9 A;  2KRU A;  3I4V A;  3V76 A;  1OAI A;  1D0K A;  1L1T A;  1GJS A;  4AQY M;  3GPU A;  2FH0 A;  1ORY B;  4LJ8 A;  4LFA M;  4G3O A;  3ZQJ A;  2D7H A;  1VDL A;  3A42 A;  2Z4R A;  1K3W A;  1W5S A;  1D0M A;  2MGW A;  5KQD A;  2DWZ B;  1NY6 A;  1XXH E;  1WJ7 A;  2EO2 A;  1R7R A;  1ZAE A;  1XMQ M;  3E9S A;  3THG A;  3VLF B;  3UJN A;  2KNA A;  4JI2 M;  1DO0 A;  5FLX S;  1OIZ A; 
#chains in the Genus database with same CATH homology
 4WUR A;  3A45 A;  3PNY A;  5DNY A;  1HNW M;  3U61 B;  3VFD A;  1OFH A;  2O5R A;  1FNN A;  3GQ4 A;  4DR7 M;  1L2D A;  3UMM A;  3SMP A;  3U5Z A;  3D8B A;  7CAT A;  4DR5 M;  4D82 A;  2K47 A;  4NSR A;  1MU5 A;  4R3D A;  2C99 A;  5DYI A;  3RGP A;  4EIW A;  2J7O A;  2KXE A;  4KHP M;  3KVW A;  2LH0 A;  2FFJ A;  2XZF A;  1KFV A;  4D80 A;  3HHZ A;  4LF6 M;  4KOD A;  4JI8 M;  4MGI E;  3HWS A;  4JXJ A;  4IBB A;  1K3X A;  4LY6 A;  3GQ5 A;  2QCU A;  4G4O A;  3CF0 A;  2CE7 A;  4CIS A;  4QHT A;  3GO8 A;  4I8O A;  3EIH A;  2CEA A;  3KP1 E;  2AHM A;  2RGO A;  3J7B A;  1DO2 A;  2CHQ A;  3RFW A;  1QAO A;  4JI6 M;  2CUZ A;  1NY5 A;  4QOZ C;  3PVS A;  4X62 M;  2L09 A;  5EXT A;  1OJL A;  4LJ5 A;  3J81 S;  4X66 M;  3ILK A;  3TPZ A;  3IG5 A;  1TH4 A;  2LNH C;  2CHG A;  3VDP A;  4PDG A;  3U60 B;  3FTC A;  4LJA A;  3U6S A;  2RGH A;  1SXJ C;  3TWL A;  1NNJ A;  3HGI A;  4W5W A;  3SYL A;  1QQW A;  4X65 M;  5EXS A;  4LF4 M;  4XGI A;  3KS8 A;  1IY2 A;  3HU3 A;  4OVZ A;  1TDZ A;  1QAN A;  3KFU G;  2DHR A;  4LJ9 A;  5EXX A;  2HKJ A;  1NJF A;  2CV0 A;  3FYC A;  5E26 A;  1C1K A;  2JA2 A;  4FCT A;  1XHB A;  3UZU A;  3GLI B;  2UU9 M;  2W82 A;  3JR4 A;  3TWK A;  3FYD A;  3FUU A;  1NNU C;  2KA6 B;  3FTF A;  1R2Z A;  3Q8X A;  4LZJ A;  5ITT A;  2VQF M;  2F5O A;  3KSX A;  4QOS A;  4LG2 A;  4XBO A;  4M9X A;  4L16 A;  1IBM M;  2R18 A;  2KRK A;  1G3I A;  1E32 A;  5EJC A;  5EP4 A;  3SAU A;  1TDH A;  2R65 A;  1HT1 E;  3VK8 A;  4DV5 M;  4IBF A;  2J7N A;  5IT9 S;  5KPZ A;  3GRU A;  4TUW A;  1IY0 A;  4B7H A;  1J09 A;  3K92 A;  1VDD A;  3IG8 A;  4KO8 A;  3AFH A;  4NRW A;  3KOW E;  2HL7 A;  1L8Q A;  3DA1 A;  3GLF B;  3W0L B;  3HU2 A;  4I4L A;  3GLG B;  4DV1 M;  1YE9 A;  3KW6 A;  4I5S A;  3U6L A;  2RKO A;  2XFS A;  4AKG A;  2HHH M;  3TE6 A;  3AKZ A;  4DV2 M;  1GVN A;  2Z4S A;  2G5G X;  3U6D A;  3T38 A;  3D8L A;  3T15 A;  4FW9 A;  1XMO M;  1IN4 A;  3RGS A;  1DGB A;  4AI6 A;  2KW0 A;  3FTD A;  4LGM A;  2KEB A;  4DR1 M;  4IBI A;  4DV7 M;  2KZS A;  2QEN A;  3L27 A;  5C18 A;  4GMQ A;  5FTN A;  3GPP A;  2R46 A;  3CTW B;  1QAM A;  3AV0 A;  5EP1 A;  5ITY A;  3M6A A;  4IBG A;  2CHV A;  5FTL A;  3AOE A;  3AJI B;  2UUC M;  2LXE A;  2QP9 X;  3KOY E;  5IWA M;  4IIW A;  4NOO B;  3PNV A;  1NJG A;  3L28 A;  4AG5 A;  1T3T A;  4IJE A;  1J7K A;  1Q3C A;  3VKH A;  3FUT A;  2DWN A;  2DVW B;  4D81 A;  2XFT A;  2F5Q A;  2LWX A;  4B3T M;  1HT2 E;  2DWL A;  2ZAN A;  3J2P B;  1X37 A;  3KS4 A;  4DR2 M;  4FWD A;  3AOG A;  2H1R A;  1JR3 A;  4G4Q A;  3U6E A;  3U60 A;  1DGH A;  3SAV A;  1JQJ C;  1GL7 A;  2ZBK B;  1HR0 M;  2DZN B;  1Q39 A;  4BB9 A;  4DR6 M;  4AKH A;  2OQ4 A;  2VQE M;  1G59 A;  4L4U A;  1EE8 A;  2I7N A;  4MGY E;  1E9R A;  2L6O A;  3JAM S;  1W5T A;  4NSO B;  5GKN A;  3WHK A;  3U6P A;  2F5S A;  2G8L A;  4DV3 M;  2KZU A;  5BR8 M;  5FSW A;  1G8P A;  1E94 E;  3LQR A;  5KO3 A;  3HJ8 A;  4Z6Y A;  4GHL A;  1K82 A;  3QAU A;  4KLN A;  1JR3 D;  2YNM D;  2P5T A;  2R45 A;  3A98 B;  1QVR A;  1PM5 A;  4LZZ A;  2V6Z M;  4PD2 A;  1NHW C;  3ZH9 B;  1IXZ A;  4JN6 A;  4IBK A;  4GIT A;  5IRE B;  4LJ4 A;  3DOA A;  2XF3 A;  1D2N A;  2QPA A;  4R7G A;  3SYK A;  3SBJ A;  3OTO M;  3AL0 C;  3PFI A;  3J27 B;  1NVM A;  2XSZ A;  2Y0T A;  5LMU M;  4RF0 A;  2DZO B;  4LJ7 A;  3M7G A;  3VK7 A;  5KQ8 A;  2XGN A;  5FTK A;  1IN6 A;  3A46 A;  4DUY M;  4L8R C;  2V1U A;  4BLC A;  3GQ3 A;  3KOZ E;  1SXJ B;  5A2Q S;  3SMS A;  3HHX A;  4MH0 E;  3MJ5 A;  1N75 A;  1ZQ9 A;  3K1J A;  4MGZ E;  4G4R A;  2L7I A;  3U6Q A;  1LV7 A;  4NXN M;  2Z3X A;  3WHL A;  5F3W A;  3K8Z A;  2DWM A;  2Y21 A;  2Q2E B;  4REZ A;  1G41 A;  4G4N A;  4B08 A;  3GLG A;  3KP0 E;  2R4E A;  4DV6 M;  4GRI A;  1Z5C A;  1GL6 A;  3LVW A;  1IXR C;  3K2L A;  2F5P A;  1OFI A;  2C96 A;  1IBL M;  2V1C A;  3HJS A;  4LJ6 A;  2X49 A;  5ITR A;  4DV4 M;  2C98 A;  3B9P A;  4GKK M;  4OVZ B;  1FJG M;  4FCW A;  1S3S A;  2D7E A;  5ITX E;  3FUX A;  4YHH M;  4Z8X A;  3NBI A;  2YFQ A;  2ERC A;  4GHA A;  5EQT A;  1QZM A;  4GC9 A;  1N33 M;  2C9O A;  1DGG A;  3ZCB B;  1IN8 A;  3FKE A;  3DFZ A;  2DXI A;  2QBY B;  3GP1 A;  2BJV A;  5BPV A;  3U61 A;  4DUZ M;  4M0D A;  3LMM A;  2XH9 A;  2ZAO A;  4LGY A;  4RF1 A;  4JI1 M;  3DZD A;  5H37 D;  3R8F A;  3ZC7 B;  2M60 A;  1XXH B;  3SAW A;  4M9Z A;  4QNM A;  4B7G A;  1N34 M;  3TQS A;  4CHT B;  3L25 A;  2UXC M;  4YY3 M;  1PJJ A;  1H6U A;  4OW0 A;  4M9S A;  2L7H A;  4ZPX A;  1IM2 A;  4JYA M;  4JV5 M;  1I4W A;  4LRT A;  4B7F A;  4AW4 A;  1N36 M;  3JR5 A;  3W0F A;  1HQY E;  4PT5 A;  4B3M M;  3GLH B;  4JI3 M;  2Y0Q A;  1IBK M;  1E9S A;  4IBJ A;  4LF8 M;  5KPR A;  4LF9 M;  3HKP A;  3E4R A;  1N78 A;  3U6M A;  4DR3 M;  1J5E M;  2BNK A;  3KOX E;  1NHG C;  3GRY A;  3SC3 A;  4FCV A;  3FTE A;  2FNA A;  1WXQ A;  3GRV A;  3L2A A;  1XNR M;  1KSF X;  4GC5 A;  3AOE C;  4LF5 M;  4DR4 M;  1HNX M;  5EP3 A;  3J7A S;  4CGY B;  3NWL A;  5ITQ A;  2BJW A;  3KXE C;  4L15 A;  5C1B A;  2YQZ A;  1Z5B A;  1QYR A;  2F5N A;  2FE8 A;  4LFC M;  4NXM M;  1N32 M;  1GLN A;  3HJQ A;  3M0E A;  3LQQ A;  3LVV A;  1R6B X;  2X4A A;  2R62 A;  2E5L M;  4ITQ A;  1IN5 A;  1TH2 A;  1UM8 A;  2VII A;  3U6C A;  1G4A E;  1XNQ M;  4AG6 A;  1QAQ A;  3C58 A;  1PJI A;  4AKI A;  2D7G A;  4WW0 A;  2OPF A;  2ZAM A;  8CAT A;  2UUA M;  4NL4 H;  2A5Y B;  3QWL A;  3GLI A;  5E6J A;  4FVM A;  1Z6T A;  4RNA A;  4JI0 M;  1SXJ A;  4HLQ A;  2C9C A;  5ITX A;  4X64 M;  3SHG B;  3U5Z B;  2CV1 A;  3H4M A;  3KDS E;  3SAR A;  5LMN M;  4LF7 M;  4B3S M;  4IBE A;  1Z59 A;  4JI5 M;  3T1H M;  4MM3 B;  4I81 A;  1L2C A;  1IN7 A;  1DGH B;  3I51 A;  4QHS A;  1TH3 A;  3L29 A;  3VKG A;  3MHV C;  3GPX A;  3PXG A;  1L1Z A;  1Z5A A;  4DV0 M;  5KPT A;  4HL4 A;  2EA0 A;  4M0W A;  4OX9 M;  3FUW A;  4II7 A;  3L26 A;  2F4V M;  4K0K M;  3RE8 A;  2Z7J A;  2Y20 A;  2XEP A;  4LRS A;  1SXJ D;  4MGK E;  4FWH A;  4MGH A;  1XWI A;  1R2Y A;  1HNZ M;  4PDI A;  1L2B A;  2UXB M;  2NQ8 C;  1IY1 A;  4S12 A;  4PCZ A;  3TWM A;  2XSZ D;  3BOS A;  3GLF A;  2CV2 A;  3FUV A;  3SHF A;  3SFZ A;  2ZM6 M;  1IQP A;  4JI7 M;  3VDU A;  1XC8 A;  2QBY A;  1GKI A;  4AZF A;  3GRR A;  2QZ4 A;  3J80 S;  4JI4 M;  3GPY A;  3T1Y M;  1YUB A;  4FWG A;  3U6O A;  5EP2 A;  2R4J A;  5FTM A;  2XLJ A;  1Q3B A;  5JI2 E;  4P16 A;  5FTJ A;  1SXJ E;  1I94 M;  3SAT A;  1XXH A;  3R9X B;  1TGU A;  2XZU A;  4GIP A;  4LFB M;  3MK6 A;  4GH9 A;  3UK6 A;  2X8A A;  4OU7 A;  4MB7 A;  1IXS B;  2UUB M;  2UXD M;  2I7P A;  3SAS A;  4IBC A;  4L78 A;  3EIE A;  4NRV A;  5JI3 E;  3I4Y A;  4IBD A;  1N77 A;  5EXP A;  5IZ7 D;  3GLH A;  4LCB A;  2HCB A;  1NSF A;  2M5Z A;  3CF2 A;  3UGJ A;  3CF6 E;  4FD2 A;  4GKJ M;  2CFO A;  1KYI A;  2EUC A;  1YSY A;  3HU1 A;  3KSJ A;  3HHY A;  1DGF A;  4B3R M;  4G6Z A;  2FOI C;  2YR0 A;  4IJF A;  5ITU A;  3HHW A;  4A3V B;  4BBA A;  5DYG A;  1MX0 A;  2C5R A;  1HQC A;  1L1T A;  3FD9 A;  2KRU A;  3I4V A;  4AQY M;  3GPU A;  4LJ8 A;  1ORY B;  4LFA M;  2D7H A;  3A42 A;  2Z4R A;  1K3W A;  1W5S A;  5KQD A;  2DWZ B;  1NY6 A;  2EO2 A;  1R7R A;  1ZAE A;  1XMQ M;  3E9S A;  3THG A;  3VLF B;  3UJN A;  4QNR A;  4JI2 M;  1DO0 A;  5FLX S;  3TL4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...